3PR9A

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3pr9A00
3PR9A 3PRAA 1IX5A
chains in the Genus database with same CATH superfamily
5HKGA 1Q6IA 4IQCA 1N1AA 2PN0A 1KT0A 1Q6HA 3RMEA 1Q1CA 3GU0A 1WB0A 2DT1A 2AOSA 4WKAA 3O5DA 1GOIA 2XPBA 4DWSC 3ARVA 1BL4A 3WD0A 3AS0A 3PRBA 2XPAA 4ZPTR 3RM4A 1LQ0A 4WKFA 2A3AA 3ARQA 4IT4A 3UI4A 2WM0A 3ARYA 3NRKA 2B5UB 4S3KA 1W26A 3RM8A 4WKHA 4QIBA 2RUDA 4ITZA 2WK2A 3IHZA 4DRQA 1GPFA 2F23A 2F4EA 3G6LA 4KR0B 2RURA 2ZR6A 5HWCA 3JXVA 4L3NA 3O5MA 2DT2A 3UQIA 1C9HA 5DF0A 1NSGA 1FKRA 2DSUA 2XP5A 2XP7A 4DWSD 1X6NA 3ARWA 1J4RA 4ODPA 4NZCA 1UR8A 3BXWA 3CGNA 5B8IC 2DG9A 4WK9A 4UDMA 2PV3A 4LAYA 1PBKA 2F2DA 3NI6A 4TW6A 3ARTA 4ML4A 2G8ZA 1O6IA 2IF4A 2KO7A 3O5FA 4ODKA 1Q6UA 4P8VA 4DWSA 4FAPA 3G6MA 1ZBKA 4W9OA 3WIJA 3CHDA 1FKDA 2FKEA 4JYSA 4FN2A 3KABA 4DRHA 4DRPA 2LJ4A 3CHCA 4JFIA 1L1PA 4DIPA 5HUAA 4DROA 2DPEA 4DRNA 5GPRA 4Z2GA 3TC5A 1E15A 3RM9A 3TCZA 2DSWA 4JFKA 1HKKA 1HKJA 1WAWA 5DEZA 1NWUA 3WQWA 4QT3A 1VF8A 1F40A 1F8AB 2YBTA 2ZR5A 1FFQA 1K9TA 2ZQVA 4ODRA 3ALGA 1TCOC 3RFWA 1QZ2A 4DRIA 1ZL1A 3WD4A 1FD9A 2MF9A 5DO2A 2M1IA 5HW7A 3QOKA 3KZ7A 1NMWA 1YATA 2KFWA 4Z2LA 4MNMA 4QZVB 1LG1A 4TNSA 4Z2HA 4P8WA 3B8SA 3CZ8A 2A3EA 2LPVA 4NNRA 2MLXA 3CH9A 4MNKA 4Q22A 1W9PA 3FAPA 2RUQA 4N19A 4Z2IA 4ZS6A 3O5RA 3EY6A 1HXVA 2Q5AA 4HARA 2KR7A 3O5EA 3B9EA 1FKKA 1SYTA 3ARZA 5HW6A 1D7JA 2JZVA 1HJWA 2VCDA 1JNSA 2O92A 2XP9A 3VAWA 3WL1A 1ZBVA 2WLZA 3ALFA 2KI3A 2M08A 2G41A 2YBUA 1LG2A 1W1VA 1D6OA 1J4IA 1RD6A 1D2KA 3FY1A 4IQ2A 1E6ZA 3KAGA 3IK8A 3ARSA 1M5YA 4W9QA 2DG4A 2A3BA 3ARUA 3O5LA 1ROUA 1LL7A 3O5QA 4QT2A 2PI6A 1JCHB 2MPHA 3RGCA 2PPNA 4DT4A 1XHGA 1EIBA 4G50A 3O5KA 2ESCA 3ARRA 1HJVA 3WKZA 4C02B 1TFVA 1NWSA 1FKIA 3KACA 4ODMA 2AWGA 2DG3A 4AY1A 2PPPA 3KAIA 1OGGA 2LKNA 4DZ3A 3KADA 1H0GA 4KQZA 4TX0A 1FAPA 4LAXA 1FKTA 1U79A 1UR9A 2ZR4A 2PBCA 1FKHA 3AS1A 1W1YA 2XP8A 2ETNA 3UI6A 1Y0OA 1J6YA 2PPOA 3GTYX 3B9AA 4U86A 5J6EA 3KAHA 4ZPWR 4ODLA 4JFLA 1NMVA 2ZQTA 2A3CA 3WL0A 3KCEA 1W1TA 5D75A 4HBOA 1LL4A 1E6NA 1EQ3A 2K8IA 1W1PA 2DSVA 3UF8A 1QPFA 1JNTA 3UI5A 