3PR9A

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
molecule tags Chaperone
source organism Methanocaldococcus jannaschii
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3pr9A00
1IX5A 3PRAA 3PR9A
chains in the Genus database with same CATH superfamily
1SR0A 1R9HA 5I98A 4DRPA 5HW6A 1W1VA 4WKHA 3WD2A 2WLYA 3CZ8A 3ODKA 4WJXA 4LAXA 1JNSA 3ARZA 3ARQA 3NRKA 3O5QA 3UQBA 4MTVA 2DPEA 1Q6HA 4W9QA 1ZBKA 2G41A 4ODKA 2KGJA 4MAVA 5HKGA 2RQSA 5B8IC 4JYSA 1IX5A 1M5YA 3KAHA 4TW8A 1HXVA 3G6LA 2F21A 3KACA 3IK8A 1FD9A 4U84A 3WH0A 4P8WA 1A7XA 1QPLA 4Q22A 1ZCNA 3MDYB 3CGMA 4DWSB 4P8UA 2RUCA 4DROA 1FKIA 2XP7A 4MGVA 4DRHA 4HBEA 2ETNA 3ARRA 3AS1A 1JNDA 4IPXA 1UR8A 3CHFA 4TYOA 1H0IA 2XP4A 3OA5A 2MLYA 3B8SA 3WL1A 2PV3A 1E15A 1W1TA 1H0GA 3PR9A 1GRJA 2XP9A 2DT3A 2RSEA 4DRMA 1FKDA 1FKHA 1J4HA 4DRKA 2PPNA 2PV2A 4WIWA 3JYJA 2LPVA 2ESCA 2ZQTA 2O9OA 1FKBA 1K9TA 3W4RA 4MPKA 4WKFA 3OOBA 2ZQVA 5HW7A 1D7IA 1ZB5A 3WQWA 3O5GA 4ITZA 1JNEA 1E6ZA 4TX0A 1VF8A 4R0XA 1E6NA 4IQ2A 3NTPA 2IUZA 2WM0A 2FKEA 4W9PA 3H9RB 5JH8A 1QZ2A 2ZR4A 4L72B 3WIJA 3UI6A 4IT4A 4JFKA 4ODMA 3KABA 2PBCA 4BF8A 2M2AA 1C9HA 2RUQA 1JVWA 4LAWA 2LJ4A 1RD6A 2DSWA 3PRBA 2XP6A 3BXWA 1FKLA 3KADA 3WQVA 1BKFA 2A3BA 4HARA 1D6OA 2MPHA 3JYMA 4MSPA 1LQ0A 2OLHA 1ZBWA 2AOSA 1XHGA 2F2DA 1E9LA 5HWBA 1FKRA 4QIBA 3O5FA 1NMWA 1FKKA 3AROA 4GGQA 1KT1A 1Q1CA 1FAPA 4Z2KA 4AY1A 3KZ7A 3PRAA 1WB0A 5D75A 3WD0A 3O5PA 2Q5AA 5HWCA 2XPAA 4G50A 1HKJA 3B7XA 3O5DA 2XP8A 3GTYX 2ZQUA 1D7JA 1EHNA 4GIVA 3ARSA 2QF8A 1ZL1A 4TW7A 1OGGA 1YW5A 2N87A 2DSZA 4JFIA 4LAVA 4Q7NA 2A3AA 5HUAA 1EYMA 1CTNA 4DRJA 3TDBA 3WKZA 3UF8A 1W1PA 4N19A 2LKNA 3RM9A 2DG4A 4DWSC 2L2SA 3WD1A 5GPRA 3O5RA 1E6PA 4QT2A 3ARVA 5DIUA 1HKIA 4IQCA 1F40A 3UI4A 1JNTA 4FAPA 1HKMA 5DEZA 2AWGA 3O5EA 3ARPA 1ZK6A 5DIVA 3ARXA 4Z2IA 1J4IA 4DRNA 1HJVA 1UR9A 2A3EA 1YATA 1SYTA 4JFLA 2DT0A 3B9EA 4Z2LA 4ZPVR 4QT3A 2XP3A 3FAPA 5DITA 3BMBA 3B9AA 4S3KA 3AQUA 1LL4A 4MNJA 1LJYA 3ARTA 4ODRA 2RURA 2YBUA 1NWRA 2DSUA 2B5UB 3RMEA 4WK9A 4W9OA 4J4NA 4U85A 3VAWA 1W9VA 3CHEA 1D7HA 2D9FA 3EY6A 1PINA 3CHDA 2MLXA 3RGCA 