3PR9A

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3pr9A00
3PR9A 1IX5A 3PRAA
chains in the Genus database with same CATH superfamily
2LPVA 4ODLA 1JVWA 2L2SA 3OA5A 3IKDA 4J4NA 2F23A 2F4EA 4JFMA 4MAVA 4LGXA 1SYTA 2A3EA 4ITZA 4ODQA 4NZCA 1E9LA 4DRJA 1GOIA 3B9EA 1LG2A 2PPOA 1HKIA 1FKDA 1D6OA 5HW7A 2YBTA 3PA7A 2RSEA 4IPXA 4DRMA 3WL0A 4MTVA 1D7JA 1NWUA 4IT6A 3H9RB 4DWSC 4GGQA 1GPFA 4MNMA 2DPEA 4U85A 3PRDA 1HKKA 1YATA 4DH0A 1M5YA 2Q5AA 3AQUA 1LL7A 2A3CA 3WIJA 1JNDA 2XPAA 2MF9A 1OGBA 1W9PA 1VF8A 3G6LA 2DT1A 1NMVA 2KO7A 3UQIA 4ML4A 1LG1A 5HUAA 1W1TA 4BF8A 1W26A 1U79A 4G50A 2FKEA 5HBFA 4QT2A 4DRKA 2ETNA 1CTNA 3WD3A 3AROA 4Z2LA 4DWSB 2P4VA 1ITXA 3UQAA 5JH8A 3FXYA 3AS2A 1FFQA 2RURA 4DWSD 2DT0A 1FKTA 2FDMA 3O5KA 4ZPVR 3UI5A 1QZ2A 1PBKA 2MLYA 1FKFA 1T11A 3KAHA 4MNKA 2DG4A 4GIVA 2WLZA 3KZ7A 4DRHA 3WQVA 2LKNA 3TCZA 2M08A 4DRIA 2ZQSA 1FKHA 1KFWA 1N1AA 4UDMA 2KFWA 1H0IA 1OWQA 1ZCNA 2DSUA 2M1IA 3QOKA 5HW6A 1ROUA 2RUDA 2WM0A 1E6PA 3JYJA 5DF0A 1HKJA 3ARQA 4W9OA 3O5MA 1Q6UA 1L1PA 1IX5A 4ODOA 4P8UA 1JNEA 1UR8A 2XPBA 2ZR5A 2XP9A 3BMBA 4ZPTR 1EHNA 1Q1CA 3CHDA 3KAIA 3CHFA 4HBEA 2YBUA 3RM4A 4JFJA 4ODRA 3UQBA 1HKMA 2IF4A 1ZBKA 3ODKA 3IHZA 3O5RA 1JCHB 2N87A 1EDQA 4U84A 4URIA 1FKJA 2DSWA 2KI3A 3IKGA 1HJXA 3TC5A 2PPNA 2ESCA 3UF8A 3PRAA 4DROA 4S3KA 4ODPA 3B7XA 3UI4A 3UI6A 5DIVA 4HARA 3KAGA 2WLYA 4Z2IA 2G41A 4Z2GA 3JXVA 4QIBA 1NWTA 2K8IA 1KT0A 2ZR6A 4DT4A 2DG9A 4O2TA 2F21A 3ALGA 1BKFA 4DWSA 2VN1A 4FAPA 4U86A 3KCEA 4HBOA 4L3NA 2A3AA 3B8SA 1JNSA 4TNSA 4W9QA 3FY1A 1X6NA 3G6MA 2PV1A 4WKHA 3RFWA 2O9OA 1NMWA 1Y0OA 3EIPA 2MLXA 1E15A 1EYMA 3RM9A 1NWRA 3ARTA 3ALFA 3B9AA 1QPFA 1EIBA 2XP8A 4Q22A 1LL4A 4JFIA 1R9HA 2D9FA 3ARWA 4QT3A 2M2AA 3O5DA 5DEZA 1FKLA 4TYOA 1NSGA 1K9TA 3NI6A 4WKFA 1PINA 4WKAA 3VAWA 5HTGA 2WK2A 3AS3A 1J4HA 5B8IC 1GUVA 3CZ8A 1UR9A 4DIPA 3TDBA 2DT2A 3ARPA 4TW8A 2RQSA 3IK8A 4P8VA 1WNOA 5HW8A 1SR0A 5HWBA 1J6YA 3CGNA 1E44A 1W9VA 1WB0A 3AS1A 3WKZA 2DG3A 2AOSA 3NTPA 1ZBWA 1LJYA 1FFRA 4IQCA 4Z2JA 4FN2A 4DZ2A 4DRNA 4TX0A 2PBCA 4IQ2A 4MGVA 4J4OA 3CHEA 4QZVB 3WQWA 