3PRBA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
molecule tags Chaperone, isomerase
source organism Methanocaldococcus jannaschii
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prbA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prbA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prbA03
4JFIA 1TCOC 1FKDA 1ROUA 4JFLA 3IK8A 5BXJA 2RUQA 3KACA 4DRNA 2KE0A 1JNSA 3VAWA 2RQSA 3NRKA 3GPKA 1FKTA 1FAPA 3O5RA 4JFMA 2FKEA 2XP3A 3B7XA 1Q1CA 3PRBA 5HW7A 2F2DA 4ODMA 2XP6A 2N87A 5D75A 4DRIA 1A7XA 4W9PA 3IKDA 1ZK6A 1KT0A 4LAVA 1M5YA 2LJ4A 4TW8A 1FKLA 1C9HA 4QT2A 1Q6IA 2ZQSA 4W9OA 2L2SA 1J4HA 3CGNA 3MDYB 4JFKA 2XP9A 4TW6A 2KFWA 5HUAA 2MLYA 2PPNA 2PV2A 3O5EA 5HT1A 1ZCNA 4DRKA 1NMVA 2ZQTA 3KCEA 1NMWA 4GGQA 1ROTA 2DG3A 3KAIA 4ODKA 3TC5A 4LAXA 3NI6A 3JYJA 1EYMA 4LAWA 2VCDA 4ODNA 1FKJA 5B8IC 3UQBA 1F8AB 2MF9A 2OFNA 3O5PA 4W9QA 1FKHA 3UQAA 4TW7A 3RFWA 2F4EA 3UI4A 3O5DA 4ODPA 1NSGA 1B6CA 1N1AA 3JYMA 3OOBA 4J4OA 4DRPA 4GIVA 1JNTA 3JXVA 1QZ2A 4C02B 1QPLA 3CGMA 1W26A 1PINA 1HXVA 5HKGA 2XPAA 1FKSA 4DROA 4ODOA 2ZR5A 1J4IA 4N19A 3RGCA 2PBCA 3ODKA 3IHZA 3O5FA 2LKNA 4DRQA 1J6YA 2UZ5A 2XPBA 2XP7A 3KABA 2KO7A 1FKKA 1QPFA 1FKGA 1YATA 1U79A 3LUOA 4LAYA 4ODQA 4QT3A 4U86A 4O2TA 4G2PA 4TX0A 4U84A 2M2AA 2MLXA 2RUDA 4J4NA 2DG4A 3WH0A 3KAFA 1JVWA 5DIUA 1D7HA 2Y78A 2KI3A 3TDBA 3UF8A 4MSPA 1L1PA 2DG9A 4BF8A 4DRJA 1KT1A 3O5QA 2LGOA 1FJDA 2PV3A 4FN2A 2F21A 5HTGA 1FD9A 2AWGA 1FKFA 1BL4A 3IKGA 3KAGA 4IQ2A 2ITKA 3FAPA 2MPHA 2MLZA 4JYSA 2XP8A 1D7IA 4DRMA 3PRDA 2ZQVA 1BKFA 3O5LA 3I6CA 4DZ2A 5J6EA 3TCZA 2D9FA 2RUCA 2RURA 1FKBA 2XP5A 3O5GA 2JZVA 4JFJA 3UI5A 4ITZA 3UQIA 2IF4A 4G50A 2FAPA 2MNTA 1EQ3A 2M1IA 3UI6A 4IPXA 2VN1A 4DRHA 5HWCA 4NNRA 2KGJA 4DIPA 5I98A 1F40A 2Q5AA 2KR7A 1Q6HA 3PA7A 1R9HA 3O5KA 3O5MA 1YW5A 