3PR9A

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3pr9A00
1IX5A 3PRAA 3PR9A
chains in the Genus database with same CATH superfamily
3GU0A 3BXWA 3O5EA 1SYTA 1W1PA 4KR0B 1HKKA 3JYJA 1GRJA 4GGQA 4TW8A 1Q6IA 4Z2HA 1J4HA 4MGVA 2ITKA 3ARWA 3IKDA 3B8SA 3CZ8A 5DEZA 3I6CA 4Z2IA 5HWCA 2ZQTA 1HJXA 1FKSA 2RQSA 3CHCA 4J4NA 1YW5A 1ZBCA 2L2SA 1OGGA 2PPOA 4QT2A 2LGOA 2ZR4A 2PPPA 3G6LA 4HBOA 2PI6A 5D75A 2G8ZA 4IPXA 3EY6A 1W1YA 1JNSA 2A3AA 4S3KA 3WD1A 2IF4A 2XP8A 4Z2GA 3CGMA 4TW7A 3KZ7A 4ODKA 3WQVA 3O5MA 4Q22A 1LQ0A 1U79A 4HBEA 2F23A 3KCEA 2ESCA 3CHDA 3IK8A 1E44A 5HW7A 4IQ2A 4TYOA 4DZ2A 2O9OA 3PA7A 4QIBA 4TW6A 2XP9A 3TDBA 3QOKA 4LGXA 2KE0A 4ODNA 1K9TA 5HBFA 4NNRA 1YATA 2M08A 4KQZA 3ARVA 2OFNA 4U85A 1TFVA 1LJYA 3WIJA 3KAGA 2MLYA 1XRVA 4ODRA 4ODPA 4MNMA 2XP6A 3B9DA 2VCDA 1NWUA 1ZU8A 4Z2KA 3RM9A 2UZ5A 1ZCNA 4JFMA 3WL1A 3UQBA 2Y78A 2MPHA 4QZVB 2MF9A 5DIVA 2RUQA 2AWGA 3B7XA 5GQBA 2A3BA 1JVWA 1PINA 4URIA 4JFLA 1OWQA 3BMBA 4Q7NA 3G6MA 2WM0A 1QPLA 2WLZA 1Y0OA 2B31A 1E6RA 1ZBWA 2ETNA 4R5EA 4FAPA 2D9FA 4DRHA 4DT4A 1J4IA 1FKHA 1NWTA 1OGBA 4ODQA 1WAWA 1ROTA 3WL0A 3NTPA 2PPNA 1FD9A 4WKFA 1NSGA 3O5FA 4MAVA 3O5RA 2YBTA 1EDQA 1Q6HA 4TNSA 1FKFA 4JYSA 3CH9A 4ML4A 4WK9A 4C02B 1ZB5A 3KAIA 1X6NA 3RGCA 4DRKA 2RUDA 4NSBA 3PRBA 1W1TA 5HKGA 2JZVA 1PBKA 1W9UA 1HKMA 3O5PA 1JNDA 1FKTA 4W9QA 4J4OA 2XP4A 4WKHA 2A3CA 1P5QA 3CGNA 4P8XA 2G41A 3AQUA 2DG9A 4S3JA 1FKLA 1NH6A 4ZPVR 2RURA 2OLHA 4ITZA 1A7XA 4ODMA 1NWSA 2IUZA 5DIUA 3WD3A 1KFWA 1LL4A 1Q1CA 2K8IA 3ARUA 1L1PA 2PN0A 1ROUA 3ARYA 1FKIA 4DRPA 4QT3A 3ARSA 2ZR6A 5HTGA 3ARXA 2DG3A 2KFWA 1XHGA 2F21A 3FY1A 1T11A 3JXVA 1VF8A 3WH0A 3WD0A 3KACA 1FFRA 3FAPA 4DRNA 4MNLA 1UR8A 4DWSA 4LAXA 1D7IA 1E6ZA 1D6OA 2PBCA 3RFWA 3VAWA 5DITA 3O5DA 2MNTA 2DSWA 3UQAA 5J6EA 4W5UA 2MLZA 2M2AA 4P8UA 5HUAA 4Z2LA 1TCOC 3AS2A 2RSEA 2AOSA 1EQ3A 1H0GA 1W1VA 2DSVA 1X6LA 1Q6UA 2FDMA 3AROA 1N1AA 2ZR5A 1M5YA 4LAWA 2F2DA 4MNKA 1FAPA 1BKFA 3OA5A 4DWSD 1WNOA 4HARA 1HJVA 4MTVA 4MNJA 1EHNA 1JNEA 4P8VA 1CTNA 3O5LA 4DWSC 2ZQSA 1BL4A 1J4RA 1EIBA 1FKJA 2XP7A 1ZL1A 1NWRA 