3PQEA

Crystal structure of l-lactate dehydrogenase from bacillus subtilis with h171c mutation
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
NKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMGDVMDLNHGKAFAPQPVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFKGIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEYFGAAPQNVCAHIIGEHGDTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNAAYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNRGGIAGITELNLNEKEKEQFLHSAGVLKNILKPHFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of L-lactate dehydrogenase from Bacillus subtilis with H171C mutation
rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 110
structure length 314
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pqeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3pqeA02
4BNXA 5H82A 2VWPA 4QFCA 3F3SA 3RAJA 2QRJA 2VUTA 4PLWA 3VDQA 1YBVA 4Q3CA 4YT8A 3MTGA 1EVIA 1SC6A 4OM8A 2X5OA 3P19A 2VZ0A 1VE9A 5I9LA 3K9QO 3AI3A 3AW9A 3GC6A 2YY7A 3WMXA 3VKVA 2O23A 4WK6A 4DQVA 1UZMA 5BNFA 3GUYA 2GPTA 1HKUA 3LT1A 5DBGA 1NHGA 1DC3A 1N7HA 3GFGA 3PHGA 4ALMA 5BT9A 2NNLD 1AHIA 1ZUD1 4MVJD 5FI5A 5B37A 2X0NA 2R6JA 2VOJA 2ZTUA 4EEXA 3ENKA 5B1YA 2D5AA 3QWIA 2AMFA 3KB6A 3E8XA 3DHEA 4BGIA 4EZBA 3HB4X 4J4HA 5IXYA 3DMTC 5I8WA 2EW2A 1BDMA 2I3AA 5G0SA 2JJYA 1DRVA 3HDQA 3JQGA 4GKVA 3DHNA 5L7YA 4YCAA 3AM4A 3GGOA 2I99A 2VZ9A 3WGQA 1N2SA 1E7RA 3IL2A 3OBBA 2PKRA 4BS9A 4FGSA 2HRZA 2EWMA 3A4VA 1PQUA 4FFMA 4FCCA 1WNTA 1XQ6A 3PIDA 3SEFA 1LLUA 1DAOA 3M2TA 5JYDA 3U49A 1YOVA 4C7JA 3WR5A 3BTUA 2X1HA 4LCEA 5IDYA 3O26A 3VH3A 1OI7A 4LGVA 3WYCA 2IZ1A 1NPDA 4BGVA 5KTKA 4KDEA 1EDZA 5JAQA 3NDIA 3L6DA 3PGJA 3U9LA 3RU9A 2C5AA 2ZB7A 1T1SA 4RORA 4M1QA 1ISIA 1PL8A 2X5JO 3EMKA 4FS3A 1GL3A 3K5PA 4LCJA 4CMEA 4RF2A 2XAAA 3V2GA 2JCXA 2BGKA 3GGPA 3O38A 1P1FA 3EZYA 3K92A 3OQBA 4CMGA 1Y9EA 2PNFA 5TIIA 2HK8A 1MGOA 3ST7A 3OECA 2BFMA 1EDOA 2AEMA 4ZQHA 3PYLA 1SB9A 4TVOA 3KHUA 5IXSA 4B7XA 3DFZA 1P0CA 2ZIZA 3PVZA 2D2IA 1YH3A 4J43A 4K9DA 3DFUA 1ZSNA 3AY3A 1DFGA 2WE8A 3I52A 5DCYA 3UW3A 2D59A 2DU8A 3ZU3A 3Q9UA 2X7HA 3IIEA 4WCDA 2WJPA 1ZO8A 2ZB4A 4O0LA 1IHYA 2I65A 2D8AA 3ONEA 3PHLA 4MVJA 4FW8A 1U1IA 1Q1NA 1YB1A 4UVEA 1QV7A 3G17A 3OMLA 3WQSB 1WPQA 4ZD6A 3GNQA 4R9SA 2YYYA 3H7AA 4CLHA 1C0IA 3TL3A 4PLFA 4R16A 4Z9FA 1DIRA 1YQDA 1GV1A 2O7SA 4K28A 5AOVA 4E6PA 2PKQP 3VVBA 2X86A 5BSEA 1KYQA 1LLQA 1C1XB 2GF2A 3OIDA 3JQBA 1P9LA 3ZU5A 1KVRA 4Y67A 3ROMA 3WOHA 1GY8A 2PR2A 1E1NA 1ORRA 3TWOA 2PGDA 4F6CA 3AI2A 1NM5A 3JQDA 3ZH2A 3H5AA 3FCOA 4BO6A 4BNWA 5A4DA 2B37A 4DBZA 4XQCA 1ADBA 1C3VA 1LBEA 3VTFA 1NNUA 4B79A 4G2NA 3OQ1A 4BKQA 1PIWA 1YXMA 4H15A 1V9LA 3KTDA 3WTCA 4AJNA 4KTTE 2HUNA 3DZFA 2PTGA 4RZHA 3K73O 1LSJA 3ZV5A 3D4OA 4FC6A 5CDUA 5L40A 2CDCA 3HFGA 4NBUA 4Z0HO 1Z74A 3Q9NA 2HDHA 1Y1PA 1JA9A 2FY8A 5JMPA 1HE2A 4LVUA 4MIEA 3PQDA 3PXXA 2O3QA 3JQFA 3FHLA 1I32A 4HKTA 3WNVA 1XDWA 1UJMA 3EY4A 3O8QA 1QMGA 3D3EA 2VT3A 7MDHA 1UXKA 3FNGA 1U8FO 2O4UX 4TWRA 2IDZA 4D0RA 5IDXA 3KETA 1Y7TA 4ZICA 1ONOA 2E82A 3BMOB 4AJPA 3B1KA 3FPCA 5JPIA 1WW8A 4PLYA 1Z7BA 1V3VA 4WCFA 2DPGA 3BMCB 2VNSA 4Y6SA 4BIIA 4Q3DA 1PGJA 4CMEC 2Y67A 1QLHA 2ZK7A 3M6IA 4RGBA 3RJ5A 2JD2A 3LT2A 2Y68A 3EVTA 4PG4A 4EBFA 1X7DA 3JD3A 1LDBA 1UZNA 4I9NA 4XRGA 1K6JA 4ND3A 4XGNA 1B16A 2J5KA 4XQEA 1HWYA 4M8SA 4OH1A 5EJ2A 1UH5A 2CY0A 2DUWA 4GWGA 2DFVA 2D1YA 5EPOA 1RM0A 1U4OA 3DAGA 1T2FA 3WICA 1WP4A 3FPLA 1ISHA 1A27A 3NDRA 3PYXA 4J2OA 3D7LA 4BKUA 3U4HA 1B8UA 1Y5RA 5KIAA 3T7EA 2HLPA 5I9MA 4I5FA 4YRAA 4BNTA 4WASA 2DAPA 3UUWA 2GZ3A 2CDBA 3C3XA 3Q6IA 4CM5A 4FN4A 2IXAA 2ZTMA 3OA2A 3PHIA 3JD4A 4LRSB 3DBHB 3EUWA 4ALKA 5IDQA 4QEDA 2AQKA 4B4WA 4XJSA 3PYMA 2AE2A 2WEKA 2XXJA 4J1NA 3RFXA 1HL3A 3JD2A 5IF3A 2CZCA 3Q2IA 1EZ4A 3JQCA 2I5PO 3GVIA 3JQBC 1Y8QB 1DIAA 1M67A 3JQGB 3U09A 1E5QA 4GI2A 4ALNA 1AE1A 4TROA 4E5MA 1QYDA 1OAAA 4WLVA 2BFAA 4CM8A 2X4GA 1B14A 4XGIA 2FWMX 5G0TA 3RJ9A 5DP2A 4PRKA 5A9TA 4XYEA 1FDVA 4LW8A 3FBGA 1GDHA 8LDHA 1YOVB 4U0KA 2IZ0A 4TZKA 4ALLA 4CM4A 4ZN6A 4KUEA 4XIYA 3VHRA 4BB6A 4DREA 5B4TA 1D8AA 2Q1TA 4GQAA 3RI3A 3CSDA 1QYXA 3VVCA 4YAEA 3N74A 1NR1A 3PHJA 2OOSA 3ZNNA 2C07A 1B8PA 2VT2A 3DAFA 3EAGA 4UVGA 3CUKA 2YHIA 1JAYA 4UUNA 3WBBA 3EDMA 4OO3A 3UFXA 3UHAA 2VTDA 3W4JA 4HV4A 1T4BA 4FGWA 4FFPA 3OJLA 2BI8A 4J9UE 1BVUA 3TZQA 3JQFC 1PTJA 3DOOA 1C14A 4BOYA 2UAGA 2GYYA 4IDAA 1YWGO 4MJLA 1EE9A 4R68A 1DJNA 4XB2A 3RUDA 3HG7A 4E21A 1HETA 4YT5A 1ONPA 5F3RA 5BSFA 2Q2VA 6ADHA 4BO4A 1HF3A 2GO1A 1YONA 3SC4A 3SVTA 1VKOA 2Y1FA 3VPXA 5JO0A 1LJ8A 3MCVA 4FJ1A 4KZPA 2Z5LA 4NK5A 2WYVA 3COSA 3DXFA 4YJDA 1PQPA 3RWBA 3E82A 5AQ1A 5JDIA 1LU9A 2PK3A 2EF1A 4AJLA 2C29D 1HTBA 2GRAA 3VZSA 4BO3A 3VH4A 1YBMA 4W99A 3TDKA 5KVVA 1GQYA 3FBTA 1OC2A 3SJ7A 4BNUA 1D4FA 3DBVO 4B3HA 4EJ6A 2CVOA 4IY1A 1O6ZA 3ANNA 3WXBA 5B4UA 2QYTA 5BQFA 4JBHA 5KVSA 3AU9A 4RLSA 1H6AA 4O6VA 2OXIA 4A27A 1WZIA 5TGDA 2Y0EA 3ZWCA 1LDMA 1S6YA 3ZNQA 2JD1A 4YJGA 1V35A 1TT7A 4G65A 1PJSA 4B7UA 4D46A 4CLRA 4U5QA 1SBYA 4R41A 4ESOA 4U6QA 4MIYA 3ETDA 4GX2A 1VLLA 3DONA 1FDSA 3TNLA 1X0VA 4BQRA 4DUPA 5L7TA 3KYCA 2A35A 4PLTA 5L53A 1CF2O 3H9QA 3OJ0A 