3PR9A

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3pr9A00
3PRAA 3PR9A 1IX5A
chains in the Genus database with same CATH superfamily
4IQCA 3LUOA 2A3AA 3B9EA 2ZQUA 2DT3A 3ARPA 3AS3A 4LAYA 1FKFA 2DSZA 1ZCNA 3B8SA 4MAVA 3WD1A 4P8WA 3CGNA 1NWTA 1FAPA 1J4RA 4GIVA 2LKNA 1LQ0A 1EIBA 2XP9A 4MNKA 1E6PA 2VN1A 3KCEA 2PPNA 3ARZA 4JYSA 2DG4A 1HJWA 2XP8A 1ROTA 1KT0A 2DT0A 1D7IA 3O5KA 1SYTA 4NSBA 3KAIA 1D2KA 4PTMA 3RGCA 2K8IA 1LG2A 2D9FA 1W9UA 1UR8A 3RMEA 3ODKA 1LL7A 1ZBWA 3NTPA 2DSWA 3CHEA 2F4EA 2MF9A 4DRMA 5DO2A 4W5UA 4DRKA 2KR7A 2DT1A 4J4NA 5GQBA 2A3CA 2LPVA 1D7HA 3JYMA 1WNOA 1JNEA 5HKGA 3ARTA 3H9RB 4QT3A 1ZBKA 3UQIA 1W1YA 1E9LA 4DRIA 5HW6A 3ARUA 2B31A 3CHFA 4XAKA 4MGVA 2PBCA 1Q1CA 1GRJA 4URIA 2PV2A 1Q6HA 4AY1A 2YBUA 4DROA 5HTGA 1CTNA 4ODOA 1JNDA 4TW8A 3O5RA 2L2SA 1FKIA 4NZCA 3NI6A 1EQ3A 3O5DA 2O9OA 2KFWA 2MLXA 4IT4A 1J6YA 1F8AB 2Q5AA 2DSVA 3KACA 4JFKA 2DG3A 4Q22A 2Y78A 1T11A 3ARXA 3WD2A 1ZB5A 2MPHA 3ALFA 5GPGA 3CZ8A 1LJYA 4DWSB 2DT2A 4DH0A 1O6IA 3PR9A 1Q6IA 2B5UB 3AS2A 2PI6A 1J4HA 1QZ2A 1OGGA 2M2AA 3JYJA 4O2TA 4ODMA 3WL0A 5HUAA 3RM8A 3UI6A 3O5LA 1HJXA 1YW5A 1RD6A 3O5JA 1YATA 3KAGA 1KFWA 2WK2A 4ODQA 2KE0A 1EDQA 3TC5A 4IQ2A 4MPKA 3ARSA 5HT1A 3KABA 4MNLA 4N19A 3KZ7A 5JH8A 2RUCA 2M1IA 2A3EA 1U79A 4ML4A 1J4IA 1FKJA 2IUZA 2ZQVA 1FKHA 1W26A 3G6MA 1OWQA 3UF8A 3O5OA 3CHDA 4Z2LA 3FXYA 4Z2HA 1QPLA 3UI5A 3AS0A 2XP6A 4WIWA 5HBFA 1GOIA 2KO7A 3MDYB 4FN2A 2F2DA 2LGOA 4DWSC 1EYMA 1ZBVA 2XPBA 1NMVA 2N87A 4ODKA 4DRHA 4HBOA 1TFVA 1FJDA 2IF4A 3FAPA 4KQZA 4HBEA 4LAXA 2A3BA 3VAWA 4MSPA 4S3JA 4W9OA 1ZK6A 4ITZA 3RFWA 1F40A 4Z2IA 1E6NA 4ODLA 2G8ZA 4HARA 2DSUA 1SR0A 4G2PA 3TCZA 2MLYA 1FKKA 4LAWA 1FKDA 2ETNA 4BF8A 3TDBA 4JFLA 1D7JA 1PBKA 1HKMA 2F23A 4DRNA 3IHZA 4Q7NA 4TW7A 5DIVA 1UR9A 1OGBA 2KI3A 2XP7A 1BKFA 3ARQA 2LJ4A 1NWRA 3CHCA 4JFJA 5B8IC 3B9DA 4R0XA 1ROUA 4QT2A 4MNMA 1ITXA 1GUVA 4TNSA 1FKSA 2UZ5A 3ARVA 1FD9A 5BXJA 1X6LA 3AS1A 4ZPVR 4DZ2A 2XPAA 3ARYA 3KAFA 3IKGA 3B7XA 3UQBA 1E15A 4P8VA 5HWBA 2RURA 3JXVA 1NSGA 1TCOC 3B9AA 4QZVB 2XP4A 1X6NA 1FFQA 3WH0A 4DRJA 2M08A 