3PPVA

Crystal structure of an engineered vwf a2 domain (n1493c and c1670s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
CSMVLDVAFVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGDILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCSSGEGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords von Willebrand factor
publication title A novel calcium-binding site of von Willebrand factor A2 domain regulates its cleavage by ADAMTS13
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ppvA00
4Z7NB 2XWJI 3EGDB 3VI3B 3ZDYB 3V4VB 1AOXA 3FCUB 1XDDA 4HQKA 1M10A 4MMXB 3IJEB 1QC5A 4O02B 1YVPA 1PD0A 1CK4A 3PPWA 3EH1A 2M32A 1CQPA 2VC2B 4UM9D 5KYUB 2NUPB 5KYYB 1JEYB 1AUQA 1IJBA 2WINI 4WK4B 4XW2A 5HDBB 3V4PB 2QTVA 3EH2A 4Z7OB 5KYXB 1BHQ1 2O7NA 3GXBA 1SHTX 3EG9B 3FCSB 1PCXA 1MHPA 1PT6A 1UEXC 5E6RA 4BJ3A 1RTKA 2NUTB 4DMUB 3NIGB 3PPYA 1FNSA 1MQ8B 1DGQA 1U0NA 3K6SB 1ZONA 1MF7A 1ATZA 1ZOPA 2XWBF 3BQMB 3NIFB 3EOBI 2ODQA 1M1UA 4NENA 2ODPA 3EGDA 2VDQB 3ZE0B 1XUOA 1SQ0A 3QA3E 4MMYB 5KYNA 1FE8A 4G1MB 5LN1A 1M2OA 2VDNB 3PPVA 1L5GB 2ICAA 5KYUA 2NUPA 5KYYA 1NA5A 4HQOA 1JEYA 4HQNA 4WK2B 1M1XB 5KYXA 4WK0B 1JEQB 3K71B 5E6SA 3EG9A 1XDGA 1M2VB 4CN8A 1PD1A 2VDRB 2NUTA 2NVOA 3EFOB 1YVRA 2B2XA 3F78A 3RAGA 3E2MA 4F1KA 3K6SA 5E6UB 3K72B 2VDKB 4Z7QB 1BHO1 1T0PA 1JLMA 2XGGA 3NIDB 1TYEB 4IXDA 3HI6A 1MJNA 3PPXA 1V7PC 4UM9B 4M76B 3EOAI 1JV2B 5HJ2A 4F1JA 4UM8B 4WJKB 2ADFA 2VDOB 1IDOA 3M6FA 3T3MB 3TXAA 1Q0PA 1IDN1 3ZDZB 3F74A 2VDLB 1JEQA 4IHKA 1M2VA 2VDPB 3EFOA 3EGXB 3BN3A 4HQFA 3TCXB 4CNBA 1MQ9A 5E6UA 1N3YA 4WFQA 1N9ZA 1RS0A 3VI4B 3TVYA 5BV8A 4MMZB 4PN7A 5KYWB 4A0QA 4JDUA 3BQNB 5HGJA 2WW8A 2IUEA 3Q3GE 1RD4A 4IGIA 1QC5B 4NEHB 2I6SA 1T6BY 1AO3A 1QCYA 3T3PB 4C2AA 3HXQA 4FX5A 3N2NA 3ZE1B 2X5NA 3HXOA 1OAKA 3ZE2B 1MQAA 5E6SB 3TW0A 4C2BA 4G1EB 3EGXA 1IJKA 1RRKA 5E6RB 1SHUX 4C29A 1U8CB 3IBSA 3ZQKA 2I6QA 4HQLA 1DZIA 2I91A 4CN9A 2VDMB 1LFAA 5ES4B 3ZDXB 1ZOOA 5KYWA 4NENB 1U0OC
chains in the Genus database with same CATH superfamily
2LUOA 3N05A 3DO6A 3NDPA 2R6ZA 4CMHA 1OA0A 4P4SA 5CCEA 4OXYA 1T3TA 3QF4B 1SNYA 2AJDA 5LP6C 3C6KA 4YMIA 1CQPA 2F2TA 2ZB8A 3AINA 3HLYA 4HXGA 3VZPA 2X40A 4D97A 4XW2A 2QEQA 4LN1A 5C5EA 2HU2A 3CW8X 2CF6A 4V0QA 1LLUA 1WX1A 1ZH2A 2EQ5A 2HREA 3A4VA 1JDBC 3HR7A 3WL7A 4EYKA 4JJAA 1MB3A 1P9RA 3QX3A 3FNHA 2IHJA 2BF4A 4B7XA 1XHLA 2I7DA 4DDUA 4YRNA 1DAFA 2PZFA 4YMGA 1GCUA 3EVZA 2JLUA 3ND6A 1MMFB 3DOOA 1EFVB 1GCOA 1AGXA 2BHSA 2MINA 2WIDA 4U2KA 1HRKA 5JPIA 3TIFA 4XVHA 1SBQA 2Q6KA 3TZKA 5JAIA 3DB1A 2EQBA 4P3KA 5ECGC 2ASEA 2DH5A 4Y67A 3LNCA 1ODCA 3GYBA 5LQUA 2J6CA 4OGLA 2PD6A 2P4EA 4FJ2A 4MQFB 3STYA 3T35A 2VDNB 5BRAA 3A9RA 4TX1A 3HACA 1FIUA 1YFJA 1RSZA 1NU6A 2XVYA 5IJWA 1EJ2A 2ZYTX 2W98A 5EXXA 3EZGA 1D5CA 1U8YA 2YR0A 3SFTA 3S68A 1V6CA 3KAPA 3E81A 4DWOA 2GVNA 3ABSB 3F5FA 2FY8A 3KRTA 1VSBA 4Q4HB 3GPLA 1T2EA 1DQYA 3OWXA 2FFQA 3IX7A 3UMRA 1JLMA 3TLEA 4UTNA 5MHTA 1XT6A 3ICEA 1MJHA 3U1VA 5IKEA 1D0IA 4NF2A 2VT3A 4PYJA 2AX4A 2XNCA 3PHCA 2CYBA 4YBZA 2HB6A 3VPAA 4C22A 1NMQA 1KH3A 4NOKA 3L9WA 1Z6AA 2XT9A 4M0KA 4UJ3A 2WAOA 4YDHB 1QJ4A 1Q0PA 2JFOA 3EXHA 3GR6A 1CB7A 1RWNA 3QBVA 3KPJA 5BT8A 1O9GA 3IUSA 3KSMA 3VC7A 6NULA 2OQIA 1MZPA 4RFSA 1RABA 3A10A 4YJGA 3PLAE 1SRRA 4EKGA 4YRDA 4BVGA 2RD2A 2I65A 4IR7A 3RSSA 3R4CA 1AS2A 1RRPA 1DIGA 3QTTA 2QUJA 4BOYA 9GPBA 1W47A 5LPNA 1ZQ9A 5FBLB 5F23A 1NVVQ 3RU7A 1BCRB 2ZTUA 1QONA 2GBLC 3BGDA 3H5WA 3A2LA 1MRSA 4B83A 5IC6A 1FX0B 3BQNB 5BV7A 1FY2A 5JU6A 4JI7B 3U80A 4YI3A 1Y8AA 3LDHA 3VSBA 3ZTYA 1Q1EA 4BO8A 2BC9A 1WDTA 1CE8B 1RFLA 2FN9A 2HA3A 3L8EA 4PGGA 2WIJA 3ZS8A 5F78A 4A8HA 4EI2A 2FSPA 2BKVA 2G9NA 2WIGA 5TXGA 4DQVA 3DLPX 3QKSA 1HE1C 1UJBA 3ORQA 5K05A 3HWX1 3VJRA 2QTVB 3A4TA 3B3AA 2Q9AA 2AW3A 3L43A 2DWCA 5IKOA 3O31A 3NTRA 2HO5A 4QQFA 2GK3A 5DXAA 4X9XA 2G09A 1DINA 5I7WA 1ZX1A 3KKLA 3TXXA 1GU0A 3S44A 1LD3A 1DZIA 2HA4A 1E1KA 1CUUA 1Y4DE 3MLAA 1G3IA 1DRUA 5L6LB 1AQYA 1TOAA 1Q14A 1JHUA 2M9MA 3RE1A 5LL6P 1XRJA 4JQYA 2VIIA 1AQIA 3Q4GA 3WBBA 2VJKA 2DPLA 1FBTA 3EXFA 1IXRC 4F12A 3BCRA 3EZFA 3LAWA 4RLFA 3QXSA 1WPGA 1H6BA 3LF2A 4H0NA 3KTDA 2IPOA 4RTMA 2QRZA 5J63A 3N7UA 3NHRA 2XCIA 2YIMA 1GVHA 4US0R 2AF4C 4BNKA 3I6QA 1NF9A 4A0FA 4MJ7A 5A4DA 2JHPA 5FJIA 4HMQA 3S99A 1XB2A 4OYYA 1KAOA 3WYCA 2P3QA 3QE4A 1COWA 2GEVA 3Q9LA 3RUHA 4EL5A 3LHKA 1JHMA 3T9FA 3TJZA 1TEXA 2KMLA 3JATA 4TSFD 5M29A 3U4CA 4WQMA 1MO4A 2Q2QA 3EGDA 4PC2A 1EFRA 2YC4C 2Z57A 4J1SA 2G67A 1YGYA 2AJLI 2VJMA 4DA9A 1K0FA 2ZI9A 1YZGA 3T1QA 4WE3A 4RDXA 3LCRA 5KTPA 4L15A 1Z0JA 4XDZA 5SZHB 1M2EA 3X1YA 4WJLA 3L18A 5IM4A 5JV5A 2RGDA 2OZLA 1GQYA 2ZWAA 4CCSA 1OH5A 1VA5A 3VC3A 3UZUA 2XDQB 2H1CA 2JI8A 3BFVA 2ZIEA 3DTVD 4N0MA 1UBLS 2VDRB 4BL5A 4CN8A 3EWSA 2O2GA 4QGSA 3K1AB 3TM4A 1J09A 2PL3A 2BZ1A 1P4RA 4PG7A 3UV6A 2WVGA 2XUDA 1VE5A 1L4KA 2H07A 3ROXA 4ISBA 1WRBA 2YMLA 4C7MA 1D7AA 4DLYA 3RFXA 3FFWA 1IY9A 4HDRA 5FPYA 1KYYA 2JA1A 4EOGA 1RQRA 2FFAA 4O6VA 4S2UA 4B75A 2E6KA 2I3BA 5ELXA 3AMVA 3QYFA 4QL3A 2G9VA 3CVYA 1YR6A 2OE2A 4YGYA 4GOLD 4UMEA 4X84A 5ITZB 3HJFA 1PWXA 3PT9A 5E3JA 3STHA 3MWDA 2LE0A 4DILA 2EF1A 5JZ9A 3GJ0A 