3RQSA 3UKOA 1O9BA 3PQEA 2GSDA 2UUPA 4IJVA 2JD0A 2VRBA 5DDIP 4P8RA 1YE3A 4WUVA 5DNAA 3UCXA 1RKXA 3L77A 1FXSA 1KC1A 5I8ZA 2AQIA 4M89A 2SCUA 3DB2A 4AG3A 4BNIA 1YB5A 2ZQYA 1MLDA 1NQOA 3IAHA 1GADO 2W90A 4E2ZA 4NJMA 9LDBA 4BMNA 2GZ2A 4CPDA 4NG5A 1VJ0A 2FZWA 1HE5A 3E5RA 2H9IA 1N1EA 5JC8A 4CMCA 3H9JA 2V6GA 4ZU3A 5DN9A 1ENPA 4PLHA 3WQQA 2EGGA 2NADA 1HEUA 4JX8A 3AY6A 4Y6RA 3K2EA 2R00A 3KEQA 1OFGA 1PJQA 3MJCA 4J0FA 2HAEA 5FI3A 5ITVA 4XQ9A 3GVXA 5EINA 3NT4A 3S2IA 5I7VA 1NPYA 4BNKA 5CDGA 4ZRNA 4HFMA 3RBVA 1XEAA 4N54A 3C1OA 3T4XA 1T1RA 1O95A 2UYYA 3GR6A 2D3TA 4WCFB 5L45A 2Y1OA 1P1RA 3HNPA 4MPDA 2B5VA 4UVHA 1RM5A 3S8MA 4NI5A 5CEJA 3QSGA 1JWBB 2Y1DA 1B3BA 3V1YA 1GYPA 4RVHA 2NVUA 4WGGA 1QKIA 4DIOA 4EUEA 3PJFA 3NRCA 2DQ4A 3PWKA 1E7QA 5TT0A 3A28A 1X7GA 5JAIA 3JQEA 2B4TO 3BAZA 4XQGA 1P74A 5A5FA 1QG6A 1XWFA 2H1SA 3LC1O 4H16A 1BXKA 4KP7A 4QECA 4UEKA 1SO8A 4NU6A 3RSHA 1T2DA 3K2BA 4H3VA 4UVDA 2X22A 4XYMA 3TRIA 2EP5A 3OIGA 5LC1A 2BGMA 3ZWNA 5ICMA 3VZRA 4XJTA 3EW7A 1EVZA 3KRTA 5JDIC 4YRBA 4F3YA 2FSSA 1W8DA 1H93A 3EZLA 3LC2O 4J3FA 1HZZA 3RCBA 4YEDA 3U5TA 2PH3A 4IQ0A 3RD5A 3GDFA 4PGFA 1ADCA 1DO8A 2Q99A 3JQ7A 4JN6B 4W6ZA 2GD1O 2QZ9A 1KVQA 3GG2A 3GOHA 4RV9A 4WNCA 3RKRA 2QHXA 5CPFA 1Q2XA 2C2XA 1P3DA 5AXDA 4DC1A 1QRRA 4CV3A 2FR0A 1CYDA 1DC6A 1YVEI 1Y8RA 1R0KA 3JQ8A 3GPIA 2PWZA 4IDBA 1FJHA 2F00A 3D4PA 4ZQFA 3KZVA 1EUZA 4D44A 1ZNQO 1EUDA 3U3XA 3F4BA 3ZHYA 4CM8B 2EXXA 3T4EA 3NJ8A 4KMSA 3NAQA 4DBVO 1PWXA 3MJ4A 2WD8A 1YL6A 2X23A 1WMBA 3CINA 3DZHA 4GX0A 1EVJA 2W8ZA 1ZEJA 3WDSA 3WJ7A 5JY6A 4ZHSA 3WTBA 1PS0A 2DBVO 4OXNA 1RJWA 1OBFO 4LVCA 2R2GA 4A0SA 1NP3A 2C82A 1IULA 1T25A 3SLGA 1EQ2A 3BTSA 1A7KA 1B26A 1HE4A 1D3AA 1BW9A 3PI7A 3DOJA 4JJFA 1B3RA 3GHYA 2C59A 2GZ1A 1GAEO 1MB4A 3G3EA 3C7DB 4UEOA 1UXIA 5I7SA 5CEEA 2R00C 4X54A 1HLDA 4CM9D 2Q2WA 3WGZA 3W4IA 2WYUA 1R0LA 3DMTA 2CF5A 2V6MA 3H4VA 4QFDA 4BO9A 4JP2A 4PZCA 1PJTA 4CUKA 3BHIA 1ZIDA 2ZQZA 2JHFA 1WWKA 2X9NA 3LYLA 3PDUA 3R1IA 3MOIA 3R0IA 5L4LA 1U3VA 1TI7A 3HN2A 5EQDA 1YJ8A 5TF4A 3TN7A 4FR5A 4BV9A 1PL7A 4RQUA 2H6EA 2VZ8A 3ZW9A 2J3JA 3LQFA 4OL9A 4F45A 1X7HA 2VHXA 2Z1MA 3NUGA 4MKXA 3PDJA 4XDYA 1RM3A 4Z0TA 5IN4A 1XU9A 4WOKA 3ENNA 4KWHA 2C7GA 4ZGWA 3W6UA 3V1TC 3I4CA 5AVOA 1KERA 3K6JA 4FQ8A 2PA3A 4ZA2A 3SBOA 4ND4A 5DOVA 1ZFNA 1MG5A 2B36A 3KVOA 3KYDA 3JQ6A 3V2HA 3NYWA 1AXEA 1GUYA 4YJGB 4B4OA 4CLRB 1QV6A 5ITWA 4AJHA 2YQ4A 4TRNA 3IJRA 3JTMA 1SZJG 4AJEA 3ZZNA 3CE6A 1PL6A 4PRLA 3WGOA 3KYCB 2NLOA 1U7TA 1FF9A 3FTPA 1QP8A 4JJGA 3CXRA 2ET6A 3LT4A 4ROSA 2NACA 3JD1A 4JBGA 1R0SA 1QLJA 4PVDA 4DRYA 3PLRA 3ZV6A 2Y99A 3PQFA 4KOAA 4ND1A 5IN5A 3I9JA 1H2HA 3PPIA 4WKGA 4R01A 5LDGA 1HDXA 4J7XA 3RC2A 2OP1A 2Y1EA 4PIVA 4TKMA 3L6EA 3H5NA 3OF2A 4NJMB 1ADGA 3GF4A 1F06A 4NK4A 4MKZA 1XA0A 4PVCA 3PWSA 1UXJA 1IL0A 4E2WA 4YAKA 3AK4A 3F4LA 2CVZA 5GZ1A 3B6ZA 5KJFA 4CQMD 4UEJA 5JBIA 4GWKA 3DTYA 3U62A 4CM9A 4E5KA 1BXGB 2Q46A 1MX3A 2EW8A 3ITDA 5BSHA 3E9QA 1JVBA 2G0TA 4RO0A 1MA0A 3K8ZA 3JYPA 2CSUA 3PJDA 3ROKA 2HJRA 3U0BA 2RH4A 1EFLA 4E2YA 1VSVA 3DBRA 5K9ZA 3LZ6A 4CV0A 1GR0A 5L7WA 5LDHA 3A14A 1E7MA 3C7AA 1R4NA 2NVUB 4R51A 2V6FA 4P22A 2P4QA 1B2LA 1M66A 4L4XA 2BH9A 4OKIA 2Z1NA 1NAHA 3EVNA 4GBJA 3HSKA 3VAZA 4BHTA 5JMWA 4NBVA 1I2BA 3OQ6A 2NU6A 1KVUA 1VSUA 4IUYA 1H5QA 1PR9A 1SPXA 1TA4A 1X14A 3I6IA 2DTDA 3UH1A 4D3SA 4R5MA 1Z7EA 4OOFA 1FDUA 4CL3A 1DOHA 4YAGA 2X58A 5KKCA 4CQLA 3QVSA 4ZJUA 1I2CA 4OSPA 1IOLA 1BRMA 1M76A 4DMLA 3DL2A 3NKLA 4IS3A 1ZK0A 3NV9A 3RUCA 3ZWBA 1MV8A 2E48A 4D7AA 2IRWA 2Z95A 4YAIA 2AEFA 1TEHA 1DJQA 4BNNA 1GUFA 2HO5A 2WE7A 4ND5A 4Z9YA 1RYDA 4GMFA 4PZEA 3JQ7B 3ICCA 2GN8A 3H9EO 3DOCA 2VUUA 4GAEA 4WEQA 3X2EA 2NQ8A 3QIVA 1LSUA 1PJ3A 1ZKMA 3HDHA 1GTMA 4JBIA 5KJ6A 5MDHA 2AHRA 4YJFA 1AGNA 3GDOA 3WYEA 1ZJZA 3JQ8B 1Y9AA 5JSFA 1E6WA 1EQUA 4O59O 5FF9A 1DC4A 5H83A 3VZQA 4AJ2A 5C7IO 5F5NA 3S2GA 5ER6A 3QW2A 1PGOA 4CQMA 3QP9A 4BUCA 1YB4A 1ZXBA 4QXMA 1C1DB 4HNHA 2JAHA 1ZK1A 1MXFA 3HB5X 1F0YA 2J5RA 1NR7A 4TKLA 4IBOA 5F1OA 4AFNA 1BSVA 5JDCA 1E0DA 4FJ0A 1WMAA 4XZ3A 1ZK2A 3UGKA 4P4GA 5GY7A 5JE8A 1QXSA 1ULSA 5CFZA 2ILTA 2G82A 4R1TA 3WGHA 1SCUA 1NTOA 4MP8A 4XR4A 4IZIA 1GZ6A 3TOXA 3RC9A 1O5IA 1BW9B 1IY8A 4IINA 4CMIA 4RPHA 1ONNA 3G1UA 1JKFA 4FOOA 4NHEA 3ZHBA 1DHTA 1I0ZA 3GZNA 4BMSA 4GPD1 2BI7A 3DEYX 1DXYA 1ISMA 1CERA 4FFLA 1KOLA 1XHLA 3AM3A 4DPKA 1R37A 1Y5MA 2DBQA 5F1KA 3S55A 4BO7A 5KKAA 2YQ5A 4J0EA 2B5WA 3A1NA 3CIFA 4A03A 4ZVVA 4RCVA 4U6SA 3GPDG 1ISGA 1BVRA 1P1HA 1YDEA 4RF4A 3U4CA 3ZW8A 4DIBA 5L95A 2PKQO 4YRDA 1KVTA 1HYHA 1J4AA 4Y9DA 1DRUA 1X15A 3F5QA 3DZJA 2P5YA 2DTXA 4ITUA 2Q50A 3AFMA 4JCOA 5JAMA 5A3VA 3E9NA 4JGBA 1YQXA 1MFZA 4TRMA 3KOUA 1KIFA 2EEZA 4W82A 4TRJA 4UREA 4N5LA 5B12A 4QX6A 1IUKA 1KEVA 3JCZA 3K30A 4RVUA 3KYDB 3NX4A 1R15A 4FBGA 1C0LA 1U2GA 1O0SA 3QWBA 4WLFA 3ICPA 3KSUA 3SX2A 5U9CA 2G17A 4ILKA 3B70A 1NVMB 1K6IA 1Q0LA 1A9YA 2IEDA 4MP6A 1N92A 3GRPA 1SOWA 1PWZA 2V65A 2OL4A 2AA3A 5TJHA 1F8FA 5A06A 3AU8A 3PHHA 1NHWA 4FFNA 1GCUA 3WFIA 2D5CA 1F8GA 1PU2A 3E6AA 5HBRA 3VPFA 1KY5A 2RBEA 5FFFA 4HFRA 3O4RA 4C7KA 3DHYA 2W98A 1P45A 3M1AA 4CV1A 1IPEA 4GVLA 3AUSA 5I7FA 3NJ4A 4L76A 4B4UA 2C0CA 1H6BA 3PTZA 3A9WA 