3PRBA 1HKJA 3KAHA 4ODPA 3KADA 1FKGA 4JFMA 3BMBA 5DIUA 2ZR6A 3PA7A 1M5YA 3CGMA 1ZL1A 4DZ3A 3GPKA 3UQAA 3ALGA 1W9VA 4S3KA 3RM9A 3AROA 4MTVA 4R5EA 2PV1A 4G50A 2XP3A 3O5IA 1H0IA 5I98A 2OFNA 4WKFA 4J4OA 1WB0A 2PV3A 4ZPWR 4P8UA 2ZR5A 2DG9A 2FAPA 3PRDA 4P8XA 1NWSA 1H0GA 2DPEA 2QF8A 2RSEA 5HWCA 4LGXA 1FKTA 4DWSD 2OLHA 3I6CA 2PPPA 4WKHA 3O5EA 1IX5A 2ZQTA 1HXVA 4MNJA 3WD0A 3G6LA 4U86A 4W9PA 5D75A 2ESCA 1FKRA 1KT1A 4ODRA 3WQVA 5HW7A 1JNSA 1A7XA 1E6RA 3O5PA 3WL1A 1LL4A 3WIJA 4LAVA 2WLYA 3O5QA 2PPOA 4JFIA 4IT6A 3O5MA 4ODNA 4WKAA 2RUQA 1VF8A 3GU0A 4TYOA 1W1PA 2RQSA 2FDMA 5DITA 1ZBCA 1W1TA 1HKIA 2WLZA 4DRPA 2O92A 2VCDA 2ZQSA 2YBTA 3WD4A 3FY1A 4U85A 1K9TA 2ZR4A 1Q6UA 1XRVA 4DT4A 3W4RA 4Z2JA 3WQWA 4Z2KA 3GTYX 2MLZA 3CH9A 2JZVA 2MNTA 4DWSA 3UI4A 1LL6A 4UDMA 4GGQA 1N1AA 1B6CA 1C9HA 2PN0A 4NNRA 2FKEA 1LG1A 2XP5A 1E44A 3IK8A 1BL4A 3EIPA 2G41A 1EHNA 1E6ZA 2P4VA 2AWGA 2RUDA 3PRAA 4ZPTR 3WD3A 3EY6A 4DIPA 3ARRA 2KGJA 3O5FA 4C02B 2EULA 4IPXA 4Z2GA 3NRKA 5DEZA 5GPRA 1P5QA 1W9PA 1ZU8A 1NWUA 3QOKA 2F21A 4WK9A 4L3NA 5HW8A 3AQUA 3O5GA 2AOSA 1FKBA 1HKKA 3BXWA 1XHGA 1NH6A 3ARWA 4TW6A 1W1VA 1Y0OA 1HJVA 5DF0A 4KR0B 4WJXA 3OOBA 4QIBA 1QPFA 1JCHB 1D6OA 3OA5A 3RM4A 5J6EA 4FAPA 1NMWA 1L1PA 4L72B 1FKLA 1GPFA 1WAWA 1JNTA 1PINA 1JVWA 1FFRA 1R9HA 4ZS6A 4TX0A 4W9QA 3IKDA 4DRQA 2WM0A 3WKZA 2ITKA 4U84A
chains in the Genus database with same CATH topology
4IQCA 3LUOA 2A3AA 3B9EA 2ZQUA 2DT3A 3ARPA 3AS3A 4LAYA 1FKFA 2DSZA 1ZCNA 3B8SA 4MAVA 3WD1A 4P8WA 3CGNA 1NWTA 1FAPA 1J4RA 4GIVA 2LKNA 1LQ0A 1EIBA 2XP9A 4MNKA 1E6PA 2VN1A 3KCEA 2PPNA 3ARZA 4JYSA 2DG4A 1HJWA 2XP8A 1ROTA 1KT0A 2DT0A 1D7IA 3O5KA 1SYTA 4NSBA 3KAIA 1D2KA 4PTMA 3RGCA 2K8IA 1LG2A 2D9FA 1W9UA 1UR8A 3RMEA 3ODKA 1LL7A 1ZBWA 3NTPA 2DSWA 3CHEA 2F4EA 2MF9A 4DRMA 5DO2A 4W5UA 4DRKA 2KR7A 2DT1A 4J4NA 5GQBA 2A3CA 2LPVA 1D7HA 3JYMA 1WNOA 1JNEA 5HKGA 3ARTA 3H9RB 4QT3A 1ZBKA 3UQIA 1W1YA 1E9LA 4DRIA 5HW6A 3ARUA 2B31A 3CHFA 4XAKA 4MGVA 2PBCA 1Q1CA 4URIA 2PV2A 1Q6HA 4AY1A 2YBUA 4DROA 5HTGA 1CTNA 4ODOA 1JNDA 4TW8A 3O5RA 2L2SA 1FKIA 4NZCA 