4G50A 4WKAA 4ODOA 4DIPA 3UF8A 1B6CA 1QPFA 3AS1A 4GIVA 2A3EA 1HKIA 1FKDA 4DWSB 2FKEA 3O5JA 4NZCA 1ITXA 3CHFA 1H0IA 1O6IA 3O5OA 4LAVA 1GUVA 3AS3A 1LL6A 3MDYB 4ZS6A 3ALFA 3W4RA 3UQIA 1LG1A 3NI6A 3KAHA 3UI5A 1F40A 4IT6A 4ODLA 4JFJA 2Q5AA 2DSUA 1WB0A 2B5UB 2DT1A 3ARQA 3LUOA 3WD2A 1HXVA 1ZBVA 2PV1A 3PRDA 4U86A 3PR9A 3KABA 1KT0A 4W9OA 4G2PA 4R0XA 1FFQA 1E15A 2XP3A 2ZQUA 3JYMA 4P8WA 5HT1A 4Z2JA 3O5GA 2DSZA 1IX5A 5DF0A 4L72B 3EIPA 3O5KA 3ARRA 3RM8A 5B8IC 4IQCA 4MPKA 2FAPA 4L3NA 3WKZA 3OOBA 1JNTA 2VN1A 4DRMA 2KI3A 3TCZA 2O92A 3WD4A 1D7HA 2EULA 2M1IA 4DRJA 3ALGA 3WQWA 1W26A 4N19A 4XAKA 3AS0A 5BXJA 3GTYX 2KR7A 1FKBA 1W9VA 1LG2A 1E6PA 2DPEA 3RM4A 2DT3A 4DROA 4DH0A 4IT4A 3H9RB 3ARTA 3NRKA 4DZ3A 1D2KA 1JCHB 2YBUA 1UR9A 1ZBKA 4WIWA 2DT0A 1E9LA 2PV3A 2KGJA 4UDMA 2KO7A 1ZK6A 2WLYA 1SR0A 5JH8A 1EYMA 2WK2A 3CHEA 4PTMA 1GPFA 4JFIA 1FKGA 1LL7A 2DG4A 2LPVA 3B9AA 3UI6A 2LJ4A 4JFKA 1C9HA 3KADA 5HWBA 1D7JA 4LAYA 1NMWA 3RMEA 2ZQVA 1FKKA 1HJWA 3FXYA 5GPRA 3ODKA 3O5QA 3TC5A 5I98A 2XPBA 2RUCA 4AY1A 1RD6A 4DRQA 4O2TA 2DT2A 1KT1A 1GOIA 1QZ2A 4ZPTR 4W9PA 2PV2A 4TX0A 3ARZA 1FKRA 2MLXA 3IHZA 5GPGA 3UI4A 1R9HA 1W9PA 5HW6A 3PRAA 4ZPWR 2XPAA 1J6YA 3ARPA 3B9EA 2F4EA 1F8AB 3O5IA 4U84A 3IKGA 2N87A 1NMVA 4MSPA 5DO2A 5HW8A 3GPKA 4BF8A 3KAFA 2P4VA 2LKNA 4DRIA 2XP5A 4FN2A 2QF8A 4WJXA 1FJDA 1HKJA 1E6NA
chains in the Genus database with same CATH topology
3O5EA 3BXWA 1SYTA 1W1PA 4KR0B 1HKKA 3JYJA 4GGQA 4TW8A 1Q6IA 4Z2HA 1J4HA 4MGVA 2ITKA 3ARWA 3IKDA 3B8SA 3CZ8A 5DEZA 3I6CA 4Z2IA 5HWCA 2ZQTA 1HJXA 1FKSA 2RQSA 3CHCA 4J4NA 1YW5A 1ZBCA 2L2SA 1OGGA 2PPOA 4QT2A 2LGOA 2ZR4A 2PPPA 3G6LA 4HBOA 2PI6A 5D75A 2G8ZA 4IPXA 3EY6A 1W1YA 1JNSA 2A3AA 4S3KA 3WD1A 2IF4A 2XP8A 4Z2GA 3CGMA 4TW7A 3KZ7A 4ODKA 3WQVA 3O5MA 4Q22A 1LQ0A 1U79A 4HBEA 3KCEA 2ESCA 3CHDA 3IK8A 5HW7A 4IQ2A 4TYOA 4DZ2A 2O9OA 3PA7A 4QIBA 4TW6A 2XP9A 3TDBA 3QOKA 4LGXA 2KE0A 4ODNA 1K9TA 5HBFA 4NNRA 1YATA 2M08A 4KQZA 3ARVA 2OFNA 4U85A 1TFVA 1LJYA 3WIJA 3KAGA 2MLYA 1XRVA 4ODRA 4ODPA 4MNMA 2XP6A 3B9DA 2VCDA 1NWUA 1ZU8A 4Z2KA 3RM9A 2UZ5A 