3PQRA

Crystal structure of metarhodopsin ii in complex with a c-terminal peptide derived from the galpha subunit of transducin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
326
Chain Sequence
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of metarhodopsin II.
pubmed doi rcsb
molecule keywords Rhodopsin
molecule tags Signaling protein
total genus 121
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
A PF10413 Rhodopsin_N Amino terminal of the G-protein receptor rhodopsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3pqrA00
3UONA 5H2MA 4DAJA 1XJIA 4XTLA 1F88A 3WQJA 1R84A 1L9HA 3OE8A 4XT1A 1AP9A 3HAPA 3KJ6A 3BVDB 4GP5B 2F93A 4EA3A 1KGBA 3RFMA 4BV0A 4GYCA 3VVKA 4A4MA 1FBBA 5H2NA 1BRRA 4FPDA 1H68A 3QBKA 5J7AA 3CAPA 1VGOA 3DDLA 3SN6R 1UAZA 5B34A 4G72B 3DQBA 4QI1A 3X3CA 5KKHA 2R4RA 2I35A 4KLYA 3VG9A 1PY6A 3UTYA 5G2AA 5B6ZA 5TGZA 5AX0A 5B6WA 5H2PA 4EJ4A 5AWZA 3QJVB 1KMEA 5AZDA 2YDVA 4KNFA 2YDOA 3COCA 4BVNA 4LDOA 5DHGA 1FBKA 1S51A 3OE9A 4MD2A 4G70B 1KG9A 4K5YA 5A45A 5A8EA 1JV6A 4L35A 5ITEA 4HYJA 5G2DA 1P8UA 2VT4A 1F50A 2HPYA 2QPEB 1S8LA 1E0PA 2YCYA 3D4SA 5B0WA 5G28A 1R2NA 3QJTB 3UG9A 2EI4A 1M0MA 2WJLA 4XTOA 4WAVA 5ETZA 2NTWA 5DYSA 5H2OA 3S3DB 5EN0A 5FJGA 1KG8A 3NY9A 2I21A 5JJEA 2Z55A 4X1HA 5AX1A 1Q5JA 1AT9A 4EIYA 1BRDA 1VJMA 3OAXA 4IB4A 4N6HA 3RZEA 2Y03A 3QAPA 2Y04A 1O0AA 3UTVA 3AM6A 2YCZA 4BEYA 4X31A 2KSAA 3CODA 2Y01A 1E12A 1XMEB 4DKLA 5H2JA 3EMLA 1U19A 4NC3A 4PXFA 2I20A 1Q5IA 4FA7B 4LDEA 3AYNA 4G71B 3T45A 2YCXA 5JJNA 5H2LA 3QJQB 2R4SA 4G7SB 1HZXA 4OV0A 1MGYA 4HWLA 2L6XA 3MBVA 3HAQA 3X3BA 5DHHA 2ZZLA 1X0K1 4MQTA 1IXFA 1GZMA 3AYMA 2RH1A 1F4ZA 3QBGA 2LNLA 1C3WA 4XT3A 4X32A 1DZEA 1PXSA 2NTUA 4AMIA 1JV7A 1S53A 4J4QA 5G54A 4PXKA 3UTWA 5ITCA 1BM1A 4JR8A 2G87A 4G7RB 3S3CB 1EHKB 3UZCA 2Y00A 4GP8B 3PWHA 3VI0A 2YCWA 4G7QB 4IARA 4N4WA 3PQRA 1QKOA 5AHYA 3OE6A 2PEDA 5G53A 3VGAA 3P0GA 3HARA 4QIDA 4UG2A 1QM8A 3UTXA 4HYXA 4DJHA 4Y9HA 1M0KA 2X72A 1S52A 4TL3A 3PBLA 4XTNA 4UHRA 1P8HA 5B2NA 2Y02A 3HASA 4WW3A 5B6YA 3ODUA 3QBIA 3V2YA 1BRXA 3S8FB 5BR5A 1S54A 2M3GA 1M0LA 1X0SA 1LN6A 1PXRA 4JKVA 3QJSB 1XIOA 3QJUB 5G2CA 5LWEA 3NYAA 3NSBA 