3PPVA

Crystal structure of an engineered vwf a2 domain (n1493c and c1670s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
b'CSMVLDVAFVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGDILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCSSGEGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords von Willebrand factor
molecule tags Cell adhesion
source organism Homo sapiens
publication title A novel calcium-binding site of von Willebrand factor A2 domain regulates its cleavage by ADAMTS13
pubmed doi rcsb
total genus 68
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ppvA00
3EGDA 3EFOB 5KYUA 2VDNB 2O7NA 3N2NA 3IJEB 5E6UB 4WK2B 3EGDB 4CN8A 3IBSA 1LFAA 4NENA 1BHO1 1SQ0A 1JEQA 4WJKB 4WK0B 1QC5A 3EOAI 1UEXC 1BHQ1 5HGJA 2XWJI 1IDOA 5E6SB 1ZONA 3BQNB 3PPWA 3V4PB 5KYWB 5KYWA 4C29A 1RS0A 4NEHB 1YVRA 4A0QA 3BN3A 1RRKA 4IGIA 3NIFB 3HXOA 1QC5B 3RAGA 1DGQA 4UM9B 1MF7A 4Z7NB 3TCXB 5KYXB 1V7PC 4C2AA 1IDN1 2NVOA 1RD4A 4HQLA 5E6RA 4HQKA 5E6UA 1AO3A 4CN9A 4Z7OB 1N9ZA 1M1XB 1L5GB 3E2MA 3F74A 2I6SA 2VDRB 3FCSB 4JDUA 4MMZB 2WW8A 3T3PB 1JEQB 4F1JA 1M1UA 1IJKA 4HQNA 4PN7A 3Q3GE 3ZE2B 1M2VA 1M2OA 2ADFA 2ICAA 4HQOA 3ZE0B 2B2XA 3EG9B 3HXQA 4IHKA 3K6SB 3ZDXB 4BJ3A 3GXBA 3PPXA 1XDDA 3ZDYB 1M10A 3BQMB 3PPVA 1MQ9A 1CK4A 3HI6A 4Z7QB 1RTKA 1NA5A 2XGGA 2IUEA 2X5NA 4CNBA 3NIDB 3EH2A 5HJ2A 3TW0A 2VC2B 4IXDA 3EGXA 4HQFA 4M76B 1JEYB 1T0PA 2I6QA 3TVYA 3VI3B 3K71B 1AOXA 2VDKB 1PD1A 2VDPB 1ATZA 1DZIA 1JLMA 3ZQKA 2NUPA 1ZOPA 3VI4B 4NENB 1U8CB 1FE8A 2I91A 1PCXA 3FCUB 3EG9A 1TYEB 5KYNA 3EFOA 1ZOOA 5KYUB 1PT6A 3EOBI 3M6FA 5KYXA 1MJNA 2ODPA 4MMYB 3ZE1B 2ODQA 5LN1A 3QA3E 3EGXB 5HDBB 1MQAA 3K72B 2VDQB 1IJBA 3TXAA 4G1EB 5E6RB 3F78A 2VDLB 2M32A 3ZDZB 4DMUB 1U0NA 4UM8B 4C2BA 1AUQA 1XDGA 4MMXB 2XWBF 2NUTA 5BV8A 4FX5A 2NUPB 2VDMB 1MHPA 4O02B 5KYYB 1OAKA 2QTVA 5KYYA 4UM9D 4WFQA 2NUTB 1T6BY 3K6SA 1JEYA 1SHUX 1JV2B 5ES4B 1U0OC 1N3YA 1YVPA 1MQ8B 1Q0PA 5E6SA 1QCYA 1XUOA 1M2VB 3PPYA 3EH1A 4G1MB 2WINI 4F1KA 1CQPA 2VDOB 4XW2A 3T3MB 3NIGB 4WK4B 3V4VB 1SHTX 1PD0A 1FNSA
chains in the Genus database with same CATH superfamily
2O5CA 1YASA 2EIHA 1JLSA 4L95C 4YALA 4Q47A 5E8RA 5M7EA 1UIRA 5AR1A 3ZIAD 1Z45A 2VO1A 2GJ9A 4FB4A 2JI9A 3P2EA 1W581 3U3RA 3U7QB 1Q1NA 5CFOA 3TJRA 1S3SA 5AK4A 3PQFA 3Q7SA 2I6FA 1MB9A 3DFFA 3MWKA 4R1TA 1AA6A 3IIEA 1YFJA 2BTOA 3PCRB 1DIHA 4KDCA 2IE0A 2Y93A 5FKJA 1QH1A 1OH7A 2ZETA 1ZIOA 3PLNA 1CY7A 3HL0A 3IB3A 1W88B 2ZYDA 3ECSA 1SUIA 2GXSA 5FPPA 1CJMA 3ZCXA 2ZRDA 4O4IF 3ZNOA 5JROA 4F8YA 4OV6B 3GFVA 3NBUA 2IOFK 4R2KA 3IV6A 1HXHA 4R8LA 2ZE7A 5KYXB 3FPEA 3BD7A 1H5QA 4TSFA 3CG4A 3T06B 1KAEA 5MDHA 3NTVA 3GIDA 2VJMA 3F2IA 1W6RA 1Y1RA 4HGZA 4YJ2F 5IHXA 2VDRB 5I45A 1QTNA 3HXPA 3LRXA 4OAQA 4HZGA 3RNLA 1VSTA 4ZAYA 2FZ5A 5FT9A 3WA7A 4HQNA 5ENZA 2GXAA 4KKXB 3L93A 1XB2A 1W0KA 2PUBA 3AKEA 3HTXA 2JFZA 1NUQA 1PS9A 3A1DA 4XYGA 1OLSB 2GCNA 5F33A 2BOVA 2QQ0A 3TIIA 4B4WA 4QGSA 2FTKE 4G85A 3QFSA 5AVSA 1UK8A 4E13A 3QBEA 1LW7A 4ZEMA 1YCGA 2ZWIA 1VSUA 3E8SA 5DNWA 4AICA 4CXMA 1N2HA 4XJVA 4DSNA 4ZAGA 2B2CA 3GLKA 3JPYA 1L4GA 3KLMX 4O4JB 3U4DA 3HR8A 4B7ZA 1J5PA 2YHIA 1TA9A 5EVCA 2Y2UA 3HCCA 3HSYA 3WLRA 4CIVA 1PJLA 1DKPA 1QGZA 1HA3A 1U8YA 5KDLA 2EFHB 2GCEA 3Q2OA 5BMVA 1O6CA 3N2EA 1IVYA 4D8TA 4TUYF 5CUQA 2C98A 3N8KA 5CMLA 4EIWA 3FYTA 4IOLA 3A4IA 5G4KB 2P3OA 1QVVA 4ENVA 1RWOA 1OFUA 3GB9A 1AVTA 1NNI1 3CRQA 3HJAA 4YROA 2ONJA 5KYUB 2FN7A 4UBKA 3SDZA 4DLZA 1ZGAA 3WL8A 2Y0CA 2MIIA 3GBSA 4PHHA 2AZMA 3HEMA 1NVUQ 3ZU6A 4OK6A 2SECE 3F6PA 3HP1A 3REQA 3GPDG 4JXXA 4GMFA 4S2EA 1PZEA 3L6DA 4HAXA 4CT0A 1BWSA 3EIXA 1BCRA 1ZK1A 2QZJA 2W58A 3HBJA 3NGMA 1X8LA 1MW8X 5A9SA 1WUYA 1JYSA 3BSSA 1UDXA 1IPFA 4R69A 2DWPA 1H6DA 2V54A 4BNKA 1J8FA 3AR5A 4QFDA 4Z3DA 5KVQA 2F9MA 2IV2X 2V0GA 3COWA 2H85A 1BXZA 3FPLA 4TQ9A 4EL0A 3C7AA 3VYTB 2GPTA 3W5HA 4MR7B 3R5HA 4HZUA 4KI7A 1UKVY 3DDOA 1F12A 2UZ1B 4AN0A 3AUAA 3QVUA 4BBPA 1X7WA 1KIMA 5C8YA 5CBKA 4RORA 5J47A 2FQ1A 4Q4AA 1I0ZA 1K5HA 1CQZA 3EDRA 4MJXA 3ZCVA 1PNRA 2GPSA 2QLFA 4HNTA 4IOKA 1YF3A 5T67A 1TEZA 3BE4A 1BXGB 3PQ3A 1TA4A 4UU0A 3ONDA 4YB8A 5NLLA 2OLKA 1KU0A 4QFCA 1A7AA 4FOPA 3UAWA 1E66A 2Q7XA 4K6HA 3ZE9A 3VR2A 1DAKA 1BX1A 1LI4A 2JIOA 4BJHB 2QTFA 3ZEIA 3HY4A 3R8FA 1G4UR 4FWBA 4WBNA 4B33A 3DMNA 3GEBA 4D4MA 1HE2A 2HF8A 2OOKA 3T7SA 1SOAA 3X2FA 1V2GA 3HN2A 4D6XA 2ISSD 5F23A 1MV8A 5E6SB 4LV8B 4Q39A 1W29A 3WKDA 2VQFB 2F62A 5TJ9A 3D31A 1ML4A 4QUHA 4ZIRB 4M83A 4OGKA 3GNSA 1C0KA 1E2QA 1HWYA 1VHLA 2KLBA 4P3PA 4PEVA 4RS3A 3W8RA 4B7AA 5JDIA 1ULSA 3C98A 5DYIA 5K8TA 5TGZA 1OWOA 2PV7A 3WIDA 1IG0A 2H29A 2AG5A 3WIEA 1U0GA 2A1TS 2MSWA 4F3RA 5CTAA 2X0KA 1O6FA 4S1NA 5IUNC 4AI6A 2QG6A 3HCNA 1N2XA 2QB5A 4REQA 4R3WA 4B3FX 1W4AA 1HDOA 2WIFA 1Y4AE 2AOTA 2I1LA 2HIMA 3FTQA 3L7MA 1U2TA 2RGUA 4JVMA 4MYCA 1GP2A 3NRBA 2Y1DA 5DT2A 4L8VA 5J4VA 4B3MB 1YDGA 1E6WA 4NYMQ 5HCIA 2OAQ1 4MV0A 2H6EA 1U2GA 3VKWA 2ZUEA 1Y1QA 3RRYA 3E9EA 4OOEA 4D5GA 2PUAA 1CJBA 1G1MA 1Z8NA 4RKWA 4B4UA 3TSZA 1EGHA 2I5PO 1F2UB 1RP7A 2QN7A 2Y1CA 4N0MA 1Q3HA 4NBNA 4WA7A 4L28A 4YRIA 4GWGA 1XELA 5CW2A 1WPGA 5AUPB 5LWHA 1H2FA 3GUYA 2RGYA 3ZI7A 1Z4PX 4FD2A 