3UI5A 1Y0OA 4PTMA 1B6CA 4FN2A 2UZ5A 4U86A 4ODNA 1U79A 1HJWA 4R5EA 4WKAA 4ODPA 2ZQSA 3ALFA 2M08A 2KFWA 1FFRA 1HJXA 2MNTA 4LAYA 4ODOA 3CH9A 1N1AA 1LG2A 2LGOA 1ZU8A 4KR0B 1OGBA 4P8XA 4W5UA 3KAIA 2ITKA 2PPOA 2ZR6A 3IHZA 3NI6A 4MNKA 2XPBA 1F8AB 2DT1A 4JFJA 5HT1A 2O92A 4O2TA 2XP5A 1FFQA 1WNOA 4JFMA 3ALGA 3KCEA 2PI6A 1E44A 1FJDA 1NH6A 2PPPA 3ARUA 2IF4A 1W26A 3AS0A 1X6NA 1T11A 1J4RA 3WD3A 3PRDA 1Q6UA 3CGNA 5GQBA 4URIA 1BL4A 3GPKA 1TCOC 1Q6IA 1NWTA 1E6RA 5HBFA 4ODQA 4QZVB 2WLZA 4DZ3A 3ARYA 1XRVA 4TNSA 2MLZA 2A3CA 1W9PA 3IKDA 3JXVA 3PA7A 2RUDA 4NZCA 4XAKA 4C02B 1ROTA 4TW6A 3O5MA 1LL6A 3QOKA 1J6YA 4DWSA 2YBTA 4DH0A 3RM8A 1FKGA 4J4OA 2VN1A 2DG9A 2DG3A 1NSGA 1LG1A 3B9DA 2DT2A 1EQ3A 2F4EA 5J6EA 4NNRA 1PBKA 1ROUA 2FDMA 2B31A 1FKFA 5BXJA 2ZR5A 4MNLA 1FKTA 1KT0A 3IKGA 2G8ZA 2P4VA 2VCDA 5GPGA 1ZBCA 3AS2A 3I6CA 4IT6A 5DO2A 1ITXA 3GU0A 3UQAA 4DZ2A 3TC5A 3TCZA 2FAPA 1OWQA 4KQZA 3LUOA 4G2PA 1NWUA 2MF9A 1FKSA 2OFNA 4DT4A 2KI3A 2KE0A 2K8IA 2KR7A 4NSBA 4ZPTR 1NWSA 1QPFA 3O5KA 1NMVA 4L3NA 2WK2A 4ODLA 5HTGA 2PV1A 3O5LA 4ML4A 1EIBA 1TFVA 2Y78A 2M1IA 3G6MA 4MNMA 1GUVA 1P5QA 4P8VA 1W1YA 3WD4A 4ZPWR 1L1PA 1W9UA 1ZBVA 4UDMA 4DWSD 1LL7A 3CHCA 5DF0A 1GPFA 3WL0A 5HW8A 3O5OA 4Z2HA 3UQIA 4DIPA 1D2KA 1HKKA 4Z2GA 3EIPA 3FXYA 4S3JA 1O6IA 3O5JA 1GOIA 3AS3A 3RM4A 3KAFA 2F23A 1FKJA 3KAGA 1JCHB 2KO7A 3O5IA 3ARWA 4DRIA 3FY1A 1KFWA 1WAWA 4Z2JA 1EDQA 2DSVA 2PN0A 4DRQA 1X6LA 2JZVA 4HBOA 4ZS6A 4LGXA 3RFWA 2EULA
chains in the Genus database with same CATH topology
1SR0A 1R9HA 5I98A 4DRPA 5HW6A 1W1VA 4WKHA 3WD2A 2WLYA 3CZ8A 3ODKA 4WJXA 4LAXA 1JNSA 3ARZA 3ARQA 3NRKA 3O5QA 3UQBA 4MTVA 2DPEA 1Q6HA 4W9QA 1ZBKA 2G41A 4ODKA 2KGJA 4MAVA 5HKGA 2RQSA 5B8IC 4JYSA 1IX5A 1M5YA 3KAHA 4TW8A 1HXVA 3G6LA 2F21A 3KACA 3IK8A 1FD9A 4U84A 3WH0A 4P8WA 1A7XA 1QPLA 4Q22A 1ZCNA 3MDYB 3CGMA 4DWSB 4P8UA 2RUCA 4DROA 1FKIA 2XP7A 4MGVA 4DRHA 4HBEA 3ARRA 3AS1A 1JNDA 4IPXA 1UR8A 3CHFA 4TYOA 1H0IA 2XP4A 3OA5A 2MLYA 3B8SA 3WL1A 2PV3A 1E15A 1W1TA 1H0GA 3PR9A 2XP9A 2DT3A 2RSEA 4DRMA 1FKDA 1FKHA 1J4HA 4DRKA 2PPNA 2PV2A 4WIWA 3JYJA 2LPVA 