2ZQUA 3O5OA 1Y0OA 4MGVA 1FKIA 5HW6A 1FKRA 4ODRA 4DH0A 3H9RB 2ZR6A 4ODLA 3O5IA 3EY6A 2K8IA 4TYOA 4FAPA 5HWBA 3KADA 2LPVA 1J4RA 1PBKA 2XP4A 4DZ3A 3NTPA 2PPOA 4IQCA 1P5QA 1Q6UA 4DT4A 1D7JA 1T11A 1D6OA 2PV1A 3KZ7A 2RSEA 4TNSA 4QIBA 2M08A 5HW8A 2PPPA 4U85A 5DIVA 3O5JA 4R0XA 5DITA 3KAHA 2ZR4A 5GPGA
chains in the Genus database with same CATH superfamily
1QJHA 5LH8A 3EA9A 1VITG 3DCLA 2HRVA 2ZGJA 1YCPH 4DPXA 3N5FA 1RTZA 4BWMA 3LP1A 2UUTA 1KQFB 5DK1A 1C2PA 3LANA 4YQWA 3UFAA 3C6TB 4IQMA 5M2PA 1WDTA 3SJOA 3PHEA 2G13A 5C1XA 1TKZB 1YYY1 3RFWA 4NRTA 4IMQA 3CHEA 3B6BA 4U2WA 1DWCH 4Q2LA 1GMWD 4XAKA 3ESTA 3B4DA 4ZVRB 1UFWA 2ZE2B 1C1CA 2DRAA 4ZOSA 2ZFQH 4UUXA 2LEBA 3CHCA 3AY0A 5GWZA 3NP5A 1RT7A 4FYDA 3L9ZA 1F5LA 1ZTLA 4W90B 2EVZA 1IKWA 3QLPH 2H2ZA 3ENQA 2UWLA 2EXUA 5F8ZA 2AZ1A 1XUHA 3R6GB 1NCLA 1Z1IA 2A4GA 1DTQA 1T03B 2YWWA 2ZDOA 3OHAA 1FDNA 3MNCA 4MT1A 2J94A 4ED0A 4JK5A 3NS5A 4EZ6A 1U6FA 4X4UA 5GVQA 4M5HA 1HAVB 1GI5A 1HAHH 2BD8A 1ZSJA 1P9SA 3MU4A 3ZZRA 1ZTJA 2EC2A 1OPHB 1NWTA 1K9MT 2FDAA 3VFEA 2P6TA 2UUYA 4ABHA 5LPRA 1TMJA 3QRRA 1HBUB 2SFAA 1WC3A 4JI6F 3QX5H 2XP9A 4UDWH 1ZAWA 3KDOA 3MGJA 4IRCA 4GLYA 2WUCA 2ZQTA 4PG6A 1TKZA 4ZCMA 1YQHA 5ESTE 1JLCA 5C2GA 1O3JA 2NU4E 2EEYA 2HLTA 2HVHA 1C9PA 2GO8A 3ISNC 3QQCD 2FGOA 1QPLA 4OHVA 1IQHA 3C14B 1ELOA 4AL5A 5D0RA 3J7AN 2MPUA 1SYTA 3DHKH 1IWGA 1TL3B 4LZ4B 2W2PP 4CRBA 3CJ5A 3KHGA 1EJAA 1Y9OA 2ZHOA 3UE2A 1EZZB 4HT5A 2G52A 2BBEA 1BC6A 2Y1LB 1UCYE 1COWD 1M9UA 4OYXA 2RFKC 3R5DA 4CHAB 2XLKA 4WMFA 5TCAA 2JC1A 3W64A 2ZQUA 1SQRA 4FS2A 3AD8C 1D2KA 3M30A 5ADZA 5C25B 2CQDA 4DUYJ 2BZ2A 4DR2J 3H9RB 3IAS9 2ZE2A 1VK3A 4ICLA 3BGRA 4X1PU 3H98A 3K5LA 2W4DA 4DL0C 2CJIA 2PWXA 3TX0A 1RLCL 4JI4J 4F0KA 5KFSA 3NCLA 3PYGA 2EKNA 2M88A 2XM3A 4ISLA 1AA1B 3RAQA 3KJVB 4ASUD 3LALA 3UOUA 4PYAA 