2CKDA 2VC2B 4N5MA 4N7BA 1TCCA 2V9CA 1DQRA 4HFJA 1BU5A 4TMFA 3CNBA 3IMCA 5CLHA 3VSAA 5MGBA 4CM9D 3WR5A 1LZKA 2WJIA 4XRGA 3K71B 5IYZB 4L5YA 1PG5A 4TQAA 4UXJA 4EUSA 5E38A 1WETA 2ZSAA 4C30A 3QP9A 2ZI7A 4C05A 3DDUA 3EWIA 2J3KA 3ABZA 4WJLA 3B1WA 1P44A 1J0AA 2ZBFA 3MCVA 4US1R 3DTTA 2QTNA 2R1VA 1KYIA 1BMFA 1HORA 4G9EA 3VU1A 1M73E 4RDHA 5B4VA 5IF3A 3L8EA 3GI1A 1ECPA 4MDYA 4Z86A 3W4IA 1SELA 1ND5A 4A8JB 2L42A 4F4FA 1GHTA 3JQCA 4C4PA 3EEIA 4RJ2A 5IUJC 2N3ZA 1L1FA 2YUTA 5CTJA 1KJZA 4GX5A 5G4LA 4RPHA 2IF2A 4BGVA 1T8WA 2V7BA 3DLIA 1OIWA 5J5CA 4BLVA 4Y6GB 4MARA 2COKA 1EP9A 1GYRA 3V1YA 3QF4B 2VF5X 2EATA 3BHMA 2NUBA 1IJEA 4RJJA 3WKAA 4JBYA 4OMDA 2CMFA 5FYDA 1M8KA 2C31A 4EG1A 1NJFA 1IE3A 2QVZX 3Q7QA 1E7YA 1KI2A 1ZD2P 2ZIXB 4HDMB 5L45A 1ECCA 3I4LA 4W9NC 4JD5A 4Q48A 4AYXA 3LYHA 1AM4D 1H94A 5G0VA 3TCKA 5T57A 4NZPA 1P0IA 1KK0A 1C1XA 3PKZA 2OQVA 1Q57A 2HDOA 4JLBA 4PX5A 4ZPJA 3RYIB 4CIXA 1SIBE 1K7FB 2KE5A 3PHLA 3QE0A 1VG0B 4L1KA 4P3NA 4MPTA 3ZGNA 3L8ZA 4DIFA 3ACBA 3T41A 2D06A 4N7JA 1UBSB 1IZ8A 2PXAA 5ALOA 3MERA 4UUMA 3QXCA 2XCOA 4KOEC 3VBCA 5ILQA 3HABA 4PFSA 3BGDA 5JC8A 3W3ZB 4P3KA 5EZSA 4EX7A 3VKHA 3E5HA 3CVWA 4GAEA 4GI3A 4QU0A 1UOOA 2XWJI 5JS6A 1RRFA 5TQVA 3VC1A 2VK1A 3OESA 1FFEA 3DE4X 3I5MA 1XA0A 3CV3A 3ZEAA 1YV9A 4OQMA 5EE0A 3UKJA 2QYTA 3U1VA 3ZX4A 2I8LA 2ZRJA 2XTAA 2VBIA 3HQ4O 3KAQA 1RQLA 1AF7A 2DKNA 1QAMA 4YDSA 4BBJA 1HG1A 5FLEX 3CA8A 2VPWA 3GWGA 4ZJUA 2X14A 5ALVA 1IMJA 2XJ9A 1ZI6A 2XT6A 4H7FA 4O4HF 4CUKA 4NV0A 1VLJA 4M9XA 4W9MC 1MAHA 4HAWA 1RHRA 3EZFA 3FSGD 3FZEA 3JAKB 2HA5A 3EGWA 3M8KA 4PC6A 4UDXX 3E9QA 3SR4A 5AJWA 2OPHA 4DSTA 2UZAA 4KLAA 1CYDA 3E2MA 3GJ3A 4KQ9A 3SHTA 4IBOA 4EW3A 3JZDA 3VFDA 2GJSA 4BQNA 3TG8A 3K92A 1OBVA 3CZ9A 2HDHA 1H1DA 3LIIA 2CVQA 4YT5A 5FAKA 5K0TA 4AURA 4RD2A 4IX1A 5JBNA 3CZRA 4GT1A 2Q1WA 2Z0MA 3MCAA 5HOEA 3D1JA 4H7PA 3KDPA 4BEBA 5A4JA 1TD1A 1YDHA 4XLTA 1M5RA 2B83A 3OD1A 2RKBA 3WJ1A 4LE0A 5BNFA 4ECEA 2CFSA 3KJXA 3L8FA 4F85A 2WU3A 1IZZA 2VZEA 1II8A 1TF7A 3IDSA 3NYRA 1M7GA 3R5JA 4UBJA 2ZUTA 5BUSA 4BB0A 5TB5A 2Y3IA 5BWCA 3TQCA 1HDXA 1DAGA 4JJ8A 2ZYGA 1FMCA 2M1XA 4NIMA 5I3ZA 1XEWX 1T24A 1YACA 4AQYB 4G5QA 2FX3A 3C3MA 5G02A 3ZG6A 4EI9A 1HY3A 1BOOA 2R00A 4G5RA 1MH1A 1S2DA 1PKXA 3H9UA 4BKQA 4YJKA 1D6NA 1SXJE 3CX4A 3LZCA 1S8AA 1X38A 2YWHA 3KFXA 2XMDA 3JRXA 3VDMA 3DMDA 2OGTA 1ZISA 2R7NA 3OZVA 2P4EA 1G0NA 5DRYA 4EL5A 1KY3A 3FNEA 3E61A 4A0GA 3P4YA 3O47A 4QARA 3IAAA 4DM4A 4OJMX 3RARA 4XSHA 4I66A 1P1HA 1XCBA 1VI6A 3P9KA 4JI4B 4JJFA 1SCNE 3CEJA 2Q4BA 3LW8A 3CUYA 4PSDA 5H02A 1JVSA 2P0YA 1Z2DA 1JR3A 3QBTA 4MUNA 4OJYA 4BX8A 4QFMA 4UATA 5HF9A 5LQUA 4IQFA 5EZYA 1N5LA 3GRVA 1C7IA 3KIPA 1POWA 1UBNA 1OI3A 1ST2A 3FSGA 5KREA 1SU6A 3LPAA 3F3YA 4JXJA 3TSYA 4WXYB 2Q99A 4M6WA 1IH8A 5JNVA 2GZRA 1QP0A 4LJSA 2PLFA 1BKSB 3R6TA 5CVTA 4XGNA 4Q4JB 2VATA 4DLWA 4LOIA 1BN6A 5CYPA 4AJ9A 1XFAA 1IJFA 2R65A 3K5PA 1OXKB 4NL4H 3B36A 4Q66C 4AMUA 4GKAA 3A9RA 4W6QA 2QOEA 1I4EB 5HA5A 4ZCMA 1L5VA 1RZRA 3PK0A 2RHOA 4O1HA 3E4DA 4OQPA 3UYLA 1OKKA 1F5SA 4I4CA 1I7QB 1J2JA 5FPSA 1A9TA 3RSQA 3ADCA 1GAQA 4IDBA 5DZSA 3RFTA 4IRMA 5JMPA 3ZE8A 5C1BA 3IKTA 3ICPA 2PBZA 1M0SA 1P73A 2AOUA 5ECGC 3KHTA 2VWHA 5A4AA 3MTJA 3OM9A 1XROA 1X86B 2AMLA 4HNRA 4KIJA 4YEDA 3OE7A 2ZW9A 3VR0A 4P93A 1Q1GA 1XMPA 2BEWA 4HS4A 5KAPA 4EJ2A 2HF2A 1XRPA 3QLTA 2ZIXA 4AULA 2RJNA 4LFBB 2O5RA 1NU6A 4R9NA 5KNBH 4C7OB 2JAUA 4C29A 2VYCA 2NO1A 4WOJA 5LD2C 4GHWA 3GG2A 1UK9A 4LGVA 1A96A 5FB3A 1DJQA 1OREA 1TC1A 3DJYA 4LRUA 1RXYA 3V2GA 2WHPA 1AXGA 3WYNA 4KX3A 2ZG6A 2PCLA 5EIOA 3OCZA 5EZYF 2P5SA 1A88A 4N4AA 5H83A 3V1KA 3ILXA 5TMDA 2ESRA 2F1KA 5J4LA 4HYEA 4G8JA 2DFPA 1O6ZA 4ER3A 5T7BA 1L4KA 2A9PA 1Q77A 3MCWA 1UXIA 2OILA 3QVWA 4OIFA 4ID3A 4NCNA 3IEXA 4D0GA 3ERCA 2XF2A 3RSZA 4EMBA 2XUIA 1SZPA 4KR7A 1O5OA 3F1LA 5K2MA 1IJKA 1P9WA 1JQJC 1AKYA 3RVNA 3DAFA 2V8OA 5ALJA 1JR3D 3TTWA 3S5UA 4GLJA 3MUNA 3VR6A 1MU0A 4QYMA 4LTDA 2X0IA 2R6AA 3L84A 3PQ6A 3BTUA 4KQ2A 1L7VC 3AHHA 3A14A 3M5PA 2IBSA 4QDXA 3SC2A 3QKSB 3EXEA 1ZK3A 3HI6A 3RC8A 1R9GA 1UXJA 4OLJA 2WPNA 3F6BX 3KB6A 1XZNA 4ZKEA 2ZJYA 5HJ2A 3H1PA 3JQ8A 3RIYA 3S2GA 3ZYZA 2DH6A 3ESZA 1AZTA 3KSBC 3K9NA 2BFEA 2PA0A 5BOVA 3RLIA 2W2XA 1GFWA 3PTLA 4G8BA 1WTAA 2XB6A 3FVVA 1BJTA 1TMKA 2FMUA 2Z1MA 1M34A 2IYOA 2WIBA 3E35A 4W9RA 1PFKA 5DWDA 3HY3A 3PEEA 4UHHA 1DG1G 4EW1A 1E7SA 3GARA 4J8PA 1DKRA 3G6WA 3H2SA 3L41A 3LHSA 4JVNA 3EEOA 2G1PA 5FNVB 1YIAA 4DLKA 3QELA 1NW6A 2ODPA 4V0KA 1V9CA 5KTYA 2XE4A 4DADA 2V5UA 2IHBA 2ZR0A 4ILEA 1BDIA 3M5WA 3H0CA 4REMA 2XLBA 1R6DA 2QIOA 4PLZA 2P2LA 4MUGA 1P4RA 2VLBA 3JU3A 4MVXA 1Z73A 2AUTA 1MQAA 1YS2X 2JFVA 3A58B 1S2IA 2X0EA 5F2EA 3L0CA 3DVAA 2IH4A 3H7IA 4NV1A 1PJ3A 2FRXA 1ORRA 2PX2A 3EXIB 4MI6A 3SBOA 4CJXA 1CIVA 4HDNB 2V6GA 2UYCA 2HKIA 3WOVA 4MHTA 1E3WB 1LDNA 3PGKA 4F3YA 2ST1A 3DHYA 1WHSA 2QVLA 3DYIA 2AFRA 2GASA 2JLQA 4KWTA 4C6HA 1EXDA 4W5QA 1YE3A 4ZT5A 5E7IA 1L5NA 3C70A 2VCHA 4D7AA 5DYYA 4DXHA 3R0XA 1GN8A 1U0HC 4UMFA 3MNFA 1RLMA 1Z82A 2VYVA 2X4GA 4KIFA 1G291 1CB0A 1HL7A 1XTJA 3MS7A 4YO8A 4ZVLA 2YWCA 1OH6A 1NTOA 1OC2A 4MZDA 5TDHA 4YRLA 3FMVA 2WUGA 4R98A 2RG1A 3DEFA 4PPNA 1JPUA 3JWIA 2WJHA 