4URFA 5ILGA 1SAYA 4J49A 1JTVA 1UXGA 5JLAA 4D45A 4E31A 3LF2A 1AHHA 3VPHA 3EK2A 4L75A 3W1VA 4XGKA 3ZHXA 1OOEA 2QG4A 1KY4A 3PEFA 5JDCC 3OJFA 1IB6A 3QVTA 1DAPA 2C7VA 4HFNA 2QRKA 4GGPA 4Y8VA 2PLAA 2DT5A 3ZV4A 3EGOA 2FHSA 1NQ5A 5K0ZA 3OIFA 3G1TA 4MVJG 5MGBA 2WD7A 1ZK4A 1QORA 4EJMA 5G4KA 2HJSA 1R4NB 4B8WA 3WJAA 5BNIA 1EVYA 1AUPA 4J7CA 4AJIA 3AI1A 1D7OA 2YV2A 4CUZA 4MP3A 1F14A 4TVBA 4IZHA 5JYEA 3GNSA 5KCZA 3HDYA 2A9FA 1Z45A 1UDAA 2I66A 4I08A 4NMHA 3ZWYA 3S2FA 2PFGA 5DCUA 2FN7A 4A7PA 4I9HA 1E3WA 1KEPA 5JXWA 4XR9A 4TQGA 4GSKA 4YB8A 1L7EA 1A4IA 1K5HA 1BDBA 3UF0A 4CQLB 1DB3A 1E3SA 2BFPA 2ZKLA 4I5DA 2I76A 1HDGO 3RBXA 5T6BA 5JAZA 1NFFA 1R4MA 5FEUA 1I30A 3WGIA 1GD1O 4OQYA 3VH2A 1V0JA 1IZ9A 3MJSA 2YUTA 4QO7A 4CMKA 3GEDA 2DKNA 4Q3BA 2QIOA 1LA2A 4LRTB 1FK8A 1XG5A 4IMRA 2BKAA 4JK3A 2VHVA 2H5LA 5CHEA 2BHLA 1JW9B 4E4YA 3OFSA 4YJFB 4ZQEA 3ZWPA 3VH1A 1LQTA 3QA9A 3VTZA 1LRLA 1CWUA 4PCVA 5GZ6A 4P38A 4J2HA 4EW6A 2ZCUA 3AFNA 3FRJA 3HFSA 1HSOA 4EUFA 3GY0A 1VJ1A 1I36A 1HDRA 1A9ZA 2J5QA 1VKNA 3R3SA 4NH4A 2CDAA 5I9NA 5C37A 4U7WA 3BMNA 4FJ2A 4IXTA 4CQMB 1U5AA 3L9WA 4WLNA 3JYNA 1I3NA 3WNQA 5A5EA 5G4LA 4GKBA 2E4AA 2GN4A 1R66A 2P9GA 1HDYA 3SJUA 1PGPA 2RHRA 2DC1A 1ZCJA 4O1MA 4RLHA 1EBUA 5T67A 5H81A 2CVQA 4Q3AA 2AG5A 3I23A 3I1JA 4UAGA 1DLIA 1PS9A 1MXHA 2HK9A 2JKVA 3WYBA 4BNGA 4LMPA 2VRCD 4FFOA 2CNBA 4CMIB 4E13A 5C3MA 1W4ZA 5L9AA 4E5NA 4I9UA 5KJCA 4HUJA 2NU9A 1B15A 1X1TA 3NEPX 3IDSA 3W8EA 4RDIA 1CIVA 1NVTA 1E3LA 3C24A 4L4SA 2VQ3A 4E2XA 4S3MA 2EP7A 1ZH8A 2ZATA 3D5TA 4OQZA 1T26A 2YDYA 3JQ9A 2J8ZA 2IYOA 2PZMA 2VHYA 1U2DA 1CDOA 3BA1A 3TFQA 1T2AA 3LT0A 2VTEA 3OH8A 2A4KA 5DF1A 1K2WA 2UDPA 4JJIA 4J4BA 3RUAA 4EJ0A 3H9GA 3OETA 4RDHA 4NDNE 2YV3A 5T8KA 3CZMA 2EKLA 1LTHR 5DT9A 4BL5A 2RAFA 2PZLA 4U8GA 1V3TA 1R12A 4OSOA 1XU7A 4AJ4A 1O8CA 4OAQA 1WDKA 2WTBA 1ISJA 1Q7BA 3BYZA 1C0KA 3OJEA 3QY9A 4DPMA 1U4SA 3M2PA 2YHUA 4BGUA 1ZK3A 3TZKA 2Y66A 4D3FA 4IGEA 1N8KA 1J0XO 1ZSYA 1PGNA 1YRLA 3ONDA 4KUGA 2OGUA 2QQ5A 3JD0A 2NTVA 4M87A 1DFHA 2HQ1A 5JFOA 5FYDA 4J91A 3O8QB 4GMGA 4UUMA 5C5IA 3WGGA 1P1IA 1TLTA 1HDZA 2G1UA 3E03A 3RU7A 2PD4A 3FTNA 4YAJA 4CM7A 3P2YA 4DLLA 4TRRA 3WGYA 1SEPA 2O7QA 4MVJH 3ZHZA 5DBIA 5IJZA 1M75A 3RVDA 1UP7A 1GEGA 1ZMOA 2HU2A 3GFBA 3BXXA 3NT2A 3BTVA 3Q0EA 3DZIA 3P2OA 2VRCA 5TNXA 2X9VA 1E3JA 4EYEA 3VKUA 3I6QA 2FSVA 3TOZA 2IYPA 1GUZA 3KSZO 2UUOA 3NGXA 3HE3A 1BMDA 3TF5A 3ZWXA 1PJ2A 5HA5A 3UXYA 2FOIA 3IUPA 2OP0A 5HWSA 4OXKA 1UR5A 1JN0A 2XOXA 4K26A 1BTOA 3N58A 5TQVA 3VPSA 4RVFA 3IKTA 4ID9A 1E77A 2UVDA 3KLPX 3ZWVA 3BMQA 2YFQA 4OYRA 1GEEA 3BHJA 4RVDA 4TSKA 1P1KA 2DTEA 2J3HA 4XYGA 1U3TA 2WD7B 1IHXA 1JQBA 3GA0A 3M1LA 4XCVA 5G4KB 4R1NA 4IDGA 2ZJ0A 4BNZA 1IE3A 3VC7A 4E5YA 1HE3A 4WE3A 2HMTA 2GR9A 3MWEB 4BQPA 1I3LA 4Q39A 3PZRA 2Q1WA 2I9PA 2J3KA 3JQ9C 1ULUA 4A10A 5ICSA 4AVYA 5T57A 1E3WB 2FRDA 3BIOA 4CL8A 2V6BA 1LSOA 1E3IA 1AN9A 2GLXA 5ILOA 3LDHA 5GMOA 4DQXA 4MVJM 5L4SA 2QW8A 5BSGA 1A4UA 3QE3A 1VC2A 1GU7A 1ZEMA 3I83A 3V1UA 1R4MB 5CP8A 5T8KC 4DA9A 3NDJA 3LC7O 3NTOA 4YR9A 1I5RA 3DAPA 1GV0A 5JO9A 4W4TA 3S1LA 4CM4B 5CDTA 1QR6A 2X0JA 4PG5A 4JXKA 3H3FA 2P4HX 4XB1A 4N18A 4YBZA 3DR3A 2TMDA 2JHGA 2P5UA 5JCJA 5TJ9A 1PR3A 2YHIB 2AQHA 2EG9A 3FNHA 3H65A 3OP4A 4CLXA 3ADPA 2EKQA 2P2SA 1TB4A 3FNEA 3QVWA 2VWQA 5ADHA 1RPNA 3LF1A 4HADA 1NWCA 2ZJ1A 4B8ZA 3JV7A 3ABIA 3QWHA 4JROA 3FD8A 4WPGA 3T7CA 4AJKA 2RHCA 4DYDA 1M6HA 1IZ0A 1KVSA 4E33A 2CF6A 4RZIA 3GHHA 2CMDA 3OSUA 5DOZA 1N7GA 4OOEA 4KWIA 1SMKA 2RH8A 4NJOA 2Y05A 3IC5A 4BKPA 2WWRA 4LSWA 4R9RA 5CEFA 3WLFA 3B1FA 1N1GA 3RROA 4AJJA 5A04A 3F6YA 2BD0A 2OZPA 4BGEA 1GPJA 1Z6ZA 5IDWA 1NWHA 2BGLA 1HDOA 3LVFO 3IKVA 2ZYAA 4NIMA 1RWBA 5JW6A 1UAYA 3C1AA 1O89A 1QYCA 3RUIA 1C1XA 3EHEA 1PX0A 1PJCA 3GLQA 3QWFA 1HLPA 3L9XA 1HZJA 5EMHA 2E37A 2DVMA 1G6KA 1GPDG 4Z3DA 4BNFA 4CV2A 2YV1A 4N5MA 4XDZA 2OUIA 3FSRA 3AOEA 1R16A 1LSSA 3I9KA 5TS3A 3H3JA 4PG8A 1J5PA 1YL5A 3H5RA 4QUKA 3EYWA 4UVIA 3ULKA 3HDJA 5T64A 3MOGA 1SOVA 4R1UA 2NSDA 2TMGA 2X5KO 4C4OA 4NFHA 2E49A 5BNTA 4L73A 3N7UA 5T5QA 2PD3A 2B69A 2NU8A 4I1IA 1WLYA 3INRA 3I3OA 4D41A 3LSYA 4DLBA 2JCVA 1P33A 4INAA 4Q3EA 1A7AA 2PY6A 1GZ4A 2X0RA 3ZWMA 1YBAA 2BF7A 1MG0A 2JL1A 1E7YA 5C7OO 2O2YA 2O3JA 1VJTA 3W6ZA 1DC5A 1K0UA 4CM3A 1LX6A 1PS8A 3WIEA 1K89A 1LC0A 5KNLA 3GH3A 1X1EA 3I9LA 4QTZA 4PFJA 4O63O 1EE2A 3ON5A 3HADA 4I5EA 1UAGA 5G0VA 4CR6A 4IXWA 3LK7A 1BHSA 3WMWA 2Y0CA 3ZI0A 1YS4A 3GMDA 4BO8A 1V8BA 3PGXA 4PG6A 4CMBA 2I6TA 2P9EA 3ADOA 3KXDA 4MDHA 2EIHA 4NFSA 4F46A 1K6XA 3QQPA 4BO5A 5A1TA 5CG1A 4BKOA 1HXHA 1PJLA 2YFHA 4YWJA 4D79A 1K3TA 3FF4A 3IOYA 4IIUA 3ETEA 2FPPA 3ZU2A 5DZSA 1RM4A 2A94A 4IGFA 1S7CA 1U3UA 9LDTA 3E1KA 3KUXA 4GSLA 3I5MA 4Y6PA 3GAFA 4IDFA 3GEMA 4QT0A 2EJVA 4E12A 1VM6A 5EESA 4MOWA 1SEVA 5U1PA 3AOGA 2W2LD 4IS2A 1I01A 1LNQA 4PLGA 4BKRA 2HRBA 1A72A 2VYND 2ZTLA 2CFCA 5EQFA 3L4SO 3V8BA 4EDFA 3CEAA 1IPFA 3UCEA 3BHMA 3UN1A 3INTA 2J3IA 3BMQB 2EGHA 3DBHA 2GN9A 4E5PA 1JAXA 3ZNPA 4J1QA 5THKA 4BV8A 4FD3A 1PSDA 1XGKA 3QJ5A 1T2EA 2QRLA 3AUAA 5JY1A 3I9OA 2O3UA 2ZB8A 1Y8QA 3SXPA 4O5OA 4D42A 1W0CA 3AOEC 3F46A 2C2YA 4XIJA 5A9SA 1Y8RB 3GN2A 3CTMA 1BG6A 4I8XA 2EHDA 4A73A 4J16A 