2ESCA 2ZQTA 2O9OA 1FKBA 1K9TA 3W4RA 4MPKA 4WKFA 3OOBA 2ZQVA 5HW7A 1D7IA 1ZB5A 3WQWA 3O5GA 4ITZA 1JNEA 1E6ZA 4TX0A 1VF8A 4R0XA 1E6NA 4IQ2A 3NTPA 2IUZA 2WM0A 2FKEA 4W9PA 3H9RB 5JH8A 1QZ2A 2ZR4A 4L72B 3WIJA 3UI6A 4IT4A 4JFKA 4ODMA 3KABA 2PBCA 4BF8A 2M2AA 1C9HA 2RUQA 1JVWA 4LAWA 2LJ4A 1RD6A 2DSWA 3PRBA 2XP6A 3BXWA 1FKLA 3KADA 3WQVA 1BKFA 2A3BA 4HARA 1D6OA 2MPHA 3JYMA 4MSPA 1LQ0A 2OLHA 1ZBWA 2AOSA 1XHGA 2F2DA 1E9LA 5HWBA 1FKRA 4QIBA 3O5FA 1NMWA 1FKKA 3AROA 4GGQA 1KT1A 1Q1CA 1FAPA 4Z2KA 4AY1A 3KZ7A 3PRAA 1WB0A 5D75A 3WD0A 3O5PA 2Q5AA 5HWCA 2XPAA 4G50A 1HKJA 3B7XA 3O5DA 2XP8A 2ZQUA 1D7JA 1EHNA 4GIVA 3ARSA 2QF8A 1ZL1A 4TW7A 1OGGA 1YW5A 2N87A 2DSZA 4JFIA 4LAVA 4Q7NA 2A3AA 5HUAA 1EYMA 1CTNA 4DRJA 3TDBA 3WKZA 3UF8A 1W1PA 4N19A 2LKNA 3RM9A 2DG4A 4DWSC 2L2SA 3WD1A 5GPRA 3O5RA 1E6PA 4QT2A 3ARVA 5DIUA 1HKIA 4IQCA 1F40A 3UI4A 1JNTA 4FAPA 1HKMA 5DEZA 2AWGA 3O5EA 3ARPA 1ZK6A 5DIVA 3ARXA 4Z2IA 1J4IA 4DRNA 1HJVA 1UR9A 2A3EA 1YATA 1SYTA 4JFLA 2DT0A 3B9EA 4Z2LA 4ZPVR 4QT3A 2XP3A 3FAPA 5DITA 4S3KA 3B9AA 3AQUA 1LL4A 4MNJA 1LJYA 3ARTA 4ODRA 2RURA 2YBUA 1NWRA 2DSUA 3RMEA 4WK9A 4W9OA 4J4NA 4U85A 3VAWA 1W9VA 3CHEA 1D7HA 2D9FA 3EY6A 1PINA 3CHDA 2MLXA 3RGCA 3UI5A 1Y0OA 4PTMA 1B6CA 4FN2A 2UZ5A 4U86A 4ODNA 1U79A 1HJWA 4R5EA 4WKAA 4ODPA 2ZQSA 3ALFA 2M08A 2KFWA 1FFRA 1HJXA 2MNTA 4LAYA 4ODOA 3CH9A 1N1AA 1LG2A 2LGOA 1ZU8A 4KR0B 1OGBA 4P8XA 4W5UA 3KAIA 2ITKA 2PPOA 2ZR6A 3IHZA 3NI6A 4MNKA 2XPBA 1F8AB 2DT1A 4JFJA 5HT1A 2O92A 4O2TA 2XP5A 1FFQA 1WNOA 4JFMA 3ALGA 3KCEA 2PI6A 1FJDA 1NH6A 2PPPA 3ARUA 2IF4A 1W26A 3AS0A 1X6NA 1T11A 1J4RA 3WD3A 3PRDA 1Q6UA 3CGNA 5GQBA 4URIA 1BL4A 3GPKA 1TCOC 1Q6IA 1NWTA 1E6RA 5HBFA 4ODQA 4QZVB 2WLZA 4DZ3A 3ARYA 1XRVA 4TNSA 2MLZA 2A3CA 1W9PA 3IKDA 3JXVA 3PA7A 2RUDA 4NZCA 4XAKA 4C02B 1ROTA 4TW6A 3O5MA 1LL6A 3QOKA 1J6YA 4DWSA 2YBTA 4DH0A 3RM8A 1FKGA 4J4OA 2VN1A 2DG9A 2DG3A 1NSGA 1LG1A 3B9DA 2DT2A 1EQ3A 2F4EA 5J6EA 4NNRA 1PBKA 1ROUA 2FDMA 2B31A 1FKFA 5BXJA 2ZR5A 4MNLA 1FKTA 1KT0A 3IKGA 2G8ZA 5GPGA 2VCDA 1ZBCA 3AS2A 3I6CA 4IT6A 5DO2A 1ITXA 3UQAA 4DZ2A 3TC5A 3TCZA 2FAPA 