4PZCA 3KSRA 2GCPA 4R1QA 5F64A 3ZZTA 2V4UA 1O7JA 5KJCA 4KDRA 1RLIA 1TIBA 3P19A 5LYJB 2O4UX 2Y66A 3CHYA 1GFIA 5G3YA 1IULA 3NALA 1QR2A 4H6WA 2B0JA 2W90A 3C7CB 3RUIA 3WLKX 5KTKA 1RJ9A 4FZJA 1G59A 1BDHA 3SMVA 1L2TA 2NIPA 2IPOA 3RSFA 4D81A 4YLGA 1NJ6A 2AR0A 2WTEA 1JJ7A 4QAJA 4AS1A 4Z2AA 4JKYA 1TL7C 5EAIA 3Q7TA 2O2YA 1ORTA 2XBUA 1G3QA 2D62A 4BMVA 2VQEB 3QX8A 4JXZA 4L2IA 1U4SA 3KQKA 2I71A 1DXHA 3E9MA 3OTQA 4LHYA 3RIXA 2GM9A 3FTEA 1F3LA 1AKMA 3SF0A 2GYWA 1JFVA 3BMOA 3UUWA 1BYUA 1KFKB 2ZJ6A 1OJ7A 1WUKS 3GDFA 4DBLE 2ZIVB 3SLKA 3USES 3CU5A 1GKKA 4LFCB 3KWLA 1YDMA 4NCIA 2AW3A 5JCOA 1SKUA 4PYOA 2UUPA 3T3PB 3THYB 1HURA 3EDOA 1M1YB 2HSZA 3BK1A 4PN7A 5JMTA 2C8JA 5HG0A 5CFMA 1CD5A 4ZEXA 5BORA 4D3YA 1IY8A 2OCKA 3CLHA 4FFSA 2NV0A 4Y0AA 5CVUA 3TG2A 1SIOA 4GPTA 4M37A 2W2QA 3QM1A 4AY3A 1KRWA 2W2TA 3PC4A 2QN6A 4PNHA 1J90A 1U90A 4ZK6A 3EVAA 2PEZA 1Y3FE 5JXHA 4TKUA 1VL5A 3WA6A 4HDKB 4JYPA 4IVQA 2BFEB 1FUYB 5BV1A 5AIBA 3G13A 2JLBA 2OORC 2OV1A 1EE2A 2XMQA 4YQZA 5FQNA 5HTOA 4CF7A 4D26A 5IKOA 4IINA 5C8XA 3R3UA 2X7JA 2Z2JA 3ZDRA 1K88A 4CMIB 3TXXA 1U1GA 2CMKA 1KDTA 3IIKA 3AG6A 5M04A 4LY3A 3R5XA 4HGNA 5BN3A 1FMLA 1BW9B 4IDEA 2C94A 1VRCA 4Q0MA 1VJCA 3T1VA 1NPDA 1H4SA 2JARA 3DKVA 3K09A 5TPZD 2COUA 4AMYA 3V7UA 4AP9A 3A4NA 1X1QA 2VP0A 3FDZB 2R87A 4XZ3A 4PG5A 3W4KA 4EO4A 1CJSA 4QM7A 1EBFA 4WT7A 2IXAA 4YDHB 2JLVA 1KEPA 1L7RA 3AOEC 1XJQA 3DD5A 3DKIA 1Z0SA 3I1YA 1ADBA 3K2BA 3HDJA 2HIAA 1XCGB 3KR2A 3LFHA 4X7MA 1INLA 2EZ4A 3D0KA 5CT9A 1QG6A 5EUCA 4MIEA 4TMWA 4QLBA 4XDYA 3GD7A 1SHUX 3STWA 1G7SA 1UZMA 5ARBA 4LCJA 3D1VA 5CT4A 4EGAA 1E1RD 4ZHQA 1FTGA 5DB4A 1C14A 2BR5A 4PZLA 3HA3A 5AQEA 3PFHA 3RRBA 3ZW9A 4E03A 4FM9A 4I4TA 5CR9A 2PSHA 2UUOA 4YS6A 5JR3A 1PQ4A 2ROQA 3IHKA 3UWKA 4P58A 4YMSA 1IEWA 1EUCA 1X1AA 1YQ9A 4HGOA 4R2MA 4M9QA 4Q1VA 1OFGA 1NDUA 4A8JC 4BJ1A 1GNQA 3O1LA 1H2YA 3HGTA 4RK5A 4UTOA 5JSFA 3LUFA 5KNLA 1CR2A 1KZ6A 2AOVA 2W7TA 2HNBA 4R83A 1CB7A 4XCXA 4BC0A 4D4JA 1KK1A 4DWWA 5LD2B 1MB0A 1O57A 4CV0A 1A8IA 2C3YA 3CKLA 1KAHA 2G9NA 1Z0DA 4JX8A 1GUZA 1QIJA 4DE5A 2RH5A 2WABA 3ESBA 3H86A 3JD3A 2FKNA 2GEKA 3YASA 5C8YF 2MU1A 5KQMA 1JR2A 4U7TB 5H4HA 1NRJB 1PJ2A 4FGUA 1YHZA 5IXSA 1OZFA 4MKIA 1G1AA 2QI9F 3RAFC 2J1LA 4EHBA 1PR3A 1JF8A 1HH4A 2ZYHA 3NGXA 3E18A 2WJJA 5IC4A 4OAPA 3AUUA 4CEIA 2OFPA 2OHJA 2FVXA 2QTCA 3LCRA 4WGFA 4QLAA 4MJ7A 5MGNA 4XGKA 3OLXA 3ETGA 5G53C 3QEAZ 4RE5A 3WG9A 1TNDA 4IHAA 4OMCA 4OY3A 4RPIA 3RRNA 3FCAA 1DC4A 1Z0KA 1JVBA 5I48A 3HVHA 1LI5A 2O07A 2QE7D 1VCMA 2BFAA 3AM1A 4Y67A 4LTMA 2KBFA 2W4QA 1YHNA 2AD1A 5I7HA 4RK0A 1QP8A 2WWTA 3DPSA 4LVOA 3UFXB 3DZCA 3KZXA 3B6JA 3U60B 1VMDA 1CK4A 1SY7A 2P41A 5IWCA 4CKZA 1P9NA 1NMQA 3AEUB 3HBFA 3G0CA 3I2YX 4V3BA 4O8CA 3AI1A 4EJSB 4RS4A 2C78A 2JFNA 5BV7A 1I1OA 2HRBA 2VN8A 1TT5A 3K9LA 5FR2A 3C1OA 5ALLA 4U0JA 3VC7A 4J07A 3NAQA 3TLMA 3C87A 3WOHA 3HMKA 3PQ8A 4PPGA 3MUEA 1MAWA 3L0IB 5CW1A 5I4IA 1SVOA 4MIKA 4Z4IA 4X1OA 10MHA 1FFDA 1XZAA 1NU8A 2FAXA 1EIZA 1CDDA 2MMGA 2HQBA 2Q6OA 4ZCQA 1YA6A 2QRUA 5B64A 5JARA 1QH8B 3I04A 3SVLA 2OCBA 3GQVA 3STVA 3ZHYA 1ZIPA 5KVCA 4N54A 1Z5WA 3QU2A 5FI3A 2L19A 4F9FA 4MR7A 5KOJB 3A26A 5CU7A 3NOOA 1ACMA 4XVCA 3VQTA 1O1YA 1X70A 4PBTA 3NEPX 1TYAE 3T4UA 5T8KA 4DRYA 1KMHA 4J4HA 4YAWA 4WNIA 1VIYA 4QDKA 2ZQYA 4H4DA 4QNRA 4ZOLF 3MB8A 3EULA 2XADA 2YXDA 3RQSA 4QBFA 3P96A 4MVJE 2HCBA 3FDIA 1U0JA 1XUOA 3BKWA 4HQRA 5F4BA 1XLTC 2WSSD 3B3GA 3GZ4A 4GPIB 4MUJA 1Z5VA 1CEXA 3PX2A 4J2HA 2J6HA 5CRIA 1P5HA 2DR3A 5DTRA 2B5WA 3VYWA 2Z58A 2FPIB 4ALMA 3EZLA 2YR0A 2VYND 5AVJA 2HEIA 2WILA 2R6GA 3CUUA 4HNVA 1LWOA 3V6MA 4BMPB 4NULA 2X9QA 5I7OA 3H1FA 5DGCA 3Q7RA 2IRWA 3A7EA 2VTDA 3UWSA 4KR0A 2LCIA 1K97A 2I62A 3EARA 3AUJB 1G3MA 3PFCA 3W8NA 1NG1A 1VDZA 3OZXA 4PCVA 3T38A 1EXVA 3OZFA 3VJRA 5C34B 4HGRA 1XA4A 1D6MA 1ACLA 2IDKA 2YJTD 3KKEA 4G0PA 4FFRA 1KHHA 1E6CA 1GR1A 1TT7A 2D59A 5IKMA 1I3KA 2RHCA 3F49S 5DGTA 5DSTA 4B6SA 3MA0A 2EARA 3KQHA 4R1UA 5GV8A 3GDHA 3LO8A 3WLEA 4N76A 2COEA 4MWCA 1DJLA 3GLHE 5K3CA 4XUGB 2BT4A 4OSPA 4U39A 1AXEA 2WD9A 1V11B 2W2MA 3COPA 1ESCA 4JSRA 4KU4A 5FPYA 1ML3A 3TTVA 8OHMA 4IDPA 4OQDA 3FNRA 1M66A 4KQIA 1K92A 4JKIA 4L0MA 4FR5A 4UNSA 1DKLA 5FLYA 3X0DA 3U16A 1WCWA 2H2IA 4GXTA 4KAXA 1J0EA 1FUEA 4U2DA 2G63A 3SZRA 2CB0A 3SM9A 5A3SA 1SXQA 4I4IA 1ESNA 3WB0A 3L1UA 4YRZA 4RHEA 1K9SA 3DE6X 7ABPA 1TTTA 1Z2OX 4MR8B 5EHNA 1SOMA 4IH9A 4EI2A 1LLQA 2AFIA 1Z08A 2FOLA 3KPVA 4L50A 4LJ4A 3FYHA 3K20A 4V1CA 1E18A 1S4QA 1F8XA 2AN3A 3DXZA 1NUSA 3W2FA 1MMFB 4H0CA 2YL2A 4TXJA 2RC5A 5CB4F 2JGNA 2Z9BA 3K2EA 4BLOA 2HOQA 1CQJA 4QXPA 4UXIA 1GCUA 4YQEA 4NFSA 5JCJA 3O1IC 2RAUA 3AI2A 1EK1A 1W0CA 2H4HA 3GHHA 1H2WA 3VYVA 1FPMA 3K2IA 1K2VN 3M2TA 5FF9A 2J5RA 5JFOA 3V9PA 2NZJA 1TUBA 3Q8KA 3E03A 5EJ4A 1NBME 2FI1A 2CMGA 1RYFA 2I2WA 4I4TB 4BRUA 1ODSA 4WBSA 3G2OA 3MWEA 4Z3KA 1W93A 3S3TA 2J3LA 3DT8A 4J3FA 1LS6A 4LZAA 5DKFA 4B3JA 3WHLA 4ARIA 4OMFG 1HYBA 4EHDA 2UZIR 1JJFA 3BXGA 4Q16A 1OAKA 3WIBA 3WZLA 3N39C 1YCHA 4M8LA 3W6PA 3DQQA 1QYDA 1EG7A 4DDUA 1EFRD 5ARDA 2QJFA 1D4OA 4WNCA 3A1SA 2C2ZA 3CVOA 2QUAA 1ENPA 2Z5FA 3IAHA 1TO2E 4LC1A 2WINI 4MWZA 3WVNA 1XF9A 1FFAA 1FVOA 3GOHA 2WG1A 4PYNA 