1ZCNA 4JFMA 3WL1A 3UQBA 2Y78A 2MPHA 4QZVB 2MF9A 5DIVA 2RUQA 2AWGA 3B7XA 5GQBA 2A3BA 1JVWA 1PINA 4URIA 4JFLA 1OWQA 4Q7NA 3G6MA 2WM0A 1QPLA 2WLZA 1Y0OA 2B31A 1E6RA 1ZBWA 4R5EA 4FAPA 2D9FA 4DRHA 4DT4A 1J4IA 1FKHA 1NWTA 1OGBA 4ODQA 1WAWA 1ROTA 3WL0A 3NTPA 2PPNA 1FD9A 4WKFA 1NSGA 3O5FA 4MAVA 3O5RA 2YBTA 1EDQA 1Q6HA 4TNSA 1FKFA 4JYSA 3CH9A 4ML4A 4WK9A 4C02B 1ZB5A 3KAIA 1X6NA 3RGCA 4DRKA 2RUDA 4NSBA 3PRBA 1W1TA 5HKGA 2JZVA 1PBKA 1W9UA 1HKMA 3O5PA 1JNDA 1FKTA 4W9QA 4J4OA 2XP4A 4WKHA 2A3CA 1P5QA 3CGNA 4P8XA 2G41A 3AQUA 2DG9A 4S3JA 1FKLA 1NH6A 4ZPVR 2RURA 2OLHA 4ITZA 1A7XA 4ODMA 1NWSA 2IUZA 5DIUA 3WD3A 1KFWA 1LL4A 1Q1CA 2K8IA 3ARUA 1L1PA 1ROUA 3ARYA 1FKIA 4DRPA 4QT3A 3ARSA 2ZR6A 5HTGA 3ARXA 2DG3A 2KFWA 1XHGA 2F21A 3FY1A 1T11A 3JXVA 1VF8A 3WH0A 3WD0A 3KACA 1FFRA 3FAPA 4DRNA 4MNLA 1UR8A 4DWSA 4LAXA 1D7IA 1E6ZA 1D6OA 2PBCA 3RFWA 3VAWA 5DITA 3O5DA 2MNTA 2DSWA 3UQAA 5J6EA 4W5UA 2MLZA 2M2AA 4P8UA 5HUAA 4Z2LA 1TCOC 3AS2A 2RSEA 2AOSA 1EQ3A 1H0GA 1W1VA 2DSVA 1X6LA 1Q6UA 2FDMA 3AROA 1N1AA 2ZR5A 1M5YA 4LAWA 2F2DA 4MNKA 1FAPA 1BKFA 3OA5A 4DWSD 1WNOA 4HARA 1HJVA 4MTVA 4MNJA 1EHNA 1JNEA 4P8VA 1CTNA 3O5LA 4DWSC 2ZQSA 1BL4A 1J4RA 1EIBA 1FKJA 2XP7A 1ZL1A 1NWRA 4G50A 4WKAA 4ODOA 4DIPA 3UF8A 1B6CA 1QPFA 3AS1A 4GIVA 2A3EA 1HKIA 1FKDA 4DWSB 2FKEA 3O5JA 4NZCA 1ITXA 3CHFA 1H0IA 1O6IA 3O5OA 4LAVA 1GUVA 3AS3A 1LL6A 3MDYB 4ZS6A 3ALFA 3W4RA 3UQIA 1LG1A 3NI6A 3KAHA 3UI5A 1F40A 4IT6A 4ODLA 4JFJA 2Q5AA 2DSUA 1WB0A 2DT1A 3ARQA 3LUOA 3WD2A 1HXVA 1ZBVA 2PV1A 3PRDA 4U86A 3PR9A 3KABA 1KT0A 4W9OA 4G2PA 4R0XA 1FFQA 1E15A 2XP3A 2ZQUA 3JYMA 4P8WA 5HT1A 4Z2JA 3O5GA 2DSZA 1IX5A 5DF0A 4L72B 3O5KA 3RM8A 3ARRA 5B8IC 4IQCA 4MPKA 2FAPA 4L3NA 3WKZA 3OOBA 1JNTA 2VN1A 4DRMA 2KI3A 3TCZA 2O92A 3WD4A 1D7HA 2M1IA 4DRJA 3ALGA 3WQWA 1W26A 4N19A 4XAKA 3AS0A 5BXJA 2KR7A 1FKBA 1W9VA 1LG2A 1E6PA 2DPEA 3RM4A 2DT3A 4DROA 4DH0A 4IT4A 3H9RB 3ARTA 3NRKA 4DZ3A 1D2KA 2YBUA 1UR9A 1ZBKA 4WIWA 2DT0A 1E9LA 2PV3A 2KGJA 2KO7A 1ZK6A 2WLYA 1SR0A 5JH8A 1EYMA 2WK2A 3CHEA 4PTMA 1GPFA 4JFIA 1FKGA 1LL7A 2DG4A 2LPVA 3B9AA 