1OWQA 4KQZA 3LUOA 4G2PA 1NWUA 2MF9A 1FKSA 2OFNA 4DT4A 2KI3A 2KE0A 2K8IA 2KR7A 4NSBA 4ZPTR 1NWSA 1QPFA 3O5KA 1NMVA 4L3NA 2WK2A 4ODLA 5HTGA 2PV1A 3O5LA 4ML4A 1EIBA 1TFVA 2Y78A 2M1IA 3G6MA 4MNMA 1GUVA 1P5QA 4P8VA 1W1YA 3WD4A 4ZPWR 1L1PA 1W9UA 1ZBVA 4DWSD 1LL7A 3CHCA 5DF0A 1GPFA 3WL0A 5HW8A 3O5OA 4Z2HA 3UQIA 4DIPA 1D2KA 1HKKA 4Z2GA 3FXYA 4S3JA 1O6IA 3O5JA 1GOIA 3AS3A 3RM4A 3KAFA 1FKJA 3KAGA 3O5IA 2KO7A 3ARWA 4DRIA 3FY1A 1KFWA 1WAWA 4Z2JA 1EDQA 2DSVA 4DRQA 1X6LA 2JZVA 4HBOA 4ZS6A 4LGXA 3RFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX5 A;  3PRA A;  3PR9 A; 
#chains in the Genus database with same CATH topology
 1SR0 A;  1R9H A;  5I98 A;  4DRP A;  5HW6 A;  1W1V A;  4WKH A;  3WD2 A;  2WLY A;  3CZ8 A;  3ODK A;  4WJX A;  4LAX A;  1JNS A;  3ARZ A;  3ARQ A;  3NRK A;  3O5Q A;  3UQB A;  4MTV A;  2DPE A;  1Q6H A;  4W9Q A;  1ZBK A;  2G41 A;  4ODK A;  2KGJ A;  4MAV A;  5HKG A;  2RQS A;  5B8I C;  4JYS A;  1IX5 A;  1M5Y A;  3KAH A;  4TW8 A;  1HXV A;  3G6L A;  2F21 A;  3KAC A;  3IK8 A;  1FD9 A;  4U84 A;  3WH0 A;  4P8W A;  1A7X A;  1QPL A;  4Q22 A;  1ZCN A;  3MDY B;  3CGM A;  4DWS B;  4P8U A;  2RUC A;  4DRO A;  1FKI A;  2XP7 A;  4MGV A;  4DRH A;  4HBE A;  2ETN A;  3ARR A;  3AS1 A;  1JND A;  4IPX A;  1UR8 A;  3CHF A;  4TYO A;  1H0I A;  2XP4 A;  3OA5 A;  2MLY A;  3B8S A;  3WL1 A;  2PV3 A;  1E15 A;  1W1T A;  1H0G A;  3PR9 A;  1GRJ A;  2XP9 A;  2DT3 A;  2RSE A;  4DRM A;  1FKD A;  1FKH A;  1J4H A;  4DRK A;  2PPN A;  2PV2 A;  4WIW A;  3JYJ A;  2LPV A;  2ESC A;  2ZQT A;  2O9O A;  1FKB A;  1K9T A;  3W4R A;  4MPK A;  4WKF A;  3OOB A;  2ZQV A;  5HW7 A;  1D7I A;  1ZB5 A;  3WQW A;  3O5G A;  4ITZ A;  1JNE A;  1E6Z A;  4TX0 A;  1VF8 A;  4R0X A;  1E6N A;  4IQ2 A;  3NTP A;  2IUZ A;  2WM0 A;  2FKE A;  4W9P A;  3H9R B;  5JH8 A;  1QZ2 A;  2ZR4 A;  4L72 B;  3WIJ A;  3UI6 A;  4IT4 A;  4JFK A;  4ODM A;  3KAB A;  2PBC A;  4BF8 A;  2M2A A;  1C9H A;  2RUQ A;  1JVW A;  4LAW A;  2LJ4 A;  1RD6 A;  2DSW A;  3PRB A;  2XP6 A;  3BXW A;  1FKL A;  3KAD A;  3WQV A;  1BKF A;  2A3B A;  4HAR A;  