4G2PA 3KADA 3GTYX 4MNLA 2F2DA 4WIWA 4DZ3A 2QF8A 1OGGA 1HJVA 1ZB5A 3GPKA 2LGOA 5HKGA 1C9HA 3KAFA 2PPPA 4W9PA 2XP7A 3CGMA 3PRBA 2JZVA 2G8ZA 4TW6A 1D7IA 1ROTA 2ZQTA 3ARYA 3RMEA 1WAWA 3KACA 4JYSA 1W1YA 2EULA 3O5JA 2PI6A 4NSBA 4MSPA 2XP6A 4DRPA 4AY1A 2OLHA 2AWGA 4R0XA 3O5OA 1ZL1A 4ODNA 1H0GA 3KABA 1B6CA 1D7HA 2KR7A 1FAPA 3O5PA 1ZBVA 2PV3A 3B9DA 3ARUA 1E6RA 3OOBA 2ZQUA 3O5FA 1LL6A 2RUCA 4Q7NA 4N19A 2KE0A 4S3JA 4C02B 4PTMA 3CHCA 2XP4A 1LQ0A 3WD4A 3ARRA 1W1VA 2LJ4A 3W4RA 2B31A 3WD0A 2B5UB 2MNTA 1ZBCA 4MNJA 5J6EA 4P8XA 2PN0A 4L72B 4Z2KA 1JNTA 3I6CA 1J4RA 1FKGA 1O6IA 1FKBA 1J4IA 3ARVA 4WK9A 3LUOA 2ITKA 3WD2A 1XHGA 3NRKA 2MPHA 5DITA 1GRJA 4KR0B 5I98A 2KGJA 1X6LA 3O5QA 3RGCA 2VCDA 1FJDA 2O92A 3O5LA 1F40A 2XP3A 1F8AB 5D75A 3ARSA 5GPRA 4DRQA 3AS0A 4TW7A 1P5QA 2UZ5A 1XRVA 1ZK6A 1Q6HA 3FAPA 3WH0A 2PV2A 4LAVA 2DSVA 4P8WA 4LAWA 4W5UA 3WL1A 1FKIA 1FKKA 5GPGA 4Z2HA 2XP5A 1NWSA 1TFVA 4LAXA 2RUQA 1HXVA 4ZPWR 4LAYA 2IUZA 1KT1A 4ODKA 2DT3A 2FAPA 4ODMA 1ZU8A 2A3BA 4ZS6A 5HT1A 3GU0A 1BL4A 1TCOC 1W1PA 1FKRA 1E6ZA 2ZQVA 1D2KA 1Q6IA 4XAKA 2MLZA 2DSZA 2ZR4A 5DIUA 5HWCA 3O5EA 3ARZA 3CH9A 2Y78A 3PR9A 1EQ3A 3ARXA 4WJXA 1A7XA 1HJWA 1NH6A 4JFKA 1FD9A 3MDYB 4KQZA 1W9UA 5DO2A 4NNRA 3EY6A 3JYMA 4JFLA 4IT4A 4R5EA 3WD1A 3RM8A 5GQBA 5BXJA 3O5IA 1QPLA 2OFNA 1FKSA 3BXWA 1YW5A 4MPKA 1RD6A 3O5GA 1E6NA
chains in the Genus database with same CATH topology
2LPVA 4ODLA 1JVWA 2L2SA 3OA5A 3IKDA 4J4NA 2F4EA 4JFMA 4MAVA 4LGXA 1SYTA 2A3EA 4ITZA 4ODQA 4NZCA 1E9LA 4DRJA 1GOIA 3B9EA 1LG2A 2PPOA 1HKIA 1FKDA 1D6OA 5HW7A 2YBTA 3PA7A 2RSEA 4IPXA 4DRMA 3WL0A 4MTVA 1D7JA 1NWUA 4IT6A 3H9RB 4DWSC 4GGQA 1GPFA 4MNMA 2DPEA 4U85A 3PRDA 1HKKA 1YATA 4DH0A 1M5YA 2Q5AA 3AQUA 1LL7A 2A3CA 3WIJA 1JNDA 2XPAA 2MF9A 1OGBA 1W9PA 1VF8A 3G6LA 2DT1A 1NMVA 2KO7A 3UQIA 4ML4A 1LG1A 5HUAA 1W1TA 4BF8A 1W26A 1U79A 4G50A 2FKEA 5HBFA 4QT2A 4DRKA 1CTNA 3WD3A 3AROA 4Z2LA 4DWSB 1ITXA 3UQAA 5JH8A 3FXYA 3AS2A 1FFQA 2RURA 4DWSD 2DT0A 1FKTA 2FDMA 3O5KA 4ZPVR 3UI5A 1QZ2A 1PBKA 2MLYA 1FKFA 1T11A 3KAHA 4MNKA 2DG4A 4GIVA 2WLZA 3KZ7A 