1TN0A 3VW7A 4GBRA 3OE0A 2ZFEA 1IW6A 1QHJA 1H2SA 3ZPRA 3HANA 2BRDA 3UZAA 5B6XA 2ZIYA 4LDLA 3VHZA 4L6RA 2I1XA 4GP4B 4IAQA 4GPOA 5H2HA 2JAFA 1IW9A 2QPDB 4FBZA 3NY8A 3ZPQA 5H2KA 5B35A 2KSBA 3REYA 3V2WA 3QJRB 1GUEA 4XXJA 4MD1A 5F8UA 5AHZA 5H2IA 2Z73A 2AT9A 2KS9A 3QDCA 3QBLA 3PXOA 2J4YA 3EH4B 3C9MA 5B6VA 5C1MA 4MQSA 3EH5B 1C8SA 3NS0A 1X0I1 4AMJA 2F95A 1P8IA 3A7KA 3HAOA 1S8JA 1TN5A 3ZEVA 5JJJA 3QAKA 4BEZA 4BUOA 3C9LA 3ABWA 1UCQA 5BR2A 2WJKA 3EH3B 2JAGA 3S8GB 5A44A 4MBSA 1JGJA 3PDSA 5G36A 1QKPA 3S3BB 4N4YB 1C8RA 4QRYA 1L0MA 1JFPA 4GRVA 4FAAB 4BWBA 2KSYA 1CWQA 1GU8A 4JQ6A
chains in the Genus database with same CATH superfamily
3UONA 5H2MA 4DAJA 1XJIA 4XTLA 1F88A 3WQJA 1R84A 1L9HA 3OE8A 4XT1A 1AP9A 3HAPA 3KJ6A 3BVDB 4GP5B 2F93A 4EA3A 1KGBA 3RFMA 4BV0A 4GYCA 3VVKA 4A4MA 1FBBA 5H2NA 1BRRA 4FPDA 1H68A 3QBKA 5J7AA 3CAPA 1VGOA 3DDLA 3SN6R 1UAZA 5B34A 4G72B 3DQBA 4QI1A 3X3CA 5KKHA 2R4RA 2I35A 4KLYA 3VG9A 1PY6A 3UTYA 5G2AA 5B6ZA 5TGZA 5AX0A 5B6WA 5H2PA 4EJ4A 5AWZA 3QJVB 1KMEA 5AZDA 2YDVA 4KNFA 2YDOA 3COCA 4BVNA 4LDOA 5DHGA 1FBKA 1S51A 3OE9A 4MD2A 4G70B 1KG9A 4K5YA 5A45A 5A8EA 1JV6A 4L35A 5ITEA 4HYJA 5G2DA 1P8UA 2VT4A 1F50A 2HPYA 2QPEB 1S8LA 1E0PA 2YCYA 3D4SA 5B0WA 5G28A 1R2NA 3QJTB 3UG9A 2EI4A 1M0MA 2WJLA 4XTOA 4WAVA 5ETZA 2NTWA 5DYSA 5H2OA 3S3DB 5EN0A 5FJGA 1KG8A 3NY9A 2I21A 5JJEA 2Z55A 4X1HA 5AX1A 1Q5JA 1AT9A 4EIYA 1BRDA 1VJMA 3OAXA 4IB4A 4N6HA 3RZEA 2Y03A 3QAPA 2Y04A 1O0AA 3UTVA 3AM6A 2YCZA 4BEYA 4X31A 2KSAA 3CODA 2Y01A 1E12A 1XMEB 4DKLA 5H2JA 3EMLA 1U19A 4NC3A 4PXFA 2I20A 1Q5IA 4FA7B 4LDEA 3AYNA 4G71B 3T45A 2YCXA 5JJNA 5H2LA 3QJQB 2R4SA 4G7SB 1HZXA 4OV0A 1MGYA 4HWLA 2L6XA 3MBVA 3HAQA 3X3BA 5DHHA 2ZZLA 1X0K1 4MQTA 1IXFA 1GZMA 3AYMA 2RH1A 1F4ZA 3QBGA 2LNLA 1C3WA 4XT3A 4X32A 1DZEA 1PXSA 2NTUA 4AMIA 1JV7A 1S53A 4J4QA 5G54A 4PXKA 3UTWA 5ITCA 1BM1A 4JR8A 2G87A 4G7RB 3S3CB 1EHKB 3UZCA 2Y00A 4GP8B 3PWHA 3VI0A 2YCWA 4G7QB 4IARA 4N4WA 3PQRA 1QKOA 5AHYA 3OE6A 2PEDA 5G53A 3VGAA 3P0GA 3HARA 4QIDA 4UG2A 1QM8A 3UTXA 4HYXA 4DJHA 4Y9HA 1M0KA 2X72A 1S52A 4TL3A 3PBLA 4XTNA 4UHRA 1P8HA 5B2NA 2Y02A 3HASA 4WW3A 5B6YA 3ODUA 3QBIA 3V2YA 1BRXA 3S8FB 5BR5A 1S54A 2M3GA 