1D6O A;  2MPH A;  3JYM A;  4MSP A;  1LQ0 A;  2OLH A;  1ZBW A;  2AOS A;  1XHG A;  2F2D A;  1E9L A;  5HWB A;  1FKR A;  4QIB A;  3O5F A;  1NMW A;  1FKK A;  3ARO A;  4GGQ A;  1KT1 A;  1Q1C A;  1FAP A;  4Z2K A;  4AY1 A;  3KZ7 A;  3PRA A;  1WB0 A;  5D75 A;  3WD0 A;  3O5P A;  2Q5A A;  5HWC A;  2XPA A;  4G50 A;  1HKJ A;  3B7X A;  3O5D A;  2XP8 A;  3GTY X;  2ZQU A;  1D7J A;  1EHN A;  4GIV A;  3ARS A;  2QF8 A;  1ZL1 A;  4TW7 A;  1OGG A;  1YW5 A;  2N87 A;  2DSZ A;  4JFI A;  4LAV A;  4Q7N A;  2A3A A;  5HUA A;  1EYM A;  1CTN A;  4DRJ A;  3TDB A;  3WKZ A;  3UF8 A;  1W1P A;  4N19 A;  2LKN A;  3RM9 A;  2DG4 A;  4DWS C;  2L2S A;  3WD1 A;  5GPR A;  3O5R A;  1E6P A;  4QT2 A;  3ARV A;  5DIU A;  1HKI A;  4IQC A;  1F40 A;  3UI4 A;  1JNT A;  4FAP A;  1HKM A;  5DEZ A;  2AWG A;  3O5E A;  3ARP A;  1ZK6 A;  5DIV A;  3ARX A;  4Z2I A;  1J4I A;  4DRN A;  1HJV A;  1UR9 A;  2A3E A;  1YAT A;  1SYT A;  4JFL A;  2DT0 A;  3B9E A;  4Z2L A;  4ZPV R;  4QT3 A;  2XP3 A;  3FAP A;  5DIT A;  3BMB A;  3B9A A;  4S3K A;  3AQU A;  1LL4 A;  4MNJ A;  1LJY A;  3ART A;  4ODR A;  2RUR A;  2YBU A;  1NWR A;  2DSU A;  2B5U B;  3RME A;  4WK9 A;  4W9O A;  4J4N A;  4U85 A;  3VAW A;  1W9V A;  3CHE A;  1D7H A;  2D9F A;  3EY6 A;  1PIN A;  3CHD A;  2MLX A;  3RGC A;  3UI5 A;  1Y0O A;  4PTM A;  1B6C A;  4FN2 A;  2UZ5 A;  4U86 A;  4ODN A;  1U79 A;  1HJW A;  4R5E A;  4WKA A;  4ODP A;  2ZQS A;  3ALF A;  2M08 A;  2KFW A;  1FFR A;  1HJX A;  2MNT A;  4LAY A;  4ODO A;  3CH9 A;  1N1A A;  1LG2 A;  2LGO A;  1ZU8 A;  4KR0 B;  1OGB A;  4P8X A;  4W5U A;  3KAI A;  2ITK A;  2PPO A;  2ZR6 A;  3IHZ A;  3NI6 A;  4MNK A;  2XPB A;  1F8A B;  2DT1 A;  4JFJ A;  5HT1 A;  2O92 A;  4O2T A;  2XP5 A;  1FFQ A;  1WNO A;  4JFM A;  3ALG A;  3KCE A;  2PI6 A;  1E44 A;  1FJD A;  1NH6 A;  2PPP A;  3ARU A;  2IF4 A;  1W26 A;  3AS0 A;  1X6N A;  1T11 A;  1J4R A;  3WD3 A;  3PRD A;  1Q6U A;  3CGN A;  5GQB A;  4URI A;  1BL4 A;  3GPK A;  1TCO C;  1Q6I A;  1NWT A;  1E6R A;  5HBF A;  4ODQ A;  4QZV B;  2WLZ A;  4DZ3 A;  3ARY A;  1XRV A;  4TNS A;  2MLZ A;  2A3C A;  