3UI6A 2LJ4A 4JFKA 1C9HA 3KADA 5HWBA 1D7JA 4LAYA 1NMWA 3RMEA 2ZQVA 1FKKA 1HJWA 3FXYA 5GPRA 3ODKA 3O5QA 3TC5A 5I98A 2XPBA 2RUCA 4AY1A 1RD6A 4DRQA 4O2TA 2DT2A 1KT1A 1GOIA 1QZ2A 4ZPTR 4W9PA 2PV2A 4TX0A 3ARZA 1FKRA 2MLXA 3IHZA 5GPGA 3UI4A 1R9HA 1W9PA 5HW6A 3PRAA 4ZPWR 2XPAA 1J6YA 3ARPA 3B9EA 2F4EA 1F8AB 3O5IA 4U84A 3IKGA 2N87A 1NMVA 4MSPA 5DO2A 5HW8A 3GPKA 4BF8A 3KAFA 2LKNA 4DRIA 2XP5A 4FN2A 2QF8A 4WJXA 1FJDA 1HKJA 1E6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX5 A;  3PRA A;  3PR9 A; 
#chains in the Genus database with same CATH topology
 3GU0 A;  3BXW A;  3O5E A;  1SYT A;  1W1P A;  4KR0 B;  1HKK A;  3JYJ A;  1GRJ A;  4GGQ A;  4TW8 A;  1Q6I A;  4Z2H A;  1J4H A;  4MGV A;  2ITK A;  3ARW A;  3IKD A;  3B8S A;  3CZ8 A;  5DEZ A;  3I6C A;  4Z2I A;  5HWC A;  2ZQT A;  1HJX A;  1FKS A;  2RQS A;  3CHC A;  4J4N A;  1YW5 A;  1ZBC A;  2L2S A;  1OGG A;  2PPO A;  4QT2 A;  2LGO A;  2ZR4 A;  2PPP A;  3G6L A;  4HBO A;  2PI6 A;  5D75 A;  2G8Z A;  4IPX A;  3EY6 A;  1W1Y A;  1JNS A;  2A3A A;  4S3K A;  3WD1 A;  2IF4 A;  2XP8 A;  4Z2G A;  3CGM A;  4TW7 A;  3KZ7 A;  4ODK A;  3WQV A;  3O5M A;  4Q22 A;  1LQ0 A;  1U79 A;  4HBE A;  2F23 A;  3KCE A;  2ESC A;  3CHD A;  3IK8 A;  1E44 A;  5HW7 A;  4IQ2 A;  4TYO A;  4DZ2 A;  2O9O A;  3PA7 A;  4QIB A;  4TW6 A;  2XP9 A;  3TDB A;  3QOK A;  4LGX A;  2KE0 A;  4ODN A;  1K9T A;  5HBF A;  4NNR A;  1YAT A;  2M08 A;  4KQZ A;  3ARV A;  2OFN A;  4U85 A;  1TFV A;  1LJY A;  3WIJ A;  3KAG A;  2MLY A;  1XRV A;  4ODR A;  4ODP A;  4MNM A;  2XP6 A;  3B9D A;  2VCD A;  1NWU A;  1ZU8 A;  4Z2K A;  3RM9 A;  2UZ5 A;  1ZCN A;  4JFM A;  3WL1 A;  3UQB A;  2Y78 A;  2MPH A;  4QZV B;  2MF9 A;  5DIV A;  2RUQ A;  2AWG A;  3B7X A;  5GQB A;  2A3B A;  1JVW A;  1PIN A;  4URI A;  4JFL A;  1OWQ A;  3BMB A;  4Q7N A;  3G6M A;  2WM0 A;  1QPL A;  2WLZ A;  1Y0O A;  2B31 A;  1E6R A;  1ZBW A;  2ETN A;  4R5E A;  4FAP A;  2D9F A;  4DRH A;  4DT4 A;  1J4I A;  1FKH A;  1NWT A;  1OGB A;  4ODQ A;  1WAW A;  1ROT A;  3WL0 A;  3NTP A;  2PPN A;  1FD9 A;  4WKF A;  1NSG A;  