3VTAA 1UADA 1E99A 1GGVA 4FBGA 2CXUA 4QUGA 5DYGA 3MBIA 3TLXA 2H1OA 2DR0A 2YIVX 3QYFA 5DLYA 5BV2P 5FWAA 3BB3A 4YV0A 1PV1A 1YA8A 4BZXA 4E7PA 2HA4A 3EPKA 4ARBA 3BA1A 3TOSA 5H81A 3TLJA 2VNSA 4CWAA 1Z6YA 3TD9A 3K32A 1NX6A 3M9WA 3PRHA 4N9WA 4RKQA 4WLVA 4PZUA 1GRVA 3ENKA 4E4TA 2Q9UA 3GVHA 4UXHA 5AKKA 3MIIA 4LDNA 3RU7A 3EBPA 5IVPA 3SICE 3N7AA 3T5BA 4DY6A 3DC2A 3V46A 4RPCA 1SVSA 3PI6A 1M3SA 2Z8YA 5KYWA 3UPUA 4E3WA 2O8FA 1KAMA 2CJPA 2JCYA 2XNHA 2F1HA 2I4NA 1JU3A 1Z07A 4TLMB 2HPVA 2PL3A 4L3VA 4RQBA 4GNKA 4L07A 1RRPA 3I5UA 3IQDB 2OO5A 3PENA 3RC9A 1I2BA 4IDGA 3UMGA 2RD2A 4AN1A 3TPZA 2P0AA 2X9NA 4C2AA 3ON5A 2F43A 5CK5A 3VPAA 3HACA 4NSNA 4BFTA 2IH2A 2UV8A 3AINA 2EQAA 4XUCA 2Y0PA 5BQPA 5AVZA 2HCFA 5DNCA 2BFCA 1B8NA 1IRXA 1Y81A 1JS1X 3JVIA 2FP3A 3EIQA 2QORA 3L9WA 1C3OA 3QVSA 4LZJA 5AXBA 3EQ6A 1M1UA 5GZ6A 2CL6X 3CSUA 2ZRBA 3FRHA 1D6SA 3IYLW 1U7HA 4HZIA 3T35A 4URVR 1R12A 5FNVA 3V42A 3DZIA 4ENQA 4XWYA 3JWPA 2XUOA 4EJMA 3CUEF 1DL5A 1IM2A 3DS8A 4IVRA 3GAZA 1BE1A 5IMSA 5L6LB 2XA2A 5E2AA 3FGZA 3L7CA 4UD2A 5JEEA 1BX3A 1WLSA 5CXSA 3KRTA 4Z7QB 2HYDA 4X1IB 2R6FA 3BGIA 5AW3A 2ZRQA 4KXLA 2ZQZA 2ZUDA 1GPMA 1H9AA 2AH5A 4EBFA 4YRMA 3L46A 3CRW1 2PPVA 4DMFA 1KFJB 4YUAA 1R9JA 2PVCA 5TGDA 3TD2A 2GZAA 3V33A 5K3OA 2YFYA 2HMWA 3MWYW 4L8GA 4DSAA 4L0QA 4MVJD 1JU4A 1YB6A 1VPLA 3ZVLA 4AMZA 2O1XA 3QKRB 4GM1A 1ZD5A 4BO2A 3ABOB 1AB5A 1I6LA 4OHPA 1M6VB 5F3RA 4RTRA 1H8HD 2X7XA 1U9YA 3V8EA 2ZUUA 3M6WA 1GM5A 1KS9A 3TDMA 1S1MA 2P2SA 3CNLA 5K8JB 2BGJA 4KYIB 4WLNA 2C83A 2FPPA 3QHPA 2P6OA 1CJTC 1ZO8A 3CJTA 2PMEA 2CYCA 1FSSA 4FX2A 3WWPA 4OB7A 1AQLA 4BUJA 2CLCX 1GUAA 2C7BA 1DB3A 3C85A 3OH8A 1U3FA 2QTVB 1NP6A 1OTHA 3OJWA 3COZA 4NKRA 4QBKA 4W9NA 5HQ3B 1UODA 3HUEA 2VPIA 5I4KA 2HF9A 1FMJA 2I9PA 3I1IA 4HLCA 2AE1A 7ADHA 3U7HB 2YZGA 3MSCA 3TGWA 4H7JA 3EE6A 3PPYA 1D2GA 1E6UA 1HNNA 1GZUA 1E59A 4EWLA 3K9BA 2RAVA 2ENUA 3Q85A 3AESA 3K0AB 3RCBA 1BROA 3AR9A 4FN5A 4KAAA 3ZZMA 1SHTX 1PT5A 2I6UA 3KTFA 3G0BA 4RH1A 1XJ5A 4JJGA 4A5SA 2D8MA 3N2NA 1QTIA 3VO9A 1F8UA 3FY4A 4HBZA 5IJAA 4IQ4A 1VG1A 1UK6A 1J1IA 2CL5A 4N5NA 3O4HA 3I04M 3ZHZA 3NHPA 2CLDX 3G9QA 1NN0A 2YRWA 4URUR 5CURA 1XA3A 3QX7A 1NRWA 1QCZA 2Q41A 4PYKA 4U7PB 4WCFB 4C43A 2QX6A 3LDGA 3LF2A 2NPOA 3HADA 4YRCA 5BSHA 4MB6A 4G0OA 3M2PA 1NXSA 4P4SB 4UEWA 4FC6A 4KYVA 5FX2A 1TZMA 3Q3HA 4JLMA 1UBMS 4O4JA 3FROA 3RVPA 5KJ6A 3ASUA 2JJQA 5ITVA 4IDDA 1SK9A 3OFSA 5F76A 1YRAA 1HRDA 3AM4A 3KVOA 5EXTA 2YJ3A 1SBTA 4EP1A 2FEAA 3Q12A 5LKAA 1PJ8A 3QMMA 3WFJA 3JATB 3DEAA 1C1DB 2CYAA 2OAGA 3D6TB 3UM9A 2Q0QA 4FN4A 5CEEA 3EJ6A 1TT5B 4FYKA 5LWQA 3IIIA 2XUQA 2O0JA 1W75A 2E4YA 3EVZA 3DAHA 4EJ0A 1NF3A 1C2YA 1X7XB 1SURA 1RCFA 4WOPA 2WBLC 3RREA 3ZV3A 3ZE2B 1FP2A 3W6OA 3TGPA 1HR0B 4P54A 4XE5A 1BVUA 4M9UA 1OAOA 3CEHA 4M7PA 2VKQA 2M9MA 4PYIA 4UC0A 4JI5B 1W52X 4F3NA 3O74A 2OBFA 2QPAA 1G4HA 1VL6A 3IERA 5DP2A 1JFFB 3AF6A 3NEAA 3NDIA 2ZRPA 4KPYA 3ITKA 3ITEA 2FRDA 1CVIA 3Q8WA 4GU5A 3UWOA 5FA5A 1MOSA 2CK3D 3MQ2A 5JZSA 2MWMA 4BKPA 1XG5A 4F84A 3ENVA 5FTWA 4BFZA 4QG3A 1A1VA 4AY5A 2QRMA 4Z49A 1M2HA 1R6BX 3IAUA 1BQ3A 1JAZA 1QO0A 1SXHA 1RSZA 3SYTA 3GJSA 4C3VA 4Z3OA 3QNMA 1WZUA 2FR8C 2VRCA 1QORA 3I9JA 3KB2A 4MVJG 2JLWA 5IVHA 5IKPA 3DXYA 2GEDA 4BO3A 1NW8A 1II0A 2Q9CA 3K8ZA 1GQQA 1JLHA 3B3QA 1AU9A 3DCJA 4H6PA 4JJ4A 2ZVDA 3KEOA 3VR3D 4BOYA 4DT1A 4E1VA 5IZCA 1CR6A 4RTSA 3A9UA 3EB9A 2D54A 1P0FA 3FI9A 3PX3A 4P9NA 4TLLB 2XJ4A 1LJLA 2DULA 4Q6BA 4CU2A 4WEQA 4MCAA 1E0DA 3TRDA 4C4SA 3ZJ5A 1MOPA 1N5OX 5TEVA 1BMQA 1E94E 1ELOA 2IUSA 3VUEA 1JQBA 3ZHCA 2J48A 1AMNA 1S7CA 5FPTA 1KSFX 3VNUA 3FDFA 3V7FA 1ESDA 1PEDA 2IX3A 4EVIA 2D7JA 1YDWA 3ECCA 3IMFA 3KAPA 4KXNA 1T2AA 2WF9A 4I1OA 2WJWA 3AR2A 4DAEA 2DXIA 2ZSIA 3UJ6A 2CXPA 3IAEA 1OHHD 4DNOA 1V41E 2LKCA 3V5NA 2LUOA 3QEBZ 1D1PA 2BN4A 2P2CA 3MWEB 4ZCRA 5C7IO 4WFKA 3EH1A 4QT4A 1PU2A 4YJFA 2C54A 5A0FA 3DHVA 3ISVA 4ERNA 3CZMA 4FLFA 4RHYA 5ERYA 1ODTC 3DSRA 2ZM6B 4UUAA 2GOYA 3GN1A 2R0QC 4K86A 1NXOA 2OHHA 3PQ4A 3BAZA 2I3AA 4IGEA 1V11A 5K9ZA 3W4JA 2LWIA 4XX0A 5HEKA 3AILA 4D46A 3G5UA 3JTEA 1LC3A 2BM9A 2Q3DA 2EL9A 4BFVA 3LXUX 4OHBA 1O97D 5HCNA 2M6SA 1KJIA 5JG7A 4OLHA 3KP1A 4DQVA 1ESZA 1GRQA 1NI4B 1NBMD 1YIOA 1XALA 1MRZA 1HFJA 1UJBA 3GLRA 3Q6IA 3OICA 3C3KA 3OSUA 4WKGA 1D4ZA 1NJ8A 4CVNA 2B7BA 1AKQA 2UYOA 1BHJA 3LCVB 4BWVA 1W0JA 4LGCA 4DWVA 4OU5A 1MO6A 1A7KA 2GTHA 3KQLA 4UOEA 4OGFA 4J7UA 2V58A 4XX1A 5FBVB 3NBYC 5CH3A 2WTXA 3JSAA 4MW5A 3G79A 4K3VA 2DBVO 4UM9B 2Y1OA 3P52A 3L6BA 1BO6A 2XWQA 1GT91 3IJPA 4U6SA 5F1YA 5TMEA 3QJGA 4EHIA 4URXR 1QK5A 3H8VA 1E9FA 5IZ4A 2VRBA 4Z1MA 1OYWA 1UEJA 2CLKB 3OOJA 4FYHA 4WCFA 2EJTA 1Q1EA 1KDZA 4E5SA 3UJ8A 1JFTA 5ELXA 3H0KA 2XI4A 3IGFA 4FYPA 3VUFA 2WUFA 4E6PA 2XDYA 4TTIA 2VTVA 4I4NA 1P0MA 4TYQA 4C3OB 1D1TA 1I6WA 4H6XA 4TXMA 4HG2A 1TX4B 2A59A 4WXHA 1RU3A 1DCKA 1X94A 2Q5FA 4O4LA 3ZDYB 3HFSA 1O94D 2P67A 4Q9LA 3UJCA 3MYRA 5FL7A 3DE0X 3OX2A 2J45A 4ND8B 1Z6XA 2RGGA 1VA4A 1GLGA 3BD8A 3MLBA 1XYYA 4PXSA 5DSZA 4KRXA 1KTVA 3C5EA 3BXOA 5CDUA 3CZAA 4MUFA 3ZZ0A 2P9GA 1TM3E 3RS9A 1D0SA 3IBGA 4C6RA 5KZMB 4HLNA 2DM6A 4X3OA 2LIPA 4X8LA 5CJ2A 4OLFA 3VGJA 1CP3A 4MB2A 2NUPA 3VDQA 5KKAA 1X14A 