4DRHA 3WQVA 2LKNA 3TCZA 2M08A 4DRIA 2ZQSA 1FKHA 1KFWA 1N1AA 2KFWA 1H0IA 1OWQA 1ZCNA 2DSUA 2M1IA 3QOKA 5HW6A 1ROUA 2RUDA 2WM0A 1E6PA 3JYJA 5DF0A 1HKJA 3ARQA 4W9OA 3O5MA 1Q6UA 1L1PA 1IX5A 4ODOA 4P8UA 1JNEA 1UR8A 2XPBA 2ZR5A 2XP9A 4ZPTR 1EHNA 1Q1CA 3CHDA 3KAIA 3CHFA 4HBEA 2YBUA 3RM4A 4JFJA 4ODRA 3UQBA 1HKMA 2IF4A 1ZBKA 3ODKA 3IHZA 3O5RA 2N87A 1EDQA 4U84A 4URIA 1FKJA 2DSWA 2KI3A 3IKGA 1HJXA 3TC5A 2PPNA 2ESCA 3UF8A 3PRAA 4DROA 4S3KA 4ODPA 3B7XA 3UI4A 3UI6A 5DIVA 4HARA 3KAGA 2WLYA 4Z2IA 2G41A 4Z2GA 3JXVA 4QIBA 1NWTA 2K8IA 1KT0A 2ZR6A 4DT4A 2DG9A 4O2TA 2F21A 3ALGA 1BKFA 4DWSA 2VN1A 4FAPA 4U86A 3KCEA 4HBOA 4L3NA 2A3AA 3B8SA 1JNSA 4TNSA 4W9QA 3FY1A 1X6NA 3G6MA 2PV1A 4WKHA 3RFWA 2O9OA 1NMWA 1Y0OA 2MLXA 1E15A 1EYMA 3RM9A 1NWRA 3ARTA 3ALFA 3B9AA 1QPFA 1EIBA 2XP8A 4Q22A 1LL4A 4JFIA 1R9HA 2D9FA 3ARWA 4QT3A 2M2AA 3O5DA 5DEZA 1FKLA 4TYOA 1NSGA 1K9TA 3NI6A 4WKFA 1PINA 4WKAA 3VAWA 5HTGA 2WK2A 3AS3A 1J4HA 5B8IC 1GUVA 3CZ8A 1UR9A 4DIPA 3TDBA 2DT2A 3ARPA 4TW8A 2RQSA 3IK8A 4P8VA 1WNOA 5HW8A 1SR0A 5HWBA 1J6YA 3CGNA 1W9VA 1WB0A 3AS1A 3WKZA 2DG3A 2AOSA 3NTPA 1ZBWA 1LJYA 1FFRA 4IQCA 4Z2JA 4FN2A 4DZ2A 4DRNA 4TX0A 2PBCA 4IQ2A 4MGVA 4J4OA 3CHEA 4QZVB 3WQWA 4G2PA 3KADA 4MNLA 2F2DA 4WIWA 4DZ3A 2QF8A 1OGGA 1HJVA 1ZB5A 3GPKA 2LGOA 5HKGA 1C9HA 3KAFA 2PPPA 4W9PA 2XP7A 3CGMA 3PRBA 2JZVA 2G8ZA 4TW6A 1D7IA 1ROTA 2ZQTA 3ARYA 3RMEA 1WAWA 3KACA 4JYSA 1W1YA 3O5JA 2PI6A 4NSBA 4MSPA 2XP6A 4DRPA 4AY1A 2OLHA 2AWGA 4R0XA 3O5OA 1ZL1A 4ODNA 1H0GA 3KABA 1B6CA 1D7HA 2KR7A 1FAPA 3O5PA 1ZBVA 2PV3A 3B9DA 3ARUA 1E6RA 3OOBA 2ZQUA 3O5FA 1LL6A 2RUCA 4Q7NA 4N19A 2KE0A 4S3JA 4C02B 4PTMA 3CHCA 2XP4A 1LQ0A 3WD4A 3ARRA 1W1VA 2LJ4A 3W4RA 2B31A 3WD0A 2MNTA 1ZBCA 4MNJA 5J6EA 4P8XA 4L72B 4Z2KA 1JNTA 3I6CA 1J4RA 1FKGA 1O6IA 1FKBA 1J4IA 3ARVA 4WK9A 3LUOA 2ITKA 3WD2A 1XHGA 3NRKA 2MPHA 5DITA 4KR0B 5I98A 2KGJA 1X6LA 3O5QA 3RGCA 2VCDA 1FJDA 2O92A 3O5LA 1F40A 2XP3A 1F8AB 5D75A 3ARSA 5GPRA 4DRQA 3AS0A 4TW7A 1P5QA 2UZ5A 1XRVA 1ZK6A 1Q6HA 3FAPA 3WH0A 2PV2A 4LAVA 2DSVA 4P8WA 4LAWA 4W5UA 3WL1A 1FKIA 1FKKA 5GPGA 4Z2HA 