3O5F A;  4MAV A;  3O5R A;  2YBT A;  1EDQ A;  1Q6H A;  4TNS A;  1FKF A;  4JYS A;  3CH9 A;  4ML4 A;  4WK9 A;  4C02 B;  1ZB5 A;  3KAI A;  1X6N A;  3RGC A;  4DRK A;  2RUD A;  4NSB A;  3PRB A;  1W1T A;  5HKG A;  2JZV A;  1PBK A;  1W9U A;  1HKM A;  3O5P A;  1JND A;  1FKT A;  4W9Q A;  4J4O A;  2XP4 A;  4WKH A;  2A3C A;  1P5Q A;  3CGN A;  4P8X A;  2G41 A;  3AQU A;  2DG9 A;  4S3J A;  1FKL A;  1NH6 A;  4ZPV R;  2RUR A;  2OLH A;  4ITZ A;  1A7X A;  4ODM A;  1NWS A;  2IUZ A;  5DIU A;  3WD3 A;  1KFW A;  1LL4 A;  1Q1C A;  2K8I A;  3ARU A;  1L1P A;  2PN0 A;  1ROU A;  3ARY A;  1FKI A;  4DRP A;  4QT3 A;  3ARS A;  2ZR6 A;  5HTG A;  3ARX A;  2DG3 A;  2KFW A;  1XHG A;  2F21 A;  3FY1 A;  1T11 A;  3JXV A;  1VF8 A;  3WH0 A;  3WD0 A;  3KAC A;  1FFR A;  3FAP A;  4DRN A;  4MNL A;  1UR8 A;  4DWS A;  4LAX A;  1D7I A;  1E6Z A;  1D6O A;  2PBC A;  3RFW A;  3VAW A;  5DIT A;  3O5D A;  2MNT A;  2DSW A;  3UQA A;  5J6E A;  4W5U A;  2MLZ A;  2M2A A;  4P8U A;  5HUA A;  4Z2L A;  1TCO C;  3AS2 A;  2RSE A;  2AOS A;  1EQ3 A;  1H0G A;  1W1V A;  2DSV A;  1X6L A;  1Q6U A;  2FDM A;  3ARO A;  1N1A A;  2ZR5 A;  1M5Y A;  4LAW A;  2F2D A;  4MNK A;  1FAP A;  1BKF A;  3OA5 A;  4DWS D;  1WNO A;  4HAR A;  1HJV A;  4MTV A;  4MNJ A;  1EHN A;  1JNE A;  4P8V A;  1CTN A;  3O5L A;  4DWS C;  2ZQS A;  1BL4 A;  1J4R A;  1EIB A;  1FKJ A;  2XP7 A;  1ZL1 A;  1NWR A;  4G50 A;  4WKA A;  4ODO A;  4DIP A;  3UF8 A;  1B6C A;  1QPF A;  3AS1 A;  4GIV A;  2A3E A;  1HKI A;  1FKD A;  4DWS B;  2FKE A;  3O5J A;  4NZC A;  1ITX A;  3CHF A;  1H0I A;  1O6I A;  3O5O A;  4LAV A;  1GUV A;  3AS3 A;  1LL6 A;  3MDY B;  4ZS6 A;  3ALF A;  3W4R A;  3UQI A;  1LG1 A;  3NI6 A;  3KAH A;  3UI5 A;  1F40 A;  4IT6 A;  4ODL A;  4JFJ A;  2Q5A A;  2DSU A;  1WB0 A;  2B5U B;  2DT1 A;  3ARQ A;  3LUO A;  3WD2 A;  1HXV A;  1ZBV A;  2PV1 A;  3PRD A;  4U86 A;  3PR9 A;  3KAB A;  1KT0 A;  4W9O A;  4G2P A;  4R0X A;  1FFQ A;  1E15 A;  2XP3 A;  2ZQU A;  3JYM A;  4P8W A;  5HT1 A;  4Z2J A;  3O5G A;  2DSZ A;  1IX5 A;  5DF0 A;  4L72 B;  3EIP A;  3O5K A;  