3NI6A 1EQ3A 3O5DA 2O9OA 2KFWA 2MLXA 4IT4A 1J6YA 1F8AB 2Q5AA 2DSVA 3KACA 4JFKA 2DG3A 4Q22A 2Y78A 1T11A 3ARXA 3WD2A 1ZB5A 2MPHA 3ALFA 5GPGA 3CZ8A 1LJYA 4DWSB 2DT2A 4DH0A 1O6IA 3PR9A 1Q6IA 3AS2A 2PI6A 1J4HA 1QZ2A 1OGGA 2M2AA 3JYJA 4O2TA 4ODMA 3WL0A 5HUAA 3RM8A 3UI6A 3O5LA 1HJXA 1YW5A 1RD6A 3O5JA 1YATA 3KAGA 1KFWA 2WK2A 4ODQA 2KE0A 1EDQA 3TC5A 4IQ2A 4MPKA 3ARSA 5HT1A 3KABA 4MNLA 4N19A 3KZ7A 5JH8A 2RUCA 2M1IA 2A3EA 1U79A 4ML4A 1J4IA 1FKJA 2IUZA 2ZQVA 1FKHA 1W26A 3G6MA 1OWQA 3UF8A 3O5OA 3CHDA 4Z2LA 3FXYA 4Z2HA 1QPLA 3UI5A 3AS0A 2XP6A 4WIWA 5HBFA 1GOIA 2KO7A 3MDYB 4FN2A 2F2DA 2LGOA 4DWSC 1EYMA 1ZBVA 2XPBA 1NMVA 2N87A 4ODKA 4DRHA 4HBOA 1TFVA 1FJDA 2IF4A 3FAPA 4KQZA 4HBEA 4LAXA 2A3BA 3VAWA 4MSPA 4S3JA 4W9OA 1ZK6A 4ITZA 3RFWA 1F40A 4Z2IA 1E6NA 4ODLA 2G8ZA 4HARA 2DSUA 1SR0A 4G2PA 3TCZA 2MLYA 1FKKA 4LAWA 1FKDA 4BF8A 3TDBA 4JFLA 1D7JA 1PBKA 1HKMA 4DRNA 3IHZA 4Q7NA 4TW7A 5DIVA 1UR9A 1OGBA 2KI3A 2XP7A 1BKFA 3ARQA 2LJ4A 1NWRA 3CHCA 4JFJA 5B8IC 3B9DA 4R0XA 1ROUA 4QT2A 4MNMA 1ITXA 1GUVA 4TNSA 1FKSA 2UZ5A 3ARVA 1FD9A 5BXJA 1X6LA 3AS1A 4ZPVR 4DZ2A 2XPAA 3ARYA 3KAFA 3IKGA 3B7XA 3UQBA 1E15A 4P8VA 5HWBA 2RURA 3JXVA 1NSGA 1TCOC 3B9AA 4QZVB 2XP4A 1X6NA 1FFQA 3WH0A 4DRJA 2M08A 3PRBA 1HKJA 3KAHA 4ODPA 3KADA 1FKGA 4JFMA 5DIUA 2ZR6A 3PA7A 1M5YA 3CGMA 1ZL1A 4DZ3A 3GPKA 3UQAA 3ALGA 1W9VA 4S3KA 3RM9A 3AROA 4MTVA 4R5EA 2PV1A 4G50A 2XP3A 3O5IA 1H0IA 5I98A 2OFNA 4WKFA 4J4OA 1WB0A 2PV3A 4ZPWR 4P8UA 2ZR5A 2DG9A 2FAPA 3PRDA 4P8XA 1NWSA 1H0GA 2DPEA 2QF8A 2RSEA 5HWCA 4LGXA 1FKTA 4DWSD 2OLHA 3I6CA 2PPPA 4WKHA 3O5EA 1IX5A 2ZQTA 1HXVA 4MNJA 3WD0A 3G6LA 4U86A 4W9PA 5D75A 2ESCA 1FKRA 1KT1A 4ODRA 3WQVA 5HW7A 1JNSA 1A7XA 1E6RA 3O5PA 3WL1A 1LL4A 3WIJA 4LAVA 2WLYA 3O5QA 2PPOA 4JFIA 4IT6A 3O5MA 4ODNA 4WKAA 2RUQA 1VF8A 4TYOA 1W1PA 2RQSA 2FDMA 5DITA 1ZBCA 1W1TA 1HKIA 2WLZA 4DRPA 2O92A 2VCDA 2ZQSA 2YBTA 3WD4A 3FY1A 4U85A 1K9TA 2ZR4A 1Q6UA 1XRVA 4DT4A 3W4RA 4Z2JA 3WQWA 4Z2KA 2MLZA 3CH9A 2JZVA 2MNTA 4DWSA 3UI4A 1LL6A 4GGQA 1N1AA 1B6CA 1C9HA 4NNRA 2FKEA 1LG1A 2XP5A 3IK8A 1BL4A 2G41A 1EHNA 1E6ZA 