1F8YA 1T4MA 1O0CA 3ITDA 2JHAA 3K5HA 1E5VA 5KUTA 3F6EX 3E22B 2Z4RA 1IEXA 1X19A 3KYBA 3OWHA 3VH4A 1X7DA 3GVXA 4B6SA 3C15C 2AT1A 3WTCA 1E6MA 2SKDA 5CX4A 1NOKA 1P0QA 4BB0A 1JG3A 2QU7A 3CZ9A 5DT9A 4ZCSA 1O8CA 1ZK1A 3LD9A 4JLJA 3ULKA 3ZY4A 1WF3A 4RPCA 3ZUPA 4BMVA 4F45A 1Q5PA 2JGDA 3FPKA 2QZ4A 2UZ3A 2WWGA 5BR7A 2CDBA 4C7KA 4O2AB 1HG1A 1MXHA 2Q2OA 3V80A 4JR2A 3ZD9A 1TIPA 3PGXA 4OI4A 5E3HA 1MAHA 4PRLA 3VPCA 4ER5A 4E2YA 2QX9A 1OLUB 4L08A 5ALVA 4ASUA 3U44A 2IOHA 4LTMA 1VJRA 3NAGA 1K3FA 3QLVC 4BXOB 3AF6A 5JZOA 1LQTA 3GZJA 1Q15A 4MUHA 3NHUA 2QPLA 3BJIC 1KO1A 4BBZA 2EHDA 2PWZA 5BQXA 1M2NA 2ZRLA 3NAZA 4YXFA 3SC2A 1HMPA 4FNAA 3URKA 5AUNB 3D2CA 5F4BA 3W79A 1V5FA 4HLUC 2HYIC 4QFMA 1GPJA 2WRZA 3BB3A 1KQFA 1ENPA 1QYDA 1R1DA 2ZIAA 3OMLA 2BGGA 3ZIAA 3DTTA 1KMCA 3HV2A 3NEJA 2IRWA 3BMXA 1QJCA 3F9RA 3OT1A 4NBRA 4ZALA 1XDBA 2DHQA 1CRQA 2PMFA 2FPIA 2VPIA 3RBZA 4XD2A 3FCUB 3TQHA 4GHWA 3VI3B 2FFHA 1DC3A 2CSXA 1ML3A 3AQIA 1Y1QA 1OJ7A 2L82A 3PKJA 1ZVKA 3R5JA 5HFNA 3DUFA 4XJVA 5E4YA 4H6XA 4BQFA 2PBZA 2QU8A 1H2YA 3BXPA 4ER7A 3E9QA 4AAYA 3F6BX 3ZHSA 4E51A 4R2MA 4MA0A 1SRQA 1FTYA 1UOQA 1I9CA 1CLUA 2FZKA 1CY6A 2APJA 2JAPA 4TZTA 4Q4CA 2NV0A 5IABA 4JI2B 1E3MA 4D4KA 1EG2A 1AQ6A 4R1QA 3RODA 2H5LA 5AVQA 5DK6A 5ISMA 1CF2O 3Q8XB 4FZJA 1MOSA 5K51A 3RS4A 4MGYR 3I01M 1QB7A 1PTKA 4YCLA 2HQBA 1X13A 1Z5VA 3DQQA 4NEQA 5HIJA 1JQJC 2EGHA 3TZEA 1O9BA 3FSGA 1GQOA 1LTQA 3FSEA 5T4FA 3SHOA 4YUWA 4KFSA 3K9WA 1WTAA 4YJFB 2JRCA 1JFFA 2G5PA 1VPTA 4FCWA 6CHYA 1DC4A 3LH5A 2HRBA 1ISMA 2OMKA 3DOIA 3KB2A 3TKLA 4HFNA 2AWOA 1IM2A 2CLEB 1KHTA 3L02A 4NR0A 1P8JA 3HA3A 1P5HA 1TF7A 1VJCA 3O8QB 4ZQEA 2FH5B 1B74A 4GMHA 3QFFA 4HXEB 5A5FA 1E1DA 3RB8A 2OCXA 2P41A 1XOIA 1EAMA 1WD5A 2HJRA 3OPMA 4O2AF 4AY4A 3QLTA 1QWSA 4GWKA 1NZFA 1R27A 2BHRA 2IKQA 1Y8RA 3MTQA 4GFDA 4QKQA 1KJQA 1UPTA 2PH5A 4BVLA 4UBJA 2VSFA 2EDAA 1E2EA 1SGWA 1E2IA 4N3GA 4OHPA 1NG1A 1LTKA 1Y80A 4GP7A 4U00A 4EQZA 5FUMA 1U7HA 1WY7A 3Q3HA 2XW6A 4ZT4A 1U63A 2VO1A 3KXIA 5LP1A 2BZ0A 5KVSA 3T4XA 2VYVA 3O73A 3KZCA 5FXMA 3G9XA 3IAM6 1E9FA 4I4CA 5TMEA 3S2ZA 3PQ3A 2F48A 1FDVA 4XM0A 3Q7PA 5FNVB 4B6FA 3NEYA 5M5BA 2W70A 2UVDA 4TS3A 1TCAA 4O8ZA 4AP6A 2GT1A 1GTZA 3ZZMA 2G7ZA 1P60A 3K2EA 2POCA 4LG1A 4IH4A 2DBZA 4EHAA 4XQEA 3N87A 4YBRA 1IZ7A 4M88A 2ZREA 4YJ2B 2QQFA 3KEGA 1TD9A 5HG0A 2QD2A 3UYKA 3OKAA 2ZYSA 3QKIA 5HFJA 1T1SA 1PJ2A 2GASA 4B4KA 3U3ZA 2IP4A 3IA7A 2VNKA 3GEHA 4EKEA 4BKUA 4F4JA 1CXZA 5GVRA 1PZMA 5CX1A 3WGHA 1XDSA 2J3DA 1NI4B 2VXOA 1K7EB 1FNMA 1ZL2A 1U5AA 4FWIB 4EPVA 1L4GA 3SK0A 5IDQA 3G0DA 2QVLA 1A7UA 4IOMA 4Q1FA 4UNIA 4CGZA 4MJ3A 1SK9A 3ESXA 4FMDB 3COZA 2EWVA 2IWRA 5HIKA 3JQAB 5HUJA 4L75A 1Z75A 2Y1DA 1R18A 5HK9A 3PUWA 3NOVA 4KDCA 1TM4E 3HKCA 2QRVA 3NIBA 1DQZA 4JJGA 1IQPA 3ZH2A 1CUJA 2DKOA 5K3EA 4BMXA 3UUEA 3A6JA 3BREA 1Q22A 3Q0TA 2BSAA 2YNMA 3CJRA 1ZESA 3G8BA 4UOEA 1QP4A 3KQPA 3EPHA 2B6HA 3NVMB 4DL9A 1CRZA 1K98A 4E08A 3NH6A 3NCHA 3ERCA 4Q9KA 4C01A 5T6MA 4BEVA 2BMVA 2YXDA 1YHYA 1BOFA 3LL7A 1J39A 5MN4A 3IIMA 1NSFA 2ZDHA 1X14A 1A9RA 1EE2A 4Y6GB 2VJAA 2EFHB 3DKIA 3MCWA 2YJGA 2ZUSA 5L7WA 3MJSA 5TPZA 1VBNA 5E0KB 4P54A 5FNVF 5L53A 3T95A 1MGOA 2FPWA 1PBTA 2PKXA 5EEGA 1YQXA 4MS1B 2X1HA 3PNQA 1UBOS 1P9NA 4R2XA 4RA6B 5EEHA 3R9KA 3IEKA 5J9FA 2F90A 3ZR4B 1SQSA 1BQ3A 4YAKA 5LYJA 3OQOA 2CJWB 3F71A 2ZPAA 1NONA 4PCVA 1DKNA 4RLQA 3LHIA 2QLBA 5GM2A 2XRFA 4BUJA 5LM3A 1HR0B 1UMDB 1Q1QA 2XRYA 4YJ2F 1V8BA 4KE8A 4N8EA 1TZKA 2ICAA 2GJ9A 2A92A 4YVFA 4YXWD 4RABA 1D3AA 5A2GA 1YRHA 1LLQA 1E1NA 3IT2A 5E6SA 3KUDA 4R1PA 4K6OA 2DVMA 1D1PA 2VSYA 3ZU2A 4BRUA 5K0SA 3KJQA 1KP2A 1D09A 1N33B 2CUTA 5D87A 4YJHA 4PIPA 3VH1A 5EJ4A 3M2PA 2NN3C 1RM3A 3RRXA 2G08A 1K7FB 1LDEA 2B4KA 2RONA 1DOAA 4FMDF 3PXBA 1WMDA 4RYLA 1PGQA 5LA6B 1U7WA 4HYQA 1DJQA 1HL7A 2W22A 4PEVA 5HJ2A 5EMJA 5JAHA 4UM8B 2YQZA 3RK0A 1L5FA 2I66A 4DNPA 4AU1A 1X3SA 1RC1A 4LPSA 3UWMA 2IUSA 1F8FA 1I2BA 1WW3A 1ZIXA 3S2IA 4XB6B 4HDKB 1J2TA 3H0EA 4PG8A 2ON6A 3OZAA 4FKBA 2H9YA 3GLFA 4MGIR 1D07A 3TEMA 5A7FA 2BI4A 1F7UA 1EP2B 1VL1A 1WW2A 2OORA 1MO6A 2XEXA 3IP5A 1OTHA 5JZVA 2VP4A 3ENZA 5CH8A 1WCWA 1SIOA 1TNDA 3R0JA 3GGDA 2HM7A 2Y3IA 5AHWA 1BDIA 2XLCA 3SICE 3CRZA 3NT4A 2OYCA 4ESEA 4ZV4A 1ZGJA 1SOAA 4GEKA 2C2OA 1TIKA 1T5BA 2H7VA 2OD9A 1VSTA 1BJKA 1Y3IA 2XGOA 3MJHA 1SKQA 3MJ4A 4P4SB 3W05A 1AZSC 3VNQA 4CTKA 4OI2A 3V1MA 2VA8A 1T3LA 2Q9CA 3BXXA 2NPIA 3EF1A 4TYWA 3N8HA 4C21A 3RSLA 5K3FB 1L4YA 2FFJA 5H9VA 3JQFA 2REXB 1XV5A 4ZYYA 3CLTD 4M3NA 1I6WA 1LF5A 2BBWA 1RI3A 3JYLA 4R1TA 5FPPA 3SS8A 4DIDA 1YK0A 1RJDA 1PO7A 1E59A 1F0PA 1FJHA 2R6GA 1XEFA 2VWGA 2OL4A 2W2KA 3NBUA 3WOVA 3GD7A 1JYEA 4C4TA 4JT2A 5GTDA 4KN5A 2P6UA 2XOKD 3C1UA 3ESZA 3EMKA 3AEYA 1SXHA 3I32A 4Y3UA 5ALTA 4J3NA 3WB1A 1H22A 3WBKA 2I99A 4CYMA 1LF0A 1NW6A 1BD3A 1UBGA 2MINB 2YXBA 3AERA 3PC8C 3Q0IA 4G2TA 4WXMA 3MTGA 4C1BA 3QP9A 5HRAA 1XMOB 5HWSA 1LPNA 2LBPA 4RNDB 3UEOA 3MJVA 3ZJUA 4QREA 2BISA 5CPBA 3ILXA 4CQMB 1NFQA 3QXJA 2BGTA 3QU9A 1XQ6A 2Q6VA 1E2DA 3CZ5A 4KBFA 5LA6F 3UXYA 1CQXA 5CFPA 2PBLA 2QAJA 2FAXA 3CGWA 4HR7A 4TYQA 3LDFA 5K5EA 2XH8A 2CB0A 1HE8B 2XWSA 3UJ7A 4HC4A 2QAGA 4LJ6A 2CV2A 5BN5A 1NVUQ 