4XAKA 4Z2KA 1T11A 3WD3A 1XRVA 3AQUA 2RUCA 3PR9A 2PV2A 3WD1A 3KAFA 5HBFA 1ITXA 2RQSA 3NTPA 1E6RA 4DWSB 3H9RB 1A7XA 1HKMA 3O5JA 4Z2JA 4URIA 1EYMA 1ZCNA 4G2PA 1FJDA 2PV1A 3TDBA 1ZK6A 3O5OA 4MPKA 2D9FA 1FKGA 3LUOA 3UQBA 4W9PA 4LGXA 4MGVA 1ZU8A 4Q7NA 2ZQSA 4MNJA 3PRDA 1B6CA 2MLYA 4JFJA 1FKSA 3O5PA 1KT1A 3JYMA 4DZ2A 2O9OA 3WD2A 4MAVA 4R0XA 3PRAA 4TW8A 4MNLA 4W5UA 2DSZA 4WJXA 3AS3A 3GPKA 3EIPA 5HWBA 1H0IA 2FDMA 2WLYA 1JNDA 2UZ5A 4ODNA 4TW7A 4MTVA 5BXJA 2RSEA 4HBEA 3WQVA 2MLZA 3W4RA 3O5GA 4DRJA 4GIVA 4TYOA 3AS2A 3B7XA 1FKLA 4GGQA 4L72B 4MSPA 1WNOA 1NWRA 3IKDA 5HTGA 2MNTA 3OOBA 4DRKA 4ZPVR 3I6CA 1JVWA 5DIUA 2FAPA 2QF8A 5HT1A 1EHNA 2KGJA 3CHFA 4J4OA 3O5IA 1FKBA 2LGOA 2XP4A 1YW5A 4S3JA 1W9UA 1D7IA 1KFWA 1ZBWA 3B9DA 2P4VA 1X6LA 3JYJA 5JH8A 4JFMA 4PTMA 2DT3A 2Y78A 1IX5A 3OA5A 4DH0A 3UQAA 1QPLA 3ARPA 1HJXA 4U84A 3MDYB 1ROTA 5HW8A 1P5QA 1FFRA 4P8UA 1W9VA 1GUVA 1J4HA 2EULA 4DRMA 5DITA 3CGMA 1HKIA 2M2AA 3WH0A 2VN1A 4ODOA 4IT6A 2IUZA 4P8XA 4WIWA 2OFNA 1SR0A 1OWQA 4LAWA 3IKGA 2L2SA 1NH6A 3PA7A 1LJYA 2OLHA 3FXYA 2DT0A 1OGBA 3CHEA 1ZBCA 1CTNA 2B31A 4NSBA 2N87A 5I98A 1LL6A 1R9HA 5GQBA 1E6PA 1E44A 2ZQUA 1FKFA 1JNEA 2ITKA 4U85A 1BKFA 4J4NA 1E9LA 1D7HA 2XP6A 3AROA 4ODQA 4LAVA 1EDQA 4BF8A 3ARXA 5GPGA 1ZB5A 1NWTA 5DIVA 1FKJA 4R5EA 2XP3A 4O2TA 3ODKA 2KE0A 1PINA 4IPXA 1GRJA 3BMBA 2F21A
chains in the Genus database with same CATH topology
5HKGA 1Q6IA 4IQCA 1N1AA 1KT0A 1Q6HA 3RMEA 1Q1CA 1WB0A 2DT1A 2AOSA 4WKAA 3O5DA 1GOIA 2XPBA 4DWSC 3ARVA 1BL4A 3WD0A 3AS0A 3PRBA 2XPAA 4ZPTR 3RM4A 1LQ0A 4WKFA 2A3AA 3ARQA 4IT4A 3UI4A 2WM0A 3ARYA 3NRKA 4S3KA 1W26A 3RM8A 4WKHA 4QIBA 2RUDA 4ITZA 2WK2A 3IHZA 4DRQA 1GPFA 2F4EA 3G6LA 4KR0B 2RURA 2ZR6A 5HWCA 3JXVA 4L3NA 3O5MA 2DT2A 3UQIA 1C9HA 5DF0A 1NSGA 1FKRA 2DSUA 2XP5A 2XP7A 4DWSD 1X6NA 3ARWA 1J4RA 4ODPA 4NZCA 1UR8A 3BXWA 3CGNA 5B8IC 2DG9A 4WK9A 2PV3A 4LAYA 1PBKA 2F2DA 3NI6A 4TW6A 3ARTA 4ML4A 2G8ZA 1O6IA 2IF4A 2KO7A 3O5FA 4ODKA 1Q6UA 4P8VA 4DWSA 4FAPA 3G6MA 1ZBKA 4W9OA 3WIJA 3CHDA 1FKDA 2FKEA 4JYSA 4FN2A 3KABA 4DRHA 4DRPA 2LJ4A 3CHCA 