2XP5A 1NWSA 1TFVA 4LAXA 2RUQA 1HXVA 4ZPWR 4LAYA 2IUZA 1KT1A 4ODKA 2DT3A 2FAPA 4ODMA 1ZU8A 2A3BA 4ZS6A 5HT1A 1BL4A 1TCOC 1W1PA 1FKRA 1E6ZA 2ZQVA 1D2KA 1Q6IA 4XAKA 2MLZA 2DSZA 2ZR4A 5DIUA 5HWCA 3O5EA 3ARZA 3CH9A 2Y78A 3PR9A 1EQ3A 3ARXA 4WJXA 1A7XA 1HJWA 1NH6A 4JFKA 1FD9A 3MDYB 4KQZA 1W9UA 5DO2A 4NNRA 3EY6A 3JYMA 4JFLA 4IT4A 4R5EA 3WD1A 3RM8A 5GQBA 5BXJA 3O5IA 1QPLA 2OFNA 1FKSA 3BXWA 1YW5A 4MPKA 1RD6A 3O5GA 1E6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PR9 A;  1IX5 A;  3PRA A; 
#chains in the Genus database with same CATH topology
 2LPV A;  4ODL A;  1JVW A;  2L2S A;  3OA5 A;  3IKD A;  4J4N A;  2F23 A;  2F4E A;  4JFM A;  4MAV A;  4LGX A;  1SYT A;  2A3E A;  4ITZ A;  4ODQ A;  4NZC A;  1E9L A;  4DRJ A;  1GOI A;  3B9E A;  1LG2 A;  2PPO A;  1HKI A;  1FKD A;  1D6O A;  5HW7 A;  2YBT A;  3PA7 A;  2RSE A;  4IPX A;  4DRM A;  3WL0 A;  4MTV A;  1D7J A;  1NWU A;  4IT6 A;  3H9R B;  4DWS C;  4GGQ A;  1GPF A;  4MNM A;  2DPE A;  4U85 A;  3PRD A;  1HKK A;  1YAT A;  4DH0 A;  1M5Y A;  2Q5A A;  3AQU A;  1LL7 A;  2A3C A;  3WIJ A;  1JND A;  2XPA A;  2MF9 A;  1OGB A;  1W9P A;  1VF8 A;  3G6L A;  2DT1 A;  1NMV A;  2KO7 A;  3UQI A;  4ML4 A;  1LG1 A;  5HUA A;  1W1T A;  4BF8 A;  1W26 A;  1U79 A;  4G50 A;  2FKE A;  5HBF A;  4QT2 A;  4DRK A;  2ETN A;  1CTN A;  3WD3 A;  3ARO A;  4Z2L A;  4DWS B;  2P4V A;  1ITX A;  3UQA A;  5JH8 A;  3FXY A;  3AS2 A;  1FFQ A;  2RUR A;  4DWS D;  2DT0 A;  1FKT A;  2FDM A;  3O5K A;  4ZPV R;  3UI5 A;  1QZ2 A;  1PBK A;  2MLY A;  1FKF A;  1T11 A;  3KAH A;  4MNK A;  2DG4 A;  4GIV A;  2WLZ A;  3KZ7 A;  4DRH A;  3WQV A;  2LKN A;  3TCZ A;  2M08 A;  4DRI A;  2ZQS A;  1FKH A;  1KFW A;  1N1A A;  4UDM A;  2KFW A;  1H0I A;  1OWQ A;  1ZCN A;  2DSU A;  2M1I A;  3QOK A;  5HW6 A;  1ROU A;  2RUD A;  2WM0 A;  1E6P A;  3JYJ A;  5DF0 A;  1HKJ A;  3ARQ A;  4W9O A;  3O5M A;  1Q6U A;  1L1P A;  1IX5 A;  4ODO A;  4P8U A;  1JNE A;  1UR8 A;  2XPB A;  2ZR5 A;  2XP9 A;  3BMB A;  4ZPT R;  1EHN A;  1Q1C A;  3CHD A;  3KAI A;  3CHF A;  4HBE A;  2YBU A;  3RM4 A;  