1BN6A 4G0MA 4PX3A 1M6YA 3N2YA 2QT9A 3G7SA 3PT5A 3U0BA 2CL7X 2NSJA 5ALJA 3B9QA 3JQ7A 4UDOA 1GL3A 4LGCA 4FHZA 2DCMA 3PA8A 1C0IA 4F0JA 4CF3A 5DP1A 3LKZA 1BAPA 1DCKA 5CFZA 3G0IA 2NUPA 1ZI9A 4F4IA 4REQA 3O9ZA 5ABPA 1JAZA 2Q3LA 3EXHB 5KYYA 1OFUA 2OGUA 2PS0A 3BHIA 2OILA 1MRNA 4N5LA 1VL8A 2BGJA 2FPLA 2NYUA 4YJGB 4GM1A 1A4XA 3IMFA 4QDTA 3OE4A 3ZU3A 1UFVA 5AIAA 4WY2A 6YASA 5DRTA 4I4IA 4ETWA 2E37A 2GJSA 2QQ5A 3NIDB 3JVEA 3RC1A 3GPIA 3MQ2A 1ZAYA 2RBEA 1GN9A 2QR5A 2QY6A 3FSJX 3A6LA 1WB5A 2J3LA 4Q7KA 4GPBA 4UBMA 5EA2A 3MAAC 4XVUA 3G79A 1Y1RA 1ZUNB 2B99A 3IVMA 3AZOA 4UASA 4XKJA 5D3MA 2B4TO 3WIVA 2Z6UA 1QG0A 2CDRA 4TTJA 3V3TA 3O95A 1Q50A 3TB4A 1EDOA 4AD8A 2IIBA 3QSGA 4KQIA 3U7EB 3T5BA 4WY5A 1U1FA 4D9NA 2JFVA 2WP0A 1UJ4A 1JJBA 2X4GA 3QKSB 4DV6B 4MV9A 1V6SA 1SN7A 3L7JA 4EMBA 1O95A 3HB7A 1DKOA 5AHOA 1RYMA 2QX4A 4F71A 4NBUA 2BAGA 4D9BA 4CM8A 4L95C 2IEIA 2QLJA 1E6WA 3IUBA 3M5DA 1KH1A 4MMZB 2ZRNA 3WMGA 5KOYA 3GAMA 5KKAA 2QQGA 4OU5A 1GUZA 4JD5A 3SSMA 3V9AA 2EX1A 4PCUA 2PN1A 4YMWA 4A0QA 4UTRA 4I6EA 1RD4A 1UIMA 3MRXA 1A9QA 1N6HA 4CG0A 1CZKA 4D4GA 3EXFB 3GT3A 3KSAC 3SHTA 3T15A 3AM3A 1RWXA 1WXIA 3A2NA 4KMSA 1XJ5A 1T9GR 4EY3A 3C2QA 1Y9JA 5BSEA 4DCOA 1FQWA 5JE8A 1T3SA 3CX8A 4ZGGA 4EA8A 3EZNA 3G49A 3OLWA 2IU6A 3QMWA 5BNIA 4JYZA 5TX7A 1OB5A 1T3GA 3VR6A 4OQDA 3A7EA 2X2PA 1AZWA 4YLEA 2FRVA 1R9MA 2Z1MA 5EUMA 5LKAA 1Q1ZA 3BVPA 1H23A 1JSCA 1Z26A 2CLOB 3G59A 4M1SA 1YAHA 2REBA 1FA9A 1WBDA 2P4SA 3JATB 1ZOOA 3ZCXA 5KYWA 4DMCA 1AUPA 3SI7A 4B45A 3EGDB 3NONA 4RJTA 1WCIA 4KSYA 4KRXA 4QG7A 3V4VB 2EJBA 2VZ8A 3LGXA 3N2LA 3ADPA 4FPXA 5DHFA 3A37A 4B3JA 1W85A 3WLNA 1X15A 2VJMB 4UTOA 1EE1A 1ODLA 1TU0A 2HNKA 4JH0A 1AM4D 2BGIA 4UM9D 2CXXA 1EVLA 1Z29A 2Y0PA 5KNCA 5CVUA 2PZMA 3QXGA 2ZE5A 4ZAXA 2IEAA 4NYJQ 1MO3A 2BE9A 2BY4A 3BMQB 5GJWC 2GF9A 1ST2A 1TA4A 4LI3X 2XVMA 4ARBA 4MUJA 3WAKA 4DPKA 4CL2A 1QK4A 3P2MA 1T9GS 3EGOA 2NTYC 3WRVA 4HDRB 3JVDA 4MWTA 2IA5A 3ZV3A 2PKEA 4F56A 3M0EA 4ID3A 1YC2A 4F85A 3BEDA 4J16C 2AIRA 2ESRA 4KUGA 5B3AA 1WUTA 3PWSA 4DNXA 1DL5A 2OR3A 1SQ6A 1E2JA 2EJVA 2GCOA 2VUHB 4KJXA 5DLQC 4E07A 5FUYA 3MWDB 2UZ0A 1EEXB 4H0FA 1T9KA 3RAEC 3A1WA 1ENZA 5D7NA 2A1TR 3WDLA 5DW3A 2R6R1 4RY8A 2W2LD 1OYYA 3RJ5A 1JLLA 3K9BA 4NZOA 4REOA 1XU4A 1JDZA 4R01A 1FSFA 1L8LA 4CG3A 5FRDA 1TD1A 4PLGA 3EIUA 4CM7A 1CZUA 1ZOIA 2HWXA 2HU8A 3DZ8A 4MCJA 5CYFA 5EZQA 4K1XA 3FCCA 1BX3A 3QBJA 4BIIA 3U61B 4NI5A 3MD9A 3TQCA 3DOFA 4C4XA 1DXYA 3HXTA 2B61A 2JGDB 3DCNA 4ABYA 2OP1A 3T4PA 5HZMA 3HZHA 1MCZA 2PZLA 3Q15C 2DEUA 3KUCA 5HZHA 4RKYA 3KZVA 5AK0A 1OBCA 4BV8A 2Q1YA 3LBNA 3FA2A 2A4MA 2PXXA 3OBIA 4DM3A 1B8VA 1XQVA 3MUOA 5K6TA 4PRKA 1U6KA 2JIPA 3U44B 1WNFA 1E7QA 3GH1A 2I7VA 1JAYA 4X41A 4RDHA 1ZD8A 2KWIA 3GLFE 3A4MA 1W4CA 2PUGA 2XVZA 5DMXA 2MSWA 3CY6A 3SC2B 1E0KA 1P2TA 4KQJA 1JN0A 5DHQA 3CCCA 3VR4A 1KYIA 4FD3A 5IM4F 1XAHA 2C4TA 5E1OA 1N9ZA 1JG6A 3MCAA 1NGSA 3PA6A 2IIPA 1M83A 4UDNA 5FUXA 5F4ZA 3TVYA 1ILEA 1V1JA 2CMDA 4M9SA 1ECLA 1Z15A 3GZ4A 3R76A 5B12A 2CFTA 3OT1B 5KNBA 2R68A 3PNMA 2FPIB 1K5HA 1YDFA 2M6LA 4PYLA 3QG5A 2ZR8A 3W34A 1IXZA 4B87A 5JYBA 4Z4EA 4JBLA 3DUFB 4BC1A 1PK7A 4P3XA 5H81A 3W2HA 2BBSA 1BGWA 2PO5A 3HDJA 3D3NA 4IM7A 1Y6GA 1NVEA 3ST7A 1XXHA 2Y76A 3AW8A 3TZCA 2EOAA 2DQKA 4UC0A 3DOCA 2FEMA 5FPHA 4HVLA 5IPFA 3E9ZA 4OXQA 1OROA 3BB4A 5HCIA 4UUAA 4PGAA 2WU4A 1ZAKA 4GQIA 3VKWA 2GCNA 4DGSA 2QM3A 2IYAA 3QUAA 4A9AA 4E5PA 1W1IA 2P75A 1NLYA 2NGRA 4KRYA 4QOFA 4ZU1X 1GL6A 1YS7A 1JFFB 2X2OA 5GOTA 1S3FA 1D1QA 2QVGA 5K8IA 2RE8A 1C8KA 3HZZA 2HL6A 4LFBB 2HDHA 4YR7A 3Q1LA 3BXGA 4NCHA 2BDEA 2DWQA 1HDIA 2X8JA 5BQPA 2BFEA 3I9V1 1KBZA 1ZUD1 4DLBA 1TA0A 1QRSA 3F2VA 3T5GA 3IKMB 5F51A 4IDNA 4X8MA 2HIHA 4QPPA 3HCPA 4GMGA 1I2AA 1Y8RB 3IALA 2JCYA 3OUTA 2ZIUB 3PFGA 3ELBA 4LRSB 4NYMR 1XROA 1NQUA 5EIWA 4X93A 3AKEA 1U7ZA 5CNMA 3K70B 3HO1A 1VKNA 4LJ8A 3H2ZA 3IHLA 4FYKA 1E9RA 2HA2A 2WYVA 4X64B 2E2WA 3KAJA 4H17A 2Q29A 4V0NA 2WSIA 3LMKA 1JWBB 2Y99A 4G1MB 1CUIA 3AW9A 2P2LA 1D8TA 3FR8A 2WF5A 1EMDA 3DT9A 1LGYA 4LX0A 2EJWA 6GPBA 1QIMA 2CFRA 2JARA 4FQ8A 4JN6B 3COWA 3DEAA 3OU6A 3WHLA 4AZSA 4ZAYA 2I71A 5DTEA 2RJNA 2HJSA 4ZYZA 3NDRA 1G5QA 1LDNA 1PJ4A 2QRMA 3CLSD 4NKRA 4RH3A 4UVDA 3RREA 3WJ7A 3Q87B 2OXRA 2HY7A 3K6SA 1CP3A 4R83A 2I2AA 4QQKA 3O75A 3DZFA 2V7QA 3HGTA 3V4ZA 2D1TA 1FL9A 4HH4A 4HGRA 3T3HA 5B4TA 1U1DA 2J1LA 4RPHA 1G2OA 1CEQA 1PQ4A 5DPMA 3SNHA 4BDTA 3DPIA 1AZTA 1OW3B 2C9ZA 3NTUA 2O52A 4MNTA 1NRIA 4LJ5A 1RKBA 5C0OE 1YR1A 3T61A 1MFZA 5CX1B 5LCXA 2Y93A 3IAS1 4AO6A 2BH9A 2H1SA 4LMBA 4PC3A 1H3FA 4Y2TA 5TV2A 1BFDA 5JSHA 5B57C 3CVXA 1RI2A 4XGQA 1JR3A 1VMAA 2HBQA 2HUNA 3KQLA 4Q05A 5KQLA 4R16A 1UR5A 2AOUA 2KLBA 3OPQA 1ZM9A 4EZIA 1G6OA 1AV7A 1RHUA 2JIDA 4YCAA 4BVAA 4E4RA 2R2AA 2YFHA 1YI1A 5ER9A 3UHAA 2Y2VA 3HKCB 1JVSA 2QRVB 2GLXA 3HB5X 5TJ9A 5IK2D 3WHIA 5JNUA 1M2WA 4K7JA 2ZBVA 4J7XA 1YU6A 5HF9A 1KZHA 3IQIX 2OBNA 2DBRA 1HDEA 3KOXA 1Y7PA 4G0QA 5ALEA 3DZKA 2Z2ZA 1KNXA 2VYQA 4IGIA 4PSUA 2OAEA 5IASA 5EZYA 5CB6A 2I34A 1SQGA 1KVSA 1R88A 1DIHA 2O2XA 1C0EA 2W6JD 4I55A 4KTTE 3G88A 3O8BA 4NFSA 4OJYA 1KDVA 3U3XA 1RKQA 3VC1A 4DLXA 3FFTA 4UBIA 1ZUHA 4ZGBA 3K73O 2RHOA 