4JFIA 1L1PA 4DIPA 5HUAA 4DROA 2DPEA 4DRNA 5GPRA 4Z2GA 3TC5A 1E15A 3RM9A 3TCZA 2DSWA 4JFKA 1HKKA 1HKJA 1WAWA 5DEZA 1NWUA 3WQWA 4QT3A 1VF8A 1F40A 1F8AB 2YBTA 2ZR5A 1FFQA 1K9TA 2ZQVA 4ODRA 3ALGA 1TCOC 3RFWA 1QZ2A 4DRIA 1ZL1A 3WD4A 1FD9A 2MF9A 5DO2A 2M1IA 5HW7A 3QOKA 3KZ7A 1NMWA 1YATA 2KFWA 4Z2LA 4MNMA 4QZVB 1LG1A 4TNSA 4Z2HA 4P8WA 3B8SA 3CZ8A 2A3EA 2LPVA 4NNRA 2MLXA 3CH9A 4MNKA 4Q22A 1W9PA 3FAPA 2RUQA 4N19A 4Z2IA 4ZS6A 3O5RA 3EY6A 1HXVA 2Q5AA 4HARA 2KR7A 3O5EA 3B9EA 1FKKA 1SYTA 3ARZA 5HW6A 1D7JA 2JZVA 1HJWA 2VCDA 1JNSA 2O92A 2XP9A 3VAWA 3WL1A 1ZBVA 2WLZA 3ALFA 2KI3A 2M08A 2G41A 2YBUA 1LG2A 1W1VA 1D6OA 1J4IA 1RD6A 1D2KA 3FY1A 4IQ2A 1E6ZA 3KAGA 3IK8A 3ARSA 1M5YA 4W9QA 2DG4A 2A3BA 3ARUA 3O5LA 1ROUA 1LL7A 3O5QA 2PI6A 2MPHA 3RGCA 2PPNA 4DT4A 1XHGA 1EIBA 4G50A 3O5KA 2ESCA 3ARRA 1HJVA 3WKZA 4C02B 1TFVA 1NWSA 1FKIA 3KACA 4ODMA 2AWGA 2DG3A 4AY1A 2PPPA 3KAIA 1OGGA 2LKNA 4DZ3A 3KADA 1H0GA 4KQZA 4TX0A 1FAPA 4LAXA 1FKTA 1U79A 1UR9A 2ZR4A 2PBCA 1FKHA 3AS1A 1W1YA 2XP8A 3UI6A 1Y0OA 1J6YA 2PPOA 3B9AA 4U86A 5J6EA 3KAHA 4ZPWR 4ODLA 4JFLA 1NMVA 2ZQTA 2A3CA 3WL0A 3KCEA 1W1TA 5D75A 4HBOA 1LL4A 1E6NA 1EQ3A 2K8IA 1W1PA 2DSVA 3UF8A 1QPFA 1JNTA 3UI5A 4XAKA 4Z2KA 1T11A 3WD3A 1XRVA 3AQUA 2RUCA 3PR9A 2PV2A 3WD1A 3KAFA 5HBFA 1ITXA 2RQSA 3NTPA 1E6RA 4DWSB 3O5JA 1A7XA 1HKMA 3H9RB 4Z2JA 4URIA 1EYMA 1ZCNA 4G2PA 1FJDA 2PV1A 3TDBA 1ZK6A 3O5OA 4MPKA 2D9FA 1FKGA 3LUOA 3UQBA 4W9PA 4LGXA 4MGVA 1ZU8A 4Q7NA 2ZQSA 4MNJA 3PRDA 1B6CA 2MLYA 4JFJA 1FKSA 3O5PA 1KT1A 3JYMA 4DZ2A 2O9OA 3WD2A 4MAVA 4R0XA 3PRAA 4TW8A 4MNLA 4W5UA 2DSZA 4WJXA 3AS3A 3GPKA 5HWBA 1H0IA 2FDMA 2WLYA 1JNDA 2UZ5A 4ODNA 4TW7A 4MTVA 5BXJA 2RSEA 4HBEA 3WQVA 2MLZA 3W4RA 3O5GA 4DRJA 4GIVA 4TYOA 3AS2A 3B7XA 1FKLA 4GGQA 4L72B 4MSPA 1WNOA 1NWRA 3IKDA 5HTGA 2MNTA 3OOBA 4DRKA 4ZPVR 3I6CA 1JVWA 5DIUA 2FAPA 2QF8A 5HT1A 1EHNA 2KGJA 3CHFA 4J4OA 3O5IA 1FKBA 2LGOA 2XP4A 1YW5A 4S3JA 1W9UA 1D7IA 1KFWA 1ZBWA 3B9DA 1X6LA 3JYJA 5JH8A 4JFMA 4PTMA 2DT3A 2Y78A 1IX5A 3OA5A 4DH0A 3UQAA 1QPLA 3ARPA 1HJXA 4U84A 3MDYB 1ROTA 5HW8A 1P5QA 1FFRA 1W9VA 