4JFJ A;  4ODR A;  3UQB A;  1HKM A;  2IF4 A;  1ZBK A;  3ODK A;  3IHZ A;  3O5R A;  1JCH B;  2N87 A;  1EDQ A;  4U84 A;  4URI A;  1FKJ A;  2DSW A;  2KI3 A;  3IKG A;  1HJX A;  3TC5 A;  2PPN A;  2ESC A;  3UF8 A;  3PRA A;  4DRO A;  4S3K A;  4ODP A;  3B7X A;  3UI4 A;  3UI6 A;  5DIV A;  4HAR A;  3KAG A;  2WLY A;  4Z2I A;  2G41 A;  4Z2G A;  3JXV A;  4QIB A;  1NWT A;  2K8I A;  1KT0 A;  2ZR6 A;  4DT4 A;  2DG9 A;  4O2T A;  2F21 A;  3ALG A;  1BKF A;  4DWS A;  2VN1 A;  4FAP A;  4U86 A;  3KCE A;  4HBO A;  4L3N A;  2A3A A;  3B8S A;  1JNS A;  4TNS A;  4W9Q A;  3FY1 A;  1X6N A;  3G6M A;  2PV1 A;  4WKH A;  3RFW A;  2O9O A;  1NMW A;  1Y0O A;  3EIP A;  2MLX A;  1E15 A;  1EYM A;  3RM9 A;  1NWR A;  3ART A;  3ALF A;  3B9A A;  1QPF A;  1EIB A;  2XP8 A;  4Q22 A;  1LL4 A;  4JFI A;  1R9H A;  2D9F A;  3ARW A;  4QT3 A;  2M2A A;  3O5D A;  5DEZ A;  1FKL A;  4TYO A;  1NSG A;  1K9T A;  3NI6 A;  4WKF A;  1PIN A;  4WKA A;  3VAW A;  5HTG A;  2WK2 A;  3AS3 A;  1J4H A;  5B8I C;  1GUV A;  3CZ8 A;  1UR9 A;  4DIP A;  3TDB A;  2DT2 A;  3ARP A;  4TW8 A;  2RQS A;  3IK8 A;  4P8V A;  1WNO A;  5HW8 A;  1SR0 A;  5HWB A;  1J6Y A;  3CGN A;  1E44 A;  1W9V A;  1WB0 A;  3AS1 A;  3WKZ A;  2DG3 A;  2AOS A;  3NTP A;  1ZBW A;  1LJY A;  1FFR A;  4IQC A;  4Z2J A;  4FN2 A;  4DZ2 A;  4DRN A;  4TX0 A;  2PBC A;  4IQ2 A;  4MGV A;  4J4O A;  3CHE A;  4QZV B;  3WQW A;  4G2P A;  3KAD A;  3GTY X;  4MNL A;  2F2D A;  4WIW A;  4DZ3 A;  2QF8 A;  1OGG A;  1HJV A;  1ZB5 A;  3GPK A;  2LGO A;  5HKG A;  1C9H A;  3KAF A;  2PPP A;  4W9P A;  2XP7 A;  3CGM A;  3PRB A;  2JZV A;  2G8Z A;  4TW6 A;  1D7I A;  1ROT A;  2ZQT A;  3ARY A;  3RME A;  1WAW A;  3KAC A;  4JYS A;  1W1Y A;  2EUL A;  3O5J A;  2PI6 A;  4NSB A;  4MSP A;  2XP6 A;  4DRP A;  4AY1 A;  2OLH A;  2AWG A;  4R0X A;  3O5O A;  1ZL1 A;  4ODN A;  1H0G A;  3KAB A;  1B6C A;  1D7H A;  2KR7 A;  1FAP A;  3O5P A;  1ZBV A;  2PV3 A;  3B9D A;  3ARU A;  1E6R A;  3OOB A;  2ZQU A;  3O5F A;  1LL6 A;  2RUC A;  4Q7N A;  4N19 A;  2KE0 A;  4S3J A;  4C02 B;  4PTM A;  3CHC A;  2XP4 A;  