2JGJA 2PZBA 3W8NA 4YV1A 4BNMA 3AU9A 1H3EA 1N7IA 2EZUA 1T1EA 2E18A 1WXGA 4MUKA 4HEJA 4EENA 1T25A 2I29A 4ZREA 1N5RA 1RYHA 4BMPB 3UBTA 4E3WA 3W3AA 3W4KA 5CDYA 4XI9A 4EMSA 1X86B 5LYJB 3C6YA 5A9TA 2WZQA 5K0LA 4D8YA 1TQ2A 2QZPA 2YFYA 1AHNA 5CT6A 4D3SA 2WJYA 3RTDA 2WD9A 2MYUA 2P5UA 1I3LA 1DBQA 2J08A 4N82A 4D4IA 4F4HA 1NURA 1Q0LA 1XN1A 1BVYF 2AFIA 4TN5A 2O3JA 1M75A 1LKZA 1MTZA 2CNLA 1ZD9A 1KZ4A 2HPZA 2GAOA 2QVXX 5CJ2A 3SKYA 4YJHB 2OAQ1 4I5FA 4QE3A 1X3LA 4Q3AA 4TSRA 1NU8A 2ERXA 2H31A 4UPDA 4DMFA 3K92A 3UUWA 3HVRA 1JIXA 4MVJP 1RLUA 2A94A 4LJYA 3U7QA 5F3DA 1M1UA 2ZJYA 1ZBQA 3TUIC 1O0BA 4AWXA 3CUSA 1SQ0A 2IXBA 2CUNA 3R0IA 2PSDA 3LWBA 3Q9SA 5DM0A 4E1AA 4DLLA 2GYUA 1PWEA 2G4CA 1GGJA 1AE1A 1AS0A 1DS6A 3PQ7A 5G1NA 1GU1A 4BQOA 4BWVA 1LBEA 4HQNA 1NAIA 3TLXA 2FX3A 1B6SA 1RWVA 3HVJA 4WK0B 3SP1A 3MWJA 4TTSA 4IJKA 4L6AA 3WIOA 2YFQA 2HCJB 2OAGA 1FLNA 3A3YA 4IWNA 1OI7A 1YFKA 4D45A 2I0FA 3ADKA 5E1MA 3GLFB 3MCVA 3BORA 1PG0A 4EYOA 2Z1DA 1MZVA 2NZXA 5LMUB 1Z0UA 4QHSA 5I9NA 3MRTA 4DR5B 4H7IA 1EIZA 3TD9A 1R50A 3IQFA 2GTIA 5AKIA 4EUFA 1HFKA 3C6XA 4XH9B 1LBTA 2C1ZA 2VTEA 2XB8A 3IJ5A 1KEEA 1BSVA 1M2HA 1NJ2A 2QIOA 4WKGA 1XALA 3TPCA 5K4HA 3UQYS 3QLEA 4COKA 5FAXA 8AT1A 1PT9A 4F9TA 1ZCBA 4R5HA 2GHIA 4H15A 5I7RA 1RMQA 3CX6A 1L5ZA 1NN3A 4JXZA 1Z17A 2GTHA 4O4LA 3FDIA 1GFIA 1YJ5A 4DIMA 3UT6A 5K0GA 4G1FA 4MHTA 2BGLA 1WDMA 2RHJA 5LYJF 3V4LA 2ODAA 3DV0A 4TYNA 1SBIA 1ZUWA 4BYMA 4AQDA 2N46A 2W2KB 2XQKA 1M7BA 1IZYA 4J43A 5HIMA 1KJ8A 4M54A 4UEQA 3ZZ1A 2I4RA 1E92A 3GX1A 5FBRB 3AERB 5CM9C 1QZXA 4PXAA 4LE2A 3EVEA 4PYOA 4Q18A 4DJFC 3CPSA 1J25A 1W48A 1XQ1A 3GD5A 3HSSA 3L7LA 3QHAA 2ZZMA 1ZDMA 1JZTA 3DPSA 3G1UA 3LT5A 4ACAA 2JGLA 2FZCA 3QVKA 2Y6VA 1WTCA 9MHTA 1E3QA 1EFKA 3GRYA 1WMBA 5A3JA 1EUCA 1QCYA 3E3AA 5B1EA 4NOJA 1O97D 3FGZA 4MWDA 4D4JA 3ZK9A 3LHFA 3NUQA 3ICQB 1U8UA 4WERA 3KKKA 1XXHE 2VF4X 3E9EA 4LXGA 1DO8A 1FCJA 1GGNA 3SJAA 4DQLA 5FORA 3K1YA 3DBIA 3VU1A 3CA8A 2QAGB 4II7A 4XD7D 5E7QA 2X7JA 5BN5B 5IKPA 2QVCA 3RC3A 5E3IA 2H1VA 1DU4A 1H5QA 2WU8A 2I2XB 3INYA 3L0BA 4LVNA 2Y1FA 3UK6A 3H1TA 3LM8A 3VPXA 3GEIA 2PGNA 3JQ7B 2G82A 3V7YA 4N9WA 1N2SA 3Q40A 1H2XA 3HB0A 3U5ZB 1TW3A 1Y5IA 5KTYA 3SQLA 4C9BA 2GPTA 4Z0PA 1A82A 1CW2B 2V97A 1ZP6A 2XJ4A 1VG0B 5BV1A 5KC9A 2NUPB 5KYYB 4REQB 5HZKA 3UK0A 3P5BA 3OX4A 4KEAA 1XPOA 4M60A 4DZTA 2F4VB 2HZBA 2K2QB 2Q5QA 4ZICA 2X22A 1QYCA 1N2IA 1UP7A 3R3SA 3F7MA 1WLYA 3RS0A 3VX4A 1MHPA 4FYMA 4BJ1A 1BWQA 1Y3AA 3CLUD 1JHXA 5JLJA 1QNLA 2ID4A 1MQ8B 3CO0S 1VHWA 5JJ5A 4Z2AA 1UANA 3A36A 1F6BA 4E2WA 3UAZA 3N2EA 3AJAA 4UVIA 3SVLA 1DO2A 4JZYA 3MM4A 5G0VA 1UKCA 4WKNA 3N7TA 5D3MB 2ECOA 3FWPA 4UNRA 1R0ZA 3IQGX 5JYEA 4HQOA 1YL6A 1K2WA 5AO9A 3TIGA 2AYYA 2OOSA 1F4LA 4AC9A 4CL8A 4YRFA 1JG4A 3C3CA 4KBGA 4AM8A 2VZEA 1ARZA 4QLOA 4D74A 3O3MB 1NJ1A 5B3LA 2IXAA 2XE7A 2ZUUA 3QLUC 4KG7A 1SUAA 4NTZA 4B33A 2VDVE 2VUSA 1HZJA 3DPUA 3JYOA 3O4GA 2ZRKA 4EPYA 4FYIA 5ELMA 1DX9A 2DC1A 1ZU5A 3TPFA 2O8CA 4CM8B 3PGJA 1Q7TA 1TQ4A 2PGLA 2OHJA 3K20A 2LDXA 4CDNA 4IXTA 2DULA 4PPQA 1A1SA 1VHJA 3AUAA 3BGSA 4RIIA 1VC2A 3VGJA 1GDTA 2B8WA 2LKDA 2EBUA 4EFLA 3K5WA 2C7PA 3JZFA 1DQSA 1CEEA 1AKEA 4I8DA 5DE3A 2JAWA 1R6UA 4O8CA 4PYRA 5C8DA 4DNFA 2VYFA 2R4UA 1JR3E 4Q1DA 1X7XA 2GDJA 2TMDA 3A6HA 4QATA 4DREA 4TSFA 4N7BA 1OLXA 1F8GA 3WRXC 1EX6A 4UEWA 2ZB3A 3RWOA 3AZPA 3L0YA 4HQFA 4YRTA 4M0UA 1BYUA 1XYVA 1RLOA 4EG6A 2X6TA 1PBNA 2P7IA 3KE8A 2WILA 4Q3CA 5JD5A 4XEHA 3P4XA 3QEOA 4GI3A 4KQFA 3AH8A 2D4AA 4ENRA 3TWOA 4PTLA 5KYWB 2W90A 4H08A 5HJ5A 3J80A 2VSQA 4GW3A 1WCIB 4EAQA 3A3PA 1NJ5A 4P3NA 4NCAA 2O5CA 2Q5JA 4CCWA 4IGEA 1VLVA 1W85B 1X39A 3AYXB 1UOPA 3EMBA 4UCXA 1XE3A 3R9IA 4D9HA 1JTEA 1K5GA 1E1YA 1H8ED 4L9RA 4A82A 4IZHA 2CWDA 5KQMA 5AOVA 3GMSA 3ZE2B 4FMCB 3LXUX 1KGDA 1SY7A 3HI4A 4NHOA 3VAYA 5HRCA 5KX5A 3DLBA 1JDUA 5CB0A 2MSEB 2YJZA 1FW8A 1D8AA 5CA1A 5IN4A 1OH7A 2FMKA 3CW2A 1NVBA 4LJLA 4A6XA 1SU8A 2BLNA 4GX1A 3D3KA 3T3NA 4TXNA 1F4PA 3CNLA 3LYHA 4Q7JB 2PWPA 1BH2A 1HA3A 1B43A 1NJFA 2E9SA 3DWIA 3HDHA 4CKXA 5BSKA 5EHXA 2VJDA 2JDID 2B83A 1D0VA 3GGSA 2BZSA 4WHMA 5C53B 3K0CC 4HWPA 1UDWA 1PEDA 2GCOB 2MJLA 3E3LA 2FW7A 4MRMA 5F7JA 2MT9A 4YREA 3H1GA 3SCZA 2NG1A 1WBBA 4WACA 2GYVA 3AHGA 2AFIE 4MLDA 1LU9A 2VPQA 4RFVA 1DG3A 5LFAA 3OPXA 3R5SA 5T7BA 3C1OA 1Z7BA 1WZIA 3A1VA 3LGSA 1GAJA 5EIBC 3UM9A 4ZYVA 5C35A 3NBAA 3GLSA 4O08A 3RRZA 2PLFA 2WE8A 1J07A 1YI8A 2M6KA 1WXDA 3HRHA 3P9QA 4IIYA 5A1TA 4R9VA 1QAOA 3BTSA 2VJPA 2JGRA 4HX2A 1FFHA 3IAUA 1C9DB 4K26A 5P21A 1YQDA 5LXTA 1KO7A 1E5QA 4MHOA 4QJ5A 1XRNA 5KJ1A 3SJBA 5JUWA 2GNPA 5AWFC 1GZUA 3LVQE 2E4VA 1N8SA 5ESWA 2V8OA 3RG2A 5C7IO 2RK6A 2ZI4A 3UJ8A 4Z99A 3QFRA 2JC3A 1R74A 2FWAA 2VNSA 5INTA 1P1BA 1W87A 4Q4AA 3ZWAA 4MJXA 3WGKA 4BP8A 2ZFUA 3C5VA 2H1HA 3E0XA 2BFAA 3G9UA 4QGAA 4CUKA 3MG9A 1IJEA 4MYRA 1Y7TA 4RMHA 3KZKA 2X86A 4B1FA 4RDCA 1I3CA 5IARA 4JFAA 1M73E 4FI3C 1IOZA 1FFYA 5CLLA 5FL3A 4JJZA 4FMCF 1CRWG 1H1LA 1SU7A 4GOND 1SPBS 3AKYA 4P7GA 2X5XA 5FOQA 1B6RA 3TI7A 2JEOA 4JL5A 1QYIA 4Z4CA 1NFFA 4IIGA 4IKEA 3T5DA 2ZM5A 1PZEA 4M53A 1DJNA 3A1EA 1ORTA 2I3AA 2VDWA 3GCWA 4Y6PA 3KYCA 1FTSA 4IXWA 3T4EA 3OUUA 3GFGA 3KXPA 3TAUA 