3ARR A;  3RM8 A;  5B8I C;  4IQC A;  4MPK A;  2FAP A;  4L3N A;  3WKZ A;  3OOB A;  1JNT A;  2VN1 A;  4DRM A;  2KI3 A;  3TCZ A;  2O92 A;  3WD4 A;  1D7H A;  2EUL A;  2M1I A;  4DRJ A;  3ALG A;  3WQW A;  1W26 A;  4N19 A;  4XAK A;  3AS0 A;  5BXJ A;  3GTY X;  2KR7 A;  1FKB A;  1W9V A;  1LG2 A;  1E6P A;  2DPE A;  3RM4 A;  2DT3 A;  4DRO A;  4DH0 A;  4IT4 A;  3H9R B;  3ART A;  3NRK A;  4DZ3 A;  1D2K A;  1JCH B;  2YBU A;  1UR9 A;  1ZBK A;  4WIW A;  2DT0 A;  1E9L A;  2PV3 A;  2KGJ A;  4UDM A;  2KO7 A;  1ZK6 A;  2WLY A;  1SR0 A;  5JH8 A;  1EYM A;  2WK2 A;  3CHE A;  4PTM A;  1GPF A;  4JFI A;  1FKG A;  1LL7 A;  2DG4 A;  2LPV A;  3B9A A;  3UI6 A;  2LJ4 A;  4JFK A;  1C9H A;  3KAD A;  5HWB A;  1D7J A;  4LAY A;  1NMW A;  3RME A;  2ZQV A;  1FKK A;  1HJW A;  3FXY A;  5GPR A;  3ODK A;  3O5Q A;  3TC5 A;  5I98 A;  2XPB A;  2RUC A;  4AY1 A;  1RD6 A;  4DRQ A;  4O2T A;  2DT2 A;  1KT1 A;  1GOI A;  1QZ2 A;  4ZPT R;  4W9P A;  2PV2 A;  4TX0 A;  3ARZ A;  1FKR A;  2MLX A;  3IHZ A;  5GPG A;  3UI4 A;  1R9H A;  1W9P A;  5HW6 A;  3PRA A;  4ZPW R;  2XPA A;  1J6Y A;  3ARP A;  3B9E A;  2F4E A;  1F8A B;  3O5I A;  4U84 A;  3IKG A;  2N87 A;  1NMV A;  4MSP A;  5DO2 A;  5HW8 A;  3GPK A;  4BF8 A;  3KAF A;  2P4V A;  2LKN A;  4DRI A;  2XP5 A;  4FN2 A;  2QF8 A;  4WJX A;  1FJD A;  1HKJ A;  1E6N A; 
#chains in the Genus database with same CATH homology
 3O5E A;  3BXW A;  1SYT A;  1W1P A;  4KR0 B;  1HKK A;  3JYJ A;  4GGQ A;  4TW8 A;  1Q6I A;  4Z2H A;  1J4H A;  4MGV A;  2ITK A;  3ARW A;  3IKD A;  3B8S A;  3CZ8 A;  5DEZ A;  3I6C A;  4Z2I A;  5HWC A;  2ZQT A;  1HJX A;  1FKS A;  2RQS A;  3CHC A;  4J4N A;  1YW5 A;  1ZBC A;  2L2S A;  1OGG A;  2PPO A;  4QT2 A;  2LGO A;  2ZR4 A;  2PPP A;  3G6L A;  4HBO A;  2PI6 A;  5D75 A;  2G8Z A;  4IPX A;  3EY6 A;  1W1Y A;  1JNS A;  2A3A A;  4S3K A;  3WD1 A;  2IF4 A;  2XP8 A;  4Z2G A;  3CGM A;  4TW7 A;  3KZ7 A;  4ODK A;  3WQV A;  3O5M A;  4Q22 A;  1LQ0 A;  1U79 A;  4HBE A;  3KCE A;  2ESC A;  3CHD A;  3IK8 A;  5HW7 A;  4IQ2 A;  4TYO A;  4DZ2 A;  2O9O A;  3PA7 