1LQ0 A;  3WD4 A;  3ARR A;  1W1V A;  2LJ4 A;  3W4R A;  2B31 A;  3WD0 A;  2B5U B;  2MNT A;  1ZBC A;  4MNJ A;  5J6E A;  4P8X A;  2PN0 A;  4L72 B;  4Z2K A;  1JNT A;  3I6C A;  1J4R A;  1FKG A;  1O6I A;  1FKB A;  1J4I A;  3ARV A;  4WK9 A;  3LUO A;  2ITK A;  3WD2 A;  1XHG A;  3NRK A;  2MPH A;  5DIT A;  1GRJ A;  4KR0 B;  5I98 A;  2KGJ A;  1X6L A;  3O5Q A;  3RGC A;  2VCD A;  1FJD A;  2O92 A;  3O5L A;  1F40 A;  2XP3 A;  1F8A B;  5D75 A;  3ARS A;  5GPR A;  4DRQ A;  3AS0 A;  4TW7 A;  1P5Q A;  2UZ5 A;  1XRV A;  1ZK6 A;  1Q6H A;  3FAP A;  3WH0 A;  2PV2 A;  4LAV A;  2DSV A;  4P8W A;  4LAW A;  4W5U A;  3WL1 A;  1FKI A;  1FKK A;  5GPG A;  4Z2H A;  2XP5 A;  1NWS A;  1TFV A;  4LAX A;  2RUQ A;  1HXV A;  4ZPW R;  4LAY A;  2IUZ A;  1KT1 A;  4ODK A;  2DT3 A;  2FAP A;  4ODM A;  1ZU8 A;  2A3B A;  4ZS6 A;  5HT1 A;  3GU0 A;  1BL4 A;  1TCO C;  1W1P A;  1FKR A;  1E6Z A;  2ZQV A;  1D2K A;  1Q6I A;  4XAK A;  2MLZ A;  2DSZ A;  2ZR4 A;  5DIU A;  5HWC A;  3O5E A;  3ARZ A;  3CH9 A;  2Y78 A;  3PR9 A;  1EQ3 A;  3ARX A;  4WJX A;  1A7X A;  1HJW A;  1NH6 A;  4JFK A;  1FD9 A;  3MDY B;  4KQZ A;  1W9U A;  5DO2 A;  4NNR A;  3EY6 A;  3JYM A;  4JFL A;  4IT4 A;  4R5E A;  3WD1 A;  3RM8 A;  5GQB A;  5BXJ A;  3O5I A;  1QPL A;  2OFN A;  1FKS A;  3BXW A;  1YW5 A;  4MPK A;  1RD6 A;  3O5G A;  1E6N A; 
#chains in the Genus database with same CATH homology
 2LPV A;  4ODL A;  1JVW A;  2L2S A;  3OA5 A;  3IKD A;  4J4N A;  2F4E A;  4JFM A;  4MAV A;  4LGX A;  1SYT A;  2A3E A;  4ITZ A;  4ODQ A;  4NZC A;  1E9L A;  4DRJ A;  1GOI A;  3B9E A;  1LG2 A;  2PPO A;  1HKI A;  1FKD A;  1D6O A;  5HW7 A;  2YBT A;  3PA7 A;  2RSE A;  4IPX A;  4DRM A;  3WL0 A;  4MTV A;  1D7J A;  1NWU A;  4IT6 A;  3H9R B;  4DWS C;  4GGQ A;  1GPF A;  4MNM A;  2DPE A;  4U85 A;  3PRD A;  1HKK A;  1YAT A;  4DH0 A;  1M5Y A;  2Q5A A;  3AQU A;  1LL7 A;  2A3C A;  3WIJ A;  1JND A;  2XPA A;  2MF9 A;  1OGB A;  1W9P A;  1VF8 A;  3G6L A;  2DT1 A;  1NMV A;  2KO7 A;  3UQI A;  4ML4 A;  1LG1 A;  5HUA A;  1W1T A;  4BF8 A;  1W26 A;  1U79 A;  4G50 