1M0LA 1X0SA 1LN6A 1PXRA 4JKVA 3QJSB 1XIOA 3QJUB 5G2CA 5LWEA 3NYAA 3NSBA 1TN0A 3VW7A 4GBRA 3OE0A 2ZFEA 1IW6A 1QHJA 1H2SA 3ZPRA 3HANA 2BRDA 3UZAA 5B6XA 2ZIYA 4LDLA 3VHZA 4L6RA 4DS7E 2I1XA 4GP4B 4IAQA 4GPOA 5H2HA 2JAFA 1IW9A 2QPDB 4FBZA 3NY8A 3ZPQA 5H2KA 5B35A 2KSBA 3REYA 3V2WA 3QJRB 1GUEA 4XXJA 4MD1A 5F8UA 5AHZA 5H2IA 2Z73A 2AT9A 2KS9A 3QDCA 3QBLA 3PXOA 2J4YA 3EH4B 3C9MA 5B6VA 5C1MA 4MQSA 3EH5B 1C8SA 3NS0A 1X0I1 4AMJA 2F95A 1P8IA 3A7KA 3HAOA 1S8JA 1TN5A 3ZEVA 5JJJA 3QAKA 4BEZA 4BUOA 3C9LA 3ABWA 1UCQA 5BR2A 2WJKA 3EH3B 2JAGA 3S8GB 5A44A 4MBSA 1JGJA 3PDSA 5G36A 1QKPA 3S3BB 4N4YB 1C8RA 4QRYA 1L0MA 1JFPA 4GRVA 4FAAB 4BWBA 2KSYA 1CWQA 1GU8A 4JQ6A
chains in the Genus database with same CATH topology
3UONA 5H2MA 4DAJA 1XJIA 4XTLA 1F88A 3WQJA 1R84A 1L9HA 3OE8A 4XT1A 1AP9A 3HAPA 3KJ6A 3BVDB 4GP5B 2F93A 4EA3A 1KGBA 3RFMA 4BV0A 4GYCA 3VVKA 4A4MA 1FBBA 5H2NA 1BRRA 4FPDA 1H68A 3QBKA 5J7AA 3CAPA 1VGOA 3DDLA 3SN6R 1UAZA 5B34A 4G72B 3DQBA 4QI1A 3X3CA 5KKHA 2R4RA 2I35A 4KLYA 3VG9A 1PY6A 3UTYA 5G2AA 5B6ZA 5TGZA 5AX0A 5B6WA 5H2PA 4EJ4A 5AWZA 3QJVB 1KMEA 5AZDA 2YDVA 4KNFA 2YDOA 3COCA 4BVNA 4LDOA 5DHGA 1FBKA 1S51A 3OE9A 4MD2A 4G70B 1KG9A 4K5YA 5A45A 5A8EA 1JV6A 4L35A 5ITEA 4HYJA 5G2DA 1P8UA 2VT4A 1F50A 2HPYA 2QPEB 1S8LA 1E0PA 2YCYA 3D4SA 5B0WA 5G28A 1R2NA 3QJTB 3UG9A 2EI4A 1M0MA 2WJLA 4XTOA 4WAVA 5ETZA 2NTWA 5DYSA 5H2OA 3S3DB 5EN0A 5FJGA 1KG8A 3NY9A 2I21A 5JJEA 2Z55A 4X1HA 5AX1A 1Q5JA 1AT9A 4EIYA 1BRDA 1VJMA 3OAXA 4IB4A 4N6HA 3RZEA 2Y03A 3QAPA 2Y04A 1O0AA 3UTVA 3AM6A 2YCZA 4BEYA 4X31A 2KSAA 3CODA 2Y01A 1E12A 1XMEB 4DKLA 5H2JA 3EMLA 1U19A 4NC3A 4PXFA 2I20A 1Q5IA 4FA7B 4LDEA 3AYNA 4G71B 3T45A 2YCXA 5JJNA 5H2LA 3QJQB 2R4SA 4G7SB 1HZXA 4OV0A 1MGYA 4HWLA 2L6XA 3MBVA 3HAQA 3X3BA 5DHHA 2ZZLA 1X0K1 4MQTA 1IXFA 1GZMA 3AYMA 2RH1A 1F4ZA 3QBGA 2LNLA 1C3WA 4XT3A 4X32A 1DZEA 1PXSA 2NTUA 4AMIA 1JV7A 1S53A 4J4QA 5G54A 4PXKA 3UTWA 5ITCA 1BM1A 4JR8A 2G87A 4G7RB 3S3CB 1EHKB 3UZCA 2Y00A 4GP8B 3PWHA 3VI0A 2YCWA 4G7QB 4IARA 4N4WA 3PQRA 1QKOA 5AHYA 3OE6A 2PEDA 5G53A 3VGAA 3P0GA 3HARA 4QIDA 4UG2A 1QM8A 3UTXA 4HYXA 4DJHA 4Y9HA 1M0KA 2X72A 1S52A 4TL3A 3PBLA 4XTNA 4UHRA 1P8HA 