2AWGA 2RUDA 3PRAA 4ZPTR 3WD3A 3EY6A 4DIPA 3ARRA 2KGJA 3O5FA 4C02B 4IPXA 4Z2GA 3NRKA 5DEZA 5GPRA 1P5QA 1W9PA 1ZU8A 1NWUA 3QOKA 2F21A 4WK9A 4L3NA 5HW8A 3AQUA 3O5GA 2AOSA 1FKBA 1HKKA 3BXWA 1XHGA 1NH6A 3ARWA 4TW6A 1W1VA 1Y0OA 1HJVA 5DF0A 4KR0B 4WJXA 3OOBA 4QIBA 1QPFA 3RM4A 1D6OA 3OA5A 5J6EA 4FAPA 1NMWA 1L1PA 4L72B 1FKLA 1GPFA 1WAWA 1JNTA 1PINA 1JVWA 1FFRA 1R9HA 4ZS6A 4TX0A 4W9QA 3IKDA 4DRQA 2WM0A 3WKZA 2ITKA 4U84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRA A;  3PR9 A;  1IX5 A; 
#chains in the Genus database with same CATH topology
 4IQC A;  3LUO A;  2A3A A;  3B9E A;  2ZQU A;  2DT3 A;  3ARP A;  3AS3 A;  4LAY A;  1FKF A;  2DSZ A;  1ZCN A;  3B8S A;  4MAV A;  3WD1 A;  4P8W A;  3CGN A;  1NWT A;  1FAP A;  1J4R A;  4GIV A;  2LKN A;  1LQ0 A;  1EIB A;  2XP9 A;  4MNK A;  1E6P A;  2VN1 A;  3KCE A;  2PPN A;  3ARZ A;  4JYS A;  2DG4 A;  1HJW A;  2XP8 A;  1ROT A;  1KT0 A;  2DT0 A;  1D7I A;  3O5K A;  1SYT A;  4NSB A;  3KAI A;  1D2K A;  4PTM A;  3RGC A;  2K8I A;  1LG2 A;  2D9F A;  1W9U A;  1UR8 A;  3RME A;  3ODK A;  1LL7 A;  1ZBW A;  3NTP A;  2DSW A;  3CHE A;  2F4E A;  2MF9 A;  4DRM A;  5DO2 A;  4W5U A;  4DRK A;  2KR7 A;  2DT1 A;  4J4N A;  5GQB A;  2A3C A;  2LPV A;  1D7H A;  3JYM A;  1WNO A;  1JNE A;  5HKG A;  3ART A;  3H9R B;  4QT3 A;  1ZBK A;  3UQI A;  1W1Y A;  1E9L A;  4DRI A;  5HW6 A;  3ARU A;  2B31 A;  3CHF A;  4XAK A;  4MGV A;  2PBC A;  1Q1C A;  1GRJ A;  4URI A;  2PV2 A;  1Q6H A;  4AY1 A;  2YBU A;  4DRO A;  5HTG A;  1CTN A;  4ODO A;  1JND A;  4TW8 A;  3O5R A;  2L2S A;  1FKI A;  4NZC A;  3NI6 A;  1EQ3 A;  3O5D A;  2O9O A;  2KFW A;  2MLX A;  4IT4 A;  1J6Y A;  1F8A B;  2Q5A A;  2DSV A;  3KAC A;  4JFK A;  2DG3 A;  4Q22 A;  2Y78 A;  1T11 A;  3ARX A;  3WD2 A;  1ZB5 A;  2MPH A;  3ALF A;  5GPG A;  3CZ8 A;  1LJY A;  4DWS B;  2DT2 A;  4DH0 A;  1O6I A;  3PR9 A;  1Q6I A;  2B5U B;  3AS2 A;  2PI6 A;  1J4H A;  1QZ2 A;  1OGG A;  2M2A A;  3JYJ A;  4O2T A;  4ODM A;  3WL0 A;  5HUA A;  3RM8 A;  3UI6 A;  3O5L A;  1HJX A;  1YW5 A;  1RD6 A;  3O5J A;  1YAT A;  