1SR0A 1E79D 4I2PA 1R7IA 1GBBA 3TP2A 1C2JA 4JI3J 1HYSB 1X0PA 3GP9A 1N33F 1WEYA 1UCYH 1NZAA 1U25A 3RBDA 1HI0P 1C5QA 1SJ3P 3D3BJ 3NMAA 1D3PB 3CUNA 3HKWA 4NX9A 4ZPVR 1A6LA 1QB1A 1TP7A 4YR0A 1HWLA 5K9FA 2HRUA 5B0GA 1MU2B 1AKSB 3G9CA 2G00A 3TK9A 6GCHF 1ROTA 4CLFA 3D54A 4MKBA 4TPYA 3W7BA 5FBEA 2QGFB 2XWXA 1EAXA 2L9WA 2N7YA 3KLGB 1O6IA 2OP9A 2DGSA 3ENWA 1V2JT 3SU3A 4LF9F 1TPSA 1NM6A 2CRLA 2VBXA 3NPSA 2DYAA 2FHKA 3WD3A 1MKWH 4JYUH 4S3JA 1MTSA 3SBKA 1RD3B 3BXWA 2ZH7A 5EGMA 4NFEA 2XS7A 1T95A 3POTB 1MWYA 2F4LA 5AXLA 1UP1A 4OYPA 2L3MA 3SFUA 8AT1B 1BTZA 2FTRA 2J6TA 1UVKA 2XMKA 3LA0A 3BSCA 4RW6B 3UR6A 1C2GA 2MQPA 3KF2A 4DY7B 1QL9A 2YBVA 5DRKA 1OWDA 4RT0A 1KLMA 2TIOA 1WHVA 5CH7B 1ZTTA 4JV5F 2Y0BB 3VXFH 4KO0A 5AF9H 3O5MA 5KFRA 2ASUB 1YPKH 1BUXA 1OO0B 1QSLA 4PXBA 1FNOA 3G82A 2J34A 3BTHE 5FXLA 1S9GB 3M6UA 1S12A 3IWLA 4FNIA 1IKVB 2Y82A 2PUXB 2IN2A 1OPIA 1HKMA 3T1AA 4JB8B 5JBCS 5B0FA 1G3CA 4QIFA 4CIOA 4CRGA 1UTMA 1JNSA 2FJVA 1NFWA 4K5RA 1QBVH 1FT8A 3MAHA 2RQKA 5GPRA 1KIGH 3A4TA 2BM0A 4OS5A 3PO5A 1THPB 5IDKA 5I3QA 5E3PA 3SJ9A 1K28D 1FIWA 2A7CA 1NROH 4O3UA 2PPNA 5U47A 1NMVA 2E5HA 1OIAA 3H40A 3BGOP 1J5EJ 4U7UD 1UJ4A 3ZZ3A 3IG6B 3QK1A 1ZB5A 4LAXA 4LAWA 3AH6A 4DQRA 1OKXA 5ABWA 1RI7A 3V81B 2RNEA 2E29A 2ODPA 4O3SA 4K1SA 3C16B 3SQGB 3OVSA 4CRAA 1TFWA 1SGRE 3MFIA 4LF5J 1EATA 1NBEB 2F63A 1L2EA 4WJXA 4RX6A 3GCXP 2NUHA 4WFXA 3O5QA 3NS6A 5FDLA 4RW7A 1J9CH 1GDQA 3QDZB 3EPGA 1IJFB 2CQPA 3BEIB 1N32J 1AFQC 2G8TA 1QJ1B 3TH4H 3SQOP 4X1QU 5DJBA 3BPDA 3PW7A 2QMUB 3PB1E 1PJ6A 1GG6C 1C1NA 5D3GA 2O92A 2BKOA 1CEZA 2C8WB 1N0VC 3PA7A 1WF0A 3TAMA 3K2UA 3QAEA 1U6ZA 3NOCA 1AFQB 3AS1A 2EI5A 1T8LA 4NZ7A 5C1UA 3BQ0A 3ZVAA 2HHXA 5GNDA 3GFZA 2ETNA 1IQMA 1TQ7B 5EJ1A 4AG2A 3TA0A 1SLUB 4ED6A 1MABB 3K0JA 3SZNA 3CD0A 1JCHB 5LM7E 2RA3A 3CCQS 