5B2NA 2Y02A 3HASA 4WW3A 5B6YA 3ODUA 3QBIA 3V2YA 1BRXA 3S8FB 5BR5A 1S54A 2M3GA 1M0LA 1X0SA 1LN6A 1PXRA 4JKVA 3QJSB 1XIOA 3QJUB 5G2CA 5LWEA 3NYAA 3NSBA 1TN0A 3VW7A 4GBRA 3OE0A 2ZFEA 1IW6A 1QHJA 1H2SA 3ZPRA 3HANA 2BRDA 3UZAA 5B6XA 2ZIYA 4LDLA 3VHZA 4L6RA 4DS7E 2I1XA 4GP4B 4IAQA 4GPOA 5H2HA 2JAFA 1IW9A 2QPDB 4FBZA 3NY8A 3ZPQA 5H2KA 5B35A 2KSBA 3REYA 3V2WA 3QJRB 1GUEA 4XXJA 4MD1A 5F8UA 5AHZA 5H2IA 2Z73A 2AT9A 2KS9A 3QDCA 3QBLA 3PXOA 2J4YA 3EH4B 3C9MA 5B6VA 5C1MA 4MQSA 3EH5B 1C8SA 3NS0A 1X0I1 4AMJA 2F95A 1P8IA 3A7KA 3HAOA 1S8JA 1TN5A 3ZEVA 5JJJA 3QAKA 4BEZA 4BUOA 3C9LA 3ABWA 1UCQA 5BR2A 2WJKA 3EH3B 2JAGA 3S8GB 5A44A 4MBSA 1JGJA 3PDSA 5G36A 1QKPA 3S3BB 4N4YB 1C8RA 4QRYA 1L0MA 1JFPA 4GRVA 4FAAB 4BWBA 2KSYA 1CWQA 1GU8A 4JQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UON A;  5H2M A;  4DAJ A;  1XJI A;  4XTL A;  1F88 A;  3WQJ A;  1R84 A;  1L9H A;  3OE8 A;  4XT1 A;  1AP9 A;  3HAP A;  3KJ6 A;  3BVD B;  4GP5 B;  2F93 A;  4EA3 A;  1KGB A;  3RFM A;  4BV0 A;  4GYC A;  3VVK A;  4A4M A;  1FBB A;  5H2N A;  1BRR A;  4FPD A;  1H68 A;  3QBK A;  5J7A A;  3CAP A;  1VGO A;  3DDL A;  3SN6 R;  1UAZ A;  5B34 A;  4G72 B;  3DQB A;  4QI1 A;  3X3C A;  5KKH A;  2R4R A;  2I35 A;  4KLY A;  3VG9 A;  1PY6 A;  3UTY A;  5G2A A;  5B6Z A;  5TGZ A;  5AX0 A;  5B6W A;  5H2P A;  4EJ4 A;  5AWZ A;  3QJV B;  1KME A;  5AZD A;  2YDV A;  4KNF A;  2YDO A;  3COC A;  4BVN A;  4LDO A;  5DHG A;  1FBK A;  1S51 A;  3OE9 A;  4MD2 A;  4G70 B;  1KG9 A;  4K5Y A;  5A45 A;  5A8E A;  1JV6 A;  4L35 A;  5ITE A;  4HYJ A;  5G2D A;  1P8U A;  2VT4 A;  1F50 A;  2HPY A;  2QPE B;  1S8L A;  1E0P A;  2YCY A;  3D4S A;  5B0W A;  5G28 A;  1R2N A;  3QJT B;  3UG9 A;  2EI4 A;  1M0M A;  2WJL A;  4XTO A;  4WAV A;  5ETZ A;  2NTW A;  5DYS A;  5H2O A;  3S3D B;  5EN0 A;  5FJG A;  1KG8 A;  3NY9 A;  2I21 A;  5JJE A;  2Z55 A;  4X1H A;  5AX1 A;  1Q5J A;  1AT9 A;  4EIY A;  1BRD A;  1VJM A;  3OAX A;  4IB4 A;  4N6H A;  3RZE A;  2Y03 A;  3QAP A;  2Y04 A;  1O0A A;  3UTV A;  3AM6 A;  2YCZ A;  4BEY A;  4X31 A;  2KSA A;  3COD A;  2Y01 A;  1E12 A;  1XME B;  4DKL A;  5H2J A;  3EML A;  1U19 A;  4NC3 A;  4PXF A;  2I20 A;  1Q5I