3KAG A;  1KFW A;  2WK2 A;  4ODQ A;  2KE0 A;  1EDQ A;  3TC5 A;  4IQ2 A;  4MPK A;  3ARS A;  5HT1 A;  3KAB A;  4MNL A;  4N19 A;  3KZ7 A;  5JH8 A;  2RUC A;  2M1I A;  2A3E A;  1U79 A;  4ML4 A;  1J4I A;  1FKJ A;  2IUZ A;  2ZQV A;  1FKH A;  1W26 A;  3G6M A;  1OWQ A;  3UF8 A;  3O5O A;  3CHD A;  4Z2L A;  3FXY A;  4Z2H A;  1QPL A;  3UI5 A;  3AS0 A;  2XP6 A;  4WIW A;  5HBF A;  1GOI A;  2KO7 A;  3MDY B;  4FN2 A;  2F2D A;  2LGO A;  4DWS C;  1EYM A;  1ZBV A;  2XPB A;  1NMV A;  2N87 A;  4ODK A;  4DRH A;  4HBO A;  1TFV A;  1FJD A;  2IF4 A;  3FAP A;  4KQZ A;  4HBE A;  4LAX A;  2A3B A;  3VAW A;  4MSP A;  4S3J A;  4W9O A;  1ZK6 A;  4ITZ A;  3RFW A;  1F40 A;  4Z2I A;  1E6N A;  4ODL A;  2G8Z A;  4HAR A;  2DSU A;  1SR0 A;  4G2P A;  3TCZ A;  2MLY A;  1FKK A;  4LAW A;  1FKD A;  2ETN A;  4BF8 A;  3TDB A;  4JFL A;  1D7J A;  1PBK A;  1HKM A;  2F23 A;  4DRN A;  3IHZ A;  4Q7N A;  4TW7 A;  5DIV A;  1UR9 A;  1OGB A;  2KI3 A;  2XP7 A;  1BKF A;  3ARQ A;  2LJ4 A;  1NWR A;  3CHC A;  4JFJ A;  5B8I C;  3B9D A;  4R0X A;  1ROU A;  4QT2 A;  4MNM A;  1ITX A;  1GUV A;  4TNS A;  1FKS A;  2UZ5 A;  3ARV A;  1FD9 A;  5BXJ A;  1X6L A;  3AS1 A;  4ZPV R;  4DZ2 A;  2XPA A;  3ARY A;  3KAF A;  3IKG A;  3B7X A;  3UQB A;  1E15 A;  4P8V A;  5HWB A;  2RUR A;  3JXV A;  1NSG A;  1TCO C;  3B9A A;  4QZV B;  2XP4 A;  1X6N A;  1FFQ A;  3WH0 A;  4DRJ A;  2M08 A;  3PRB A;  1HKJ A;  3KAH A;  4ODP A;  3KAD A;  1FKG A;  4JFM A;  3BMB A;  5DIU A;  2ZR6 A;  3PA7 A;  1M5Y A;  3CGM A;  1ZL1 A;  4DZ3 A;  3GPK A;  3UQA A;  3ALG A;  1W9V A;  4S3K A;  3RM9 A;  3ARO A;  4MTV A;  4R5E A;  2PV1 A;  4G50 A;  2XP3 A;  3O5I A;  1H0I A;  5I98 A;  2OFN A;  4WKF A;  4J4O A;  1WB0 A;  2PV3 A;  4ZPW R;  4P8U A;  2ZR5 A;  2DG9 A;  2FAP A;  3PRD A;  4P8X A;  1NWS A;  1H0G A;  2DPE A;  2QF8 A;  2RSE A;  5HWC A;  4LGX A;  1FKT A;  4DWS D;  2OLH A;  3I6C A;  2PPP A;  4WKH A;  3O5E A;  1IX5 A;  2ZQT A;  1HXV A;  4MNJ A;  3WD0 A;  3G6L A;  4U86 A;  4W9P A;  5D75 A;  2ESC A;  1FKR A;  1KT1 A;  4ODR A;  3WQV A;  5HW7 A;  1JNS A;  