3EZUA 4U9RA 4N77A 1VQLS 1YJ7A 1DX5M 2R7TA 2OUAA 1FAPA 2MJNA 4R5EA 1RE1B 2RD5C 1TWXB 1RHRB 3ZYEA 4AORA 2VG7A 4OM9A 3SCIE 5DO4H 1C4Y2 5KFCA 2ASDA 2BY7X 3OEHD 5FX6A 2KZ4A 4Q2KA 6ESTA 4INHA 4A1XA 1NK0A 3RMOH 3JB9k 4E06H 1SQTA 1JIMA 2NPIA 1BRUP 3BQ1A 5A8WA 1TK5A 3K5OA 1TMTH 3F9FA 1SJ4P 1KS2A 1W1VA 2FC8A 2DSZA 1UTKA 3KGPA 1SIZA 1J6YA 3CD7A 3CWJA 2DNQA 1QSSA 3SYJA 2MLXA 4PAAA 1H8HD 1VQ4S 4LBHA 1HA1A 1TOCB 1U0HB 1N6YA 2J9NA 3B4MA 5HLFB 1W1YA 2B56A 1NKCA 2AJQA 2RDLA 1LVOA 2PFFB 1Q0NA 1R8CA 2GZ7A 2WPJS 2ACYA 3VG8A 4LK4A 2BDYA 1NDPA 1UPMB 2ZJPQ 2Z3DA 4K4XA 5KT7A 1THRH 2QF8A 1QTMA 3A7YA 4WTOB 1XC9A 1HNZF 3UPEA 4ZCKA 5B0CA 4CH1A 3KUGA 1S6QA 5LSLA 2XYGB 1T05B 2WUBA 1ZPZA 1B0FA 4GO5X 2VU8E 1OY9A 1W0JD 2CPDA 4O44B 3BEGB 5JVGQ 5G0RA 1O2QA 1ABJH 3H5XA 3LPRA 1RWNB 1EETB 5JH8A 1YRXA 2HHWA 4UT4A 4W98A 1AMHA 4GUXA 3HSJA 4TU9A 2KTQA 1O2LA 3AQUA 2B9LA 2ALVA 1PG5B 1FXRA 3O1LA 2CNNB 4O9VA 2GAGC 3OBIA 2CJXB 3MH5A 2ZI2H 1BTYA 1C5SA 1X7VA 2W2NP 1GBDA 2FY8A 1BUIA 1FA0A 2DGQA 3LDXH 3CCES 1CPZA 4PG7A 1NB2A 4Y00A 9ATCB 1JLQA 3CB4A 1GQEA 3F68H 4PPDA 2J2UA 5J2NB 5IT0A 4A46A 1TV6A 1HNEE 5T14A 4ZPAA 4X2BA 2GMJA 1FRLA 4JZEH 1QPFA 3IO1A 1YLCA 4U84A 4J4NA 2BY8X 3AAVA 3P95A 3FCVA 2LXFA 1P04A 1RAGB 4M5GA 1O3HA 4TWYA 3M8QB 2OKQA 1YP9A 4X2XA 1F7ZA 1IWAA 3JAMY 1X4EA 2PHBA 2UUCJ 4ZLLA 4ER8A 3MM7B 4KP0A 3DLKA 2HPPH 1MMLA 4M63A 2PSXA 2F91A 4ZVFA 2DY9A 1FK9A 1IQZA 3E16B 4WY3A 4K4WA 3MOJB 4IO1A 1KONA 1MBQA 1GI8B 4BC9A 2P8IA 2ZHAA 4DR7F 3PYEA 2KVIA 1C1WH 1GJ4H 3A7ZA 1CBKA 1FKPA 4AX9H 4DT4A 1SBRA 4J90A 4C11A 2RAQA 1FKPB 1X4CA 5B6LA 5HK4A 3VB6A 2WK2A 5CYJA 1Q86T 3D4JA 4RNHA 2WAQD 2LXUA 1IBLJ 3KLEA 3R5CA 2ANKH 1EPTA 5J1EB 3MR7A 1YJTA 2OP5A 4P6QA 3MWIU 1XRVA 4C0HA 1B7FA 2H1UA 2AH4X 1FRMA 1GBTA 4ZKOU 1PAUB 5KT5A 4WJBA 3EGWB 4TYBA 5KFBA 