A;  4FA7 B;  4LDE A;  3AYN A;  4G71 B;  3T45 A;  2YCX A;  5JJN A;  5H2L A;  3QJQ B;  2R4S A;  4G7S B;  1HZX A;  4OV0 A;  1MGY A;  4HWL A;  2L6X A;  3MBV A;  3HAQ A;  3X3B A;  5DHH A;  2ZZL A;  1X0K 1;  4MQT A;  1IXF A;  1GZM A;  3AYM A;  2RH1 A;  1F4Z A;  3QBG A;  2LNL A;  1C3W A;  4XT3 A;  4X32 A;  1DZE A;  1PXS A;  2NTU A;  4AMI A;  1JV7 A;  1S53 A;  4J4Q A;  5G54 A;  4PXK A;  3UTW A;  5ITC A;  1BM1 A;  4JR8 A;  2G87 A;  4G7R B;  3S3C B;  1EHK B;  3UZC A;  2Y00 A;  4GP8 B;  3PWH A;  3VI0 A;  2YCW A;  4G7Q B;  4IAR A;  4N4W A;  3PQR A;  1QKO A;  5AHY A;  3OE6 A;  2PED A;  5G53 A;  3VGA A;  3P0G A;  3HAR A;  4QID A;  4UG2 A;  1QM8 A;  3UTX A;  4HYX A;  4DJH A;  4Y9H A;  1M0K A;  2X72 A;  1S52 A;  4TL3 A;  3PBL A;  4XTN A;  4UHR A;  1P8H A;  5B2N A;  2Y02 A;  3HAS A;  4WW3 A;  5B6Y A;  3ODU A;  3QBI A;  3V2Y A;  1BRX A;  3S8F B;  5BR5 A;  1S54 A;  2M3G A;  1M0L A;  1X0S A;  1LN6 A;  1PXR A;  4JKV A;  3QJS B;  1XIO A;  3QJU B;  5G2C A;  5LWE A;  3NYA A;  3NSB A;  1TN0 A;  3VW7 A;  4GBR A;  3OE0 A;  2ZFE A;  1IW6 A;  1QHJ A;  1H2S A;  3ZPR A;  3HAN A;  2BRD A;  3UZA A;  5B6X A;  2ZIY A;  4LDL A;  3VHZ A;  4L6R A;  2I1X A;  4GP4 B;  4IAQ A;  4GPO A;  5H2H A;  2JAF A;  1IW9 A;  2QPD B;  4FBZ A;  3NY8 A;  3ZPQ A;  5H2K A;  5B35 A;  2KSB A;  3REY A;  3V2W A;  3QJR B;  1GUE A;  4XXJ A;  4MD1 A;  5F8U A;  5AHZ A;  5H2I A;  2Z73 A;  2AT9 A;  2KS9 A;  3QDC A;  3QBL A;  3PXO A;  2J4Y A;  3EH4 B;  3C9M A;  5B6V A;  5C1M A;  4MQS A;  3EH5 B;  1C8S A;  3NS0 A;  1X0I 1;  4AMJ A;  2F95 A;  1P8I A;  3A7K A;  3HAO A;  1S8J A;  1TN5 A;  3ZEV A;  5JJJ A;  3QAK A;  4BEZ A;  4BUO A;  3C9L A;  3ABW A;  1UCQ A;  5BR2 A;  2WJK A;  3EH3 B;  2JAG A;  3S8G B;  5A44 A;  4MBS A;  1JGJ A;  3PDS A;  5G36 A;  1QKP A;  3S3B B;  4N4Y B;  1C8R A;  4QRY A;  1L0M A;  1JFP A;  4GRV A;  4FAA B;  4BWB A;  2KSY A;  1CWQ A;  1GU8 A;  4JQ6 A; 
#chains in the Genus database with same CATH topology