2XPCA 4DV1B 4EH1A 5AKEA 2MSEB 2YYAA 3IKLA 5EQFA 4ZZ0A 4PY2A 4MIOA 1TQ2A 3FX2A 1WZCA 2D3WA 1R88A 2BAGA 3P0IA 5J4YA 5ENDA 4IEIA 4ES6A 1RYDA 2J85A 2PLNA 2GAIA 4S35A 3TTYA 3II6X 4YCAA 4BNWA 4C0AC 1IEQA 1NVTA 3V1TC 3UJNA 3HV2A 1VMKA 1YQDA 2GAJA 4G0MA 3FTPA 2ZE5A 5HZMA 2V7WA 5E8JA 1BD4A 3HB1A 5EMJA 1V1RA 2TMDA 3LL4A 5HFNA 3L0SA 1B23P 1TM1E 1PR6A 1U3WA 1V47A 1VRVA 2QAGC 2YN0A 3GRAA 3MELA 1PBNA 5EINA 4QHSA 4DR1B 3A1UA 3S55A 3ZJ4A 3NEJA 5CFPA 3AI3A 3FVTA 2HRRA 3MEQA 4OSEA 1ZM4A 4C4OA 5DHSA 1KHTA 2WD7A 2GN1A 2WTNA 1WQ3A 2ASEA 1YS4A 3AG5A 3D8SA 3GRRA 4CQNA 3EQ9A 4OLBA 3QBVA 4ZVUA 5BVHB 1XN4A 3B9PA 2P0EA 2PGOA 1FDWA 1R4NB 1VJTA 2DC1A 4GBED 1B8UA 4U6NA 3RJ5A 1EDZA 3OTHA 2UZ4A 1S2MA 2C4TA 4GECA 4AFNA 2OR3A 2D0OB 4JJKA 4XAQA 2FN4A 1QG4A 3RJZA 3B13B 1ISPA 3EVNA 4HDOB 3K6JA 2AUNA 3IOBA 1BRTA 2JGFA 2ARKA 3A32A 1XBTA 3O0TA 3OE7D 4JC5A 4Z9BA 4KR9A 2FEPA 4PO8A 4W7HA 1D0VA 5ANRB 4B5KA 4EHJA 5IJ9B 3STHA 2P91A 4TLEA 2AF3C 2AXNA 1QHEA 2LDXA 3KZVA 1E9DA 3V55A 4BTLA 1B0UA 5CPFA 4ENWA 4FYVA 1QCDA 3U40A 4JT8A 4LYEA 4HMPA 3NWEA 2ODEA 2ABWA 3C8UA 3L1JA 1QWOA 1D2NA 3KYJB 3B20A 4OH7A 1UEXC 5FWNA 4GM0A 1LS1A 1QYWA 1UINA 4QPNA 1XZ8A 4XJSA 2HEGA 4PZPA 2B1GA 1EX6A 3MCTA 4K2AA 4KKVA 1GL7A 4N5LA 4MS4B 5D3KA 3N0RA 4L6CA 2G70A 3DLPX 4BX0A 2CXQA 2OHOA 1EDEA 3MW8A 2OXTA 4X6XA 4ICIA 1LY1A 3VU9A 1H2HA 2ZUVA 3UNXA 4ZI3A 3G8BA 5FFNA 5C7OO 1CHDA 4C04A 1OU0A 4X90A 3IB6A 3IR6A 5JWRA 3VYUB 2K87A 3HKBB 1U2QA 1XQ1A 4DBZA 4F6RB 4CN9A 2CBGA 4X1YA 3HXTA 3ND6A 3G0IA 3BERA 1G20E 1N9GA 2E3JA 3FYUB 4HSGA 4ZI7A 2D1FA 2OLEA 5ALZA 4R2HA 1ODJA 2BBOA 3L1VA 3EAFA 3QF7A 5EMKA 2Z04A 4JFAA 1OWPA 1QK4A 2V96A 1PFUA 1VE3A 2PVPA 3B3AA 3B7WA 2ICAA 3L8GA 4G1FA 4LBVA 1F60A 1Y7IA 2R85A 2Q5HA 4ZHQB 3L6RA 1R1DA 5LZ9A 2JKVA 4HFMA 5AWFC 1V71A 5IRCD 3RGWS 2FUKA 2RE8A 1JNXX 3KDSE 3QOWA 1FRNA 4JI3B 1D9XA 4RNCA 2HL6A 4KVFA 3S2ZA 2OORA 4RX1A 5B30A 2ZZKA 4MP6A 3DM9B 1AJEA 1MX3A 2FV8A 2JLAA 1RXCA 1EGQA 1U7OA 3J80A 3PUVA 1YS7A 1BVYF 4GS5A 1UBFA 3UEOA 4Q3EA 1EWRA 1DV1A 2CXOA 3AW8A 3FRJA 4E7OA 2Q6LA 5JXWA 4D82A 3HK2A 2Z56A 4L4YA 5BN5B 3SHVA 1JDJA 4L9RA 5EXPA 1S7GA 1XK7A 2GTIA 5K8UA 1KJQA 4G23A 1HDGO 2OGZA 3OECA 1DQYA 1KL7A 1R18A 2XRFA 5SZHB 4MO9A 3TSWA 1T1JA 3GJQA 5AI8A 4WZBB 1DX6A 3CW8X 3PKIA 5I9MA 3EFBA 4YRNA 5AESA 5EGNA 5A6SA 4HDSA 5DI9A 1V2HE 1CNEA 1QKJA 3VZSA 1V3VA 2D74A 2OD9A 1C4OA 2A1TR 3ESAA 3FOWA 2AVNA 1NT4A 5BOSB 2GBFA 5KU1A 1AN9A 3I30X 2Z9DA 4RPGA 2LKDA 4WZBE 2O2SA 3VYSB 1SKMA 4RL6A 3V8MA 5KYYA 1N36B 3QQ5A 2WZQA 2Y68A 3N53A 3Q5EA 5DW3A 2EYQA 2HHCA 3K1AB 4PSVA 3DONA 5J3JA 2XODA 4B9EA 4CI0B 1CUZA 4CQJA 3GU3A 4GOKA 2CHUA 1NKVA 4B75A 1PWYE 1T3LA 3DBVO 1QHNA 1YB7A 1L7OA 3WKCA 1TIKA 3A70A 4FYYA 2OA0A 5EIBD 1FS4A 3AVYA 3T5MA 3C41J 5EZ6B 3R0ZA 1IONA 4AZ3A 4EA6A 5IPFA 4GBGA 3JATA 3O21A 2VJNA 1JDBB 5LCXA 4ZGBA 4EGCB 2DETA 1Q7CA 1EM6A 4QPCA 1HE1C 1G3UA 3ZBQA 3EGDB 1PJAA 2DWUA 1VCHA 2V0NA 1K6XA 2VP9A 4B3GA 2P9ZA 2QTAA 1ZHHA 3MIZA 1I9GA 2QK4A 4C7JA 5EPUA 4FEAA 5GONA 1GNRA 2WYHA 3CUVA 4DCJA 3UN1A 1E2LA 2O57A 5FUXA 3FNGA 3UQZA 3W5UA 5JNUA 1T36A 5JD3A 1AE1A 2C07A 3IELA 4G1BA 4Q3CA 3ICWA 1A0OA 3L01A 4E2XA 3ZNPA 1NI3A 2BC9A 1YVRA 1XCPA 2JKYA 4MPDA 2XTZA 2JVIA 3JQPA 4LNUA 2OC9A 1ODFA 1K8QA 1P0CA 1ISFA 4D3ZA 4EX6A 4RTJA 2X8JB 4LNHA 5ICFA 1JMVA 4D0SA 1I4LD 3OHPA 4Q7MB 3QPWA 2VXYA 2O3TA 3RT1A 2CCGA 3NOVA 2ZYVX 4K26A 2OCPA 1EBBA 4U2BA 2NZ8A 1IUKA 1JJAA 1ZH8A 3AQIA 4ZV7A 2J9YB 5KNDD 3T3OA 4ZANA 3K9GA 4O63O 1XHFA 3QUBA 3VTFA 2YWGA 4RTLA 2NZXA 1UDAA 2EBUA 4ITVA 5EHXA 4BNYA 2QL5A 3WQBA 1EBUA 1NXTA 2XE6A 1IZ7A 2BKVA 1B2RA 1CUBA 4TSRA 3MGAA 3CB2A 2FXVA 4I1YA 3ZE7A 1OV4A 4HWRA 3H9EO 1V6AA 1E63A 1OXUA 4KRGA 4QQKA 3QK7A 4DMCA 3G17A 4OKIA 1GKIA 3NIDB 1KAOA 3EH2A 4FOOA 1DX4A 4UZEA 3ZWQA 3TQOA 3DWFA 2HA6A 5FPQA 4CETA 1EK2A 2ZP1A 3HXLA 3RAPR 4ZXPA 3BC1A 1WX1A 1ZKMA 1RABA 1TPZA 2II6A 2WSYB 1M0TA 4IDCA 2F6RA 4LJ7A 5DOZA 1JKIA 5TPWA 4TYNA 1T5SA 2H59A 1UEIA 1P1FA 1QYVA 1JBQA 5FUVA 1D07A 5KX5A 7MHTA 3AR3A 1XI2A 3FMFA 5EIXA 1J56A 1PCXA 1P31A 1TCBA 4DIEA 4AJJA 1FFXA 2FETA 5KYNA 5KC9A 3PNYA 3QU5A 2QNRA 4ISBA 2UXBB 3CG0A 3HHEA 5D87A 5AP9A 3ESYA 3RHZA 3KZCA 2I3ZA 4Q4AB 5G1NA 2WJ4A 1JPNA 1DRUA 3R2JA 1XTBA 3HG7A 4RHUA 4EBBA 1EUZA 1QP7A 1YRBA 1OQAA 3EY9A 5M3BA 1BH6A 4R4JA 2HA0A 4X41A 1EFKA 2A0WA 5JPCA 1HBJA 1X19A 2IYNA 4M0PA 4ZAXA 1LPMA 1TAUA 2VNIA 3ELYA 3T5GA 3OP4A 3LT5A 4NF2A 3JWHA 4QA9A 1WMBA 4KSCA 4KNWA 3NTXA 3W8DA 1A71A 2EP7A 2Y1GA 3NHRA 3GEMA 1UANA 4JK3A 1SM4A 3JY6A 1SC3A 4S1VA 4NI5A 4GBMA 2XYVA 1ISGA 5G1PA 1L6RA 1LNSA 2GSWA 2YOGA 2J5XA 2C3OA 3FLAA 3CUTA 2LPMA 2EZTA 3AF4A 3FPKA 3PLRA 2LNDA 2ZDGA 3W5DA 5IG2A 3I9NA 3OMWA 1AGXA 1JUDA 4FHCA 2AIRA 3F9IA 1ZOIA 3K0HA 4Z53A 3O4VA 4HP8A 4DMRA 4ND5A 5KYUA 1TCVA 1TD9A 4R84A 4XTRA 5C52B 1NT2A 1JA1A 3AUTA 1H6BA 3I39X 4TTRA 2X9LA 5GOTA 3BZBA 1RLOA 4F60A 1SWWA 1XTKA 4BFUA 2P6PA 2G36A 4WESB 1BEUB 1JIXA 2AK3A 4OQZA 5LYYA 1QBKC 4M38A 2FSIA 2QN2A 5AK0A 2CJXA 3SYLA 4JNCA 5K8LA 4TV8F 1PV2A 2G67A 1L5OA 5KDOA 3V4OA 2XQFA 4M1QA 2WTUA 3HDHA 3ZWDA 1AIPA 2X8JA 5DX1A 1JXAA 4BBZA 1DC6A 2JGIA 3IIJA 1ANKA 2HU5A 3DNPA 5JY6A 3TBFA 1VMEA 2ZTMA 4XGIA 