1A7X A;  1E6R A;  3O5P A;  3WL1 A;  1LL4 A;  3WIJ A;  4LAV A;  2WLY A;  3O5Q A;  2PPO A;  4JFI A;  4IT6 A;  3O5M A;  4ODN A;  4WKA A;  2RUQ A;  1VF8 A;  3GU0 A;  4TYO A;  1W1P A;  2RQS A;  2FDM A;  5DIT A;  1ZBC A;  1W1T A;  1HKI A;  2WLZ A;  4DRP A;  2O92 A;  2VCD A;  2ZQS A;  2YBT A;  3WD4 A;  3FY1 A;  4U85 A;  1K9T A;  2ZR4 A;  1Q6U A;  1XRV A;  4DT4 A;  3W4R A;  4Z2J A;  3WQW A;  4Z2K A;  3GTY X;  2MLZ A;  3CH9 A;  2JZV A;  2MNT A;  4DWS A;  3UI4 A;  1LL6 A;  4UDM A;  4GGQ A;  1N1A A;  1B6C A;  1C9H A;  2PN0 A;  4NNR A;  2FKE A;  1LG1 A;  2XP5 A;  1E44 A;  3IK8 A;  1BL4 A;  3EIP A;  2G41 A;  1EHN A;  1E6Z A;  2P4V A;  2AWG A;  2RUD A;  3PRA A;  4ZPT R;  3WD3 A;  3EY6 A;  4DIP A;  3ARR A;  2KGJ A;  3O5F A;  4C02 B;  2EUL A;  4IPX A;  4Z2G A;  3NRK A;  5DEZ A;  5GPR A;  1P5Q A;  1W9P A;  1ZU8 A;  1NWU A;  3QOK A;  2F21 A;  4WK9 A;  4L3N A;  5HW8 A;  3AQU A;  3O5G A;  2AOS A;  1FKB A;  1HKK A;  3BXW A;  1XHG A;  1NH6 A;  3ARW A;  4TW6 A;  1W1V A;  1Y0O A;  1HJV A;  5DF0 A;  4KR0 B;  4WJX A;  3OOB A;  4QIB A;  1QPF A;  1JCH B;  1D6O A;  3OA5 A;  3RM4 A;  5J6E A;  4FAP A;  1NMW A;  1L1P A;  4L72 B;  1FKL A;  1GPF A;  1WAW A;  1JNT A;  1PIN A;  1JVW A;  1FFR A;  1R9H A;  4ZS6 A;  4TX0 A;  4W9Q A;  3IKD A;  4DRQ A;  2WM0 A;  3WKZ A;  2ITK A;  4U84 A; 
#chains in the Genus database with same CATH homology
 4IQC A;  3LUO A;  2A3A A;  3B9E A;  2ZQU A;  2DT3 A;  3ARP A;  3AS3 A;  4LAY A;  1FKF A;  2DSZ A;  1ZCN A;  3B8S A;  4MAV A;  3WD1 A;  4P8W A;  3CGN A;  1NWT A;  1FAP A;  1J4R A;  4GIV A;  2LKN A;  1LQ0 A;  1EIB A;  2XP9 A;  4MNK A;  1E6P A;  2VN1 A;  3KCE A;  2PPN A;  3ARZ A;  4JYS A;  2DG4 A;  1HJW A;  2XP8 A;  1ROT A;  1KT0 A;  2DT0 A;  1D7I A;  3O5K A;  1SYT A;  4NSB A;  3KAI A;  1D2K A;  4PTM A;  3RGC A;  2K8I A;  1LG2 A;  2D9F A;  1W9U A;  1UR8 A;  3RME A;  3ODK A;  1LL7 A;  1ZBW A;  3NTP A;  2DSW A;  3CHE A;  2F4E A;  2MF9 A;  4DRM A;  5DO2 A;  4W5U A;  4DRK A;  2KR7 A;  2DT1 A;  4J4N A;  5GQB A;  2A3C A;  2LPV A;  1D7H A;  3JYM A;  