1GUVA 1J4HA 4DRMA 5DITA 3CGMA 1HKIA 2M2AA 3WH0A 2VN1A 4ODOA 4IT6A 2IUZA 4P8XA 4WIWA 2OFNA 1SR0A 1OWQA 4LAWA 3IKGA 2L2SA 1NH6A 3PA7A 1LJYA 2OLHA 3FXYA 2DT0A 1OGBA 3CHEA 1ZBCA 1CTNA 2B31A 4NSBA 2N87A 5I98A 1LL6A 1R9HA 5GQBA 1E6PA 2ZQUA 1FKFA 1JNEA 2ITKA 4U85A 1BKFA 4J4NA 1E9LA 1D7HA 2XP6A 3AROA 4ODQA 4LAVA 1EDQA 4BF8A 3ARXA 5GPGA 1ZB5A 1NWTA 5DIVA 1FKJA 4R5EA 2XP3A 4O2TA 3ODKA 2KE0A 1PINA 4IPXA 4P8UA 4QT2A 2F21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PR9 A;  3PRA A;  1IX5 A; 
#chains in the Genus database with same CATH topology
 5HKG A;  1Q6I A;  4IQC A;  1N1A A;  2PN0 A;  1KT0 A;  1Q6H A;  3RME A;  1Q1C A;  3GU0 A;  1WB0 A;  2DT1 A;  2AOS A;  4WKA A;  3O5D A;  1GOI A;  2XPB A;  4DWS C;  3ARV A;  1BL4 A;  3WD0 A;  3AS0 A;  3PRB A;  2XPA A;  4ZPT R;  3RM4 A;  1LQ0 A;  4WKF A;  2A3A A;  3ARQ A;  4IT4 A;  3UI4 A;  2WM0 A;  3ARY A;  3NRK A;  2B5U B;  4S3K A;  1W26 A;  3RM8 A;  4WKH A;  4QIB A;  2RUD A;  4ITZ A;  2WK2 A;  3IHZ A;  4DRQ A;  1GPF A;  2F23 A;  2F4E A;  3G6L A;  4KR0 B;  2RUR A;  2ZR6 A;  5HWC A;  3JXV A;  4L3N A;  3O5M A;  2DT2 A;  3UQI A;  1C9H A;  5DF0 A;  1NSG A;  1FKR A;  2DSU A;  2XP5 A;  2XP7 A;  4DWS D;  1X6N A;  3ARW A;  1J4R A;  4ODP A;  4NZC A;  1UR8 A;  3BXW A;  3CGN A;  5B8I C;  2DG9 A;  4WK9 A;  4UDM A;  2PV3 A;  4LAY A;  1PBK A;  2F2D A;  3NI6 A;  4TW6 A;  3ART A;  4ML4 A;  2G8Z A;  1O6I A;  2IF4 A;  2KO7 A;  3O5F A;  4ODK A;  1Q6U A;  4P8V A;  4DWS A;  4FAP A;  3G6M A;  1ZBK A;  4W9O A;  3WIJ A;  3CHD A;  1FKD A;  2FKE A;  4JYS A;  4FN2 A;  3KAB A;  4DRH A;  4DRP A;  2LJ4 A;  3CHC A;  4JFI A;  1L1P A;  4DIP A;  5HUA A;  4DRO A;  2DPE A;  4DRN A;  5GPR A;  4Z2G A;  3TC5 A;  1E15 A;  3RM9 A;  3TCZ A;  2DSW A;  4JFK A;  1HKK A;  1HKJ A;  1WAW A;  5DEZ A;  1NWU A;  3WQW A;  4QT3 A;  1VF8 A;  1F40 A;  1F8A B;  2YBT A;  2ZR5 A;  1FFQ A;  1K9T A;  2ZQV A;  4ODR A;  3ALG A;  1TCO C;  3RFW A;  1QZ2 A;  4DRI A;  1ZL1 A;  3WD4 A;  1FD9 A;  2MF9 A;  5DO2 A;  2M1I A;  5HW7 A;  3QOK A;  3KZ7 A;  1NMW A;  1YAT A;  