1FE4A 4RJVA 5B8IC 3CCVS 3M5LA 2F4EA 5GIBA 4HHJA 5HROB 2LECA 3D1QA 2A7JA 3MU8A 1TV6B 2H4WB 3A8IA 3OSNA 3B9FH 1KKHA 3ZZ8A 3AS3A 2XZTB 2DGWA 4F8RA 1K1JA 4L72B 3N6LA 1T9VA 2D2DA 1SB6A 3G86A 4H54A 4MTVA 1UVSH 4V19J 4AE5A 4Y2IA 1H9HE 3MMBB 1MQ5A 4BCAA 1DWDH 5GCHG 2AMDA 4EWTA 3SV9A 2EW9A 2C3UA 2IPOB 5J6EA 4BXWA 1LCYA 5CCLA 3LP0A 2ZH2A 1NPMA 2M1IA 3HKJB 1RU1A 1S85A 3OVBA 4DV0J 4DIPA 1BGXT 1RGQA 1TX6A 4DFPA 1CVJA 4M8LA 3WQWA 2I0XA 4Z2GA 3BYRA 4YHHF 4WPAA 2AEMA 3PG9A 4B1TA 3PCOB 1XUKA 2HWTA 1C1UH 2G5NA 2WVBA 4OX7A 1IHTH 4PG5A 4UD9H 3PX0A 2IC3A 4TKTA 1Q8LA 4YR3A 1F1BB 2OBQA 2VDIA 2J95A 3K57A 1RAAB 3L7OA 9RUBA 2IM0A 1FFRA 2P2CB 1JLEA 1L1GA 2ZTZA 2CJYB 2U1AA 4RO0A 2AERH 5EIYA 1H73A 4LVNP 2YXLA 4LF6J 4RSPA 3UWJH 4M5MA 3ARWA 2D3ZA 4CM0A 4WWSA 1S6PB 3URCA 2ZCLP 5A6PA 2A3AA 4M5JA 3DD2H 4IFVA 3HZEA 3HXMA 3RXIA 3BN9A 4TW6A 3IA0A 1SC4B 2ANWA 2EFVA 1WDDA 5HLFA 2E1PA 4DUZJ 1HNVA 4USJC 1HNXF 1GL1A 3RXQA 1G7CB 2W2MP 4OJ1A 1ANDA 1JNTA 1FV9A 3RDZA 1K1IA 2ZGCA 2Q6CA 1SC8U 1S4FA 2W25A 3GE9A 3NBPA 4NCGA 3RXSA 5A8WB 2IUZA 2V0NA 1O5FH 2LA6A 4CLUA 1P02A 2CDRB 2IBOA 3LAMA 3I55S 1X9SA 1FKOB 2XHWA 3M3SA 2AKWB 4ZIWA 4LFBF 3P3DA 2GC8A 5ETKA 1GI1A 2AWGA 3HX9A 3IS9A 1FRIA 3M4XA 1RB0A 2BUNA 3KYFA 4ZAEA 3HVWA 2LEPA 2XO7A 1H2UX 2D9FA 5RUBA 3O5GA 3TGIE 1ELVA 4BHQA 4ZVTB 1S1WB 2IF4A 4UOFA 5AXKA 2QFIA 3DM2A 1GI7B 3UNQA 3H2LA 2TRMA 4ILMA 3E1XB 5FCRA 4L73A 1QUVA 1TL5A 3GCTF 7ESTE 1J5EF 1FKRA 2XHCA 5KG7A 2MQNA 2NQPA 2C2ZB 2C2MB 3I87A 4DV4J 2HWHA 4WH6A 2XZDB 5D4PA 2DK2A 4DX7A 3SFGA 3RLWH 1U09A 3FEZA 4I8JA 5DDQC 2UXDJ 4DG1A 2Z9IA 2EFQA 1GDUA 4DV7F 3R97A 1D9IA 2GCTB 2AYGA 2N4DA 3TJOA 1ZA1B 2OC8A 2TBSA 3W8PA 4NXNJ 3NZIA 4DR5F 2GT7A 4TVAB 2VIVA 1RTKA 3MD1A 3RB6A 1PBAA 1PYTA 4RW9B 4NG9H 1Y4ZB 3VGUA 1U4BA 5B6OA 1J15A 4I4BA 1CJVA 1V3XA 