 3UON A;  5H2M A;  4DAJ A;  1XJI A;  4XTL A;  1F88 A;  3WQJ A;  1R84 A;  1L9H A;  3OE8 A;  4XT1 A;  1AP9 A;  3HAP A;  3KJ6 A;  3BVD B;  4GP5 B;  2F93 A;  4EA3 A;  1KGB A;  3RFM A;  4BV0 A;  4GYC A;  3VVK A;  4A4M A;  1FBB A;  5H2N A;  1BRR A;  4FPD A;  1H68 A;  3QBK A;  5J7A A;  3CAP A;  1VGO A;  3DDL A;  3SN6 R;  1UAZ A;  5B34 A;  4G72 B;  3DQB A;  4QI1 A;  3X3C A;  5KKH A;  2R4R A;  2I35 A;  4KLY A;  3VG9 A;  1PY6 A;  3UTY A;  5G2A A;  5B6Z A;  5TGZ A;  5AX0 A;  5B6W A;  5H2P A;  4EJ4 A;  5AWZ A;  3QJV B;  1KME A;  5AZD A;  2YDV A;  4KNF A;  2YDO A;  3COC A;  4BVN A;  4LDO A;  5DHG A;  1FBK A;  1S51 A;  3OE9 A;  4MD2 A;  4G70 B;  1KG9 A;  4K5Y A;  5A45 A;  5A8E A;  1JV6 A;  4L35 A;  5ITE A;  4HYJ A;  5G2D A;  1P8U A;  2VT4 A;  1F50 A;  2HPY A;  2QPE B;  1S8L A;  1E0P A;  2YCY A;  3D4S A;  5B0W A;  5G28 A;  1R2N A;  3QJT B;  3UG9 A;  2EI4 A;  1M0M A;  2WJL A;  4XTO A;  4WAV A;  5ETZ A;  2NTW A;  5DYS A;  5H2O A;  3S3D B;  5EN0 A;  5FJG A;  1KG8 A;  3NY9 A;  2I21 A;  5JJE A;  2Z55 A;  4X1H A;  5AX1 A;  1Q5J A;  1AT9 A;  4EIY A;  1BRD A;  1VJM A;  3OAX A;  4IB4 A;  4N6H A;  3RZE A;  2Y03 A;  3QAP A;  2Y04 A;  1O0A A;  3UTV A;  3AM6 A;  2YCZ A;  4BEY A;  4X31 A;  2KSA A;  3COD A;  2Y01 A;  1E12 A;  1XME B;  4DKL A;  5H2J A;  3EML A;  1U19 A;  4NC3 A;  4PXF A;  2I20 A;  1Q5I A;  4FA7 B;  4LDE A;  3AYN A;  4G71 B;  3T45 A;  2YCX A;  5JJN A;  5H2L A;  3QJQ B;  2R4S A;  4G7S B;  1HZX A;  4OV0 A;  1MGY A;  4HWL A;  2L6X A;  3MBV A;  3HAQ A;  3X3B A;  5DHH A;  2ZZL A;  1X0K 1;  4MQT A;  1IXF A;  1GZM A;  3AYM A;  2RH1 A;  1F4Z A;  3QBG A;  2LNL A;  1C3W A;  4XT3 A;  4X32 A;  1DZE A;  1PXS A;  2NTU A;  4AMI A;  1JV7 A;  1S53 A;  4J4Q A;  5G54 A;  4PXK A;  3UTW A;  5ITC A;  1BM1 A;  4JR8 A;  2G87 A;  4G7R B;  3S3C B;  1EHK B;  3UZC A;  2Y00 A;  4GP8 B;  3PWH A;  3VI0 A;  2YCW A;  4G7Q B;  4IAR A;  4N4W A;  3PQR A;  1QKO A;  5AHY A;  3OE6 A;  2PED A;  5G53 A;  3VGA A;  3P0G A;  3HAR A;  4QID A;  4UG2 A;  1QM8 A;  3UTX A;  4HYX A;  4DJH A;  4Y9H A;  1M0K A;  2X72 A;  1S52 A;  4TL3 A;  3PBL A;  4XTN A;  4UHR A;  1P8H A;  5B2N A;  2Y02 A;  3HAS A;  4WW3 A;  5B6Y A;  3ODU A;  3QBI A;  3V2Y A;  1BRX A;  3S8F B;  5BR5 A;  1S54 A;  2M3G A;  1M0L A;  1X0S A;  1LN6 A;  1PXR A;  4JKV A;  3QJS B;  1XIO A;  3QJU B;  5G2C A;  