3JYLA 5U4QA 4U0JA 2LDBA 1H9BA 2HK7A 2P68A 5ES3A 3AJRA 4CMJA 5A03A 1YJQA 2BFOA 1E7WA 4IJWA 3STHA 1UUFA 5KWEA 3IP1A 1BXZA 3RFVA 1W73A 1SNYA 4FB5A 1WAMA 2ZTVA 3RC1A 1ZJYA 2IEBA 3S2EA 4IMPA 3ETGA 1DPGA 1Q7GA 1DFIA 3CMMA 1KETA 2CUKA 3HHPA 4FOSA 4YTEA 3BZUA 5ER9A 4LN1A 1WVGA 4BMVA 4MINA 3SLKA 1M2WA 1XYGA 3C1TA 4G5HA 2NVWA 3UVEA 3ZGYA 8ADHA 3U4DA 1YL7A 4PN3A 4WOJA 1EUCA 1Y6JA 4YQYA 3ZN2A 1CEQA 2BMAA 4F6LA 4J90A 5IFLA 3O03A 2Q49A 3ZWOA 5F1PA 4BVAA 1W6UA 1E7SA 2YJZA 1LDEA 2NM0A 3E5MA 3CMCO 3HWRA 3PFWO 5EERA 1XQ1A 2XXBA 4CJXA 4EGFA 4Z3KA 3HN7A 3AWDA 4R69A 2ZCVA 4PLCA 3HQ4O 3R3JA 4ZQBA 5A3JA 5DBFA 3TZ6A 3KV3O 3D64A 5CG2A 2POQX 2Q1UA 1E6EA 4EEZA 1GFSA 4BNLA 4HWKA 2O3TA 1A5ZA 3ZU4A 4D3DA 4HXYA 1YDWA 2W2LA 4RVSA 1I3MA 3L0DA 1WDMA 3RBZA 2VYNA 1Q0HA 3DZGA 1NQTA 4BNJA 4YACA 1E3EA 1U5CA 4R3WA 3WFJA 5I7EA 2AQ8A 4BB5A 5L4NA 3WS7A 3RFTA 5G0WA 4G81A 4DTIA 5A05A 3ROQA 2IE0A 2PGJA 1HYEA 2NWQA 5IZCA 5K6AA 2G5CA 1PZGA 2VWGA 3A06A 1CQJA 4CMHA 1A71A 3DBLA 1F17A 1ZSVA 4DMMA 1WDLA 5CPBA 1LDGA 4Z6KA 2UV8A 1OZAA 5HRUA 2B4RO 1BWSA 2W2KA 3DWFA 2C5EA 2AW5A 4PZDA 4CMAA 2EERA 3DTTA 2IXBA 4A26A 1L1FA 4R1SA 3WBFA 1I10A 4DPLA 2Y1CA 1EK5A 4NBWA 5KJEA 1FMCA 1VPDA 4IQGA 1B7GO 2X6TA 4FIZA 1ZBQA 5DCWA 4IPTA 1UDBA 4J1SA 2D0IA 3RASA 3TZCA 4UUPA 3X2FA 2QX7A 1Y81A 3GDGA 4L4RA 1HYGA 3WWZA 1LQUA 2Q1SA 5GZ3A 4DC0A 1DIGA 1GZ3A 3Q11A 3RIHA 3OA0A 3RUFA 1JLLA 2LDXA 1H0KA 3OICA 3ONFA 4R5HA 3ZV3A 3DO5A 3ANLA 3IJPA 3PZBA 3W8DA 1Q0QA 4YPOA 2NTJA 1MC5A 3WLEA 2V7PA 3ITKA 3ASVA 3MJTA 4JNKA 4YT4A 3Q2KA 1Q7CA 1PGQA 1VRWA 2HSDA 4FFRA 4LK3A 1NYTA 3TPCA 5EL0A 1NVGA 2Q45A 1I24A 2JAPA 3OEYA 3ROPA 5A02A 1ENOA 4PLPA 4Z0PA 3ZWWA 4A2CA 5F5LA 3D3WA 4WJZA 1M6WA 3E48A 2JCYA 3GQVA 2Y93A 3PJGA 1TT5A 2VUSA 2NTNA 4XEHA 4CLOA 4HBGA 1UZLA 3KO8A 4L0QA 4B4VA 2P91A 1D1SA 2PZKA 3GUCA 4CLDA 1NAIA 3JQAD 2GDZA 4FC7A 2VHWA 3VDRA 2E6UX 5CDYA 3WGTA 3GG9A 2B0JA 5C7LO 3DBRB 5EN4A 2Q3EA 3H8VA 1YGYA 1EBFA 3O9ZA 5DULA 2DM6A 2GGSA 4WLEA 1VL0A 1LLDA 4E30A 4WECA 1EMDA 7ADHA 3PP8A 4LSMA 2GUGA 3GK3A 4CUJA 4JP3A 2AE1A 4RL6A 4DLAA 4IM7A 1H94A 1ZXLA 2P9CA 4TMFA 2PZJA 3FWNA 4OKNA 4GLLA 1NPTO 2Y0DA 2G76A 3F1KA 2Q4EA 5EIOA 1LRJA 3GVCA 3KBOA 3KM0A 4W9NA 3I9NA 5HM8A 5IZCC 5K6AC 1VL8A 2WSBA 3FR8A 1LLCA 4NFYA 1MP0A 2OBYA 4L74A 4OXYA 1KEWA 4BNYA 4HNGA 2DBRA 4L8VA 2WDZA 3TL2A 3OJOA 1DIBA 4YVFA 3GEGA 2GERA 3DZBA 3F1LA 1G1AA 3VOSA 4DIFA 2I3GA 1NFRA 1CJCA 1WZEA 4CR8A 3ASUA 5A9SB 2VNAA 2X8LA 4WLOA 4XWYA 4ND2A 3IUSA 4XX0A 2DUUA 2Q2QA 2A92A 1NXQA 2FMUA 4XKJA 4CODB 2NUAA 1FDTA 2O48X 3Q1LA 4FSHA 1PZHA 1Z82A 3U4IA 4E3ZA 1I3KA 2GCGA 2QYSA 3WX0A 1DRWA 1NX6A 5F21A 2X0IA 2O4CA 1MFPA 4OHUA 1GCOA 1ZVMA 2WYWA 3JYOA 3GVPA 1GQ2A 3H6KA 3F5SA 2O3RA 2RIRA 3G0OA 4PLVA 5DP1A 1DBVO 3JQAA 4KUHA 3ZCXA 1V6AA 2X9GA 4IQ8A 2PH5A 4E0BA 4L9RA 5IZ4A 4P4LA 5CDSA 4RF5A 1TVEA 2VN8A 3HZZA 4D43A 3E18A 1UDCA 3WSWA 5TLSA 2BLLA 3K96A 5LCXA 4QQRA 2ZB3A 4W7IA 2DBZA 1P1JA 4D0SA 4XRRA 4B3IA 1P31A 4DL9A 1PJ4A 2HMVA 4HX5A 4OGWA 5ENVA 3RUEA 4EUHA 3GZNB 1H6DA 1PEDA 1NASA 3TJRA 2XPCA 3CPSA 4WCFC 3DC2A 2EV9A 5AYVA 1X0XA 1OC4A 1GYRA 3CZRA 3QVOA 1UXHA 2FP4A 3QWAA 3RKUA 4BNHA 1DSSG 2AG8A 1I2ZA 3GN1A 4HP8A 3I9MA 3QLJA 4MKRA 4MVJP 4DXHA 1YO6A 3V2UA 3IS3A 4XA8A 3DMYA 1N5DA 3KSDO 1CETA 4IDCA 3K31A 3TQHA 1C0PA 3DBLB 4CM6A 1LDNA 3LLSA 4Y98A 4KQWA 4RPKA 4A5OA 2FPIA 1EFKA 1T2CA 2W2KB 1ENZA 4DYVA 1B8VA 3PFFA 4QSMA 3FNFA 4OIMA 1JDJA 4CM1A 2JFFA 1JKJA 1GQQA 3MJEA 4W9NC 2VYVD 4NU5A 1B0AA 4YJHA 2C54A 3WQRA 1OMOA 2ZYGA 4R4JA 3TSCA 2F1KA 2VOEA 3MJVA 3OHSX 4NBRA 3DQPA 1N9GA 4CLEA 1O94A 3TZHA 4RPGA 6LDHA 5KJ1A 4DWVA 4DQUA 3NTQA 4UUOA 2BRUA 4N7RA 4AICA 3R6DA 3ORFA 3IP3A 3D4NA 1WXDA 2H63A 2O2SA 4MO2A 2ZYDA 5FWNA 1HT0A 2HMWA 3GMSA 3RC7A 3PRJA 3PK0A 1EEHA 4ZRMA 5G2OA 3FR7A 4K1LA 3JYQA 2RCYA 3AY7A 5AXCA 3WB9A 3IMFA 5JCJD 4BO2A 4OJNA 5HTOA 3HJAA 1TXGA 3FI9A 4LMRA 3QHAA 1BXGA 1RYEA 3F9IA 3WWYA 1HRDA 1G0NA 4GGOA 1XIVA 3ZWAA 1XR3A 4R54A 3D3WB 1E1KA 1E1LA 1I33A 4XD2A 1TT5B 2QZZA 4EITA 1PZEA 4NBTA 1E6UA 2EJWA 3WG9A 4XYBA 4CLOB 1J49A 3MTJA 3KYBA 4BO1A 4CR7A 3LU1A 1CRWG 3RUHA 2YW9A 1Z75A 3EC7A 1LXCA 3PLNA 4GL4A 5COAA 3UCFA 2OORA 5JC1A 4YQZA 3GVHA 3GT0A 2PGLA 5JS6A 2OHXA 2J6IA 3GRKA 4S1VA 3FN4A 2OFPA 1LDYA 3HUDA 4E32A 5KVQA 1P0FA 2HMUA 5TSDA 4FPXA 1JU9A 4B7CA 5IAAA 3Q3CA 3H2SA 2AXQA 2W4QA 5J23A 1XELA 1KEUA 4NQZA 3D5QA 1LEHA 1LI4A 2DLDA 3QV1A 1U7HA 3CKYA 2C20A 2PV7A 4BNMA 1AXGA 1U8XX 4M54A 2VCYA 3NTRA 3FWZA 4DGSA 4YXFA 1L7DA 1H9AA 1LRKA 3V5NA 2VYVA 1PJBA 3GGGA 1EK6A 1T24A 5TRTA 2GASA 3MWDB 4RF3A 5COQA 2NV6A 3L4BA 1U3WA 2EKPA 1P44A 4RPJA 1UP4A 3UOGA 3L6OO 1FDWA 4J1TA 5BR7A 4Z9XA 4DVJA 3SC6A 1ENYA 2NVBA 3GNTA 1ID1A 3JSAA 4YT2A 2NU7A 4BO0A 3PWZA 2GNAA 2VWHA 3UICA 4WNIA 2YZ7A 1JWAB 4TZTA 2JFGA 5JCXA 3MEQA 1LC3A 2YDXA 4OMUA 3B20A 1HSZA 4JIGA 3OM9A 1T4DA 1DHRA 4R3NA 1C1DA 1F12A 1H2BA 3QVXA 3ZDFA 4IIVA 4YA6A 4NPCA 2Q4BA 5AXAA 5HS6A 5CAEA 2JFHA 1I8TA 1YKFA 3DZKA 2NQTA 3OEWA 1HDCA 2VHZA 3AM5A 4GX5A 2AEJA 3BMNB 4WEOA 2D4AA 3LLVA 4Q3NA 5ENDA 3VZPA 4YYZA 4PG7A 2OMEA 5COBA 4KTVE 4GLOA 4II2A 5G0UA 1XSEA 5JNLA 3C8MA 2OO5A 2DPHA 1GYQA 5B4VA 1KC3A 3JQAB 4M86A 4JQCA 1LUAA 