2KFW A;  4Z2L A;  4MNM A;  4QZV B;  1LG1 A;  4TNS A;  4Z2H A;  4P8W A;  3B8S A;  3CZ8 A;  2A3E A;  2LPV A;  4NNR A;  2MLX A;  3CH9 A;  4MNK A;  4Q22 A;  1W9P A;  3FAP A;  2RUQ A;  4N19 A;  4Z2I A;  4ZS6 A;  3O5R A;  3EY6 A;  1HXV A;  2Q5A A;  4HAR A;  2KR7 A;  3O5E A;  3B9E A;  1FKK A;  1SYT A;  3ARZ A;  5HW6 A;  1D7J A;  2JZV A;  1HJW A;  2VCD A;  1JNS A;  2O92 A;  2XP9 A;  3VAW A;  3WL1 A;  1ZBV A;  2WLZ A;  3ALF A;  2KI3 A;  2M08 A;  2G41 A;  2YBU A;  1LG2 A;  1W1V A;  1D6O A;  1J4I A;  1RD6 A;  1D2K A;  3FY1 A;  4IQ2 A;  1E6Z A;  3KAG A;  3IK8 A;  3ARS A;  1M5Y A;  4W9Q A;  2DG4 A;  2A3B A;  3ARU A;  3O5L A;  1ROU A;  1LL7 A;  3O5Q A;  4QT2 A;  2PI6 A;  1JCH B;  2MPH A;  3RGC A;  2PPN A;  4DT4 A;  1XHG A;  1EIB A;  4G50 A;  3O5K A;  2ESC A;  3ARR A;  1HJV A;  3WKZ A;  4C02 B;  1TFV A;  1NWS A;  1FKI A;  3KAC A;  4ODM A;  2AWG A;  2DG3 A;  4AY1 A;  2PPP A;  3KAI A;  1OGG A;  2LKN A;  4DZ3 A;  3KAD A;  1H0G A;  4KQZ A;  4TX0 A;  1FAP A;  4LAX A;  1FKT A;  1U79 A;  1UR9 A;  2ZR4 A;  2PBC A;  1FKH A;  3AS1 A;  1W1Y A;  2XP8 A;  2ETN A;  3UI6 A;  1Y0O A;  1J6Y A;  2PPO A;  3GTY X;  3B9A A;  4U86 A;  5J6E A;  3KAH A;  4ZPW R;  4ODL A;  4JFL A;  1NMV A;  2ZQT A;  2A3C A;  3WL0 A;  3KCE A;  1W1T A;  5D75 A;  4HBO A;  1LL4 A;  1E6N A;  1EQ3 A;  2K8I A;  1W1P A;  2DSV A;  3UF8 A;  1QPF A;  1JNT A;  3UI5 A;  4XAK A;  4Z2K A;  1T11 A;  3WD3 A;  1XRV A;  3AQU A;  2RUC A;  3PR9 A;  2PV2 A;  3WD1 A;  3KAF A;  5HBF A;  1ITX A;  2RQS A;  3NTP A;  1E6R A;  4DWS B;  3H9R B;  1A7X A;  1HKM A;  3O5J A;  4Z2J A;  4URI A;  1EYM A;  1ZCN A;  4G2P A;  1FJD A;  2PV1 A;  3TDB A;  1ZK6 A;  3O5O A;  4MPK A;  2D9F A;  1FKG A;  3LUO A;  3UQB A;  4W9P A;  4LGX A;  4MGV A;  1ZU8 A;  4Q7N A;  2ZQS A;  4MNJ A;  3PRD A;  1B6C A;  2MLY A;  4JFJ A;  1FKS A;  3O5P A;  1KT1 A;  3JYM A;  4DZ2 A;  2O9O A;  3WD2 A;  4MAV A;  4R0X A;  3PRA A;  4TW8 A;  4MNL A;  4W5U A;  2DSZ A;  4WJX A;  3AS3 A;  3GPK A;  3EIP A;  5HWB A;  1H0I A;  2FDM A;  2WLY A;  1JND A;  2UZ5 A;  4ODN A;  