3DE0X 1NRXA 2GN0A 2BHNA 2CHEA 2Y4NA 3VMMA 1CJSA 4WVFA 4S24A 3ZV6A 1XXHB 1KEVA 1QIIA 2G28A 5BMVA 2P6OA 5HMLA 4GBMA 4HLNA 5KIAA 1JS1X 3ZWMA 4K9KA 1G8HA 4P93A 4R0MA 2PAFA 1DO0A 3DC7A 4R0VA 4XB1A 1AH2A 3T9AA 1JZSA 1XLTC 1MFPA 4JMLA 4QFDA 3RRYA 1KZ6A 4O0MA 2CXOA 4B7UA 2XYQA 2KHZA 1TADA 2H2AA 4UE2A 1VMDA 2A3RA 1N1MA 1CF4A 1WPRA 5D3ZA 5F2NA 4PLZA 1B6GA 2DFVA 3F3YA 2X8JB 1WBJB 2AFHA 2BFEB 2XMSA 3UTDA 5LC1A 5BSVA 3HG7A 2FR0A 3IO5A 3R09A 1A2BA 4JYPA 1RXIA 1RXCA 1X9IA 1QXSA 4TQAA 3WX0A 4BFXA 3ADDA 1L4HA 3V42A 3O38A 3ZYZA 5BT9A 1VGQA 2BDUA 4IUDS 4HB4A 2ZUWA 4TMTA 1C7ZA 1MAAA 1L5VA 2Q07A 3CCFA 5FPQA 1HXHA 3TOCA 1GVNB 3OZDA 1VKZA 4RACA 3JQBA 1YULA 1PZXA 3O8OA 6Q21A 4TS4A 2NIPA 4WPGA 3IVGA 7ABPA 4I3FA 5G1PA 1U2DC 3D6VA 1Q0SA 4OLFA 1DKPA 1QIFA 2A0YA 3PD0A 3BJZA 1P3DA 1KOLA 3UY4A 5K8JB 1PW7A 2ZTMA 4EG8A 2PJUA 1N9GA 2WF7A 5DGTA 2ZS8A 1ZGHA 3PQ4A 3RFVA 1U7PA 3R41A 4DS3A 1CULC 2W6ZA 3EXG2 3PE3A 3AT1A 3CNOA 4KGDA 5B36A 1XCMA 3DMYA 1B7GO 1EXMA 4M83A 4JR0A 3OCWA 1QE3A 2QE6A 3FTPA 5CEJA 2ERCA 5CD1A 2VQEB 4XM1A 3K6SB 5EMMA 4YPVA 2L0XA 4GVLA 1CUFA 1OXBB 1R16A 1JYSA 1X1BA 4QJ4A 3HBFA 3FGOA 3PX3A 4GLBA 4P84A 2VTDA 1ABFA 3IIEA 4NENA 2XYGA 3VTKA 4MMYB 1CU1A 3OZGA 4OJKA 4J29A 4QULA 1TO6A 4UVHA 5LBUA 3WR5A 2GB4A 4F2PA 4IXNA 5HFAA 1N3IA 3ZS9A 2FRDA 4FVTA 1N2BA 1RZUA 2D8MA 2EIHA 3C3WA 3C70A 2PUCA 1VE9A 4TV8A 2NMVA 1K9VF 4ADSG 5IX8A 5AM0A 3PE4A 3HFSA 3KLBA 3Q7TA 1DV1A 4OQXA 5LWQA 2BFMA 4MQEA 4G37A 3HCRA 1IUNA 2G25A 2QN3A 4R0NA 5JSYA 4GX2A 3SHFA 4OYRA 3FXAA 2O8FA 1AKUA 2ALJA 2AOUB 4OQYA 2H11A 3L7NA 2PQ0A 2XBLA 3R8FA 2X8AA 3A6KA 3DDWA 2PFKA 1QGZA 2PX5A 1W6RA 2Q5HA 4IILA 4B4OA 4AY5A 5C5CA 1L7QA 3ZE6A 3OTHA 1QVZA 4GRAA 1E2QA 3DGEC 4OHUA 4XLLA 2FUEA 2ABWA 1NQVA 1ZEMA 3TI9A 1TLLA 3Q7IA 3U6KA 3ESBA 1WXEA 1Z3IX 3TZ6A 2A9KA 3UQZA 5CB4A 2JFBA 5EZYB 1KH2A 4KMRA 1ZN7A 5HS4A 4JC5A 3OIVA 4CXMA 3IAFA 5CLQA 5DBOA 4C1NA 5KJCA 1AS3A 3FPBA 3OD5A 4I55B 4RVCA 1N6NA 3HSYA 1JEEA 2DR0A 3O4VA 4GE3A 1SCBA 1OWOA 2XUOA 1KPIA 1WSAA 2JIOA 4D57A 4MW4A 4NFLA 3WJ2A 1C0KA 5HILA 2GBGA 2P2GA 1A97A 2Q2WA 1VL5A 4MIKA 1O87A 2BRUC 2FEPA 2QUZA 1YB5A 4BMOB 3A9TA 4L27A 5LDDC 4RHTA 2ZRCA 1R0KA 4XWWA 3B2EA 3EAGA 1EINA 3HHEA 4PFJA 2ECPA 3R8CA 5TMDA 2O23A 4U7DA 2X0KA 1TCCA 2QZSA 2JJ8A 4NAUA 4JLSA 5AJUA 5K3AA 1Z37A 4IUYA 5C32A 5I9LA 2VAWA 4GSKA 4DQUA 1T4BA 1Z12A 4YJKA 1QE5A 5ALYA 1H42A 1NKTA 5BRNA 3GCXA 1V2GA 4H7FA 2X9VA 1BMFA 1R4ZA 4XDYA 3SLGA 4HDNA 1XNHA 3GGOA 2F59A 3OCXA 1BE1A 2F8LA 2FPXA 3AEUA 4N8DA 3LLSA 1MU0A 1KJYA 4LOIA 4QOIA 4ZOBA 3OBBA 1L6IA 1N7HA 3PC6A 5C18A 2AFIB 2WYIA 2Z6VA 3QWHA 3MQ4A 2AR0A 4UBLA 1U8FO 4HYYA 4DPLA 2R62A 4GC9A 4P9NA 4TWIA 1K89A 3A1FA 3AGQA 5HUQA 4GGPA 1D04A 3U7QB 3BMCA 5KWEA 1G17A 2QXTA 2C2XA 3AESA 3COVA 1GPKA 2A88A 2GN1A 1GQRA 3MK31 1TVMA 5ALLA 1QH8A 4NBNA 2PL9A 1RR6A 4KXQA 3JQQA 5KJ6A 2D1YA 1T43A 1LDYA 1JJFA 2RKBA 4J76A 4UD2A 1TMYA 1W9MA 4YCDA 3G8YA 2OFPA 4BQRA 2OZVA 5K2MA 2VRBA 2ZI3A 2RKOA 1GG9A 2IYPA 5EZYF 5EIFA 5JJKA 3C7TA 5J23A 3TBFA 3W9SA 3A6PC 3SNKA 2P8SA 4H4DA 5DYIA 4DLZA 1MJ5A 1KEEB 1JFLA 2HMSA 4MR8A 1U0HC 4P36A 4HXYA 3PG5A 3UOGA 3DZIA 4IL5A 5AVJA 5A5EA 1J5XA 4LZPA 2XIQA 3CG4A 3FVVA 4EVRA 2XOKA 4B3BA 1HLDA 3F5MA 2OOKA 4Q15A 2GPJA 3DSRA 3TSWA 2V96A 3H5IA 4O4LB 3IAM1 1GP2A 1Z2DA 3FX2A 1P5FA 3OLXA 3OFKA 1TO1E 1WZCA 1FDRA 2ZJ7A 3D8BA 3DV0B 3FTQA 3MELA 3N6XA 3PEFA 2YMMA 2HA0A 2NZUG 4IVNA 4J7AA 4D9CA 2I4IA 1RCFA 5DEOA 2CV0A 3V4OA 3SDBA 5ADHA 5AI8A 3W8FA 1GAXA 3AR6A 3H1BA 1S2MA 3TSYA 1Y5RA 3ABIA 4HHEA 1PWHA 4QPJC 2HRRA 3OUZA 4B79A 4L5CA 4Y2SA 3X2SA 1OXSC 3WSTA 1CEYA 1JQ3A 2XF8A 1WXXA 3MHPA 3NOQA 4MLZA 4WV3A 3QE0A 2ZK7A 1S3SA 3I0NA 1U8TA 2AE1A 2QENA 2OP0A 1JPNA 1BD4A 3IPRA 1EUCB 4KE6A 1RVV1 3GA0A 4B8ZA 3F74A 3SYKA 4JLVA 1LWOA 2AX3A 2DUWA 2VQSA 3IERA 4HXFB 2BRUA 3QPAA 4Q9AA 3CE6A 4RU1A 3D31A 3LC2O 1PQWA 4I66A 1OILA 1U90A 4WCFC 2CHGA 3F1KA 2M2IA 3OHSX 2VHTA 1D2NA 2HSJA 3DZDA 4LHEA 5CTAA 1RWOA 3ZQJA 1TL7C 1GCAA 1LB1B 2D7JA 3ELWA 1H1TA 1BFKA 3NHPA 3CT6A 1FB5A 3N3BC 4DSAA 4DV1B 3D3JA 1WXFA 1TT7A 2GXSA 3ZZTA 1H6CA 3I9NA 3U5TA 1W5EA 3WVNA 2G0AA 5FPTA 1XN4A 3JWEA 3A2KA 1P1FA 2PMCA 4JXXA 3GUHA 3VNRA 4HEHA 4LVCA 1XZNA 2PWBA 3BFKA 1H65A 1WVGA 2DPMA 2FF5A 2HMTA 1LVHA 2AFHE 2CNWA 3K5IA 4G89A 3PQ6A 4KC0A 4G97A 2Q8NA 3EVBA 4EH1A 2VWHA 2C8JA 4PZUA 5EE0A 5A4MS 5IC4A 1T8WA 4JBHA 4OFXA 2C5EA 4XJSA 1Q2UA 2GK4A 2TMYA 4X54A 2HU7A 4QYXA 1Z5UA 3H42B 1LPOA 1LJUA 1N6KA 3C4JA 2R6CA 2D2EA 3NR2A 4O4LF 2E4AA 1DRVA 5T67A 4HB2A 2HX1A 2HBRA 4IV0A 1S4MA 2IHKA 1OSNA 2XQFA 4V1CA 5JFOA 3TEFA 1YVPA 3W1WA 1JXOA 2VLIA 4F72A 3O4JA 5FB3A 5JDIC 2HMYB 4XIJA 2NNWB 2R6FA 2DGDA 1HPLA 1JQAA 5CDSA 1CZHA 2O2ZA 2N0SA 1G7TA 5BUZA 3QITA 4A0RA 4DDHA 1E32A 2Q3FA 3N70A 2ZRGA 1KERA 2CW5A 2J3HA 2NADA 2ZB7A 4QWWA 1LSOA 4WBXC 4YB8A 3LZ6A 5CURA 5FKJA 3TX2A 4CLOA 2O2JA 3L0DA 3OIGA 2WBLC 4RD6A 3HCDA 1NNSA 1BYIA 4UHBA 1M6VA 5FOVA 1IHPA 2K7ZA 2O8NA 2O8CB 3LLMA 3PQEA 1ZJYA 4R69A 4ACBA 2V5VA 3NIFB 1A2QA 2JGAA 1HFEL 1UBRS 3AV3A 5CW1A 1I8TA 2I7TA 9LDBA 1QRTA 4G9GA 4AUKA 1P4SA 4XWKA 1XQXA 1NUQA 1MNAA 3H3XA 4ZHQA 4OHBA 2VN8A 5A5DA 5L4SA 1XZMA 1KYQA 1XEWY 