5LWE A;  3NYA A;  3NSB A;  1TN0 A;  3VW7 A;  4GBR A;  3OE0 A;  2ZFE A;  1IW6 A;  1QHJ A;  1H2S A;  3ZPR A;  3HAN A;  2BRD A;  3UZA A;  5B6X A;  2ZIY A;  4LDL A;  3VHZ A;  4L6R A;  4DS7 E;  2I1X A;  4GP4 B;  4IAQ A;  4GPO A;  5H2H A;  2JAF A;  1IW9 A;  2QPD B;  4FBZ A;  3NY8 A;  3ZPQ A;  5H2K A;  5B35 A;  2KSB A;  3REY A;  3V2W A;  3QJR B;  1GUE A;  4XXJ A;  4MD1 A;  5F8U A;  5AHZ A;  5H2I A;  2Z73 A;  2AT9 A;  2KS9 A;  3QDC A;  3QBL A;  3PXO A;  2J4Y A;  3EH4 B;  3C9M A;  5B6V A;  5C1M A;  4MQS A;  3EH5 B;  1C8S A;  3NS0 A;  1X0I 1;  4AMJ A;  2F95 A;  1P8I A;  3A7K A;  3HAO A;  1S8J A;  1TN5 A;  3ZEV A;  5JJJ A;  3QAK A;  4BEZ A;  4BUO A;  3C9L A;  3ABW A;  1UCQ A;  5BR2 A;  2WJK A;  3EH3 B;  2JAG A;  3S8G B;  5A44 A;  4MBS A;  1JGJ A;  3PDS A;  5G36 A;  1QKP A;  3S3B B;  4N4Y B;  1C8R A;  4QRY A;  1L0M A;  1JFP A;  4GRV A;  4FAA B;  4BWB A;  2KSY A;  1CWQ A;  1GU8 A;  4JQ6 A; 
#chains in the Genus database with same CATH homology
 3UON A;  5H2M A;  4DAJ A;  1XJI A;  4XTL A;  1F88 A;  3WQJ A;  1R84 A;  1L9H A;  3OE8 A;  4XT1 A;  1AP9 A;  3HAP A;  3KJ6 A;  3BVD B;  4GP5 B;  2F93 A;  4EA3 A;  1KGB A;  3RFM A;  4BV0 A;  4GYC A;  3VVK A;  4A4M A;  1FBB A;  5H2N A;  1BRR A;  4FPD A;  1H68 A;  3QBK A;  5J7A A;  3CAP A;  1VGO A;  3DDL A;  3SN6 R;  1UAZ A;  5B34 A;  4G72 B;  3DQB A;  4QI1 A;  3X3C A;  5KKH A;  2R4R A;  2I35 A;  4KLY A;  3VG9 A;  1PY6 A;  3UTY A;  5G2A A;  5B6Z A;  5TGZ A;  5AX0 A;  5B6W A;  5H2P A;  4EJ4 A;  5AWZ A;  3QJV B;  1KME A;  5AZD A;  2YDV A;  4KNF A;  2YDO A;  3COC A;  4BVN A;  4LDO A;  5DHG A;  1FBK A;  1S51 A;  3OE9 A;  4MD2 A;  4G70 B;  1KG9 A;  4K5Y A;  5A45 A;  5A8E A;  1JV6 A;  4L35 A;  5ITE A;  4HYJ A;  5G2D A;  1P8U A;  2VT4 A;  1F50 A;  2HPY A;  2QPE B;  1S8L A;  1E0P A;  2YCY A;  3D4S A;  5B0W A;  5G28 A;  1R2N A;  3QJT B;  3UG9 A;  2EI4 A;  1M0M A;  2WJL A;  4XTO A;  4WAV A;  5ETZ A;  2NTW A;  5DYS A;  5H2O A;  3S3D B;  5EN0 A;  5FJG A;  1KG8 A;  3NY9 A;  2I21 A;  5JJE A;  2Z55 A;  4X1H A;  5AX1 A;  1Q5J A;  1AT9 A;  4EIY A;  1BRD A;  1VJM A;  3OAX A;  4IB4 A;  4N6H A;  3RZE A;  2Y03 A;  3QAP A;  