A;  2FKE A;  5HBF A;  4QT2 A;  4DRK A;  1CTN A;  3WD3 A;  3ARO A;  4Z2L A;  4DWS B;  1ITX A;  3UQA A;  5JH8 A;  3FXY A;  3AS2 A;  1FFQ A;  2RUR A;  4DWS D;  2DT0 A;  1FKT A;  2FDM A;  3O5K A;  4ZPV R;  3UI5 A;  1QZ2 A;  1PBK A;  2MLY A;  1FKF A;  1T11 A;  3KAH A;  4MNK A;  2DG4 A;  4GIV A;  2WLZ A;  3KZ7 A;  4DRH A;  3WQV A;  2LKN A;  3TCZ A;  2M08 A;  4DRI A;  2ZQS A;  1FKH A;  1KFW A;  1N1A A;  2KFW A;  1H0I A;  1OWQ A;  1ZCN A;  2DSU A;  2M1I A;  3QOK A;  5HW6 A;  1ROU A;  2RUD A;  2WM0 A;  1E6P A;  3JYJ A;  5DF0 A;  1HKJ A;  3ARQ A;  4W9O A;  3O5M A;  1Q6U A;  1L1P A;  1IX5 A;  4ODO A;  4P8U A;  1JNE A;  1UR8 A;  2XPB A;  2ZR5 A;  2XP9 A;  4ZPT R;  1EHN A;  1Q1C A;  3CHD A;  3KAI A;  3CHF A;  4HBE A;  2YBU A;  3RM4 A;  4JFJ A;  4ODR A;  3UQB A;  1HKM A;  2IF4 A;  1ZBK A;  3ODK A;  3IHZ A;  3O5R A;  2N87 A;  1EDQ A;  4U84 A;  4URI A;  1FKJ A;  2DSW A;  2KI3 A;  3IKG A;  1HJX A;  3TC5 A;  2PPN A;  2ESC A;  3UF8 A;  3PRA A;  4DRO A;  4S3K A;  4ODP A;  3B7X A;  3UI4 A;  3UI6 A;  5DIV A;  4HAR A;  3KAG A;  2WLY A;  4Z2I A;  2G41 A;  4Z2G A;  3JXV A;  4QIB A;  1NWT A;  2K8I A;  1KT0 A;  2ZR6 A;  4DT4 A;  2DG9 A;  4O2T A;  2F21 A;  3ALG A;  1BKF A;  4DWS A;  2VN1 A;  4FAP A;  4U86 A;  3KCE A;  4HBO A;  4L3N A;  2A3A A;  3B8S A;  1JNS A;  4TNS A;  4W9Q A;  3FY1 A;  1X6N A;  3G6M A;  2PV1 A;  4WKH A;  3RFW A;  2O9O A;  1NMW A;  1Y0O A;  2MLX A;  1E15 A;  1EYM A;  3RM9 A;  1NWR A;  3ART A;  3ALF A;  3B9A A;  1QPF A;  1EIB A;  2XP8 A;  4Q22 A;  1LL4 A;  4JFI A;  1R9H A;  2D9F A;  3ARW A;  4QT3 A;  2M2A A;  3O5D A;  5DEZ A;  1FKL A;  4TYO A;  1NSG A;  1K9T A;  3NI6 A;  4WKF A;  1PIN A;  4WKA A;  3VAW A;  5HTG A;  2WK2 A;  3AS3 A;  1J4H A;  5B8I C;  1GUV A;  3CZ8 A;  1UR9 A;  4DIP A;  3TDB A;  2DT2 A;  3ARP A;  4TW8 A;  2RQS A;  3IK8 A;  4P8V A;  1WNO A;  5HW8 A;  1SR0 A;  5HWB A;  1J6Y A;  3CGN A;  1W9V A;  1WB0 A;  3AS1 A;  3WKZ A;  2DG3 A;  2AOS A;  3NTP A;  1ZBW A;  1LJY A;  1FFR A;  4IQC A;  4Z2J A;  4FN2 A;  4DZ2 A;  4DRN A;  4TX0 A;  2PBC