2XCUA 2P62A 3JTMA 3ZDEA 4C0BA 2W11A 1X74A 3TS1A 1BS2A 1NQ5A 3IDAA 3AL2A 4MVJM 3RK1A 3WNBA 5EJIA 5AW8A 1AMOA 1X7XB 3KEOA 3VZBA 3EG9A 2IEZA 3WOHA 1OLXB 1SCDA 1T9CA 1PFYA 2CHFA 2QGZA 3ANYB 3QXXA 4FSHA 4FQ7A 5HE9A 4I1PA 2Q3MA 4MTCA 4X91A 2WYOA 3HB1A 3CFYA 3LDUA 3P19A 1HE2A 1T9BA 3D3WA 2LCFA 3DAHA 1L5YA 1PRYA 5SY9A 1BEZA 3PPIA 1CPYA 1SG9A 1AIPA 2PZ8A 3LOPA 1JV2B 2VPYA 4XUGB 4ZVRA 4EZBA 4WCFA 4DG9A 4BEBA 1TX4B 1NRJB 4AK9A 4DCCA 2IXTA 1B8UA 1IUOA 2QOEA 3K8QA 5AP9A 4ER3A 3GZTB 2CFSA 3VSEA 3PQ2A 4B0PA 1YB6A 2RARA 2OQVA 4KLZA 5FADA 4S1OA 5KX5B 1ZL0A 3OA0A 1F0NA 3EAFA 1MQ9A 5CA1B 1QQBA 4EI9A 3I2IA 2DQ4A 4HRXA 2V0CA 1VGRA 1RXEA 4KKVA 4KKXB 3KJZA 4KR3A 3WIUA 3EDRA 2WF9A 3G8AA 1POWA 2GAIA 4GR4A 3ZWNA 4BPBA 2BONA 3TQRA 3TRHA 4Z0HO 4A4DA 4E5VA 4YRSA 3HXPA 1JBQA 1I1OA 1W9HA 2IJGX 3EBLA 1L4BA 4HDAA 3TXYA 4JXJA 3AVWA 1LRLA 1P0CA 2C2ZA 2QW1A 3HJUA 3LRPA 4TM7A 3VTZA 3H2YA 3RLFA 4I5EA 3QA9A 4MRMB 5DSZA 5EERA 4JVSB 1RJWA 3DHYA 5BWLA 1EBBA 1OXVA 1F17A 1XQWA 1UXJA 4OP1A 3REQA 2QY9A 1S9HA 1YQGA 4BEWA 3V6LA 1J0DA 3HTXA 4AXBA 4AL4A 1WSWA 4N6GA 3LWNA 2QG9A 2Z2KA 4I9HA 2CDNA 3MQFA 5H7XA 1CKEA 5JY1A 4Y1EA 3G2MA 3NMUF 3OJCA 4P33A 2AR9A 4RIHA 2DY0A 4RPLA 3HVKA 3PV0A 1G5TA 1LLDA 1FVOA 3EIHA 5LXTB 1T6NA 1IQ0A 3B53X 3QV2A 3QQ5A 4MUBA 5BORA 3R0ZA 4G65A 2BBOA 5FCDA 3PUZA 4A7PA 2ZVJA 3PXCX 1H1DA 1Y1SA 3ICPA 1IL0A 3ZEAA 1VA4A 4X66B 4WI1A 1LRJA 1PGJA 3ENWA 3EDOA 4DLVA 1ZY2A 3V4PB 3GAZA 4NZPA 4Q4AB 4Y6QA 2OBXA 2PJRA 3DV2A 4QRDA 2QRLA 3GLHA 4DPMA 4HRYA 4WOJA 4XLZA 4B3DA 3L4EA 4LTDA 3LHDA 4MKHA 1W4AA 5BVGB 4FDUA 2BGUA 2VCYA 3IFSA 4JI1B 4ON9A 3IP7A 4EKYA 4OHYA 2DWPA 1I7NA 1R10A 5F5NA 1XD8A 5KX5F 1NDQA 5DCLA 4H7DA 1B2RA 1CEXA 5CA1F 1TB4A 3L06A 4K9DA 4RHEA 2XCLA 4Y0VA 3E84A 4MOWA 1AN0A 2DY1A 2W0SA 5HTKA 4WBSA 3V8VA 1JNXX 4TN1A 5JZSA 2Z1NA 2VDWB 3RGWS 1EQAA 3V8BA 4F21A 4YAGA 4Q34A 3KYCB 2FPOA 4U7PB 5T3YA 3DLAA 4PR3A 2Q0SA 3C3DA 3WIDA 4CE6A 5IANA 4MTLA 4QARA 5DH9A 2NSHA 3TMYA 1E3EA 3NCTA 2EKLA 1ECGA 3REGA 4DCJA 3ZCUA 5BMVB 3O3NB 4RM2A 5U4XA 1N0HA 3IDSA 1TJYA 3C97A 2VRCD 1GQ2A 4ENPA 3IIJA 5EJ8A 3E7PA 3FPEA 2GF0A 1YO6A 4DFDA 4IVRA 3DYBA 4ZU6X 2WMNB 4QFCA 3NHYA 1JPUA 2IEBA 2QLTA 2WUDA 2EL7A 4QU8A 4L78A 4QQRA 1RKUA 4G86A 1RWWA 2QMOA 3NBZC 4LY3A 1AKQA 3UT0A 3P32A 3E9CA 3NQ41 5LXTF 2J7PD 2P1RA 1E0JA 3K4QA 1BH6A 4Q7LA 4IDDA 3QRWA 2AFHB 5SV2A 3VR1A 3GJSA 3HYLA 1KFCB 1IQUA 2IITA 2FQ1A 4DR1B 1VECA 4DY4A 2Q5EA 4NH0A 4NCIA 1XZQA 2J3MA 2Z95A 7AT1A 2NX2A 4HK4A 1P6XA 1ZM3A 3GVIA 2JFNA 1LQ2A 4NATA 3DD5A 4X5OA 1DE0A 4F8JA 1ZRSA 4J4BA 2C5AA 4P0QB 4QNMA 2XQVA 1XFAA 4Y0AA 5JFTA 5IVIA 5HKAA 1UK6A 1WMAA 3S55A 4YEDA 3COJA 4JDUA 4HNGA 3O8OB 5MGBA 4R1OA 2OVBA 2VL7A 2XR1A 3ZG6A 5D5QA 4OM8A 4PLFA 1SBZA 3PZBA 3ZHQA 2ZS9A 5I3ZA 4OMDA 3NORA 4L3VA 4XX1A 1N9GB 3TZBA 2VHZA 2WM3A 4HCJA 2GUWA 2BBTA 1ZM4A 4JP3A 3EZ6A 2CXSA 4GX5A 4JODA 1RYFA 1GCIA 1NKVA 1GSIA 5CHEA 1A9ZA 3G8DA 3KFLA 2A1UA 1DAEA 3IMCA 2BFPA 3V00A 1J2JA 2GRJA 3DT6A 3WGZA 2VATA 3DKVA 1VBKA 4KLCA 5JAOA 4I14A 5CYOA 4EW3A 4NENB 2ZT7A 3UKOA 3L8DA 2PRSA 3PUHA 3O2SB 4FYVA 1T4CA 3NUZA 1JG2A 5BMVF 1ZG3A 4O02B 3CZAA 4GZ6A 2V7XA 1YJAA 4UZFA 3FZQA 3B85A 4HN9A 1M8JA 4RHUA 1LDBA 2PLRA 1A96A 5J40A 5ALQA 2NTVA 3K5PA 5LB4A 1Z6ZA 4HDMA 4ZYUA 1GPYA 1NUSA 2B5OA 2BF7A 4MQEB 3PL5A 3SSNA 3MD0A 3RSFA 3HU5A 4F91B 4LBZA 5CHYA 2PFSA 5FLEX 2GF2A 3D8HA 3OFND 5JAPA 2O8FB 1KPGA 2BTQA 4AMUA 5IH3A 4AS2A 3DEZA 2B8JA 2Q2VA 3OICA 4PYNA 4EO7A 2E4ZA 5FWDA 2RGRA 3CJQA 4UCWA 2P90A 4XYEA 2YRWA 2ATVA 3HBAA 4CM6A 3A1CA 3OPVA 4LE0A 4PFQA 2C00A 3HYCA 3GP8A 2X4IA 2DYKA 4QXRA 1IN1A 3M6MD 3NXKA 1Z4QA 2VF2A 2OV4A 4JL8A 1ZJ4A 4PINA 5AW6A 4J4HA 2AZ4A 2OMEA 2A0UA 1SU4A 5CB4B 2Z8YA 4L0CA 3MNFA 3VPGA 1WJGA 4D9FA 3QOWA 4UUQA 2CZGA 2QVZX 1G41A 3HU3A 1M0EA 4DV7B 1XMXA 4PAMA 3QWAA 5DNEA 1OKKD 1JIIA 1VRVA 3DKKA 3TOSA 3RVQA 5AVKA 5FWXA 3UAXA 5CU7A 3WWCA 1KSGA 5IHXA 3RG8A 4HD8A 4LZJA 5H4HA 3V1YA 2VDKB 1X8LA 3T3OA 5FV7A 1GL9B 1VFPA 1NDHA 3V55A 4A0SA 4C6TA 4C6HA 4RE6A 2ZSJA 1UWCA 4KODA 4YQZA 5LIPA 1NW3A 1OLOA 3HDQA 4Q21A 5EQJB 5L3RA 4ZCIA 2IS6A 3P9SA 2NYRA 3LY9A 1Y6RA 3ANLA 4R98A 3DZHA 2PKWA 4WZZA 1QH0A 4LSMA 4BNWA 5GAJA 3NBKA 4G0YA 4V39A 2C20A 5H02A 4DDTA 4B3MB 2H6EA 4W4TA 3EA0A 4X8HA 1ND6A 3LK7A 3NRJA 1LI5A 3UAOA 1V39A 4HDNB 1C0PA 2NYVA 5J4KA 4A15A 3AEUB 4DZZA 2GPAA 1UXIA 1V3VA 4NFYA 3K16A 3TNJA 3U3RA 4OQFA 4RKRA 4U6QA 3IAEA 3OIWA 3QBDA 1FYXA 3QFSA 1U3FA 4RPKA 2AK2A 4RVFA 3TUJC 1JHPA 4NBTA 2ZDQA 4WFQA 2J46A 4Q3KA 4EMTA 5CXQA 3AJDA 3DAGA 4KIUA 3BH7A 2ZXFA 4GPD1 3BMCB 3AESB 4LEIA 3VHXA 1NBME 4ZOCA 2ZJBA 1ESZA 3QVXA 5EHNA 3USES 3D6JA 2PZKA 1G3MA 1QH8B 2VHXA 2R0QC 3PEVA 2ID7A 1PNOA 1Z35A 4TV9A 3GBPA 3HMKA 1QRDA 2XUAA 5JNWA 2RSLA 4DTIA 4EBBA 2JFXA 4FDVA 3EQ2A 1WUJS 2HSWA 1DTWA 4FFSA 4EUKA 3S8MA 1X0XA 1LV7A 1KU0A 3BDVA 2C5GA 4G0OA 5AM3A 4XSHA 1QK5A 5CB4F 3Q3IA 3H17A 1YCDA 3UKDA 1BHJA 2V4MA 1Z0SA 1DBVO 1NI3A 1W96A 3IH5A 5FYDA 2CNBA 4I4LA 3I9FA 3INRA 3QZUA 3AEQA 1TYBE 1OIWA 2JLBA 1Y3HA 4HDOB 4RK5A 5HPYB 3GW8A 4MR8B 2R9VA 3M9XA 3MLBA 4MPTA 4Y6RA 2P9YA 2P9HA 2E21A 3RUIA 1IN5A 2PR7A 3Q3EA 1C50A 1XA0A 3U3KA 1E9AA 1Y4UA 4HWRA 