2Y04 A;  1O0A A;  3UTV A;  3AM6 A;  2YCZ A;  4BEY A;  4X31 A;  2KSA A;  3COD A;  2Y01 A;  1E12 A;  1XME B;  4DKL A;  5H2J A;  3EML A;  1U19 A;  4NC3 A;  4PXF A;  2I20 A;  1Q5I A;  4FA7 B;  4LDE A;  3AYN A;  4G71 B;  3T45 A;  2YCX A;  5JJN A;  5H2L A;  3QJQ B;  2R4S A;  4G7S B;  1HZX A;  4OV0 A;  1MGY A;  4HWL A;  2L6X A;  3MBV A;  3HAQ A;  3X3B A;  5DHH A;  2ZZL A;  1X0K 1;  4MQT A;  1IXF A;  1GZM A;  3AYM A;  2RH1 A;  1F4Z A;  3QBG A;  2LNL A;  1C3W A;  4XT3 A;  4X32 A;  1DZE A;  1PXS A;  2NTU A;  4AMI A;  1JV7 A;  1S53 A;  4J4Q A;  5G54 A;  4PXK A;  3UTW A;  5ITC A;  1BM1 A;  4JR8 A;  2G87 A;  4G7R B;  3S3C B;  1EHK B;  3UZC A;  2Y00 A;  4GP8 B;  3PWH A;  3VI0 A;  2YCW A;  4G7Q B;  4IAR A;  4N4W A;  3PQR A;  1QKO A;  5AHY A;  3OE6 A;  2PED A;  5G53 A;  3VGA A;  3P0G A;  3HAR A;  4QID A;  4UG2 A;  1QM8 A;  3UTX A;  4HYX A;  4DJH A;  4Y9H A;  1M0K A;  2X72 A;  1S52 A;  4TL3 A;  3PBL A;  4XTN A;  4UHR A;  1P8H A;  5B2N A;  2Y02 A;  3HAS A;  4WW3 A;  5B6Y A;  3ODU A;  3QBI A;  3V2Y A;  1BRX A;  3S8F B;  5BR5 A;  1S54 A;  2M3G A;  1M0L A;  1X0S A;  1LN6 A;  1PXR A;  4JKV A;  3QJS B;  1XIO A;  3QJU B;  5G2C A;  5LWE A;  3NYA A;  3NSB A;  1TN0 A;  3VW7 A;  4GBR A;  3OE0 A;  2ZFE A;  1IW6 A;  1QHJ A;  1H2S A;  3ZPR A;  3HAN A;  2BRD A;  3UZA A;  5B6X A;  2ZIY A;  4LDL A;  3VHZ A;  4L6R A;  4DS7 E;  2I1X A;  4GP4 B;  4IAQ A;  4GPO A;  5H2H A;  2JAF A;  1IW9 A;  2QPD B;  4FBZ A;  3NY8 A;  3ZPQ A;  5H2K A;  5B35 A;  2KSB A;  3REY A;  3V2W A;  3QJR B;  1GUE A;  4XXJ A;  4MD1 A;  5F8U A;  5AHZ A;  5H2I A;  2Z73 A;  2AT9 A;  2KS9 A;  3QDC A;  3QBL A;  3PXO A;  2J4Y A;  3EH4 B;  3C9M A;  5B6V A;  5C1M A;  4MQS A;  3EH5 B;  1C8S A;  3NS0 A;  1X0I 1;  4AMJ A;  2F95 A;  1P8I A;  3A7K A;  3HAO A;  1S8J A;  1TN5 A;  3ZEV A;  5JJJ A;  3QAK A;  4BEZ A;  4BUO A;  3C9L A;  3ABW A;  1UCQ A;  5BR2 A;  2WJK A;  3EH3 B;  2JAG A;  3S8G B;  5A44 A;  4MBS A;  1JGJ A;  3PDS A;  5G36 A;  1QKP A;  3S3B B;  4N4Y B;  1C8R A;  4QRY A;  1L0M A;  1JFP A;  4GRV A;  4FAA B;  4BWB A;  2KSY A;  1CWQ A;  1GU8 A;  4JQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...