3CH6A 3QRWA 2IODA 2OBNA 4MVJE 1J6UA 1U28A 3AUTA 2Y1GA 4IDEA 5IG2A 3MZ0A 4K6FA 4EI2A 1YQGA 4BNVA 1BGVA 1NFQA 5TT1A 4WLUA 1XKQA 4J7UA 4J9VA 4XYLA 4GVXA 3B1JA 1E1MA 1VI2A 3P5SA 3PIIA 1XCBA 5TX7A 1XLTA 4J6FA 4HY3A 3G49A 3C7CB 3E9MA 1ADFA 3BTOA 1MC4A 4N5NA 4NNJA 4RQTA 1P77A 3PJEA 4MVJF 5L3ZA 4MIOA 1CQIA 4QO8A 2HMSA 2HKIA 1VL6A 3D1LA 1X13A 4RVGA 4RPLA 4IDDA 4II3A 4KQXA 2B83A 1ISFA 4W7HA 4ALJA 4M49A 1V3UA 2BELA 3WIDA 1DIHA 1NQAO 4RJTA 1QSGA 3H9UA 2FR8A 3AUUA 3VPGA 3F47A 2O3SA 4ALIA 1QYWA 4IJUA 4MVJI 3I4FA 1DLJA 3KLMX 2FZEA 3W8FA 4AL4A 3H2ZA 3ZNOA 2O50A 2B4QA 2CD9A 4K6CA 3C85A 3WSVA 5L51A 1ARZA 3DDNA 3NT5A 2WM3A 4LISA 1ZW1A 5TC4A 4J4TA 5HS4A 2B35A 4ZQGA 4KDFA 1G0OA 1UP6A 4GX1A 2WMDA 5KOIA 4JLWA 4P4NA 1KBZA 3P7MA 3KEOA 2FPGA 1PQWA 1E5LA 4M55A 2XF8A 4B3JA 1NBOA 3G79A 1E92A 4NR0A 3GZ4A 4I5GA 1ML3A 1QYVA 4NZ9A 1DDOA 1ZZEA 1D1TA 3IQDB 3L4BC 3GAZA 4FDAA 4YJHB 3L07A 4ONEA 3TFOA 1ZMTA 4AJ1A 1KS9A 1Z73A 5KVCA 4AJOA 1IYZA 1N9GB 3BMOA 1U9JA 4H7PA 4GH5A 1R6DA 1MUUA 2FR1A 4YDRA 3UAGA 4Q9NA 4UULA 4PLZA 1H6CA 4IJKA 3BMCA 3D0OA 1PZFA 1SB8A 3W4KA 2HCTA 3NGLA 2DFDA 2PD6A 2GN6A 2I67A 3ANMA 1DEHA 2IZZA 5AXBA 3INGA 1JKIA 5THQA 4HFJA 5A9RA 1JVSA
chains in the Genus database with same CATH superfamily
1FFDA 4OBWA 5FOSA 1V5WA 5H82A 4CTNA 3UAXA 3KUDA 1F20A 3F3SA 3RAJA 2O8BA 1QTNA 1ZVJA 4K1XA 4LG1A 4PLWA 4YT8A 5AESA 1V11A 3DE6X 3MTGA 1EVIA 2W22A 3IDOA 1F4LA 1NJ6A 2W6IA 1C9MA 1HRKA 2WVHA 4OI0A 4RSGA 1WVMA 4RHYA 3I6BA 2D5LA 2H2GA 2ZBRA 1RXUA 2PX6A 3MTEA 3KR1A 5CT8A 5IM4A 1RPTA 4Q18A 4D1YA 1QKKA 2GXSA 4U3JB 1Q3TA 4WK6A 1N0UA 3G8BA 3TLEA 1UIRA 3OPQA 1VCMA 3VU1A 3LT1A 1JEOA 5DBGA 4BMOB 2O1XA 4F4HA 3A9SA 4BFZA 4YAFA 1U28C 5H3CA 1DELA 1G16A 1Y7LA 2NNLD 5E6SA 1ZUD1 4HSEA 2XKBA 2AT1A 5B37A 5J58A 1G8FA 1NT2A 1NUQA 1SHJA 4MI3A 4RLQA 3O93A 5FI1B 5IULC 4D5GA 4EEXA 2WTMA 3MT8A 4K9LA 3ZYZA 5LMNB 4GE0A 3L8ZA 1A97A 1R5OA 2R85A 4XUDA 1BDMA 1MEJA 2J9FA 2PGIA 4UBMA 1J5XA 4ZT5A 3Q0TA 2A5GA 4IH4A 2JJYA 1DRVA 3U26A 2UXBB 1JJFA 1ZC3A 4Z2AA 5J4HA 1X1RA 1K8XB 4N0QA 3MIZA 4YCAA 3WGQA 5AP9A 3RF6A 1E7RA 2AKEA 2PKRA 2AFIA 1KAEA 5T4BA 1BCSA 2V54A 3BUSA 4FGSA 2Q5FA 3E2PA 3L46A 1TM2A 4FFMA 1XQ6A 2SKDA 3PIDA 3K0KA 1LLUA 4KXYA 3L1KA 3OPYI 2ZJ8A 2UYHA 3TUIC 3WR5A 1TKBA 4LCEA 1JEJA 2B8EA 2HNKA 1IN6A 2IUFA 2P2ZA 2A8YA 2VNKA 3G68A 4OLHA 1BKDR 1V7CA 5EJIA 4OMDA 4UCWA 3WYCA 1ECBA 1WDTA 1YI1A 2ZRPA 4P3KA 2P41A 3ONVA 1KFJB 4TLBA 4RYDA 1DS6A 1YASA 3QEOA 2JLBA 2C0PA 5ICGA 2UZ3A 4BV3A 3BS4A 4DQDA 1NUPA 3E7FA 5C34B 4N41A 2BUCA 4RAQA 3K94A 2QTVA 3EAFA 3X1DA 2R1TB 3IHKA 4P3PA 3K5PA 3PXDA 1M8PA 2HIMA 2YNMA 4CMEA 2VPPA 4MB0A 4RF2A 1DE0A 5A62A 2V3CC 1X1SA 1U65A 4UC0A 4R2XA 1CK4A 3FX2A 2YY5A 3GEHA 3KQWA 5B7PA 5KNDD 5DIFA 3W5AA 2V7QD 2WUEA 3IB3A 3OQBA 2GO7A 4KMMA 1NVXQ 2ORWA 2PNFA 1Y4SA 1NI4B 2HK8A 1MGOA 4F5YA 4ND8A 5JNTA 1TTTA 3OECA 4M1MA 2O8CA 7YASA 1QV9A 3HEBA 4TYPA 3QM1A 3T5BA 4FKMA 4H27A 3H42B 3KHUA 4Y0AA 3EQ7A 3VDNB 3CLTD 1P0CA 4R6XA 4NABA 2D2IA 3HJRA 5ES4B 4HWSA 3S1AA 2DWPA 1B6SA 3ZE2B 1ZOIA 2JK0A 3GRRA 3TSAA 3VDXA 2WSSD 3OTGA 1ZQ9A 3DGEC 1VLZA 2DU8A 2YIVX 3IIEA 4ZANA 5E3IA 4WCDA 1D09A 1OLOA 2OMKA 4RKWA 2WI8A 5FTNA 1UBHS 1IHYA 1Y3AA 2PS3A 2C7PA 1ZW6A 3HU1A 4FW8A 4KFRA 1Q1NA 4MZXA 4B0PA 5JPCA 1E5DA 4RA9B 1QIHA 2R6R1 5CVUA 2WIGA 5BSKA 1WPQA 2V59A 1J7JA 2I29A 3F5MA 3GNQA 2JLAA 3MC1A 4K7JA 1KMCA 3BMXA 1ODJA 3OESA 5DNDA 2HFJA 1JHAA 3MWJA 1WBDA 4Z9FA 4DDVA 2O7SA 4K28A 4TWIA 5AOVA 2PKQP 5BSEA 2EYUA 1KYQA 5KOHA 5KO2A 3NI2A 2CFSA 4P08A 1J09A 1T36B 4ROTA 3ERCA 4TMXA 3RS7A 1X8LA 2Z8YA 1P81A 2AN9A 1XRSB 2GUWA 3F3KA 1QS0B 3OIDA 4YP0A 2DSTA 3FTCA 1OBVA 1P73A 3GGSA 5J5CA 2G9NA 1O4WA 3ZU5A 4GI7A 1GY8A 1AH2A 4EYSA 1L8QA 1C9YA 2HGSA 1N5LA 1P0MA 2FRXA 4D9JA 2PGDA 4F6CA 4H17A 4I99A 1FP4A 2CLKB 1NM5A 2CMGA 1PFGA 1B0ZA 2H1RA 2QG6A 3KALA 4F6RA 4C05A 2B37A 3TLBA 1J8FA 4MRSA 1NNUA 3VTFA 1E2JA 3HV0A 4BQOA 2ZWOA 3K09C 2WIKA 3D0QA 3OQ1A 4RTJA 2WOJA 3LS2A 5JCOC 1X7WA 3OY7A 1JZTA 2GCEA 2YVAA 1ODKA 3KTDA 5AJZA 4B81A 2X3FA 2W7TA 1QVWA 2C4MA 4RUKA 1GXSA 4RZHA 3K73O 1L4UA 4FZRA 4Q9KA 1R5NA 5L40A 4Z0HO 2I9KA 1LBHA 1Z74A 1WSAA 2QVLA 2ZT6A 2YYZA 2G28A 5JMPA 3LBAA 4ZAXA 1Z56C 3WGNA 5KNDA 3D6FA 4HEQA 2V7QA 3FHLA 1JIKA 4LZZA 2EBUA 2J4FA 1GOTA 1L3BA 4LGCA 1BU8A 2ZE7A 4CTJA 1UJMA 3EY4A 1YJCA 3RYHB 2G67A 2VT3A 5KX5B 2A1UA 2M32A 3SDZA 1U8FO 5A6SA 1UWVA 4TWRA 3KETA 1RJ9A 4G0MA 2IZ5A 421PA 4PYKA 3P9RA 3T35A 1UJ6A 4HX2A 3B1KA 3DG9A 1WW8A 1Z7BA 1V3VA 4WCFA 4C87A 3GGJA 2WSSA 4UNNA 4DLYA 3KVYA 2BZ0A 4ZI2A 3SKYA 1QLHA 1MENA 4ZKEA 4I55B 2O2XA 4HH3C 5EC8A 1E4VA 1J0BA 4BEVA 1SUFA 1KZ4A 2Y68A 1Z7WA 3H1PA 3JD3A 4C06A 3GPCA 3U7EB 1E8NA 2H59A 5DW0A 2PL1A 1K6JA 3E4CA 4XGNA 1B16A 1AVTA 4OH1A 1GLVA 5IMBA 3QFFA 1LGYA 3PU6A 2D1YA 2EZ8A 1P2VA 2V4UA 1PI3A 5KU1A 2L69A 4GU5A 3HU2A 1YKGA 2Y4OA 1T2FA 3IURA 1E6KA 2AW3A 2BMFA 2VFAA 3WICA 1ISHA 3PYXA 1KDPA 4J2OA 1C9EA 5FPPA 4BKUA 2RBKA 5JFGA 5KIAA 4GMKA 1KJJA 2QTNA 2MR6A 4I5FA 3G13A 4YRAA 2ONJA 2ZTSA 2EBWA 3OZXA 2Y27A 3PB3A 4OQQA 2WZBA 4ZCRA 1WB5A 1WUHS 1TZBA 2WU4A 3EF0A 2ZTMA 1JEQB 1UJ5A 1ABBA 3A9RA 3TLKA 3A0RB 4GPZA 1DO0A 4RH3A 3I45A 4XJSA 1XWWA 3M70A 5FJJA 