3W1EA 3H1AA 4I4TA 5LZ4A 1A7KA 2VF8A 3R6GA 5E1DA 2EEZA 3ZHYA 1HUQA 1IRIA 1QWOA 1U31A 2VJLA 3UF0A 3EISA 1J23A 2D06A 2YWDA 3I42A 3A6FA 3SEQA 3FLEA 3HXMA 1U0BB 3K53A 3LUPA 4LXHA 4DLSA 3DCJA 3CEMA 2QAIA 1UJNA 2LIPA 1GUFA 1F2VA 3LOQA 1U1EA 1ZONA 4TVKA 4TXMA 1UJ6A 3M4YA 3SKVA 1PDOA 4M1EA 4BQQA 3UVEA 4AJPA 4MUIA 2JJYA 2SICE 2AQHA 3U09A 5TGZA 3IEXA 2QYTA 3OTOB 1QGAA 1EK2A 2EL9A 2GJ4A 1D7OA 1UBHS 4J03A 2FZGA 1N7GA 4TKMA 4HUQA 2IEYA 1GKIA 2IX9A 4HBGA 3UWKA 4XD7A 1C7JA 4UOZA 1KMNA 4L74A 2JLVA 3D0RA 4X7RA 2FETA 3GHHA 4PZPA 1O2DA 1M67A 1T3HA 2DPHA 3D7NA 3GA7A 4G5YA 1U3DA 4BX2A 4ARUA 4IDHA 5EHQA 3ZVMA 3W5HA 3KDPA 4Y6LA 1Z3CA 4IZOA 4LBVA 4OFZA 3U31A 3GJ8A 1TLTA 1QPBA 2GXQA 3F9CA 3D4BA 3IUMA 4RAQA 3WXMA 3M70A 2FQXA 5J4LA 1WMFA 1CD5A 1YZ3A 4KQKA 1T26A 2AZMA 5BW8A 2ACKA 1LJLA 1MH9A 3AFOA 4LHVA 1SKUA 3DE2X 4M55A 1RHMA 2E1PA 2HEGA 3MWFA 4TMYA 5MN5A 3WK8A 3S8EA 3NYWA 3QY9A 1XTBA 3C1TA 4GYJA 3B38A 1DFIA 4H1UA 3CCBA 4HQ6A 2ID9A 1J7KA 3LQYA 3OTQA 2KS6A 4JGGA 5JRZA 1VPWA 5K0JA 4RF3A 4BKPA 3LDGA 1YXMA 5IM5A 5BQ3A 4BLQA 1YD7A 2Q4RA 2JIQA 5ALKA 1XX6A 5IFLA 4MS4A 2BMFA 1YCGA 4TLCA 3T9CA 4IEEA 4DYDA 4XUEA 1WY5A 3QJ5A 3WK6A 3E03A 3CNEA 3I3SR 4J6EA 3VR3D 3NV7A 4HGQA 4UEOA 4R8LA 4KYIB 3ZYCA 2R96A 1KYWA 1IK6A 4V1CB 3FCOA 3AI3A 1F5SA 3AP2A 1XVVA 1IYZA 4OSPA 5DT2A 2PH7A 3LL4A 4UDYX 5D01A 4PYKA 4AICA 1QDEA 5ALMA 3LC1O 1LUAA 2QLMA 4NE7A 4JB3A 4C2TA 3RU2A 3KPVA 5DBIA 5EKXA 3GJXC 1N8NA 1T8UA 4Q1CA 1C7IA 2JFUA 4N4AA 5KCMA 3VZRA 1NNUA 3U6BA 4CLOB 3O1HB 3ETNA 1WM1A 1NTOA 3HY6A 2UZIR 1KL7A 2IU0A 3WV4A 3OSZA 1M6VB 2EU8A 1N5OX 1W30A 1JSZA 1E7WA 4ER0A 5DGIA 4S3MA 3H2BA 3R3YA 3UJBA 1KVTA 2XNDD 1K75A 4FBMA 1A8QA 2VSOA 4DJAA 4DCTA 1V48A 4HQ0A 3QVGA 4ZHQB 2J0SA 3ZHOA 1M0WA 1QZUA 1XZDA 2ZWPA 3GDOA 4ZO4A 3WFZA 1Y4SA 4BAGA 3W3ZB 3FCXA 3R24A 4UM7A 3ZZ0A 4BP3A 3AB7A 4Q5IA 3FVWA 3OJFA 2OCPA 4HNVA 1RLIA 1XYGA 3WRYC 3R3ZA 4Z9FA 2CUZA 3T94A 3FG9A 2WJIA 1VI6A 3BICA 5KTMA 1YFLA 4BKQA 4L8YA 4R9NA 1MW8X 3EG9B 5IJZA 3FYDA 3WLQA 4BV3A 2FVXA 2IYXA 1J0EA 1LRKA 1WVIA 4JXKA 3WMWA 4JLPA 4MYCA 4BJ5A 1ZXXA 5F5XA 5ITWA 2VQFB 1D4FA 1QF6A 2WWWA 1TC1A 4BFUA 5MN6A 3CVUA 1B6TA 2MOKA 3D3WB 2XWBF 3L8ZA 4URWR 1JEAA 4DUGA 1GZ6A 1DG1G 2XXJA 3Q88A 1H8EA 2GSWA 3WNDA 2H3HA 1QZZA 3OM8A 3MHTA 1UFRA 2QG4A 1VYHA 1DT3A 2J31A 4YROA 1MQSA 2WT8A 3I9OA 3SKXA 4BKOA 4CMGA 4GVPA 1PQPA 2UVQA 2VNIA 3T52A 2PZAA 5DKFA 4MI1A 6LDHA 3UOWA 1EJBA 2WR8A 5ALGA 1D1TA 3HB4X 4EF4A 2GCPA 1BKYA 2QRKA 1QGOA 3DMHA 3EYAA 4W8OA 3S5JA 4UPEA 1CJCA 1KAHA 1VG1A 4C0JA 1W0CA 3IQWA 3OQJA 1IZ9A 3RABA 4RJLA 2JZCA 4KQ9A 4W7IA 1IG3A 2JDIA 3OU2A 4RELA 4B40A 1J1ZA 4KQGA 1VJTA 4TMWA 4Y9DA 4IMPA 2DLCX 1CHNA 4J3JA 1G8YA 1ZH8A 5JJIA 2H2HA 4B2IA 4D9IA 3PPXA 3MWYW 3UK1A 2NP6A 4MKFA 4DRXA 3GRVA 3I45A 1E3DA 1Z7YA 3PWZA 4M1MA 1E1QD 3VHLB 4EL0A 4FB4A 1EJ0A 1FU8A 3ANNA 2P67A 1DV2A 1J0XO 1N5KA 1RWQA 1WU7A 2VP6A 2WJ3A 4R2HA 1VPEA 4W1SA 3WICA 1MB9A 3MT7A 2Y9MB 3L6RA 1TVCA 2A14A 2OHXA 2PT5A 3R3VA 5H5JA 5BPFA 1TZMA 3OAAD 4HBZA 1A69A 3REQB 1XHFA 1Q6YA 3C98A 2D74A 1Z4KA 4ZHQF 3K05A 4W82A 4YALA 4ERXA 3OQHA 2WNIA 1JILA 2IUTA 2ZIWB 4BP1A 1SXJC 2FJ0A 2RKWA 1N3YA 2GHQA 2PG3A 2Q1SA 3I5MA 3OA2A 1RYDA 4S0XA 1RBZA 4WXHA 5PGMA 3TW4A 4DLAA 3O93A 4EW1A 1HFJA 2WB4A 5EWMA 2PJDA 5I51A 4A8JC 1A2KC 1T5LA 2YHUA 3T7SA 2V6IA 2QN6A 2A4KA 2YS6A 5DV9A 2C83A 3F46A 3HSKA 4S1PA 3JTEA 4N6NA 4XOIA 2NQ2C 3EFHA 4CQLA 1JVNA 1Q1BA 1DAIA 2J6HA 4J0DA 1OI4A 4X1IA 5CDHA 1KVUA 2QRUA 4MO2A 3X43A 2Y05A 4INZA 2C5SA 1P2SA 1VL2A 3HQ4O 3DGFC 3OY2A 5CP8A 4PW0A 1FJXA 1KS9A 1NVTA 2H0RA 5CLJA 5JZBA 2JVKA 2FLWA 3GLHB 1EDDA 2X13A 4K9NA 1HMYA 2BGKA 4LDPA 3KNZA 3OESA 4M1QA 3IVAA 1KC3A 1JR4A 4OB7A 2POQX 2V3VA 3ZK8A 5B3JC 3OKPA 1VG8A 1RZRD 1USGA 4B84A 2IU3A 1I7PA 2IZ6A 3DMDA 2OZKA 3CR3C 3FAKA 3G5AA 3K0BA 4KW7A 1UJ5A 3F0TA 1U0OC 1A0OA 4FEGA 5A02A 1QF9A 1X7YA 2YL2A 1IQRA 2JCBA 1N1EA 4MMXB 5SZIA 1V8DA 3KUKA 1DPGA 3KQOA 1OYOA 3EEBA 1NMSA 1U3WA 3PC3A 4RBNA 5A9SA 3MW8A 1R9NA 3FZGA 3D8SA 3RSGA 1H9BA 1QVVA 3H9JA 3CIOA 3P7MA 5HQJA 2ZYDA 1BHQ1 4ZEXA 5C4GB 3FPJA 4BLPA 4IRMA 2PUFA 2HU5A 2QSZA 1M2FA 1FFBA 2WU0A 4EJ2A 5G0WA 2A9PA 3N1UA 2GHRA 4C0AC 4GH5A 2DE0X 4DSOA 1ST3A 4XIFA 1RLMA 1T5OA 1RXYA 3FZEA 5GV8A 4KQ2A 1LX6A 1XVAA 2VAPA 3NEPX 3EPJA 3GMDA 1AGNA 1M34A 1QUFA 4U6NA 1PE0A 4PLCA 4TQUS 4DCSA 1Q1AA 5TGDA 4ZO9A 4Q1BA 3MTJA 4J1TC 1OWNA 4ZVPA 4CMIA 1FJ2A 4XJTA 1NW7A 3I04A 4MYUA 3RS9A 1PUXA 1TJ3A 1ORIA 2VH5R 1B1AA 3ISJA 3RYFA 3UJ6A 1KDYA 4DADA 4Y98A 1GZ4A 4P2GA 4Y2UA 2ZAOA 3JR7A 3ENVA 5JS7A 4HWGA 4R9UC 2JI7A 3Q10A 3CT4A 4RW0A 3ZWBA 3GN2A 2GBPA 4M1OA 3S5UA 1MLDA 1RPTA 3OE5A 2H5JA 4L4YA 3F3MA 3BGOS 1WMSA 4DCPA 3FYSA 3KT6A 3VSCA 3VV2A 4AZTA 4JI0B 2PBFA 3LSTA 5C52B 3TVTA 4QEKA 4BY9E 1G9SA 4LV5B 5LMZA 3OFVA 1IDOA 1TMGE 4OTZA 3JW8A 3W2IA 3WGLA 5JNSA 1ZJWA 4TTVA 1C3EA 4RV4A 3WK4A 4HUJA 3LT2A 2R6DA 2B2CA 2LDBA 3JWJA 3R77A 5GQSA 2EF0A 4S0ZA 2Q7XA 3UJ9A 4W5OA 3VYSB 4XAQA 1G3RA 3U3MA 2ZSUA 1H5UA 1GITA 1C4WA 2QDKA 5DASA 1H2ZA 1W5AA 4JS0A 1JHZA 2DU8A 1A8UA 2OO5A 5AK4A 2FN7A 2I9PA 1L4LA 1U2TA 3QVVA 1X1SA 1B3BA 1JWAB 2Q62A 3KQYA 3KU1A 2A1UB 2QRGA 3MMPA 4O5OA 1QHFA 1UFQA 