1W9P A;  3IKD A;  3JXV A;  3PA7 A;  2RUD A;  4NZC A;  4XAK A;  4C02 B;  1ROT A;  4TW6 A;  3O5M A;  1LL6 A;  3QOK A;  1J6Y A;  4DWS A;  2YBT A;  4DH0 A;  3RM8 A;  1FKG A;  4J4O A;  2VN1 A;  2DG9 A;  2DG3 A;  1NSG A;  1LG1 A;  3B9D A;  2DT2 A;  1EQ3 A;  2F4E A;  5J6E A;  4NNR A;  1PBK A;  1ROU A;  2FDM A;  2B31 A;  1FKF A;  5BXJ A;  2ZR5 A;  4MNL A;  1FKT A;  1KT0 A;  3IKG A;  2G8Z A;  2P4V A;  2VCD A;  5GPG A;  1ZBC A;  3AS2 A;  3I6C A;  4IT6 A;  5DO2 A;  1ITX A;  3GU0 A;  3UQA A;  4DZ2 A;  3TC5 A;  3TCZ A;  2FAP A;  1OWQ A;  4KQZ A;  3LUO A;  4G2P A;  1NWU A;  2MF9 A;  1FKS A;  2OFN A;  4DT4 A;  2KI3 A;  2KE0 A;  2K8I A;  2KR7 A;  4NSB A;  4ZPT R;  1NWS A;  1QPF A;  3O5K A;  1NMV A;  4L3N A;  2WK2 A;  4ODL A;  5HTG A;  2PV1 A;  3O5L A;  4ML4 A;  1EIB A;  1TFV A;  2Y78 A;  2M1I A;  3G6M A;  4MNM A;  1GUV A;  1P5Q A;  4P8V A;  1W1Y A;  3WD4 A;  4ZPW R;  1L1P A;  1W9U A;  1ZBV A;  4UDM A;  4DWS D;  1LL7 A;  3CHC A;  5DF0 A;  1GPF A;  3WL0 A;  5HW8 A;  3O5O A;  4Z2H A;  3UQI A;  4DIP A;  1D2K A;  1HKK A;  4Z2G A;  3EIP A;  3FXY A;  4S3J A;  1O6I A;  3O5J A;  1GOI A;  3AS3 A;  3RM4 A;  3KAF A;  2F23 A;  1FKJ A;  3KAG A;  1JCH B;  2KO7 A;  3O5I A;  3ARW A;  4DRI A;  3FY1 A;  1KFW A;  1WAW A;  4Z2J A;  1EDQ A;  2DSV A;  2PN0 A;  4DRQ A;  1X6L A;  2JZV A;  4HBO A;  4ZS6 A;  4LGX A;  3RFW A;  2EUL A; 
#chains in the Genus database with same CATH homology
 1SR0 A;  1R9H A;  5I98 A;  4DRP A;  5HW6 A;  1W1V A;  4WKH A;  3WD2 A;  2WLY A;  3CZ8 A;  3ODK A;  4WJX A;  4LAX A;  1JNS A;  3ARZ A;  3ARQ A;  3NRK A;  3O5Q A;  3UQB A;  4MTV A;  2DPE A;  1Q6H A;  4W9Q A;  1ZBK A;  2G41 A;  4ODK A;  2KGJ A;  4MAV A;  5HKG A;  2RQS A;  5B8I C;  4JYS A;  1IX5 A;  1M5Y A;  3KAH A;  4TW8 A;  1HXV A;  3G6L A;  2F21 A;  3KAC A;  3IK8 A;  1FD9 A;  4U84 A;  3WH0 A;  4P8W A;  1A7X A;  1QPL A;  4Q22 A;  1ZCN A;  3MDY B;  3CGM A;  4DWS B;  4P8U A;  2RUC A;  4DRO A;  1FKI A;  2XP7 A;  4MGV A;  4DRH A;  4HBE A;  3ARR A;  3AS1 A;  1JND A;  4IPX A;  1UR8 A;  3CHF A;  4TYO A;  1H0I A;  2XP4 