2ZBRA 5EJAA 2G1KA 4QXAA 5C18A 1M1ZA 3ABRB 1Y9ZA 1WQ4A 2EFGA 3EIOA 4KSYA 4WX2B 4LZLA 2PFSA 4PFJA 1G5QA 1UJ2A 4WXMA 1YE5A 2I4IA 1EK0A 3C6YA 3RE1A 3ZHXA 1NM5A 5TNXA 1EHYA 3IURA 2GFHA 3IUMA 3H75A 2NSJA 4MWEA 5IYZA 4FVTA 2J3MA 2JFXA 2ZR7A 3AVPA 2R5FA 2P79A 1E2DA 4J1TA 2KBEA 2NU9A 3OEED 4YCMA 3DFIA 2D4HA 3S2SA 5BQFA 2BMDA 2WAYA 4I55A 1M34E 1NV8A 1E9SA 3V1UA 2BMWA 2ORVA 3SJCA 4NAHA 5D7BA 3AT1A 3L4BC 4AY2A 1N0UA 2XDQB 3RAJA 1PP4A 2ZTHA 3TZLA 2R66A 1MDFA 1ZD3A 2JGKA 2P2ZA 1FLAA 3PXEA 1YKSA 1YUMA 3OIWA 2ORIA 4O2LA 4GLOA 2OBLA 2F8MA 2AT1A 4PC7A 4TRNA 2IDZA 4XCVA 2Q27A 3A7DA 4AUNA 1IK6A 4CL2A 3D7SA 4YRJA 4F86A 1VQ1A 2NO7A 1ULTA 2QM8A 1R0RE 2QTZA 4UPEA 4JZYA 5E7MA 1L5SA 1SPBS 2IOHA 2WUDA 2IODA 1EUDA 2EAUA 5CXXA 3IE2A 3MYYA 1VGVA 1ZJ4A 5EGSA 1Y1LA 3L0PA 3V8VA 1VOTA 3G2LA 1WXDA 2B9VA 5MFZA 5A71A 2QG4A 2Y9MB 3A1CA 4H3SA 1CZUA 5ALYA 4A91A 4FI3F 4W99A 5I9IA 4R8MA 2EJVA 1UAYA 1ZGZA 2D7CA 4FK8A 2ONZA 4BQPA 5CLGA 1ZRMA 3GCZA 3NBMA 4H4CA 4F2PA 2WK1A 1Z36A 4BN4A 4RYLA 4UM8B 5CYGA 5B1IA 4PIVA 3TNJA 2VPYA 4FX5A 1ZGCA 1QGDA 3RJMA 3UATA 4B87A 3KQVA 5CVVA 3VHQA 2Q7DA 3BJEA 3WNVA 1KEWA 3L7JA 3PDJA 3EG5A 3UICA 1MABA 3QLUC 2WIAA 4EG4A 1FNBA 3Q98A 1WAMA 4CMCA 1U5AA 4WEOA 5JISA 3C3WA 5D3QA 1YOBA 3UMFA 2CT8A 5A2QA 3B89A 4C3UA 5C37A 2HK8A 4Y2JA 3JQGB 5IJ0B 4WK4B 2HYIC 2EEZA 3QOYA 3C3XA 3RSCA 2BFBA 2IJGX 3V3TA 2PJUA 2A9JA 2PTHA 1BRMA 4OXQA 4U2CA 3U39A 3WDMA 4B2YA 1FUKA 2ADOA 1OXVA 3ANTA 1FVFA 1A5AB 1TTHA 1V8FA 2QD3A 3DBOB 1DG3A 3JX9A 3LIPA 2RHMA 3QBDA 5KYKA 3C43A 1NSYA 3GVIA 3OWXA 2FHSA 1WBJB 1T91A 3IVRA 1PL7A 4KWHA 3EMKA 3ED1A 4S12A 5HPYB 3NIWA 1FYWA 1WTCA 3PL1A 2ZBGA 4UCFA 1Z4MA 4MUKA 2IZ7A 4HRVA 4RDIA 5FO0A 4PG8A 1CW2B 1ZKDA 1DBPA 1P2VA 2XHZA 3CGWA 4F4CA 3B6ZA 1RMTA 1IUOA 2FA9A 2JNWA 2LVBA 4M0LA 1RRKA 3R6LA 5CB8A 1T4GA 4N3AA 1QC5B 1P29A 2P27A 1VB3A 4UUOA 3BICA 3UMVA 1EXWA 5IT5A 2R97A 4O33A 4I0WB 1JH9A 5ESDA 2PMCA 1SCKA 3A4VA 4G8DA 3O90A 3ED5A 4EFNA 4J03A 4E5YA 2HUNA 4UDNA 4ZDJA 1L7QA 3GEHA 4HN4B 3NHAA 4JB2A 3EDCA 4NDAA 3U3JA 4BDTA 3KKLA 4CNQA 4GYKA 1E2HA 3KQUA 2A5LA 4TN5A 1M2OA 2HO4A 4A6PA 1ZNZA 5EYPA 3OC0A 4NXMB 1G2PA 5F4ZA 3DNFA 3KVRA 4IXWA 1R8QA 2WIDA 1QFZA 5D3ZA 5IP5A 2W2OA 5EQTA 4UTRA 1ZMOA 2CJYA 5A02A 3GLIA 3PSAA 4UHKA 5FLKA 1OF1A 2PX3A 1BJKA 4HNAA 1C8KA 3PGA1 1P2TA 1ZRSA 2H2WA 1ZP6A 1Z29A 2XQJA 3BRWD 1T15A 2R79A 3PC3A 4OUKX 5LQCA 3SP1A 4P2BA 4OHZA 4LXTA 2BI8A 2XXAA 2AQIA 1QFMA 1TGYA 2JVJA 2BEVA 2XA1A 3EGCA 3TVYA 1GVNB 2IS2A 3O8RA 2DCUA 3K9HA 4RH0A 1VLLA 3QMVA 3TFWA 5M5BA 2C88A 3DDNA 3UANA 3OURA 1A8HA 1FYXA 3HVKA 4JU8A 3PQ5A 1WSBA 3AJEA 4O4HA 2R8EA 1XRLA 3IXLA 1UM9A 4WRRA 4YP0A 3L7AA 5HRAA 2N0SA 2W0SA 3BULA 4QJ3A 1OLXB 1YB2A 3I0ZA 2G6TA 3IBFA 3AC0A 3TLYA 2DR2A 4ZYWA 2FR0A 2WVGA 5FOTA 4JI7B 2OEPA 2FNAA 2QD1A 3KCNA 1G6Q1 2FN3A 3PCTA 5DK4A 5C1PA 2XNDD 1N2ZA 2QSYA 4PM4A 4UAVA 4XWKA 1DJOA 1I4WA 2IZZA 3IAS6 4QC2A 4EHLA 2Z6QA 1L8OA 1ZQ9A 5K0EA 1RWKA 3PGMA 4P4LA 2QRJA 5ECDA 4ND1A 1L5HA 3GROA 3KLNA 1ECJA 1PSZA 3N70A 2Y77A 3NHZA 2O9JA 3URMA 4CIWA 3C3JA 1I3CA 1O9BA 4JC4A 4EG0A 1KO4A 1U63A 2IUFA 2FG5A 1ZIDA 2HMSA 4GZ6A 1U0OC 2H31A 4KQEA 3WRWA 5BUZA 3O4JA 5KKNB 1T1GA 1E2MA 1Z83A 4KEAA 5F21A 4P0PB 1F1BA 1UFRA 4JYMA 3IX7A 1JL3A 3F5QA 4DUPA 2P7HA 4NAUA 3IDZA 2QRKA 2VCEA 4PGFA 1PD0A 1VKNA 2DTDA 3R74A 4ZC1A 3RSOA 4HF7A 2JIPA 3UA4A 1GCGA 3V1MA 3W79A 3EZYA 5TC4A 2BPOA 4REOA 5DU2A 3U17A 5FWYA 3CQ9A 1FZTA 1SUPA 1BHO1 2JJYA 1HKHA 1M1NA 2I33A 2PWBA 4YUVA 4NZNA 2EW1A 4AKSA 4H1HA 4M8NE 1JN0A 1QAOA 1XR3A 1KFCB 3C1AA 4EAAA 4FHFA 1JR3E 3NTLA 1GRRA 1O0BA 4Q1CA 3M5CA 1FTQA 1YS6A 3U49A 1ISJA 4XEHA 3SC4A 1B14A 1WB5A 1Y9DA 1Q6YA 3IT3A 2ES4A 3R6GA 1J0XO 4IV8A 4KXWA 4ALNA 1VA5A 2JZCA 4C9BA 4JITA 3IILA 3JZMA 3KXPA 2GO1A 2WTMA 3HI4A 3Q0EA 2WY2D 4HB0A 3WTBA 3RKRA 2IKQA 3RAGA 3GNQA 1NF8A 1FB5A 4XVHA 5C53B 4URFA 5TMPA 2P2DA 2QE6A 3Q1LA 1KVRA 1QH1B 3TLCA 3BMCB 1NHWA 5EIHA 4A0RA 1E79D 4QUJA 2FF5A 4V24A 3T3DA 4BU0A 3P94A 1E4VA 5FBZA 1ZINA 2X0JA 3L2OB 3SYNA 4HH1A 1AGYA 4BQEA 4OHMA 4RM2A 4D92A 2WMDA 5AM5A 4BXOA 2ONCA 3E8MA 1Z4JA 4HZUB 8GPBA 2Q8NA 4RMJA 3UHAA 1JG1A 3EIFA 4YCBA 3ETLA 3IV7A 5K0JA 3EVCA 1JECA 1T1SA 2JIQA 3S2UA 6AT1A 1BX0A 2QLLA 4NESA 3DHNA 2WA2A 1DTEA 3N0TA 4QWMA 1GAJA 3IUQA 2VLIA 5KPJA 1MVOA 4KO1S 1AQNA 3T0GA 2QGZA 3ZQUA 4F04A 4JHXA 2HQ1A 3U44A 1T9BA 2EXXA 1WKVA 1ZJYA 2W83A 2XDAA 1WMFA 4OG2A 2P6NA 3FRIA 1S2NA 4URZR 1IC6A 3WV5A 2O50A 2WB4A 1D3AA 4FILA 1EFLA 5L7YA 2A9VA 1UZLA 5KQRA 1IN1A 1PEYA 2C3PA 4KI0A 4YXWA 1UKEA 4BQOA 2YYSA 1FJXA 3BRSA 3CCCA 5FH9A 4F3CA 5C2JB 2ATVA 3ZDQA 5DF1A 2BIFA 3JW8A 4U2FA 1FNMA 2DBQA 2FPOA 4TWAA 2H00A 3S1LA 1LDYA 3U7IA 3MRXA 4PNEA 3RUCA 2O5EA 3F5DA 3VHRA 2UZ0A 2AFVA 2PZLA 2VHYA 1ZR4A 1WU8A 2UAGA 4JL6A 1JIUA 1QPZA 4WFQA 3DE5X 4Y2RA 4CKCA 4DWOA 1QQ7A 2IVZA 4MO2A 3ZZNA 1T8UA 3CVUA 3CW9A 4V0RA 1BAPA 2FZEA 3O8BA 3HY6A 3K5IA 3ZDCA 2E9SA 4S24A 4TOIA 3OKFA 1GUBA 4TRRA 5KJ1A 5C5EA 4YCLA 4TQGA 4XWTA 3I1FA 1CBUA 4H9GA 4NFHA 4RBNA 4ZAVA 5K4GA 2YXBA 2PWZA 2ZS7A 1TUBB 4LXQA 2AJTA 2Y4NA 5SY9A 3TTUA 1IN8A 1EJ6A 4WH0A 5JNWA 4P84A 2FW7A 1JIKA 4I14A 3GPIA 3JPWA 4QYWA 3RRJA 1IWBB 2FSGA 3A3NA 3JR3A 