2CZCA 3BF7A 2NXCA 3HCFA 3KE9A 3OQVA 2C59A 2IP2A 3SX4A 2AS0A 1QMGA 4W1QA 4RJ2A 4BJHB 3ZBPA 5FA5A 3EPKA 1CY8A 3R5KA 4TROA 4DOMA 4X95A 1I4EB 1T4CB 4TTTS 2FSUA 5CCBA 1Z9BA 4R9RA 4CNQA 3V46A 4YMLA 3WYNA 4V0SA 3W5DA 1USWA 4LRYA 16PKA 2ZAYA 1G55A 1MXFA 3EIEA 5KDOA 2H00A 3NHMA 5BR4A 1UC8A 2SBTA 2RGNA 1VYTA 2PDAA 4GT1A 1DC7A 1PJRA 4HDMB 1USVA 4LBYA 4Y2QA 4DMMA 1FTGA 1KZYC 1WD7A 4H1VA 2HV9A 3GDGA 3N59A 4K9PA 3CX4A 3FMIA 3JVVA 4BNZA 2BTQB 3HJGA 2A78A 5JRDS 2Q5LA 3S1LA 5CW2A 3OC0A 3GNSA 3NWBA 5LLSA 1R5OA 2HT1A 5AJTA 1BN7A 5CG1A 3IOCA 3KVOA 4MVJG 4P31A 1ZGBA 3AY7A 3CO5A 1L8QA 4L72A 2FLVA 3ECCA 3ZHRA 1Q17A 1P6UA 1ZMXA 3N53A 1DC6A 5CJJA 4EVSA 1FDIA 1JSLA 1BG6A 3PXAA 4GICA 1U04A 3PI6A 1AXEA 1TF5A 1V3QE 2WOJA 2CXUA 1DAKA 4D81A 1OA1A 3IHKA 3F9IA 3HUDA 4OREX 4TKVA 2DH6A 4UCFA 2QUKA 3SGLA 3ET4A 1CWUA 1PCXA 2YICA 4DV0B 3H65A 4FZ5A 2HBZA 5FWXB 4FILA 5BWBA 3KB6A 1XEAA 5AH0A 3N8NA 4OA8A 3AI1A 1XMIA 2OCGA 1IBRA 1PN3A 3E9NA 3W5CA 1PEAA 2D3WA 4C6TB 3DWEX 2QNIA 2YJ4A 2YQ4A 4UOQA 1IUKA 4JJIA 1EI9A 3B1ZA 5JLAA 5E9WA 2BKXA 2VDQB 3ZGLA 1BWSA 2IPMA 3ESCA 4GYKA 2YIDA 4FGUA 1KNQA 2ZAGA 3AUYA 1V25A 3EVFA 5KJEA 1ODFA 4MVJH 5DYYA 4EUSA 3QEBZ 1ZOLA 2QUHA 4KPUA 5AVXA 1WP9A 4LGMA 3HJAA 1E79D 1RQPA 1Z6PA 2F3UA 1R5NA 3GK3A 4V2UA 5GP1A 3GXOA 1EXWA 3BE4A 1GSHA 4EZEA 5P8WA 3HYNA 5EMKA 2Y8EA 1EFTA 3GQBA 4RXTA 3W6UA 1W8IA 4ZZIA 1JLSA 4RZIA 4F2GA 2Q1XA 1Z47A 2XYPA 2QX8A 1ADCA 3DCIA 1FRZA 1ABEA 721PA 4Y2GA 3JQAD 4GOJA 1YS2X 3IDFA 3FHJA 4IKOA 3ROGA 1L4EA 3EDCA 4KNWA 3VHXB 4CM4A 3L1VA 2WSMA 4F1JA 2OC9A 4RTSA 1ZKDA 2VR1A 4HZGA 5JTTA 5T3UA 1BVHA 3RU9A 3AG5A 4TV9B 2TS1A 4P82A 4UXJA 2UAGA 2JLRA 3C16C 4MB2A 3TNFA 3WKBA 4O3MA 5BURA 1W36C 2E82A 3MXTA 3CVWA 3LY8A 1DTWB 4OFBA 4PWZA 4EF5A 4IIEA 1AXGA 1WB9A 1MG0A 2HFKA 1I2DA 2VKQA 3FYUA 1QRAA 2XMCA 4YAEA 1UMBA 2RHBA 3D7MA 4PX5A 1HF3A 3B3FA 1UXHA 3DBVO 2C5FA 1BA3A 4DJJA 2FWIA 3G0HA 1WNTA 4J91A 4ZI5A 1JNYA 2PQMA 3KZMA 4FYJA 1I3KA 4Z9XA 3DAPA 1L7EA 3K4HA 3V48A 1R0RE 5JMTA 3L82B 1AMUA 1PVOA 3AEQB 3PLNA 1EWQA 2RCYA 4LVOA 4EB8A 1GA6A 5GADl 1NR7A 2WW8A 1MOZA 4C4OA 1FTQA 1DELA 4HGYA 3MOIA 3HYRA 2CE7A 2XGMA 2H5IA 3BX1A 3FPCA 4UHDA 4U7FA 5EE1A 4FE7A 4I4TB 1JXQA 3SXUA 5A4IS 1DXHA 3PFNA 2HV8A 3ESDA 3R6DA 4L6IA 5DFAA 5EHGA 3KQQA 2QR3A 4P8RA 3UT5A 4JUAA 3GRZA 5EVJA 1QV9A 2IXFA 3QK7A 1QAQA 4ZAFA 3EQZA 3FUTA 2MMCA 5DCWA 3T38A 2XB4A 1UODA 4L16A 1FX1A 4ILEA 1C1XA 3F7NA 2EZ9A 3RHTA 1M8PA 2YINC 2EGUA 5GM1A 3QUCA 5BPHA 4GXQA 5CDUA 4FOLA 2QGNA 3BD7A 1T36A 3NYIA 2C5BA 1QR2A 5DIFA 1P45A 4WXRA 2XKBA 2HRQA 1ZGAA 5JXIA 3ZWPA 4HUQB 5IF9A 4OLBA 1J1UA 1X70A 3QVWA 4MQLA 1DKLA 2WZBA 2ZT6A 1E6UA 2EFGA 1IJBA 1QFZA 3F2IA 4M9UA 4KSBA 1SXIA 3P2OA 1ZZEA 4ZVMA 3REOA 1JSRA 1GT6A 4CM1A 1XRRA 1H2BA 2O7QA 2ZROA 4FHGA 4NZ9A 4R1UA 1QE0A 4RZQA 4TL7A 1ODJA 3L07A 1RBMA 2A5JA 4TV9F 2BIFA 1WWKA 1YIOA 4HN4B 1JDJA 1OCEA 8ABPA 1TECE 5BSMA 4PGFA 2ZSBA 3BQMB 4WFIA 1OASA 1M34E 1RJ9A 2ANBA 2H8GA 4G41A 4UBKA 4Z9AA 1EVEA 5GWXA 5JCOC 4JI4B 2PUTA 4D6XA 5BV0A 4DZRA 2JIZD 3TW8A 3ZWVA 5LQSA 5LR6A 4B31A 1HI9A 2D62A 5DHUA 3SJ7A 1FS6A 2WABA 2E85A 1XDZA 4F5YA 1WDWB 2B1RA 4DV3B 4XYGA 1XJQA 4YHHB 1PEKE 1IM5A 1RPAA 4LI0A 2J48A 3KO8A 2QB5A 3CS3A 2WD7A 1KI7A 1DI0A 2ONZA 5BYJA 1U6IA 1L6RA 4EA9A 1N9KA 4MVCA 3T1TA 4JU8A 1ZYUA 2H4JA 1TIBA 2DFTA 4HX5A 4I4TF 4H1HA 4MS4B 4CM5A 4A27A 5K0BA 2Y2UA 2WVHA 5DHTA 2IHUA 2ZYIA 4M0FA 3OJOA 1GZSA 1ZNQO 3DMTA 1RBYA 3DHWC 3M1AA 4GKAA 4WLEA 1M5TA 1H93A 1BVRA 3P0HA 5L9AA 2HHHB 4XQ0A 3GPCA 1JMVA 3LPAA 4OA5A 2GWHA 5FD8A 1FRQA 4OP2A 3TLCA 4GOKA 4JSRA 1I5RA 2FV8A 3VR5H 4XWOA 4JV5B 2AMFA 1C0LA 1ZM2A 3NIWA 1WUYA 2Z2JA 4DNQA 5DWVA 3MJFA 3WA6A 4A23A 4UPVA 4K0RA 1C7EA 4K05A 5KB3A 4WUVA 1RXWA 1NLUA 1S7GA 4JC8A 5IBQA 3SYNA 4CLDA 1DUSA 3SR3A 3DKPA 4CUZA 2FUCA 3INNA 1V96A 3O82A 2Y1EA 2GO1A 3F90A 5A2QA 1N77A 1A4UA 1HNZB 1HYEA 4UTVA 1XA3A 4QQNA 2IK8A 3RS8A 3UHOA 4Z2YA 5FA6A 2MSDB 3PNOA 1U28A 1WE2A 3FKQA 1QR6A 1U8XX 3HUFA 3QPDA 5G0TA 5EUBA 3QVGB 3NVKI 1KRWA 5DP2A 4YACA 5FL7D 2HMAA 4LDAA 1NBIA 1F51E 4M0PA 2YRFA 3BGIA 2HNBA 4L4UA 3IUJA 4I81A 1YA8A 4TWRA 1EQUA 1OT3A 3DCYA 4YAFA 2XMZA 2WWVD 1B42A 2E1RA 3M4ZA 3D6FA 1KFJB 2ODNA 4U7WA 1N0UA 3SG0A 3KSBC 1R5BA 3EQ9A 2ZYVX 2B20A 3ONDA 4JENA 3OG9A 1NF3A 3EJ6A 1P77A 3OOYA 2OM6A 2PGJA 2ZKLA 3FKSA 3WO1A 3GBSA 1EFLA 1T2DA 2YBDA 2WM9B 4TM8A 4YJ3B 5EN4A 3ASYA 3AIKA 5LMNB 1B16A 2EERA 3EFEA 4WADA 1UK8A 3K9LA 1M10A 2D0OB 2D5IA 1DDGA 4M46A 3AILA 3JS5A 1YUNA 1XF1A 4EJSA 3SQWA 4IHJA 5EXTA 3C5WP 2AV6A 4DCGA 3OZIA 1W5BA 5KNLA 3U62A 4B2YA 3GLUA 3FTEA 4KPFC 1K6XA 3B89A 5DHPA 4RVOA 1H2FA 2AJCA 3OECA 1UXGA 2Z83A 4XGKA 4DE5A 5J2TB 2F43A 2RI1A 3IEUA 3NH9A 3PPYA 4G25A 5IBCA 3ESAA 3LQ4A 2EG9A 1TCVA 2GEUA 2ZR9A 4E0BA 4MI3A 4F4UA 3H2GA 5AOAA 1Y6JA 1YZLA 2C7QA 4P81A 4RQUA 5K1ZA 4NU6A 4RK0A 4YMUA 5BVHA 4IZIA 1M7HA 2VXCA 5EQTA 4DRXB 4WXYB 2BSQA 2H63A 3T3EA 1EVIA 1OZGA 4YRAA 2XKJE 1LBSA 1N0VC 4GI1A 4IIDA 3I52A 3THYA 2W8BA 1CZNA 3AFIA 1F8XA 2AGVA 2CMFA 4UHHA 4P4GA 4W7HA 1A9XA 1QOQB 3F3KA 4AO8A 1DTEA 3I01A 4FDMA 1VHDA 4TL9A 3OE7A 2X1MA 3GVPA 4KWTA 3T5TA 2XEDA 3EEYA 3SZLA 1Z36A 2WIBA 1U7XA 2ZRMA