A;  4IQ2 A;  4MGV A;  4J4O A;  3CHE A;  4QZV B;  3WQW A;  4G2P A;  3KAD A;  4MNL A;  2F2D A;  4WIW A;  4DZ3 A;  2QF8 A;  1OGG A;  1HJV A;  1ZB5 A;  3GPK A;  2LGO A;  5HKG A;  1C9H A;  3KAF A;  2PPP A;  4W9P A;  2XP7 A;  3CGM A;  3PRB A;  2JZV A;  2G8Z A;  4TW6 A;  1D7I A;  1ROT A;  2ZQT A;  3ARY A;  3RME A;  1WAW A;  3KAC A;  4JYS A;  1W1Y A;  3O5J A;  2PI6 A;  4NSB A;  4MSP A;  2XP6 A;  4DRP A;  4AY1 A;  2OLH A;  2AWG A;  4R0X A;  3O5O A;  1ZL1 A;  4ODN A;  1H0G A;  3KAB A;  1B6C A;  1D7H A;  2KR7 A;  1FAP A;  3O5P A;  1ZBV A;  2PV3 A;  3B9D A;  3ARU A;  1E6R A;  3OOB A;  2ZQU A;  3O5F A;  1LL6 A;  2RUC A;  4Q7N A;  4N19 A;  2KE0 A;  4S3J A;  4C02 B;  4PTM A;  3CHC A;  2XP4 A;  1LQ0 A;  3WD4 A;  3ARR A;  1W1V A;  2LJ4 A;  3W4R A;  2B31 A;  3WD0 A;  2MNT A;  1ZBC A;  4MNJ A;  5J6E A;  4P8X A;  4L72 B;  4Z2K A;  1JNT A;  3I6C A;  1J4R A;  1FKG A;  1O6I A;  1FKB A;  1J4I A;  3ARV A;  4WK9 A;  3LUO A;  2ITK A;  3WD2 A;  1XHG A;  3NRK A;  2MPH A;  5DIT A;  4KR0 B;  5I98 A;  2KGJ A;  1X6L A;  3O5Q A;  3RGC A;  2VCD A;  1FJD A;  2O92 A;  3O5L A;  1F40 A;  2XP3 A;  1F8A B;  5D75 A;  3ARS A;  5GPR A;  4DRQ A;  3AS0 A;  4TW7 A;  1P5Q A;  2UZ5 A;  1XRV A;  1ZK6 A;  1Q6H A;  3FAP A;  3WH0 A;  2PV2 A;  4LAV A;  2DSV A;  4P8W A;  4LAW A;  4W5U A;  3WL1 A;  1FKI A;  1FKK A;  5GPG A;  4Z2H A;  2XP5 A;  1NWS A;  1TFV A;  4LAX A;  2RUQ A;  1HXV A;  4ZPW R;  4LAY A;  2IUZ A;  1KT1 A;  4ODK A;  2DT3 A;  2FAP A;  4ODM A;  1ZU8 A;  2A3B A;  4ZS6 A;  5HT1 A;  1BL4 A;  1TCO C;  1W1P A;  1FKR A;  1E6Z A;  2ZQV A;  1D2K A;  1Q6I A;  4XAK A;  2MLZ A;  2DSZ A;  2ZR4 A;  5DIU A;  5HWC A;  3O5E A;  3ARZ A;  3CH9 A;  2Y78 A;  3PR9 A;  1EQ3 A;  3ARX A;  4WJX A;  1A7X A;  1HJW A;  1NH6 A;  4JFK A;  1FD9 A;  3MDY B;  4KQZ A;  1W9U A;  5DO2 A;  4NNR A;  3EY6 A;  3JYM A;  4JFL A;  4IT4 A;  4R5E A;  3WD1 A;  3RM8 A;  5GQB A;  5BXJ A;  3O5I A;  1QPL A;  2OFN A;  1FKS A;  3BXW A;  1YW5 A;  4MPK A;  1RD6 A;  3O5G A;  1E6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...