4DLPA 4J1NA 2HNBA 4EX7A 1SUEA 5IF3A 2PUEA 4M36A 4ED9A 4MS1B 3KQMA 3GIDA 2GJ4A 1NVWQ 2K7FA 1EZ4A 1OT3A 1ZC4A 2EL9A 3K16A 3W3ZB 1SRQA 3GP8A 5EKSA 4M98A 1W88A 1Y8QB 4Q1AA 3PXGA 1YAHA 3UIEA 2JARA 4AS1A 2WLSA 3DXZA 4WLVA 4D9NA 1G2IA 1NXSA 5E9QA 4INPA 1GZSA 2PFKA 2H1IA 2HPZA 3ACDA 2UYQA 2FZKA 4CM8A 3AJDA 5HIKA 4NXMB 3KQSA 3EXHB 5G0TA 3GFPA 4X9XA 4ZAYA 4CN9A 3Q3EA 1EG2A 1XAIA 5A9TA 2BSQA 1X87A 2JZCA 3FBGA 4LW8A 1JMYA 1QYIA 5DO9A 1YOVB 4U0KA 4TZKA 1W5TA 1RS0A 2OENG 4MQLA 5CHYA 3OF3A 4KO3S 4J75A 3SZ3A 4BU0A 2MMGA 1RLOA 4XIYA 3VHRA 1UOOA 2WWGA 2QRZA 2ZETA 1MU0A 4G0NA 4I2NA 5EZ5A 4DN6A 1DBQA 3W5BA 1PG5A 4P98A 4WZAB 3RI3A 3T4PA 3VVCA 4AY6A 3GBSA 4FYHA 1E0AA 4GBED 1NR1A 1M2VA 2XUPA 4R0NA 3W05A 3ZNNA 1KR2A 2C07A 2VT2A 3EAGA 2Q4TA 1E1DA 1M7HA 4OJYA 1KE1A 3VSAA 2OZKA 4Y2JA 3WBBA 2H2IA 1D7AA 1XP5A 2VZEA 3UHAA 3TLCA 5BN5B 1NQXA 4IHQA 1PT8A 4D81A 3G9XA 4DDKA 1QE3A 1BVUA 2WJVA 3TZQA 2XYRA 5KBYA 2G4LA 4RV4A 2PGAA 3OT1A 3WMEA 2UAGA 1A4RA 3U2QA 3PKJA 4LNUB 2OYSA 1FE8A 1IUOA 1XTBA 4MJLA 4R68A 2VTBA 3DJYA 3RUDA 5KNBH 1Q6YA 3BK1A 3EQ9A 2XUQA 2BBOA 4ZJYA 3BB4A 1C7JA 5F3RA 3H5WA 4PGAA 2I7TA 5K0CA 1GTVA 1QHHB 5CT6A 4BO4A 4XUCA 1ZESA 3C3CA 4EA8A 4EB3A 4Q4HA 2FSGA 3P9QA 3QELB 4CGZA 1DTWA 3BBPA 1T10A 1CJMA 2Q6LA 3VPXA 4BMXA 5IKXA 4M9XA 4DCMA 3KFLA 4KZPA 4XFKA 3G5MA 2WYVA 2XADA 3RWBA 3DXYA 2D2VA 1E2NA 4YHHB 5AQ1A 3DAYA 4CKEB 1JFVA 3R0JA 1J39A 1HTBA 2OVFA 3O74A 4TV8F 3OZBA 4GLJA 3VZSA 4BO3A 1MHPA 3K72B 3VH4A 4GFDA 3REFA 3TDKA 4H1HA 3SJ7A 3ADDA 3DE5X 3DBVO 2GHTA 1DAIA 4RELA 4B3HA 1JH9A 1OH7A 1XPJA 3W5UA 3KXPA 4IY1A 3BD7A 1FYEA 5U4XA 4RIEA 3WXBA 4F1KA 2QYTA 3WGMA 4JBHA 1YZTA 3BXHA 4ZT3A 3WLPA 3LPLA 1DJPA 1LTQA 2AI1A 3AHJA 3TSOA 2OXIA 3VNAA 3F96A 2IYWA 5IK2A 3WQRA 3SBEA 3ZNQA 3PC4A 1V35A 1TT7A 3AVOA 4MAMA 1O2DA 3ANTA 4A92A 4CLRA 4U5QA 5E4TA 1SBYA 4ESOA 4JYCA 4MIYA 4W5JA 4CNQA 3BXFA 1VLLA 2VPIA 2RHTA 3DONA 3A6GA 1X0VA 1V1RA 3O95A 3KOYA 1FRVA 2P9TA 2A35A 2VAPA 3DYBA 4JT8A 1KEKA 5K7SA 1C3OB 2JF0A 1O9BA 1CZLA 2UUPA 3LBYA 4KKVA 3F6PA 1O6BA 3C16C 1FNMA 1Y89A 3UCXA 4Z5XA 4QDOA 2HEIA 1PDVA 4TS4A 4AYXA 2EJTA 2YOGA 4I5IA 4OU5A 3BRQA 2B25A 4FWIB 3K4QA 4GZLA 5FTLA 4M89A 3LH5A 1MC1A 3DB2A 2PUAA 1NJGA 2BKEA 4G97A 4AY5A 2Q3HA 4BNIA 1OYVA 3CNBA 1NQOA 3I37X 4LC1A 2ADFA 2W90A 2ZVDA 1A9QA 4GUDA 2PQ2A 1C1YA 1XNHA 2WJHA 2ZLBA 4N3CA 2FZWA 2GETA 3E5RA 3SNKA 4NONA 2H9IA 3ZZMA 4CBVA 1N1EA 1J24A 4BBPA 5G41A 2GCPA 4O4HB 1D9ZA 4KK3A 4B5KA 1LI5A 2HDWA 8OHMA 2O19A 3GZJA 4HTFB 1AQYA 3O0TA 1XOIA 5BPFA 3QF4A 3UHPA 5LUAA 3KEQA 1JDBB 1OFGA 3MJCA 4QGHA 5F51A 4X94A 5ITVA 5GONB 3GVXA 5EINA 4ARVA 1AF7A 4PHCA 1F2UB 4C07A 3FPEA 4BNKA 3HZRA 1XEAA 5AQEA 5EVJA 3C1OA 1DKLA 4G09A 1T1RA 3UHOA 4C2AA 2JKZA 1A9TA 2ORIA 2QTLA 3SD7A 3EIQA 2GCIA 1I1NA 2PS0A 3AEUB 3TB4A 2AXNA 3TPFA 3NHMA 3YASA 4ENVA 3HNPA 2P7IA 4IWYA 3S8MA 4YMVA 1TM3E 2HSWA 4TPKA 1I4TD 3DKKA 5FQOA 2IYVA 1B3BA 2R4UA 1GYPA 3NALA 2NVUA 2DHCA 2ZUFA 5DRYA 2ORYA 3GEPA 1KY2A 2QMEA 1UJCA 1E7QA 3BJRA 3BBLA 1TO6A 2ZQ5A 3NRCA 4HO1X 5BRJA 5JAIA 2CHUA 1RPAA 2B4TO 3GLSA 4XQGA 2FZVA 1XX6A 4HAOA 3I3SR 1ZRNA 4WN3A 2AWNA 4H16A 4RTOA 2WIBA 4NU6A 3H4MA 4NICA 3TRIA 3OIGA 4QYXA 5LC1A 3R7WB 3IPRA 3PGKA 1NN5A 4KX3A 4GP9A 4M7WA 3H0EA 5JDIC 2AFHB 4LTDA 1H93A 2W9XA 1LCIA 2Z2JA 4MQFA 4F8EA 1DJMA 3W2GA 4HT3B 4PU0A 3CPEA 1NVKA 4DFDA 3UUGA 5JZOA 1MB9A 4IQ0A 4IRMA 1EA5A 1CHNA 1XD9A 5JT1A 1VL2A 1QK3A 2Q99A 1Q77A 3JQ7A 3L1HA 1WHSB 6GPBA 2LCIA 5AT1A 4MWDA 4BE7B 5FV4A 5FEMA 3GG2A 3GOHA 2B8JA 2XZPA 5CPFA 2CXOA 1Q2XA 5CLFA 1GT91 4GE3A 5KDDA 1P3DA 2RHGB 4ZOBA 5AXDA 4DC1A 4DV5B 2FR0A 4DVGA 1FVOA 4DKXA 2J46A 4P86A 4CIYA 4MW1A 2FXIA 3JQ8A 3CEPB 3PPYA 2N46A 1MO4A 3F3YA 4E08A 4IDBA 4LV8B 3SKXA 4ZQFA 3KZVA 1C80A 4F1WA 3CLUC 4B3TB 3OPMA 2HB6A 1XVUA 4KO4S 4C76A 3QKWA 1RNLA 3ABOB 3CN9A 1X74A 4Z7NB 4H4CA 3KZXA 3ESAA 3NJRA 2JIRA 1R9GA 4KIJA 4WV3A 4X65B 2CJWB 3ZVMA 3NJ8A 1SKYB 5IABA 3INYA 3GXBA 1N1DA 4HDMB 4XI9A 5E8RA 3HKCB 3S2SA 1KHTA 2P40A 3ETCA 3NAQA 2JI6A 4DIUA 2NUAB 2WD8A 1Y0BA 1UPTA 1WMBA 1YL6A 2R8BA 2X23A 1EVJA 4PWZA 4JZKA 5F78A 3H8WA 1Z13A 4UM9B 5JY6A 3ML1A 3WTBA 1PS0A 2YOHA 4LJ5A 1QDLB 3KQKA 4LDAA 2OAEA 4CKWA 3AHEA 3IUNA 1NP3A 1COZA 3LUPA 3QX7A 3SLGA 5B1HA 3NOQA 4F9GA 2VYCA 1A7KA 1TD9A 4C08A 3G0CA 4L0MA 2ATIA 1WXQA 5CM8B 5BSMA 2K7ZA 2GJ8A 3U81A 4EHLA 3PI7A 2XLCA 1B3RA 2ZEJA 2J3EA 1CUBA 3D0RA 2YJ4A 4N39A 2OPBA 3E23A 2IYYA 5GV7A 3VR4D 2YFKA 5CEEA 1CJKC 2DH6A 2BF4A 3ND8A 5A3RA 1HLDA 2OM2A 3W1WA 2Q2WA 2W5UA 4ZYYA 5BOSB 3MHTA 3CT6A 3M5CA 4TV8A 2CF5A 3SG0A 4QFDA 3T95A 1PSWA 4GZ5A 1Z2PX 4XWAA 1WZ2A 2IJGX 2IEGA 2OWDA 3TLJA 3L8FA 3PEWA 2YJNA 1BNCA 1UBJS 4FVTA 1PJAA 1WWKA 2CCKA 3Q5EA 3R1IA 2J7KA 1L5RA 1TI7A 3BKXA 1CB7A 4NV3A 1EVEA 1OD6A 4KQIA 1IXSB 2VDLB 3DQZA 2M6LA 3DDWA 4DLNA 2H6EA 3PA6A 5DEOA 5JZVA 3T3NA 1QR2A 3LQFA 1JAIA 4LGMA 1R8YA 4Y1EA 2GBFA 1WQ1R 1X7HA 2VHXA 4TV9B 1RADA 5AICA 1NKSA 1RM3A 1H5NA 4LNAA 1T9GR 1I13A 1OKKD 5CCDA 5JANA 5K8UA 2G1PA 5UKDA 3RTBA 4KWHA 3WL7A 3A4MA 3FKQA 4BJ5A 4YCNA 3W6UA 2ILVA 3EC2A 2IYUA 1QOZA 3HCRA 1GUDA 5AVOA 3D3QA 4LV6A 5CB4B 4NS4A 3LW8A 3QOXA 4FQ8A 4TWAA 4NE7A 4AYTA 5KWSA 3FPSA 1MG5A 2QAGC 