A;  4QIB A;  4TW6 A;  2XP9 A;  3TDB A;  3QOK A;  4LGX A;  2KE0 A;  4ODN A;  1K9T A;  5HBF A;  4NNR A;  1YAT A;  2M08 A;  4KQZ A;  3ARV A;  2OFN A;  4U85 A;  1TFV A;  1LJY A;  3WIJ A;  3KAG A;  2MLY A;  1XRV A;  4ODR A;  4ODP A;  4MNM A;  2XP6 A;  3B9D A;  2VCD A;  1NWU A;  1ZU8 A;  4Z2K A;  3RM9 A;  2UZ5 A;  1ZCN A;  4JFM A;  3WL1 A;  3UQB A;  2Y78 A;  2MPH A;  4QZV B;  2MF9 A;  5DIV A;  2RUQ A;  2AWG A;  3B7X A;  5GQB A;  2A3B A;  1JVW A;  1PIN A;  4URI A;  4JFL A;  1OWQ A;  4Q7N A;  3G6M A;  2WM0 A;  1QPL A;  2WLZ A;  1Y0O A;  2B31 A;  1E6R A;  1ZBW A;  4R5E A;  4FAP A;  2D9F A;  4DRH A;  4DT4 A;  1J4I A;  1FKH A;  1NWT A;  1OGB A;  4ODQ A;  1WAW A;  1ROT A;  3WL0 A;  3NTP A;  2PPN A;  1FD9 A;  4WKF A;  1NSG A;  3O5F A;  4MAV A;  3O5R A;  2YBT A;  1EDQ A;  1Q6H A;  4TNS A;  1FKF A;  4JYS A;  3CH9 A;  4ML4 A;  4WK9 A;  4C02 B;  1ZB5 A;  3KAI A;  1X6N A;  3RGC A;  4DRK A;  2RUD A;  4NSB A;  3PRB A;  1W1T A;  5HKG A;  2JZV A;  1PBK A;  1W9U A;  1HKM A;  3O5P A;  1JND A;  1FKT A;  4W9Q A;  4J4O A;  2XP4 A;  4WKH A;  2A3C A;  1P5Q A;  3CGN A;  4P8X A;  2G41 A;  3AQU A;  2DG9 A;  4S3J A;  1FKL A;  1NH6 A;  4ZPV R;  2RUR A;  2OLH A;  4ITZ A;  1A7X A;  4ODM A;  1NWS A;  2IUZ A;  5DIU A;  3WD3 A;  1KFW A;  1LL4 A;  1Q1C A;  2K8I A;  3ARU A;  1L1P A;  1ROU A;  3ARY A;  1FKI A;  4DRP A;  4QT3 A;  3ARS A;  2ZR6 A;  5HTG A;  3ARX A;  2DG3 A;  2KFW A;  1XHG A;  2F21 A;  3FY1 A;  1T11 A;  3JXV A;  1VF8 A;  3WH0 A;  3WD0 A;  3KAC A;  1FFR A;  3FAP A;  4DRN A;  4MNL A;  1UR8 A;  4DWS A;  4LAX A;  1D7I A;  1E6Z A;  1D6O A;  2PBC A;  3RFW A;  3VAW A;  5DIT A;  3O5D A;  2MNT A;  2DSW A;  3UQA A;  5J6E A;  4W5U A;  2MLZ A;  2M2A A;  4P8U A;  5HUA A;  4Z2L A;  1TCO C;  3AS2 A;  2RSE A;  2AOS A;  1EQ3 A;  1H0G A;  1W1V A;  2DSV A;  1X6L A;  1Q6U A;  2FDM A;  3ARO A;  1N1A A;  2ZR5 A;  1M5Y A;  4LAW A;  2F2D A;  4MNK A;  1FAP A;  1BKF A;  3OA5 A;  4DWS D;  1WNO A;  4HAR A;  1HJV A;  4MTV A;  4MNJ A;  1EHN A;  1JNE A;  4P8V A;  1CTN A;  3O5L A;  4DWS C;  2ZQS