A;  3OA5 A;  2MLY A;  3B8S A;  3WL1 A;  2PV3 A;  1E15 A;  1W1T A;  1H0G A;  3PR9 A;  2XP9 A;  2DT3 A;  2RSE A;  4DRM A;  1FKD A;  1FKH A;  1J4H A;  4DRK A;  2PPN A;  2PV2 A;  4WIW A;  3JYJ A;  2LPV A;  2ESC A;  2ZQT A;  2O9O A;  1FKB A;  1K9T A;  3W4R A;  4MPK A;  4WKF A;  3OOB A;  2ZQV A;  5HW7 A;  1D7I A;  1ZB5 A;  3WQW A;  3O5G A;  4ITZ A;  1JNE A;  1E6Z A;  4TX0 A;  1VF8 A;  4R0X A;  1E6N A;  4IQ2 A;  3NTP A;  2IUZ A;  2WM0 A;  2FKE A;  4W9P A;  3H9R B;  5JH8 A;  1QZ2 A;  2ZR4 A;  4L72 B;  3WIJ A;  3UI6 A;  4IT4 A;  4JFK A;  4ODM A;  3KAB A;  2PBC A;  4BF8 A;  2M2A A;  1C9H A;  2RUQ A;  1JVW A;  4LAW A;  2LJ4 A;  1RD6 A;  2DSW A;  3PRB A;  2XP6 A;  3BXW A;  1FKL A;  3KAD A;  3WQV A;  1BKF A;  2A3B A;  4HAR A;  1D6O A;  2MPH A;  3JYM A;  4MSP A;  1LQ0 A;  2OLH A;  1ZBW A;  2AOS A;  1XHG A;  2F2D A;  1E9L A;  5HWB A;  1FKR A;  4QIB A;  3O5F A;  1NMW A;  1FKK A;  3ARO A;  4GGQ A;  1KT1 A;  1Q1C A;  1FAP A;  4Z2K A;  4AY1 A;  3KZ7 A;  3PRA A;  1WB0 A;  5D75 A;  3WD0 A;  3O5P A;  2Q5A A;  5HWC A;  2XPA A;  4G50 A;  1HKJ A;  3B7X A;  3O5D A;  2XP8 A;  2ZQU A;  1D7J A;  1EHN A;  4GIV A;  3ARS A;  2QF8 A;  1ZL1 A;  4TW7 A;  1OGG A;  1YW5 A;  2N87 A;  2DSZ A;  4JFI A;  4LAV A;  4Q7N A;  2A3A A;  5HUA A;  1EYM A;  1CTN A;  4DRJ A;  3TDB A;  3WKZ A;  3UF8 A;  1W1P A;  4N19 A;  2LKN A;  3RM9 A;  2DG4 A;  4DWS C;  2L2S A;  3WD1 A;  5GPR A;  3O5R A;  1E6P A;  4QT2 A;  3ARV A;  5DIU A;  1HKI A;  4IQC A;  1F40 A;  3UI4 A;  1JNT A;  4FAP A;  1HKM A;  5DEZ A;  2AWG A;  3O5E A;  3ARP A;  1ZK6 A;  5DIV A;  3ARX A;  4Z2I A;  1J4I A;  4DRN A;  1HJV A;  1UR9 A;  2A3E A;  1YAT A;  1SYT A;  4JFL A;  2DT0 A;  3B9E A;  4Z2L A;  4ZPV R;  4QT3 A;  2XP3 A;  3FAP A;  5DIT A;  4S3K A;  3B9A A;  3AQU A;  1LL4 A;  4MNJ A;  1LJY A;  3ART A;  4ODR A;  2RUR A;  2YBU A;  1NWR A;  2DSU A;  3RME A;  4WK9 A;  4W9O A;  4J4N A;  4U85 A;  3VAW A;  1W9V A;  3CHE A;  1D7H A;  2D9F A;  3EY6 A;  1PIN A;  3CHD A;  2MLX A;  3RGC A;  3UI5 A;  1Y0O A;  4PTM A;  1B6C A;  4FN2 A;  2UZ5 A;  4U86 A;  