5AW6A 3O93A 5TQ0A 5LUBA 3ZYCA 2IS6A 5CX1B 5MHTA 5JZBA 3HU5A 4EUEA 2XIQA 1DPFA 4MVWA 1IBMB 1JHPA 3B60A 1HZJA 3EGIA 2W6QA 4JP1A 4KW7A 1TQ4A 3ZW8A 3CN7A 1JDZA 2CFRA 4QQFA 1NJ5A 2ZCVA 3WL6A 4C4TA 3B9QA 2ILTA 4TVOA 1D1QA 1GL6A 3E9YA 2V7VA 4EQ6A 3ETJA 4YH1A 5EXDA 5FADA 4W5NA 2VHVA 2CE2X 3IULA 4BMOB 1Y4ZA 2W93A 2YY5A 3N7TA 4ND3A 4OPMA 2XQVA 1Y3CE 3GGDA 4BGDA 3ER6A 5LL6P 4HB4A 4BB9A 3ZJUA 1TI7A 2ZVPX 3KKZA 1IUNA 1DQSA 4V0ME 1J1UA 4OKNA 4WN9A 1JZQA 3JARB 4X92A 5EJ5A 2H5EA 4W5OA 2J09A 5IAEA 3PC8C 1VJ5A 4JYBA 1ARZA 1W9MA 4LYDA 1AQUA 3G9ZA 3LGXA 4PZAA 3WLAA 4G4IA 4EJ6A 4X95A 3F2VA 3KOMA 4Y9TA 1YRHA 2YZ2A 4LXXA 4UBLA 3V8BA 4OKSA 3VC3A 1V6CA 4FKMA 5D3MB 1PI3A 4XCQA 5EPEA 5ALWA 4ETNA 3CONA 5IVKA 4FLMA 4KVZA 4UNIA 1N75A 2MYPA 5ALUA 3ZE0B 3GYGA 4HYTA 3TPCA 1N32B 2FQQA 2YN4A 1VSVA 3BXXA 3UW3A 2XF8A 4FSHA 3IEUA 4AAYA 1IY1A 4F91B 2YXEA 1XDDA 3KALA 3GVCA 2G4CA 5UKDA 4EHKA 1J97A 5GP1A 4ATNA 4TZ0A 1NC3A 2OO3A 3E27A 3EXHB 3IUPA 4LFAB 2VHQA 4DYDA 2CMDA 2XNDA 5D6OA 2WT4A 1Y8RA 4DFDA 1VLVA 1A04A 3C4QA 1UBRS 1SBQA 2GFQA 3L4EA 4N8EA 1ZHOA 2JC3A 5THQA 4UDYX 1NUPA 2CDAA 1B73A 2BJWA 2HQSA 3W6NA 4MWBA 1ZNQO 1S4MA 1JEAA 4P35A 3N5CA 4AIIA 1E1QA 3L06A 1U8ZA 1HV8A 3T7RA 2EGHA 2L82A 2WFMA 2GHTA 1A8SA 3QRWA 1UL1X 1T0IA 4F7WA 1DELA 1R50A 4O4IA 4B85A 1Z75A 3G2MA 4LJAA 2JJMA 4Q34A 1AUOA 4MUIA 3Q15C 1KEEB 4M9SA 4P33A 2GK4A 4BLTA 3HDTA 4BLWA 2IL1A 3JYPA 1W49A 2QNIA 3KSUA 3RS8A 3RUPA 4I1IA 1K75A 1WUIS 3UK2A 3N05A 1W5EA 1UR5A 3CYFA 3ESDA 2REBA 5E1DA 1I3OA 1B3BA 2QLMA 1AUQA 5KCZA 3E5RA 1CE8B 4BX9A 5FTLA 2WWFA 4CKCB 1VIVA 5U4XA 1X3SA 4DZZA 4FDAA 2C9ZA 2Q3JA 3QWAA 1KPGA 3ILSA 1D8AA 3CBGA 4NTZA 4WKOA 5CB6A 3KSDO 5LBUA 4AJEA 3H18A 5CFQA 2BEJA 4C4ZA 5AM2A 1X9GA 2VXBA 1VJ0A 5F7OA 3DV0B 1VYTA 3NM6B 3TLAA 1YZ3A 4ZN6A 3BEDA 1TM4E 2EBWA 1CY1A 5JH7B 1LV7A 3R7FA 2C9MA 3G2JA 4Q82A 2BUBA 1PR1A 4D2IA 2XEXA 3BCSA 1WXXA 1V8PA 3RRZA 3MAAC 1Y6RA 3WNZA 3AHFA 1VMAA 4EUFA 3QPBA 3UAZA 1KO8A 4R7TA 1UBCA 5LBTA 3ADDA 1LFAA 2ZE6A 4YMWA 2VWPA 4KFRA 1BZYA 2VQDA 1JHDA 4YTEA 4NJEB 5DHPA 4N12A 1FP1D 4O5OA 1ODCA 5DI3A 4QDUA 2GJKA 2PX8A 5CDFA 1DDGA 2BGNA 4MICA 4M22A 1E7RA 4I36A 3E1GA 4Z1MD 5HZKA 3QSYA 2FWPA 2MJLA 3FNHA 1KQPA 3UFXA 3GLHB 3VOAA 3MGKA 1H0KA 2IHUA 5EP1A 3WK8A 2WYWA 2QNBA 4LXUA 5CGZA 2H8GA 1T0HB 4YAUA 5KOJA 1OUMA 5JJBA 3CEAA 3DE7X 2G83A 3IPLA 2NTJA 3QHQA 1C9YA 3K09C 5CPBA 3W8FA 2GQ0A 3GNLA 4GI7A 4AF8A 1DAIA 4X94A 2VAXA 5ILGA 2R86A 4A27A 2IFTA 1QBGA 3VTKA 2H4XA 3NPAA 1TLLA 4L8FA 3LK7A 2C9CA 1T8RA 2PSFA 3C3BA 4LCEA 2KI5A 5LUAA 3HWWA 5LIRA 2WWWA 1ZICA 3R20A 3GZTB 1ZU4A 3KT6A 2OXIA 3PWKA 1M9NA 2G9UA 3BIJA 3OQOA 4HO1X 4C14A 5KS2A 5J63A 16PKA 2EBFX 2VHXA 4DDMA 5TPWB 1O08A 2YW2A 2I4MA 2X5NA 4LVNA 5HX7A 1PQWA 3OQ1A 5E3HA 1C1YA 1QP4A 1B41A 5BYKA 1GCOA 1P39A 1QM5A 1V3UA 2PZAA 4KMRA 3BHIA 4BLRA 1HI9A 5L3VA 2GAAA 3CEPB 3GT0A 2C3MA 3M1IA 1IAQA 1DKUA 4KTVE 4KQMA 3IT0A 3PEUA 4BTEA 4W5RA 4XQGA 5IM4A 1WSAA 2WYOA 3DAPA 3FOAA 4AKTA 2ERCA 4EKNB 2VSXA 1FXWA 4I99A 1IEVA 4HKTA 4HOYA 4JLDA 4QELA 3ZBPA 2RAPA 4EHAA 2B5OA 2JBAA 3A3PA 1H65A 3TLEA 3UT6A 1YUBA 1QGUA 3PC2A 4KE7A 1UMCA 2E1RA 2PGJA 3T9FA 1RYHA 1Q15A 1WF3A 2X22A 5LN1A 3SS7X 4UAJA 3Q5DA 2DUMA 1THMA 1TJ5A 1L4UA 1XKTA 4JLWA 4JQZA 1ORHA 5EE3A 1USIA 2PKRA 1L4HA 4R40A 5HKKA 1T1IA 2FF7A 2JCVA 2DVMA 1YR2A 2QD4A 3F78A 4M0DA 1IXRC 4M46A 3TM4A 2C2WA 3NWJA 1Q7BA 4TWZA 2GO7A 4IUBS 1IQRA 3A4TA 4MUAA 4QBTA 3NWBA 1T26A 2OM6A 1UPTA 2EVWX 3LQKA 3HC7A 3UC5A 3UPTA 1Z0JA 2EFYA 5FTMA 3WYBA 3ZH2A 1PUJA 2R96A 4F2DA 3QUQA 4BYMA 3ENZA 4ZIRA 1U3TA 2JIRA 3F8WA 3HB4X 1J8DA 3L1KA 4Z0HO 2LCFA 3RFFA 4L4UA 1RRMA 4AUMA 1WUHS 3G5MA 2WYIA 5EKUA 5L7TA 2GYYA 3NIGB 1XCMA 3H11B 4LJ6A 4NYMR 3I9OA 3N6RA 4QYSA 2PT6A 1P17A 2WMYA 1WP9A 5HKLA 5JQWA 2IZ5A 2N75A 2XZPA 4NE2A 2WR8A 3VAAA 2J41A 3TL3A 4WOCA 1W59A 4DTIA 2XMRA 1S3FA 2GAFA 3TLKA 1JEYB 4TL7A 4Q12A 5IDQA 1LK0A 2DPXA 2E4UA 3BREA 1NIJA 4JBHA 4MWGA 4EY7A 3T34A 2A14A 1EU1A 4IQGA 2HA2A 1E7WA 1WABA 1BHQ1 4N7MA 5KWSA 1ENYA 3IIMA 3P9YA 4FCVA 3GRUA 3DULA 3TZQA 1G21A 2ZUFA 4YI3A 1R5JA 1SUWA 2KHZA 1E2JA 3OFND 3STYA 1CEYA 2CFCA 2IYLD 3CIFA 2P4QA 3BTOA 3EUEA 2M6LA 3VVBA 3OEYA 2MR6A 3OLQA 1EZ1A 3U26A 1N8NA 4CCWA 1BQ4A 1ZL2A 3IRVA 5K0LA 2O4CA 2YINC 2L69A 3JYQA 1ISIA 1KGDA 2C0CA 1FFSA 4Z7OB 4AYWA 1ZXXA 3C6MA 4II2A 1QOZA 2CNKA 3PZRA 1M6HA 3BJIC 2A9RA 3Q3JB 4BQIA 3P2OA 4YV2A 4ETMA 9ABPA 1X2EA 4EY5A 5GZ1A 5C7LO 3QPUA 1A9PA 1Q22A 4RZQA 4UVGA 621PA 3ZD7A 1JEQB 1TM7E 5DWVA 421PA 1WCIA 3PNKA 1IY0A 3L02A 4GPAA 2NUAB 2B1JA 3RVMA 4HXYA 4A8TA 2LRHA 4HSEA 5KCMA 4DUYB 3KZMA 4D80A 3D3KA 4FR0A 3LGSA 4AECA 4Q3AA 2E4VA 3ZDXB 2DG2A 2XGMA 3E0XA 3WWEA 1K3FA 1R8XA 2PGLA 2J0UB 4TKLA 2A4MA 1KWGA 1USWA 3L8DA 4BVLA 5LJLA 2HJRA 3UKOA 1MDBA 1U1EA 1E3MA 1DKQA 5DIFA 4W1QA 1E8DA 4D4IA 3BRCA 1ORWA 4FXPA 3U7RA 4AS3A 2EP8A 4AS2A 3ZGOA 3LX4A 3KQOA 5CLJA 3A1FA 1I7SB 3RPEA 1VKHA 4GR4A 1T0PA 1IYZA 4FQ8A 2GCOA 4LXHA 4DBLC 3QY9A 4BFCA 1QB7A 2RB5A 4IMIB 4EGQA 3UXEA 2C9BA 2BMVA 4EATA 3HZRA 4JQCA 1ZSNA 3CX6A 3WIUA 3EPJA 2NNLD 1RBZA 2K6GA 1OLSA 3L79A 3P0RA 4RH3A 4Y6LA 3TL2A 3V2IA 3V8PA 3M6FA 1UQTA 3NCHA 3ZQJA 3NUZA 1NN3A 4ZODA 3P27A 