4TW7 A;  4MTV A;  5BXJ A;  2RSE A;  4HBE A;  3WQV A;  2MLZ A;  3W4R A;  3O5G A;  4DRJ A;  4GIV A;  4TYO A;  3AS2 A;  3B7X A;  1FKL A;  4GGQ A;  4L72 B;  4MSP A;  1WNO A;  1NWR A;  3IKD A;  5HTG A;  2MNT A;  3OOB A;  4DRK A;  4ZPV R;  3I6C A;  1JVW A;  5DIU A;  2FAP A;  2QF8 A;  5HT1 A;  1EHN A;  2KGJ A;  3CHF A;  4J4O A;  3O5I A;  1FKB A;  2LGO A;  2XP4 A;  1YW5 A;  4S3J A;  1W9U A;  1D7I A;  1KFW A;  1ZBW A;  3B9D A;  2P4V A;  1X6L A;  3JYJ A;  5JH8 A;  4JFM A;  4PTM A;  2DT3 A;  2Y78 A;  1IX5 A;  3OA5 A;  4DH0 A;  3UQA A;  1QPL A;  3ARP A;  1HJX A;  4U84 A;  3MDY B;  1ROT A;  5HW8 A;  1P5Q A;  1FFR A;  4P8U A;  1W9V A;  1GUV A;  1J4H A;  2EUL A;  4DRM A;  5DIT A;  3CGM A;  1HKI A;  2M2A A;  3WH0 A;  2VN1 A;  4ODO A;  4IT6 A;  2IUZ A;  4P8X A;  4WIW A;  2OFN A;  1SR0 A;  1OWQ A;  4LAW A;  3IKG A;  2L2S A;  1NH6 A;  3PA7 A;  1LJY A;  2OLH A;  3FXY A;  2DT0 A;  1OGB A;  3CHE A;  1ZBC A;  1CTN A;  2B31 A;  4NSB A;  2N87 A;  5I98 A;  1LL6 A;  1R9H A;  5GQB A;  1E6P A;  1E44 A;  2ZQU A;  1FKF A;  1JNE A;  2ITK A;  4U85 A;  1BKF A;  4J4N A;  1E9L A;  1D7H A;  2XP6 A;  3ARO A;  4ODQ A;  4LAV A;  1EDQ A;  4BF8 A;  3ARX A;  5GPG A;  1ZB5 A;  1NWT A;  5DIV A;  1FKJ A;  4R5E A;  2XP3 A;  4O2T A;  3ODK A;  2KE0 A;  1PIN A;  4IPX A;  1GRJ A;  3BMB A;  2F21 A; 
#chains in the Genus database with same CATH homology
 5HKG A;  1Q6I A;  4IQC A;  1N1A A;  1KT0 A;  1Q6H A;  3RME A;  1Q1C A;  1WB0 A;  2DT1 A;  2AOS A;  4WKA A;  3O5D A;  1GOI A;  2XPB A;  4DWS C;  3ARV A;  1BL4 A;  3WD0 A;  3AS0 A;  3PRB A;  2XPA A;  4ZPT R;  3RM4 A;  1LQ0 A;  4WKF A;  2A3A A;  3ARQ A;  4IT4 A;  3UI4 A;  2WM0 A;  3ARY A;  3NRK A;  4S3K A;  1W26 A;  3RM8 A;  4WKH A;  4QIB A;  2RUD A;  4ITZ A;  2WK2 A;  3IHZ A;  4DRQ A;  1GPF A;  2F4E A;  3G6L A;  4KR0 B;  2RUR A;  2ZR6 A;  5HWC A;  3JXV A;  4L3N A;  3O5M A;  2DT2 A;  3UQI A;  1C9H A;  5DF0 A;  1NSG A;  1FKR A;  2DSU A;  2XP5 A;  2XP7 A;  4DWS D;  1X6N A;  3ARW A;  1J4R A;  4ODP A;  4NZC A;  1UR8 A;  3BXW A;  3CGN A;  5B8I C;  