4ODN A;  1U79 A;  1HJW A;  4R5E A;  4WKA A;  4ODP A;  2ZQS A;  3ALF A;  2M08 A;  2KFW A;  1FFR A;  1HJX A;  2MNT A;  4LAY A;  4ODO A;  3CH9 A;  1N1A A;  1LG2 A;  2LGO A;  1ZU8 A;  4KR0 B;  1OGB A;  4P8X A;  4W5U A;  3KAI A;  2ITK A;  2PPO A;  2ZR6 A;  3IHZ A;  3NI6 A;  4MNK A;  2XPB A;  1F8A B;  2DT1 A;  4JFJ A;  5HT1 A;  2O92 A;  4O2T A;  2XP5 A;  1FFQ A;  1WNO A;  4JFM A;  3ALG A;  3KCE A;  2PI6 A;  1FJD A;  1NH6 A;  2PPP A;  3ARU A;  2IF4 A;  1W26 A;  3AS0 A;  1X6N A;  1T11 A;  1J4R A;  3WD3 A;  3PRD A;  1Q6U A;  3CGN A;  5GQB A;  4URI A;  1BL4 A;  3GPK A;  1TCO C;  1Q6I A;  1NWT A;  1E6R A;  5HBF A;  4ODQ A;  4QZV B;  2WLZ A;  4DZ3 A;  3ARY A;  1XRV A;  4TNS A;  2MLZ A;  2A3C A;  1W9P A;  3IKD A;  3JXV A;  3PA7 A;  2RUD A;  4NZC A;  4XAK A;  4C02 B;  1ROT A;  4TW6 A;  3O5M A;  1LL6 A;  3QOK A;  1J6Y A;  4DWS A;  2YBT A;  4DH0 A;  3RM8 A;  1FKG A;  4J4O A;  2VN1 A;  2DG9 A;  2DG3 A;  1NSG A;  1LG1 A;  3B9D A;  2DT2 A;  1EQ3 A;  2F4E A;  5J6E A;  4NNR A;  1PBK A;  1ROU A;  2FDM A;  2B31 A;  1FKF A;  5BXJ A;  2ZR5 A;  4MNL A;  1FKT A;  1KT0 A;  3IKG A;  2G8Z A;  5GPG A;  2VCD A;  1ZBC A;  3AS2 A;  3I6C A;  4IT6 A;  5DO2 A;  1ITX A;  3UQA A;  4DZ2 A;  3TC5 A;  3TCZ A;  2FAP A;  1OWQ A;  4KQZ A;  3LUO A;  4G2P A;  1NWU A;  2MF9 A;  1FKS A;  2OFN A;  4DT4 A;  2KI3 A;  2KE0 A;  2K8I A;  2KR7 A;  4NSB A;  4ZPT R;  1NWS A;  1QPF A;  3O5K A;  1NMV A;  4L3N A;  2WK2 A;  4ODL A;  5HTG A;  2PV1 A;  3O5L A;  4ML4 A;  1EIB A;  1TFV A;  2Y78 A;  2M1I A;  3G6M A;  4MNM A;  1GUV A;  1P5Q A;  4P8V A;  1W1Y A;  3WD4 A;  4ZPW R;  1L1P A;  1W9U A;  1ZBV A;  4DWS D;  1LL7 A;  3CHC A;  5DF0 A;  1GPF A;  3WL0 A;  5HW8 A;  3O5O A;  4Z2H A;  3UQI A;  4DIP A;  1D2K A;  1HKK A;  4Z2G A;  3FXY A;  4S3J A;  1O6I A;  3O5J A;  1GOI A;  3AS3 A;  3RM4 A;  3KAF A;  1FKJ A;  3KAG A;  3O5I A;  2KO7 A;  3ARW A;  4DRI A;  3FY1 A;  1KFW A;  1WAW A;  4Z2J A;  1EDQ A;  2DSV A;  4DRQ A;  1X6L A;  2JZV A;  4HBO A;  4ZS6 A;  4LGX A;  3RFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...