A;  1BL4 A;  1J4R A;  1EIB A;  1FKJ A;  2XP7 A;  1ZL1 A;  1NWR A;  4G50 A;  4WKA A;  4ODO A;  4DIP A;  3UF8 A;  1B6C A;  1QPF A;  3AS1 A;  4GIV A;  2A3E A;  1HKI A;  1FKD A;  4DWS B;  2FKE A;  3O5J A;  4NZC A;  1ITX A;  3CHF A;  1H0I A;  1O6I A;  3O5O A;  4LAV A;  1GUV A;  3AS3 A;  1LL6 A;  3MDY B;  4ZS6 A;  3ALF A;  3W4R A;  3UQI A;  1LG1 A;  3NI6 A;  3KAH A;  3UI5 A;  1F40 A;  4IT6 A;  4ODL A;  4JFJ A;  2Q5A A;  2DSU A;  1WB0 A;  2DT1 A;  3ARQ A;  3LUO A;  3WD2 A;  1HXV A;  1ZBV A;  2PV1 A;  3PRD A;  4U86 A;  3PR9 A;  3KAB A;  1KT0 A;  4W9O A;  4G2P A;  4R0X A;  1FFQ A;  1E15 A;  2XP3 A;  2ZQU A;  3JYM A;  4P8W A;  5HT1 A;  4Z2J A;  3O5G A;  2DSZ A;  1IX5 A;  5DF0 A;  4L72 B;  3O5K A;  3RM8 A;  3ARR A;  5B8I C;  4IQC A;  4MPK A;  2FAP A;  4L3N A;  3WKZ A;  3OOB A;  1JNT A;  2VN1 A;  4DRM A;  2KI3 A;  3TCZ A;  2O92 A;  3WD4 A;  1D7H A;  2M1I A;  4DRJ A;  3ALG A;  3WQW A;  1W26 A;  4N19 A;  4XAK A;  3AS0 A;  5BXJ A;  2KR7 A;  1FKB A;  1W9V A;  1LG2 A;  1E6P A;  2DPE A;  3RM4 A;  2DT3 A;  4DRO A;  4DH0 A;  4IT4 A;  3H9R B;  3ART A;  3NRK A;  4DZ3 A;  1D2K A;  2YBU A;  1UR9 A;  1ZBK A;  4WIW A;  2DT0 A;  1E9L A;  2PV3 A;  2KGJ A;  2KO7 A;  1ZK6 A;  2WLY A;  1SR0 A;  5JH8 A;  1EYM A;  2WK2 A;  3CHE A;  4PTM A;  1GPF A;  4JFI A;  1FKG A;  1LL7 A;  2DG4 A;  2LPV A;  3B9A A;  3UI6 A;  2LJ4 A;  4JFK A;  1C9H A;  3KAD A;  5HWB A;  1D7J A;  4LAY A;  1NMW A;  3RME A;  2ZQV A;  1FKK A;  1HJW A;  3FXY A;  5GPR A;  3ODK A;  3O5Q A;  3TC5 A;  5I98 A;  2XPB A;  2RUC A;  4AY1 A;  1RD6 A;  4DRQ A;  4O2T A;  2DT2 A;  1KT1 A;  1GOI A;  1QZ2 A;  4ZPT R;  4W9P A;  2PV2 A;  4TX0 A;  3ARZ A;  1FKR A;  2MLX A;  3IHZ A;  5GPG A;  3UI4 A;  1R9H A;  1W9P A;  5HW6 A;  3PRA A;  4ZPW R;  2XPA A;  1J6Y A;  3ARP A;  3B9E A;  2F4E A;  1F8A B;  3O5I A;  4U84 A;  3IKG A;  2N87 A;  1NMV A;  4MSP A;  5DO2 A;  5HW8 A;  3GPK A;  4BF8 A;  3KAF A;  2LKN A;  4DRI A;  2XP5 A;  4FN2 A;  2QF8 A;  4WJX A;  1FJD A;  1HKJ A;  1E6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...