2DG9 A;  4WK9 A;  2PV3 A;  4LAY A;  1PBK A;  2F2D A;  3NI6 A;  4TW6 A;  3ART A;  4ML4 A;  2G8Z A;  1O6I A;  2IF4 A;  2KO7 A;  3O5F A;  4ODK A;  1Q6U A;  4P8V A;  4DWS A;  4FAP A;  3G6M A;  1ZBK A;  4W9O A;  3WIJ A;  3CHD A;  1FKD A;  2FKE A;  4JYS A;  4FN2 A;  3KAB A;  4DRH A;  4DRP A;  2LJ4 A;  3CHC A;  4JFI A;  1L1P A;  4DIP A;  5HUA A;  4DRO A;  2DPE A;  4DRN A;  5GPR A;  4Z2G A;  3TC5 A;  1E15 A;  3RM9 A;  3TCZ A;  2DSW A;  4JFK A;  1HKK A;  1HKJ A;  1WAW A;  5DEZ A;  1NWU A;  3WQW A;  4QT3 A;  1VF8 A;  1F40 A;  1F8A B;  2YBT A;  2ZR5 A;  1FFQ A;  1K9T A;  2ZQV A;  4ODR A;  3ALG A;  1TCO C;  3RFW A;  1QZ2 A;  4DRI A;  1ZL1 A;  3WD4 A;  1FD9 A;  2MF9 A;  5DO2 A;  2M1I A;  5HW7 A;  3QOK A;  3KZ7 A;  1NMW A;  1YAT A;  2KFW A;  4Z2L A;  4MNM A;  4QZV B;  1LG1 A;  4TNS A;  4Z2H A;  4P8W A;  3B8S A;  3CZ8 A;  2A3E A;  2LPV A;  4NNR A;  2MLX A;  3CH9 A;  4MNK A;  4Q22 A;  1W9P A;  3FAP A;  2RUQ A;  4N19 A;  4Z2I A;  4ZS6 A;  3O5R A;  3EY6 A;  1HXV A;  2Q5A A;  4HAR A;  2KR7 A;  3O5E A;  3B9E A;  1FKK A;  1SYT A;  3ARZ A;  5HW6 A;  1D7J A;  2JZV A;  1HJW A;  2VCD A;  1JNS A;  2O92 A;  2XP9 A;  3VAW A;  3WL1 A;  1ZBV A;  2WLZ A;  3ALF A;  2KI3 A;  2M08 A;  2G41 A;  2YBU A;  1LG2 A;  1W1V A;  1D6O A;  1J4I A;  1RD6 A;  1D2K A;  3FY1 A;  4IQ2 A;  1E6Z A;  3KAG A;  3IK8 A;  3ARS A;  1M5Y A;  4W9Q A;  2DG4 A;  2A3B A;  3ARU A;  3O5L A;  1ROU A;  1LL7 A;  3O5Q A;  2PI6 A;  2MPH A;  3RGC A;  2PPN A;  4DT4 A;  1XHG A;  1EIB A;  4G50 A;  3O5K A;  2ESC A;  3ARR A;  1HJV A;  3WKZ A;  4C02 B;  1TFV A;  1NWS A;  1FKI A;  3KAC A;  4ODM A;  2AWG A;  2DG3 A;  4AY1 A;  2PPP A;  3KAI A;  1OGG A;  2LKN A;  4DZ3 A;  3KAD A;  1H0G A;  4KQZ A;  4TX0 A;  1FAP A;  4LAX A;  1FKT A;  1U79 A;  1UR9 A;  2ZR4 A;  2PBC A;  1FKH A;  3AS1 A;  1W1Y A;  2XP8 A;  3UI6 A;  1Y0O A;  1J6Y A;  2PPO A;  3B9A A;  4U86 A;  5J6E A;  3KAH A;  4ZPW R;  4ODL A;  4JFL A;  1NMV A;  2ZQT A;  2A3C A;  3WL0 A;  3KCE A;  1W1T A;  5D75 A;  4HBO A;  1LL4 A;  1E6N A;  1EQ3 A;  2K8I A;  1W1P