4Q45A 4JV5J 4DQIA 1HAZB 1NZ8A 1EDQA 1VCPA 2HGMA 2CJKA 3MU1A 1MD7A 4OX8A 1O34A 2BLQA 3MTKA 2LQ5A 4A8FA 1AVGH 4LSLB 2XULA 1HJAC 3V81A 1CQNA 1GHXH 2FLPA 3AHPA 2KHDA 1S1XB 3ARVA 4FVDA 2PW8H 2Y78A 1ETSH 1L1PA 2B7CB 3FAOA 4ZVQB 2WPKS 3DFEA 1DITH 3OTOF 1S6LA 1PYSB 3DRYA 2YPZA 2P9CA 3P8GA 1IOEA 3WD4A 4I33A 2AYEA 4ECTA 2BW7A 3QJPA 1UEUA 1D1UA 4WKYA 2IY5B 3I29A 3BB5A 5LJ3Y 2GT8A 2AT1B 3G87A 1GPFA 1GT8A 2QF3A 1W9VA 2VBWA 4KHMA 2ZH3A 3J7A1 1RJJA 3L7UA 2NU3E 2OD3B 3FRZA 1NTPA 1HMVB 4X6OA 4DSKA 2SNVA 1DT2A 5EXNA 5T3HA 5J2PA 3F2GA 1GCTB 2AFQB 1S9GA 3WX4A 1WEZA 3G82B 1XUFA 3U8TH 2ANMH 1SPBP 3AASA 1GEHA 2ZQ2A 5KT6A 4DOZA 1NK5A 2Y1JA 2XWYA 3FZDA 4X65J 3PKYA 1VRUA 2ZFTA 1FTCA 3N4WA 1TMUH 2Z2ZA 4D7GA 3MEGB 5L1IA 1EP4A 1JK9B 2Z2LA 3THVA 2J0SD 1B0PA 2OEJA 1MN7A 4LGXA 3GJTB 5HBMA 1G1XA 3T5JA 1FIZA 3TRGA 2A18A 2VC0A 2AHOB 5E3RA 2CWXA 4A1TA 2DNMA 4DMZA 2UUKB 2LLZA 3CS0A 2VQEJ 4C8NA 2RRAA 4NRUA 2V34A 2GD4B 1S4EA 1KLTA 1VKYA 8GCHG 3M5MA 5T7LB 2VQFJ 5KFUA 1YCPK 1FXYA 3MF5A 1E6PA 4CREA 1QB6A 1YATA 1XMBA 1BRAA 4H4OA 4MIAA 5KG6A 4ZVGA 2BANB 2NXNA 5GADU 2NU1E 1AZSB 1T31A 4DS5A 1FX4A 1FKFA 1LWEB 1MROB 1ZSLA 3BG8A 3ZZ4A 4UZBA 3E0NB 1M5HA 3V5RA 3K5MA 1AHTH 5AE3A 1LWFA 3JSRA 4DZDA 1KTTB 1C1SA 3GYNA 1F40A 3SU5A 2KN4A 3SBMA 2ZA5A 3MH7A 3A82A 1I94F 1BRCE 5GAEI 1WORA 2LXIA 5KT3A 3I56S 1MMDA 1W0KD 5DDRC 1Z8GA 4BAMB 2K7KA 1DANH 4BDPA 1E0FD 2YMSC 4DFKA 3LGHA 3ALFA 1QJ6B 4FF2A 3A7XA 1FKTA 3O5RA 2QV6A 1GI2A 2A31A 3PYFA 3ATLA 4NSBA 4KELA 5DO2A 2K3KA 1Q8KA 1VRTA 1M1KT 4DSJA 4P71A 4IDKB 4LFAJ 4Q22A 2V4JB 5AXNA 1IKXB 4NLVA 3WDOA 1PJ7A 6LPRA 3V2UC 3WL1A 2K2PA 3OLAA 1HIAB 3EYDA 2QO3A 2DT0A 4RNOA 3PMHB 4K8RA 4JI0F 3SW2B 4WKHA 3QTVH 1VJWA 2VPWB 2A45B 2OHDA 1KYNA 4CLSA 3UI4A 4PUOA 2R42A 3BN7A 3R1HA 3ET6B 2KZMA 1S48A 3C14A 3A7WA 2M8HA 