1VCOA 1Q0RA 1UK7A 3DVRX 3T99A 3V2HA 3DHVA 2NPIA 1TCVA 1IK4A 3FG9A 3IJRA 4RK5A 1SZJG 2WY2D 3IVGA 4RY0A 2QD3A 4O3FA 3KAPA 3AY0A 5B2EA 1PL6A 3GGDA 4PRLA 1D2NA 1QFJA 1ZOSA 4S1TA 3KYCB 2OC9A 4Q16A 5HUHA 1Y1LA 3ILSA 4WNYA 1FF9A 3FTPA 2ZUUA 5LQKA 1JL3A 4MQMA 4MTLA 1L4GA 2PEZA 2Z4TA 4AB1A 4ROSA 4TUYB 4LYFA 2GPSA 3WKBA 1JQEA 2QW0X 3A1WA 3QITA 4HDNB 4WQMA 5BV2P 5H59A 1VB5A 3PQFA 4UU1A 4UTZA 1PUJA 4TLLB 4ND1A 1LLFA 4QYTA 2VPTA 4B2IA 1H2HA 2WJYA 4PN7A 1TU0A 1ZLYA 2IHYA 2OP1A 2Y1EA 3C41J 4LXHA 4PW0A 1W7AA 4PIVA 4L8LA 4YAUA 1PEAA 1RHUA 5F1YA 3F7TA 2N47A 4JI8B 4JC0A 4LKRA 4NK4A 1GFWA 1XA0A 2KLHA 4PVCA 4ZTBA 4BVEA 3PWSA 4LZLA 2GT1A 3VR4A 3F4LA 4GRAA 4W5HA 3B6ZA 1QDEA 1WCIB 5KOYA 221PA 4UEJA 5JBIA 4GWKA 1AB5A 5HYVA 3DTYA 3U62A 2VCHA 1BXGB 4N4AA 2OFWA 3OZIA 1UMKA 3Q9LA 2G0TA 3CNNA 4RO0A 3T7TA 3BM5A 5KKNB 2PKXA 4L08A 4E22A 4MI6A 1QG0A 3OIYA 4KXVA 5BQOA 4BP9A 2CSUA 3PJDA 1Z15A 3C6ZA 4CKZA 2CCJA 3A27A 1HM5A 3AZOA 4LJRA 2HJRA 2BMEA 3W2TA 4OHKA 4D3XA 2XI4A 2G1JA 4YRMA 1EFLA 3RYIA 4W7SA 4AZ0B 1VOTA 2XGMA 3C4VA 3TX6A 3LZ6A 3OUTA 2Q4RA 5L7WA 3D7RA 1TUGA 5TQ0A 1RRVA 4BWGA 4EYOA 2V6FA 4P22A 1Q11A 4QRHA 1YR2A 4CKCB 1P2TA 1ORDA 1OKKA 4QGSA 2ZAIA 3ADKA 2XUHA 3G0HA 3VAZA 2YZKA 3LXUX 4RLFA 4BHTA 5JMWA 4MULA 3GLHE 1B23P 1Z0KA 4F56A 4IUYA 4B2LA 1TA4A 1X14A 5JCOA 2DTDA 1JGTA 3RIYA 1Y3DE 3NTUA 4BUZA 3RW9A 6AT1A 4R5MA 4X90A 2OLEA 4R71A 1YZGA 5DN6D 2X5NA 3W9BA 1DOHA 1Z22A 3NVKI 1T0UA 1PZXA 2ZVJA 3D4BA 1UBGA 1L1EA 4UUBA 3GA5A 1KQFA 1G20E 1I2CA 1B76A 2XUOA 4OSPA 2IS2A 2OO7A 3CKKA 1POXA 3ORSA 4HB4A 4RHEA 1Z25A 2HGZA 121PA 4IS3A 2N3ZA 3TVTA 3ENWA 4YAIA 4S05A 3ZIDA 1HI9A 1TEHA 1AHNA 1RQXA 4QGAA 1VGRA 2NTYC 1UWKA 4IHJB 4ND5A 3NNSA 4IOMA 1N0IA 1GHTA 3ICCA 3CWQA 2PAFA 1C9JA 3H9EO 4GAEA 4IYRA 5JH7F 3X2EA 2FW9A 3Q3JB 2NQ8A 2QE7D 4KLAA 1GG5A 2DOKA 4QU9A 1FJ2A 3OZUA 1LSUA 4C4ZA 1ZKMA 3HDHA 1GTMA 2Z3WA 4LZOA 3M0EA 2CNNA 2DR2A 5ED4A 4UZFA 2OWEA 3N9IA 3IKMB 2FFAA 1AGNA 1J0AA 1G60A 2QSZA 5EA2A 3GDOA 5E8JA 1ZJZA 1O57A 1OWLA 2FPUA 3WYEA 3NHYA 5G1PA 5DVZA 3KUKA 2H1LA 1KK3A 3H04A 3FSEA 2I4MA 2C4WA 3FWYA 4M0LA 4NBNA 4UDNA 5LP6C 3WKAA 1SVLA 1ZH6A 5ER6A 3HV2A 4TSRA 2WIFA 4BUCA 5ITSA 4AY2A 4Q12A 1MVNA 2JAHA 1SIOA 4DJAA 3VZDA 4KQGA 5KTSA 1UPAA 4G5OA 1MXFA 3ZWQA 1U0TA 3FJOA 5HKOA 1GUAA 4RSHA 4Y2YA 5K0EA 4EDHA 2GQ0A 3CLRC 4EF6A 5LQUA 2JANA 4TKLA 3UPTA 4MRVA 4IBOA 2NSJA 1Q1ZA 2PRSA 3JQQA 4X7MA 3RDPA 2WAMA 4UNQA 3WKCA 1Z39A 5JDCA 4FX2A 1UBOS 4LWOA 5LLSA 1ZM2A 4G01B 4QQNA 1QHYA 4YIHA 1ZHOA 1UBEA 3Q9SA 1ZK2A 1T0JB 5FTJA 1T6ZA 2OOKA 1L7QA 3BGVA 3WGHA 2PKWA 5KHLB 1VBNA 1RRKA 1AV6A 4IZIA 2X7JA 4PXAA 3TOXA 4URUR 3MS2A 3FFTA 2D1TA 1O5IA 1Y5NA 3G85A 4O4JF 4QYSA 5ALDA 1TYCA 4C7XA 5EZYB 2AUTA 3DE2X 4QD3A 1I0ZA 3ZHBA 4BAGA 4EHHA 5AFSA 4G5FA 5EHQA 1T0PA 4ZVUA 4AQDA 2C03A 5FUBA 1XRMA 2HRCA 2VL7A 1DXYA 5F7ZA 1ISMA 1CERA 5HOQA 1FNCA 1OBOA 1W4RA 2Y1KA 3H1AA 4FFLA 4NBKA 3G7NA 1OB2A 4FOPA 1JJ7A 3AM3A 3DP9A 1GTL1 4ENSA 2YXEA 5E1DA 2DBQA 2IEZA 4A36A 3OEED 1T5OA 5DN6A 4G0WA 1QHEA 4BO7A 2R87A 3EG9A 3M83A 4H6XA 3A1NA 2VVTA 1C4XA 2LRHA 1PFQA 3LIIA 4OGGA 1EX1A 1G5RA 3NBFA 5T41A 5CXQA 4DCPA 1YDEA 4F3TA 3RBAA 4DJJA 2PKQO 1GTZA 5MFZA 1RI2A 1J4AA 4H3KB 3BD9A 3HACA 1CUXA 3JTEA 5A4MS 2PZ8A 3R3VA 4GSYA 2XTZA 2O5EA 2DTXA 2QQ0A 2Q50A 1NT4A 2SKEA 2ZYHA 1M10A 4ITUA 3V8NA 3ESXA 4MMYB 1FZQA 4Q1EA 2LGJA 2QE7A 3D5EA 4IG4A 1UFRA 2GHRA 2ZOSA 4FMCB 4JCOA 3TJMA 2VSYA 1YQXA 1D2AA 3OZ7A 4IGIA 3HBNA 1U7XA 4BMDA 1MO3A 2C2BA 4UREA 4W63A 2ZDQA 5E2AA 3WDKA 3I6MA 5B12A 1KAGA 4QX6A 1RVV1 1OJ7A 2NZYA 4OBXA 3FUWA 1E79D 2WDPA 2FPLA 4J0IA 4QDXA 3W5IA 1O0SA 4KN8A 4GQBA 1QCCA 2VT6A 3BE6A 1JEDA 3KSUA 2NSYA 1QIIA 3SX2A 2FPGB 1UKAA 4V2IA 1QH1A 2BC9A 5C31A 3FTDA 3B1YA 2G17A 4IP0A 1WL8A 2X1LA 3VAAA 4PS0A 4PHTA 2OYCA 2IYXA 3TTTA 1QH9A 3LAWA 4HPWA 4K88A 3T0IA 2OL4A 5TJHA 1Z8NA 2R1VA 3C39A 4BFYA 1QRUA 5KSOA 3C0KA 4XGRA 1ZMRA 2XWSA 1PU2A 3E3MA 3E6AA 3PNKA 1EB9A 2RGWA 4J07A 4AU1A 2FLVA 2RBEA 3OURA 3FYDA 1QZ3A 2OAQ1 4A8JC 4C7KA 4WKBA 3WRXA 3SC3A 4RXUA 1K4KA 1L6IA 5AJTA 3T1QA 3I5YA 2AOTA 2WB4A 2XBUA 4MI1A 3WKEA 3A1VA 3AUSA 2FFRA 4PC2A 3HXTA 4L76A 3M4ZA 4X63A 2OXTA 3PTZA 1OFIA 2IX9A 3RRNA 1W1UA 2QMHA 5ILGA 4LRYA 4UTRA 1IBMB 1SAYA 1HH4A 5JLAA 2G40A 4N76A 4ND7A 1AHHA 3VPHA 3NC1C 3GARA 4PNEA 3VA7A 4AURA 1YZ3A 4XGKA 2VF4X 3UMRA 4EG1A 3J7AC 5CVEA 4I2VA 1DZ3A 1KY4A 3HY4A 5DYTA 4DT1A 3DXXA 1EVQA 3QVTA 3SIPA 3OEEA 3MNFA 1A7UA 1F9EA 1GTJ1 3PIRA 4LXQA 4C0BA 5CBPB 4FOTA 4HFNA 4MK4A 4D0NA 1JPJA 3DKIA 2I22A 1WV1A 2PLAA 1KFKB 4X41A 4EKIA 2FPMA 5JD6A 1JDVA 4DCVA 1VKJA 4JP1A 1O9GA 1FUYB 4XDHA 3LQ2A 1T3SA 3DVLA 5BRAA 3OIFA 3G1TA 3UPDA 2WD7A 3L7BA 4FB4A 2J09A 1WVIA 1V3QE 4GKAA 5E1OA 1H4SA 4WHMA 4OHRA 3B36A 3VTKA 1R4NB 2HJSA 2OBXA 4J0CA 5BNIA 1EVYA 4PXYA 3AI1A 2A7QA 1JHUA 3F78A 1J7KA 4QGFA 2YV2A 4PZAA 3U7JA 4CUZA 4MP3A 1L5MA 1F14A 3L7NA 1W94A 1ORVA 4E5SA 4V24A 2AJTA 4WNAA 3CF2A 5AK5A 1Z45A 1UDAA 3SYRA 5BNWA 2C2WA 4ODIA 5DM0A 5IC5A 3S2FA 2O05A 3GLHA 2CLDX 2WF8A 3QJYA 5LYJB 1Q3KA 3ZY5A 3ASYA 1E3WA 1ODCA 5JH7A 4KLRA 4TQGA 5JCZA 1HQCA 3WI7A 3LZCA 1E79A 3BL5A 3RU2A 3KFXA 4CQLB 1E3SA 1G20A 2B6NA 3PVCA 2W2NA 2G08A 1K92A 