A;  2DSV A;  3UF8 A;  1QPF A;  1JNT A;  3UI5 A;  4XAK A;  4Z2K A;  1T11 A;  3WD3 A;  1XRV A;  3AQU A;  2RUC A;  3PR9 A;  2PV2 A;  3WD1 A;  3KAF A;  5HBF A;  1ITX A;  2RQS A;  3NTP A;  1E6R A;  4DWS B;  3O5J A;  1A7X A;  1HKM A;  3H9R B;  4Z2J A;  4URI A;  1EYM A;  1ZCN A;  4G2P A;  1FJD A;  2PV1 A;  3TDB A;  1ZK6 A;  3O5O A;  4MPK A;  2D9F A;  1FKG A;  3LUO A;  3UQB A;  4W9P A;  4LGX A;  4MGV A;  1ZU8 A;  4Q7N A;  2ZQS A;  4MNJ A;  3PRD A;  1B6C A;  2MLY A;  4JFJ A;  1FKS A;  3O5P A;  1KT1 A;  3JYM A;  4DZ2 A;  2O9O A;  3WD2 A;  4MAV A;  4R0X A;  3PRA A;  4TW8 A;  4MNL A;  4W5U A;  2DSZ A;  4WJX A;  3AS3 A;  3GPK A;  5HWB A;  1H0I A;  2FDM A;  2WLY A;  1JND A;  2UZ5 A;  4ODN A;  4TW7 A;  4MTV A;  5BXJ A;  2RSE A;  4HBE A;  3WQV A;  2MLZ A;  3W4R A;  3O5G A;  4DRJ A;  4GIV A;  4TYO A;  3AS2 A;  3B7X A;  1FKL A;  4GGQ A;  4L72 B;  4MSP A;  1WNO A;  1NWR A;  3IKD A;  5HTG A;  2MNT A;  3OOB A;  4DRK A;  4ZPV R;  3I6C A;  1JVW A;  5DIU A;  2FAP A;  2QF8 A;  5HT1 A;  1EHN A;  2KGJ A;  3CHF A;  4J4O A;  3O5I A;  1FKB A;  2LGO A;  2XP4 A;  1YW5 A;  4S3J A;  1W9U A;  1D7I A;  1KFW A;  1ZBW A;  3B9D A;  1X6L A;  3JYJ A;  5JH8 A;  4JFM A;  4PTM A;  2DT3 A;  2Y78 A;  1IX5 A;  3OA5 A;  4DH0 A;  3UQA A;  1QPL A;  3ARP A;  1HJX A;  4U84 A;  3MDY B;  1ROT A;  5HW8 A;  1P5Q A;  1FFR A;  1W9V A;  1GUV A;  1J4H A;  4DRM A;  5DIT A;  3CGM A;  1HKI A;  2M2A A;  3WH0 A;  2VN1 A;  4ODO A;  4IT6 A;  2IUZ A;  4P8X A;  4WIW A;  2OFN A;  1SR0 A;  1OWQ A;  4LAW A;  3IKG A;  2L2S A;  1NH6 A;  3PA7 A;  1LJY A;  2OLH A;  3FXY A;  2DT0 A;  1OGB A;  3CHE A;  1ZBC A;  1CTN A;  2B31 A;  4NSB A;  2N87 A;  5I98 A;  1LL6 A;  1R9H A;  5GQB A;  1E6P A;  2ZQU A;  1FKF A;  1JNE A;  2ITK A;  4U85 A;  1BKF A;  4J4N A;  1E9L A;  1D7H A;  2XP6 A;  3ARO A;  4ODQ A;  4LAV A;  1EDQ A;  4BF8 A;  3ARX A;  5GPG A;  1ZB5 A;  1NWT A;  5DIV A;  1FKJ A;  4R5E A;  2XP3 A;  4O2T A;  3ODK A;  2KE0 A;  1PIN A;  4IPX A;  4P8U A;  4QT2 A;  2F21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...