4GCHG 3PIOQ 1CULB 1NJZA 2QMWA 1P2OA 4X2YA 4MNWA 5SZTA 2WK4A 2UU9F 1H0HB 4IGDA 3M32A 3BF4A 2DNKA 5DN6D 2ZPQA 4NLPA 1NUEA 3ZNUA 2QE7D 2DVIA 4ED7A 2DSVA 3UY9A 3OSPA 2EPIA 3MPWA 2R7OA 4I7FA 2KM8C 2OD6A 3JSYA 3GYMA 4W4MA 1B5GH 3T5LA 1KTVA 3BN4A 2BKNA 2YKPA 1KTQA 2Z2YB 2ZF0H 4R8TB 3T1YJ 1HNZJ 1X6LA 1NK7A 4K69A 3B8HA 4Q2MA 1YBTA 4HI3A 1EAIA 3TZWA 4IQCA 4LSZB 2YNFA 1BHNA 1ANEA 4C6AA 3TVKA 1O38A 2BDHA 1TCOC 1D8YA 4I0WA 3MH6A 4IC6A 2F9BH 5EQQA 5LT5A 3TH3H 1FFGB 3D68A 2ZM6F 1QUPA 2VA3A 2QG9B 3MDFA 3K6ZA 3J7ZT 1ACBE 4FYXB 3UREA 5TJXA 5D0HA 1RT5A 1YDLA 3KXDA 3FMBA 4M9FA 1ZJKA 1TL7A 3GJQB 4EO6A 4SGBE 2C2NA 2BE2B 3ZVDA 2I1RA 2X1AA 4OYBA 1RCXB 2XYPB 4J9MA 1U1KA 3PNIA 4X66F 1FO1A 1SKYE 1GOIA 4LVOP 5IQ6A 4JV0A 3AJDA 2G0JA 1HWJA 5L6NH 4TY8A 3THPA 1NK8A 1QTFA 2C3OA 1KNZA 4LF8J 3KYLA 2W9AA 4B9LA 5HTGA 4AOQA 2A32A 3RG6A 1EX3A 2YVSA 1DQ9A 2ZEBA 1HHQA 3NCQA 5GDSH 4C8MA 3F44A 3ENAA 3AOCA 2VOPA 2K1QA 5JJBA 1YLDA 1NH6A 2MY8A 1AUSL 1MTVA 4C2MA 3OJUA 1LKBA 1L1JA 2FIRH 3IMQJ 3MAAB 1VR6A 2GTBA 2QN5T 1MAYA 2FS8A 1PBKA 1ANCA 1WCZA 1P1TA 1X7AC 2KB2A 2VPXB 4PPZA 3PACA 4OYWA 4L75A 4Q44A 4CP5A 1SLWB 3JYTA 4XFQA 1SGDE 5FPYA 3FOAA 1O2HA 2OPRB 4YO9A 1RTJA 1TFYA 3MPYA 4AFSA 2WZ1A 4QBUA 4HZHA 5E0HA 1TGCA 1FWLA 5E2OA 3AXKA 1K1LA 2ZM6J 2OJ3A 3NCRA 3TWZA 5GAGI 4IQXA 5GPIB 1NS3A 1W3CA 1QLNA 4Z6AH 3GV7B 4I8LA 3AQPA 5E5NA 3BTWE 2QF5A 2WSCC 4DHVA 1N6QA 1C1MA 2XSJB 4G1QB 1UWBA 2Z3CA 2YX1A 4ZPDA 2MQMA 2HIYA 1WOPA 1RHKB 4MKAA 4CT8A 3JAMU 1D0EA 3RXMA 4CBNA 4NA9H 4YXWD 1DHMA 2HOBA 2HQFA 2UZ5A 2EI8A 5MAOA 4AL7A 4QT3A 2GVZA 3TEHB 3S6EA 2E9ZA 2DR8A 8ATCB 3KAFA 1VJAU 1S81A 1NBMD 3VGCC 5TCCA 2WV9A 3JTPA 1P10A 1A0LA 4P8UA 3D0HE 4M5DA 1IM4A 5A8KB 1HQUA 4A8QA 3CSKA 3UWIA 3JTOA 3IITA 1G2MA 4OZ3A 3PW4A 3U98H 3QFWA 1P2JA 4DV6J 3SQHE 1D4PB 3RC5A 