3BXPA 1JG7A 2Z8XA 2A67A 3LYAA 4KGDA 5FUQA 1AKTA 1GGJA 2QS9A 4JAVC 3FYUA 1XLUA 3NDPA 3PNPA 3ILHA 4JEMA 2FPUA 1RZUA 4OHVA 5DCYA 4G0QA 4GW3A 4MVJF 4JS0A 3UC9A 3H1TA 3KJGA 4J0DA 3QU9A 3I5AA 5CT6A 1STOA 3E9DA 4YRFA 2PRIA 3AFIA 4KZKA 1ONOA 4RFLA 1GDDA 4QEZA 5JU6A 1MN6A 1Y98A 1N2IA 4BUCA 4RGBA 3AOGA 3IE0A 2WJ6A 4NHOA 2E82A 3Q3VA 4IWNA 3X1XA 2VTKA 3FWZA 1U65A 2W2KA 4IGFA 1VYHA 4ZAWA 5GY7A 2O3UA 3LA6A 1FVXA 1B6GA 5ERXA 3H83A 1VBMA 2A7QA 4TT3A 5DI3B 5TQ2B 1SOWA 5E95A 4XW2A 4A73A 1L6IA 1UIMA 4AWXA 1G3IA 3MTDA 3JQDA 2QL7A 2FGKA 4TMXA 1ULAA 2A84A 4DMGA 4FNOA 1DAEA 5DM1A 1W4RA 3SLGA 5MN6A 1AKVA 1UPAA 2R751 4WJZA 3OT1B 1XEXB 3RABA 2PIDA 1AHNA 3OTGA 1ZC3A 1VJGA 3LBYA 1JAHA 3S5JA 4RAOA 1BMDA 3UMRA 5AYVA 2AG1A 4YAOA 3MMZA 1Y63A 4RSRA 5JH7A 3HJFA 4HX2A 5BSEA 1NXPA 3CMCO 4BEWA 4BB5A 1XV5A 1CZNA 4B80A 3LMKA 5K6AC 4MS4A 1EWTA 1KU6A 5DHAA 5BVHA 2GEUA 4YRRA 1ZVVA 5IDWA 3OCXA 2RKWA 3GMSA 3DMYA 5CA1A 4MAAA 5H8WA 4KV9A 4C0LA 3BN3A 3SC2B 1M2NA 4C0XA 4YRPA 4AP5A 1GSOA 4RVNA 5I4CA 1JYEA 4JR0A 3VSEA 3I3OA 2QW0X 4WLFA 2P2NA 1JQAA 1I32A 3ZWXA 4P0QB 4ZA2A 3F7NA 1OIXA 2DF8A 3L43A 4KLRA 1XNJA 3SYMA 4KQGA 1KK2A 4R0NA 4DANA 5FTJA 1NR1A 3FFXA 3ISJA 4RC9A 4MW9A 2Z3VA 2BR3A 5DHQA 1NOIA 1N77A 1SAYA 1SG0A 1DBRA 4YRKA 2OGSA 1H0RA 1T9HA 1YIDA 1YNOA 2CMHA 3A6FA 3H3JA 3U4CA 1PZGA 4ER5A 3HVRA 3GD5A 5GM1A 1SEVA 1YHYA 1L4YA 4MYSA 2IYYA 4UTZA 2HWYA 4ZMRA 5LDDC 5I9TA 2HH9A 1W1UA 1RYNA 2WHRA 2Z08A 4H31A 1AA9A 5D86A 1YJQA 4LDQA 5HS6A 3ZNQA 3BF7A 3ZWAA 3OJ0A 1EVLA 5L3RA 4BKOA 1NUTA 3GLFE 5IXJA 2HDNB 4DMLA 1W5FA 1SBHA 3CE9A 4BFWA 5KPDA 1MZVA 4L5IA 3BRQA 3NV7A 1DZ3A 2VPQA 3GEEA 3VI3B 3DW1X 1L8QA 2XZOA 4L8WB 1GLVA 3DTVA 2PH1A 4WESA 3NNDA 3C7KA 4Q03A 3PVSA 1B76A 1OILA 4MRAA 5L6MB 4B74A 3FDJA 3LC2O 5BRAA 1X13A 1Z5NA 2PRZA 3N2YA 2QTTA 1SXJA 4ZVSA 1P0QA 1U81A 2A1UB 2ATCA 1QIHA 1DBVO 1W48A 4GOJA 4MYDA 1BFKA 4A2WA 4DBVO 4DS3A 5JYBA 2XVXA 4EAQA 4MGHA 1QHYA 5A7FA 3VZRA 2F8SA 4ZZIA 4BNLA 4CIDA 3UJDA 5CIQA 2GHQA 2K7ZA 2OBMA 3A2LA 3VOTA 3ZD9A 1QNLA 1WXEA 1JZSA 2LIVA 5A0VA 4LA4A 1RC1A 3WKBA 2JZNA 3NWPA 3U4GA 3SFVA 2WMOB 4P5DA 1DCMA 1IAVA 4GYYA 4JJEA 1N3LA 4B84A 1SD5A 3E6AA 1FU4A 5CH5A 4U0KA 1W5BA 1XYVA 2AFIE 2ZDHA 3UJBA 2OCGA 4C88A 4IF4A 1JKJB 3TINA 3T1HB 5FFFA 2O19A 1NZFA 5BUQA 4HADA 3MJFA 4IDNA 4CKBA 1Y9JA 1KR2A 1SKQA 3D7MA 4FJ0A 4L73A 5HR5A 4ALJA 4YJ3F 2PG3A 5T3YA 4ZWNA 2NO4A 1REQB 2QPLA 4DDTA 1XZEA 2R9VA 1KR5A 2DSNA 4KE6A 5FOUA 1Z68A 3H6HA 4AO8A 4B17A 2BGWA 4OYYA 3H9QA 4GVLA 1U02A 1QVWA 2PRJA 1T29A 1CUIA 1A72A 3O9VA 1MZPA 1KY5A 5FD8A 2P90A 1BXRB 5LXTB 1Q14A 1TJ3A 2PS1A 3JARA 3MMNA 4KSBA 3GA7A 3R75A 4GZLA 5CXUA 1C50A 1EDOA 4DMHA 1YJBA 2GESA 4RAQA 1WB9A 3THYA 2FZVA 2H5LA 2EGGA 2YICA 1A2BA 1PK9A 3TIVA 1I2MA 1P0PA 1JB1A 1VE6A 2VEOA 1XP5A 1H1LB 3AQ4A 1SJ9A 3KZOA 1LBSA 4DZRA 5K45A 2JIBA 3EZ9A 3MWJA 5EKSA 4QYTA 3VO8A 5JS7A 3UIEA 1IXKA 1J09A 2OENG 4X8HA 1C3VA 2AG0A 3VYRB 2V5AA 4ZI5A 4BO7A 1E9BA 1RAHA 2O06A 4G4GA 4GPD1 1KH3A 3QTLA 5KQLA 4MV1A 3IUJA 4CFSA 3RIEA 1IN4A 1ETUA 1ZC4A 1Z15A 2VHWA 3K7EA 3MAJA 5C5CA 5CFNA 1C30A 1G21E 4IJUA 4JQOA 2Q4RA 3P2JA 3WNDA 4BVFA 1E9AA 2MSDB 2WJVA 4MQFA 1TYZA 3LJKA 1KMNA 4HTFB 2CLEB 1HE4A 3FYCA 3ITDA 2Z9CA 3LC1O 4MRMA 1DJPA 4YWJA 2QGNA 3DZFA 4PRYA 4ZYXA 1SCUB 2B94A 3CPSA 5C1DA 2JI4A 5J2UB 4B8WA 5JH7F 1YTUA 2HI0A 3SQDA 4A8PA 3P9SA 2DFVA 2FPSA 4WTOA 4F1WA 3MT0A 2GMWA 2OE2A 5CB4B 1U9IA 3OZGA 4GE0A 4YRSA 1WD5A 1Z0UA 2KX7A 3MD0A 2BFWA 4UHCA 4R8RA 2DLNA 3L8MA 4KITB 2GWRA 1GQOA 3B12A 3A4YA 721PA 4OGWA 3TW0A 3AB8A 2GNAA 3PI7A 1AN0A 3E2IA 3IEVA 4QXOA 3R7SA 3C5CA 4RFSB 4GLFA 4R2WA 4MIYA 2OV2A 4GNRA 2QRPA 2YWBA 1GSHA 1WHSB 2XEDA 2GD6A 2VAWA 3C0KA 4RY2A 3I6BA 4B9AA 5CLQA 3KJZA 4DR7B 3VI4B 4GKKB 4DLAA 2YV4A 4DA7A 2QJWA 4H7HA 5AKHA 5DWQA 5DTJA 5KYXA 3LVFO 1CJUC 3IUSA 1Z26A 3QVTA 2O0MA 3N3BC 4DCOA 1ZSVA 4AMVA 1PGPA 1SOUA 4XD7D 2YFHA 3I9LA 3IQEA 3GT7A 2FPGB 1E5QA 1TKBA 3AK4A 3GX1A 3OTIA 3C6QA 3QXXA 1XQVA 5ELLA 3AFHA 4PHFA 3WTCA 2HT1A 2HV9A 4UPDA 2VUTA 5JECA 2O48X 3MM4A 2BGTA 5BV8A 1C4WA 3E9RA 4PF1A 2P4UA 2YVUA 4K9RA 2IEBA 5TY0A 5GIOE 3X1ZA 4ESVA 4OREX 1DRKA 2ZWPA 5TEWA 2J5KA 3GWZA 5K51A 1P1JA 4LUCA 1QHHA 4R6XA 5CFRA 3W8EA 3AUKA 4QYIB 1OT3A 2IXEA 2AWNA 2WUEA 3B1ZA 4HHEA 4UDOA 2ZB8A 4DCGA 4D9BA 5A4FS 5C80A 5DTQA 5IF9A 4IDAA 4XPIA 3K15A 3K96A 2B61A 3MJSA 1JDSA 1AMOA 3DLAA 3OA0A 3G7NA 3H2GA 4ND6A 4RE6A 5TS3A 3CH5A 1GEEA 3P9CA 4QOHA 3F67A 1G2QA 4Y9RA 1HC7A 2XT9A 4H1TA 5L3SB 4QRIA 5AM0A 3FJOA 2ZJFA 4C1BA 4IVNA 5A5FA 3N8IA 2ZIEA 2V3CC 3FN4A 4GWKA 1UKBA 1JKJA 1GL9B 2YWEA 6Q21A 1X8XA 1ES9A 1HDYA 3LRTA 5JAPA 4ZO7A 1OCEA 2GGSA 3DL2A 4UFNA 1MD9A 5FA8A 4YV7A 1Y5RA 4AY6A 1E3SA 3R44A 2G77B 3EPRA 2YXNA 4B43A 2HA7A 4MR9B 1ZUD1 3B52X 3MT9A 3EIWA 4DW8A 5KWIA 1BQEA 2Q4EA 3NYIA 3QVVA 4IS2A 4BFYA 3FPHA 4EY4A 4K05A 1DFGA 1UZNA 2CUNA 2FFBA 4L4SA 1F2VA 2I7TA 3USZA 3INTA 2GPBA 2ZSUA 3DMPA 5I7UA 3NR2A 1H4TA 3ZIAA 3M0EA 1QCCA 1KOJA 3SSMA 2BP7B 2Y0BA 2Q3MA 1HZZA 2YC4C 1DVRA 1WEKA 3DBRB 1ZFNA 2DHQA 2DMRA 3FKQA 1E3QA 1X7XA 3EVEA 3G5TA 4RV9A 2XNKA 1TVCA 1EUYA 4RVCA 5HFJA 3SXJA 3WRXA 4QXQA 2ACWA 2UVPA 3D64A 2JHFA 1SUSA 1G5RA 4IWYA 4J94A