1WNO A;  1JNE A;  5HKG A;  3ART A;  3H9R B;  4QT3 A;  1ZBK A;  3UQI A;  1W1Y A;  1E9L A;  4DRI A;  5HW6 A;  3ARU A;  2B31 A;  3CHF A;  4XAK A;  4MGV A;  2PBC A;  1Q1C A;  4URI A;  2PV2 A;  1Q6H A;  4AY1 A;  2YBU A;  4DRO A;  5HTG A;  1CTN A;  4ODO A;  1JND A;  4TW8 A;  3O5R A;  2L2S A;  1FKI A;  4NZC A;  3NI6 A;  1EQ3 A;  3O5D A;  2O9O A;  2KFW A;  2MLX A;  4IT4 A;  1J6Y A;  1F8A B;  2Q5A A;  2DSV A;  3KAC A;  4JFK A;  2DG3 A;  4Q22 A;  2Y78 A;  1T11 A;  3ARX A;  3WD2 A;  1ZB5 A;  2MPH A;  3ALF A;  5GPG A;  3CZ8 A;  1LJY A;  4DWS B;  2DT2 A;  4DH0 A;  1O6I A;  3PR9 A;  1Q6I A;  3AS2 A;  2PI6 A;  1J4H A;  1QZ2 A;  1OGG A;  2M2A A;  3JYJ A;  4O2T A;  4ODM A;  3WL0 A;  5HUA A;  3RM8 A;  3UI6 A;  3O5L A;  1HJX A;  1YW5 A;  1RD6 A;  3O5J A;  1YAT A;  3KAG A;  1KFW A;  2WK2 A;  4ODQ A;  2KE0 A;  1EDQ A;  3TC5 A;  4IQ2 A;  4MPK A;  3ARS A;  5HT1 A;  3KAB A;  4MNL A;  4N19 A;  3KZ7 A;  5JH8 A;  2RUC A;  2M1I A;  2A3E A;  1U79 A;  4ML4 A;  1J4I A;  1FKJ A;  2IUZ A;  2ZQV A;  1FKH A;  1W26 A;  3G6M A;  1OWQ A;  3UF8 A;  3O5O A;  3CHD A;  4Z2L A;  3FXY A;  4Z2H A;  1QPL A;  3UI5 A;  3AS0 A;  2XP6 A;  4WIW A;  5HBF A;  1GOI A;  2KO7 A;  3MDY B;  4FN2 A;  2F2D A;  2LGO A;  4DWS C;  1EYM A;  1ZBV A;  2XPB A;  1NMV A;  2N87 A;  4ODK A;  4DRH A;  4HBO A;  1TFV A;  1FJD A;  2IF4 A;  3FAP A;  4KQZ A;  4HBE A;  4LAX A;  2A3B A;  3VAW A;  4MSP A;  4S3J A;  4W9O A;  1ZK6 A;  4ITZ A;  3RFW A;  1F40 A;  4Z2I A;  1E6N A;  4ODL A;  2G8Z A;  4HAR A;  2DSU A;  1SR0 A;  4G2P A;  3TCZ A;  2MLY A;  1FKK A;  4LAW A;  1FKD A;  4BF8 A;  3TDB A;  4JFL A;  1D7J A;  1PBK A;  1HKM A;  4DRN A;  3IHZ A;  4Q7N A;  4TW7 A;  5DIV A;  1UR9 A;  1OGB A;  2KI3 A;  2XP7 A;  1BKF A;  3ARQ A;  2LJ4 A;  1NWR A;  3CHC A;  4JFJ A;  5B8I C;  3B9D A;  4R0X A;  1ROU A;  4QT2 A;  4MNM A;  1ITX A;  1GUV A;  4TNS A;  1FKS A;  2UZ5 A;  3ARV A;  1FD9 A;  5BXJ A;  1X6L A;  3AS1 A;  4ZPV R;  4DZ2 A;  2XPA A;  3ARY A;  3KAF A;  3IKG A;  3B7X A;  3UQB A;  1E15 A;  4P8V A;  5HWB A;  2RUR A;  3JXV