1V95A 4YX9A 1WXWA 2P4EA 3ACCA 4ZZIA 1I51A 2YC4C 2N1BA 3DPIA 1NFFA 3LXXA 4U9HS 1F0PA 1GD1O 1MOZA 3OY2A 1RTKA 4HBZA 3HA7A 2YUTA 1T9BA 3HCWA 2HLNA 2ANCA 1JLSA 2CJXA 2KM1A 4PFSA 4IWXA 4U1RA 3RS9A 4NENA 1AUQA 2A5JA 4BEJA 4QTYA 2JH8A 5HJEA 2Z8XA 4IMRA 5A4FS 1ZYUA 1PN3A 2JC3A 1XZEA 2FEXA 1AKQA 2VHVA 5CM2Z 5ILQA 2BHLA 4N5DA 2FX2A 2IHZA 3FFAA 4IIFA 1RP1A 2C00A 2HF7A 2DBYA 3H7IA 3EQ2A 1TPYA 3VH1A 1BHO1 3A32A 5K4AA 3ZXYA 3ZHRA 2FP3A 1I1OA 2WM8A 1S5PA 1XDDA 2ONYA 5DNWA 3HFSA 4FS8A 3T9AA 1VLMA 4AZSA 4EUFA 1MH9A 2QP4A 1ABEA 2J5QA 4K5QA 4UMDA 3MS7A 3MFQA 1RIFA 2AYYA 4N8DA 4QLAA 4DIEA 3PR1A 3DL0A 3P5BA 1BA2A 5SYAA 2R8OA 3WLMA 4CQMB 4OLBA 3KKEA 1N2CB 4AXXA 2BMJA 4O4JA 1I3NA 1B0PA 1I80A 1KPIA 1K06A 3KIPA 4FK8A 4BNDA 7ABPA 2MDTA 2D4HA 2HBZA 4PC7A 2ZS9A 4UTOA 3NVDA 2F55A 2E0IA 4TXHA 1U0BB 4FFDA 4TTVA 3WLSA 5AM3A 1L5FA 1MQSA 2VJYA 2X0KA 4KGZA 4O1MA 3TW6A 2HXSA 2PUCA 1H42A 1MCZA 3EZ2A 1QFYA 4UNSA 3BSSA 5T67A 1N4DA 2Y8EA 1DP4A 4IIEA 4Q3AA 3UMMA 2VDRB 5ITZB 4JXXA 3LJKA 1KL7A 5AK6A 5JRDS 1CS4C 3TKYA 5C3MA 3D7SA 4OTZA 1CLEA 4Y2RA 1QX4A 2JFQA 2NYUA 2XMBA 4MGZR 1RYBA 2HQSA 4FEGA 2GCNA 4MCAA 4Z4GA 1X1TA 3BXZA 4EHBA 4JBLA 3NEPX 3KR0A 3R5HA 3URMA 5KQPA 3RRYA 1CIVA 5C5EA 2VQ3A 3R4CA 4LEIA 4C3UA 2IW1A 4LPKA 4ILEA 2YXNA 4OQZA 2E5LB 1T26A 2Y4NA 1B6RA 3JQ9A 2PUWA 3H5IA 5CUQA 5LBIA 4AJ9A 1FS5A 3QMMA 4OHXA 4QXPA 4ZXFA 4LF4B 4DR6B 1EJ0A 1NRJB 1SCBA 3EZ9A 4JHLA 5BSVA 2VTEA 4CEIB 3TLXA 4TYMA 2PRKA 3FMFA 1GZUA 2A4KA 2PT5A 2XVXA 3W5VA 2FWRA 3RT7A 3VR5D 5H68A 3VI3B 4B85A 4J4BA 1KJ8A 4XLTA 3RUAA 1M2OB 3NHUA 3R2JA 2B4KA 3OETA 4HSGA 3GLFA 1JEYA 1Q0ZA 4LUCA 2PXCA 3S2ZA 3A36A 3TR0A 5L6MB 4EA9A 1QFSA 3J81k 1CY8A 3OZRA 4KFUA 1VZ2A 5DT9A 3V4FA 4M1KA 5TXGA 1VRCA 1KKMA 3C70A 4FI3F 2C5FA 2VCEA 3K0AB 1XU7A 1SUAA 3MTIA 1O8CA 1CS0B 4QJ4A 1LWOA 3IX7A 1Q7BA 4GI3A 4QVKA 5GOZA 2PU5A 5E6RA 1HBJA 4Q01A 4HMPA 1DX9A 1KAHA 3VJMA 4BGUA 4H1VA 4KFCA 1ZK3A 4X66B 4JLSA 2BGNA 1KKUA 2J5BA 4AN1A 4D3FA 3IXQA 4MUEA 3RODA 1J0XO 2H57A 2Y92A 3ONDA 1IQUA 5GP1A 3SZLA 2XYQA 4NMMA 3E5NA 1MN6A 4I4TB 4HL6A 4L27A 4DIMA 1JKXA 2QK4A 5JFOA 4REMA 4L4UA 1UT8A 3AR4A 4HAWA 4GMGA 1BCRB 1D1QA 3H75A 4H6VA 3MWGA 4NC9A 2BEUB 1JFSA 2PBRA 4GKKB 2WHXA 5MGNA 3K9WA 2JLSA 4PR3A 4YAJA 3O3NB 4FIDA 4WJKB 1RXSA 3P2YA 4CM7A 5KX5F 2GVDC 4TRRA 1SEPA 2ZXFA 1UQTA 3OU7A 3ZHZA 5DBIA 1LBSA 2JFPA 4OLJA 2RHBA 3RVDA 2OVBA 1ZMOA 1GEGA 3U3KA 1VHTA 4Q48A 4UM5A 2Q3FA 1ZU4A 2R8ZA 1RWKA 3BXXA 3NOOA 4LJAA 4RJKA 5HSGA 3NT2A 1GUBA 2XTNA 3Q0EA 3DZIA 3P2OA 3F8WA 3IPCA 2W4IA 3LCRA 2WLTA 4L16A 3V42A 4EYEA 1X8XA 3CF4A 2FSVA 1X1QA 2JFBA 2IYPA 4QFMA 3UYKA 1EJ6A 3KSZO 4J2TA 1Z4NA 4RMGA 3ZD9A 4C6RA 4U3JA 3EPPA 2IC5A 3CF0A 2P7HA 3AHCA 4KO1S 5C1DA 4CTMA 9ABPA 2VEDA 2GZMA 4JYBA 2FOIA 3UXYA 1SG6A 2YZ2A 2ZUTA 1Z8FA 4B6RA 2MR5A 1JN0A 3S0JA 5BWBA 2AJLI 1BTOA 2WU3A 3RRMA 1K88A 4PF1A 3VPSA 3WY9A 3IKTA 1FW8A 3TNYA 2OILA 1HMYA 2UZ1B 4U2EA 4YR7A 3G23A 3PFHA 3QPBA 1J33A 3ILVA 3RK4A 2I4NA 3VR5A 3DJFA 2DTEA 3T9BA 1U3TA 3UZUA 3TLMA 3D6HA 1JQBA 3EFOB 3GA0A 3R4VA 5K01A 3B12A 1OREA 4GRDA 4BNZA 4KXUA 2YVLA 4B3CA 5KZMB 2NV0A 4GC5A 5FWXA 1SCKA 2HMTA 4LYJA 2QUHA 3VR6D 2GR9A 1GRVA 1I3LA 4YV0A 2D0OB 1QGOA 3GD5A 1FP1D 3PZRA 4ER6A 2Q1WA 4A1OA 1PV4A 3DT6A 4DMUB 4FU0A 4OKSA 2NXNA 1ULUA 4Q93A 1Y6GA 4AG6A 4FX5A 4AVYA 5T57A 1REQA 1U2DC 4UJ3A 4TL8A 3ZDEA 5A3QA 2IUTA 3TEMA 4CL8A 4DA4A 2FQQA 1YK0A 2VRNA 5I47A 1AN9A 4G25A 2BKLA 2QMOA 3FCCA 5L4SA 1PJZA 4O2RA 1GU7A 2DQZA 3I83A 3PQ2A 4IO0A 4WZAE 3V1UA 5AI0A 2PCJA 2C2OA 3G2NA 1L7OA 1YS9A 3LW7A 3NTOA 4GOJA 4I8DA 5DHUA 5FTWA 3TGLA 5CDTA 3S1LA 1PLKA 2WV9A 1QR6A 1O0BA 3PF8A 3HXOA 1T34A 3CLRD 1ZD5A 4N47A 4MWZA 1Y9JA 4JASB 1DTSA 4YBZA 4FMDF 5HCIA 5JCJA 2W6QA 2CW5A 4ZVKA 4DSOA 3NAMA 1TVCA 4EG0A 4NCAA 1EHYA 2ZBUA 3UFXB 3W6OA 4BLUA 1NI4A 3OTOB 3IVXA 4DF3A 5KQMA 5ADHA 1RPNA 4Z99A 5DXJA 1DBWA 4CFZA 2QZJA 2WK1A 2I1VB 2ALJA 4IEFB 3ABIA 5L3VA 2ZR9A 2IPAB 4WPGA 3T7CA 1MNQA 2HIAA 4JR1A 5KSYA 1EFVA 4DYDA 1FL9A 2XCSB 1WX1A 4ES6A 1W49A 2QQEA 4G2TA 4HEHA 4IICA 5C4GB 1XNGA 3W5SA 3AZPA 3CH4B 1T3LA 5HW0A 4KVZA 4LOHA 3K0HA 2QPTA 1BWRA 2RH8A 1UM9A 4KU4A 2WBLC 3H2BA 1RC1A 4EHJA 4UU0A 2QTTA 1N78A 1RYHA 4GWLA 1UC5B 2H7VA 1CX9B 5CEFA 3B1FA 1I2DA 3DT8A 3T3MB 4WESB 1P9OA 1OAOC 3PL5A 2CV2A 3F2IA 4RV5A 3O8BA 4OV6B 2WZDA 3A05A 2AUNA 3NNNA 1SVNA 5FKJA 1KXJA 1Z6PA 2B9EA 1NP6A 1Q6ZA 3N3AC 1HY3A 3JWJA 1KP9A 1ATZA 1VP9A 3CSUA 3Q7TA 3C1AA 3VR6A 3ZVRA 5HZKA 3N2GA 5GM2A 2R47A 1QS0A 2B3DA 1A5AB 1TCUA 3DDOA 2DX7A 4HZUA 1YRWA 1HZJA 3MWKA 1E6MA 3KZ1E 2DVMA 3MRSA 4Z3DA 4LFCB 4Q9AA 2PUVA 2QL6A 1T8PA 3BXGA 5FULA 3OQMA 1R16A 4AXBA 2O8DA 3V8RA 1LZKA 1U2ZA 2NZ2A 1QZTA 2CHEA 1GGVA 1G5HA 1S2DA 1USUA 1D2RA 3BL6A 5D5PA 4E15A 6CHYA 3R7NA 3PV0A 3ULKA 4BFWA 1IMJA 3V80A 1JECA 2I6QA 3HABA 4F3CA 4W9MC 3WLKX 2G0AA 3F74A 5IPFA 2X5KO 4OHFA 1WEKA 5REQB 4NFHA 3CUWA 3ZX4A 4HVCA 3L4JA 4L73A 2WQ6A 4LOAA 5T5QA 3FRHA 1SG0A 1YJ5A 2ZJ6A 2NPOA 3RVLA 4QBHA 3UV3A 2BFDA 3GEBA 4EY7A 3WISA 4LHXA 4EGCB 3FDZB 2P35A 3N2YA 4C7MA 4B1FA 1P33A 4V0QA 5HF8A 3TLYA 3LHFA 4EI7A 1A7AA 1KGDA 5B3KA 1DIOB 1QBGA 1JEEA 1AGXA 5CIQA 5DU2A 3ZWMA 4DLSA 1Z63A 5FA5A 1WY7A 2FRDC 3MJFA <