A;  1NSG A;  1TCO C;  3B9A A;  4QZV B;  2XP4 A;  1X6N A;  1FFQ A;  3WH0 A;  4DRJ A;  2M08 A;  3PRB A;  1HKJ A;  3KAH A;  4ODP A;  3KAD A;  1FKG A;  4JFM A;  5DIU A;  2ZR6 A;  3PA7 A;  1M5Y A;  3CGM A;  1ZL1 A;  4DZ3 A;  3GPK A;  3UQA A;  3ALG A;  1W9V A;  4S3K A;  3RM9 A;  3ARO A;  4MTV A;  4R5E A;  2PV1 A;  4G50 A;  2XP3 A;  3O5I A;  1H0I A;  5I98 A;  2OFN A;  4WKF A;  4J4O A;  1WB0 A;  2PV3 A;  4ZPW R;  4P8U A;  2ZR5 A;  2DG9 A;  2FAP A;  3PRD A;  4P8X A;  1NWS A;  1H0G A;  2DPE A;  2QF8 A;  2RSE A;  5HWC A;  4LGX A;  1FKT A;  4DWS D;  2OLH A;  3I6C A;  2PPP A;  4WKH A;  3O5E A;  1IX5 A;  2ZQT A;  1HXV A;  4MNJ A;  3WD0 A;  3G6L A;  4U86 A;  4W9P A;  5D75 A;  2ESC A;  1FKR A;  1KT1 A;  4ODR A;  3WQV A;  5HW7 A;  1JNS A;  1A7X A;  1E6R A;  3O5P A;  3WL1 A;  1LL4 A;  3WIJ A;  4LAV A;  2WLY A;  3O5Q A;  2PPO A;  4JFI A;  4IT6 A;  3O5M A;  4ODN A;  4WKA A;  2RUQ A;  1VF8 A;  4TYO A;  1W1P A;  2RQS A;  2FDM A;  5DIT A;  1ZBC A;  1W1T A;  1HKI A;  2WLZ A;  4DRP A;  2O92 A;  2VCD A;  2ZQS A;  2YBT A;  3WD4 A;  3FY1 A;  4U85 A;  1K9T A;  2ZR4 A;  1Q6U A;  1XRV A;  4DT4 A;  3W4R A;  4Z2J A;  3WQW A;  4Z2K A;  2MLZ A;  3CH9 A;  2JZV A;  2MNT A;  4DWS A;  3UI4 A;  1LL6 A;  4GGQ A;  1N1A A;  1B6C A;  1C9H A;  4NNR A;  2FKE A;  1LG1 A;  2XP5 A;  3IK8 A;  1BL4 A;  2G41 A;  1EHN A;  1E6Z A;  2AWG A;  2RUD A;  3PRA A;  4ZPT R;  3WD3 A;  3EY6 A;  4DIP A;  3ARR A;  2KGJ A;  3O5F A;  4C02 B;  4IPX A;  4Z2G A;  3NRK A;  5DEZ A;  5GPR A;  1P5Q A;  1W9P A;  1ZU8 A;  1NWU A;  3QOK A;  2F21 A;  4WK9 A;  4L3N A;  5HW8 A;  3AQU A;  3O5G A;  2AOS A;  1FKB A;  1HKK A;  3BXW A;  1XHG A;  1NH6 A;  3ARW A;  4TW6 A;  1W1V A;  1Y0O A;  1HJV A;  5DF0 A;  4KR0 B;  4WJX A;  3OOB A;  4QIB A;  1QPF A;  3RM4 A;  1D6O A;  3OA5 A;  5J6E A;  4FAP A;  1NMW A;  1L1P A;  4L72 B;  1FKL A;  1GPF A;  1WAW A;  1JNT A;  1PIN A;  1JVW A;  1FFR A;  1R9H A;  4ZS6 A;  4TX0 A;  4W9Q A;  3IKD A;  4DRQ A;  2WM0 A;  3WKZ A;  2ITK A;  4U84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...