2XQCA 2FJWA 4KE5A 2LPVA 3NNCA 1J4RA 4ZVHA 1Y5NB 2XBYA 1W25A 3AA8A 3QLHB 2KAIB 1PPCE 2DUCA 4A47A 3H4DA 3G8SA 2A10A 2GJGA 3A89A 3CNRA 1ELGA 2OGUA 3K17A 1H4WA 2DNRA 1UEVA 3AJ2A 3VGSA 3QSYB 2EY4C 2FP7B 4JI7J 2ZFPH 3E3XA 3B7XA 3M9NB 1Q1CA 2MY7A 3FVYA 2BJ9A 1SQFA 1S1UB 1UK2A 4BTUB 4NEZA 3TJ8A 1LG1A 2KYXA 4Z2IA 4F3MA 2JIZD 5HQLA 2BOHB 1RT2B 4QT2A 1W0ZU 1RBOB 1O2NA 4JYAF 1CA8B 2PDAA 1ZM3A 2HLUA 3C8YA 2JH5D 3PW0A 3AW1A 3PRVA 2BD4A 2GZ8A 1M5PC 2BDPA 2PKAB 2A3JA 2FYRA 2RQ4A 2G9OA 3AJ1A 4WE1A 3PFOA 4ZHLU 4FXWA 2VKZG 5PTPA 4C48A 1GBEA 2ODYB 1KXEA 3CO9A 5HI7A 4B3TJ 2QF0A 3AT1B 3BKTA 1GH8A 1DTTB 1X31C 4K4UA 2MHEA 4P7VA 1XKBC 4MMOA 2VGCC 4UFDH 1ZBWA 2RILA 1MZDA 2ZZNA 1N4LA 2FX6A 2V2QA 1UVUH 1C1RA 2STBE 3NAHA 1A2CH 3F6UH 4WE1B 3SDEA 2F9DA 3QO6A 4DOQA 3ZTRA 2R2TA 4MNXA 1YF4A 5GMDA 4FXGH 3K8WA 3ZZYA 1Y3JA 4NMXA 2ZQ1A 3RU4E 4CYUA 3AS2A 2CZ9A 1GJCB 1H0IA 1QGFA 3BKUA 3MM6B 3JZ1B 2Y7ZA 4B3OA 1AFIA 1R8AA 3G6XA 3CJKB 2V6AA 5DP5A 5AHGH 2BX4A 2XSJA 4G1QA 4ZP7A 1Q1KA 3AODA 1N6QB 2YKQA 2A5AA 2XRCA 3K58A 2J97A 4B75A 2Z9KA 1MKXK 2NXUA 1E35B 2OPPB 1FY5A 2Q43A 3KHRA 4WH8A 1NMWA 3TJUA 4WMEA 4X6MA 3O6QA 2CJBA 3HGNA 1VIXA 2OPRA 3B8JA 3TUPA 1DPOA 2Q1JA 1N1LA 4ZHAA 2ZD1B 3FSYA 1MNEA 3FBCA 3JSMA 1ZZNA 4Y6IA 3W2VB 3NL0A 3L95X 3CP7A 4EYHB 3LWMA 1APSA 4YOJA 2WTFA 2BD7A 1NO8A 1FDPA 3QGJA 3VVUA 2WLYA 1R0AA 4WP8A 3DN9A 3UF8A 1C5LH 1S83A 2HBZB 2GVZB 3TJAA 3EVWA 4O4GB 4FF3A 1S6UA 3C15A 3SMZA 1QQ4A 1NZQH 5CMXH 2WPIS 2WZQA 4O3NA 3UR3C 3H7TA 1GVZA 5CYQB 1ESAA 1TRNA 4UQTA 1DS2E 4TSFD 3KK1A 3T1YF 1C1VH 3Q8VA 1VQSA 3O5IA 3EY6A 3EX7B 3KK3A 5FIIA 5F8HA 2Q6DA 1U1OA 4Q8EA 3NTPA 5LMUJ 4OS6A 2FPZA 3VGCB 5C5OA 1RS0A 1P57B 1N5QA 3HHKA 2QT7A 4EZ9A 4OGXA 2VFUA 1V2ST 1UJ5A 3GY8A 1U8SA 2RKIB 1EJNA 1TL7B 2HNDA 5KFMA 3HK2A 1EKBB 1V5VA 2BYCA 3QT7A 3A8EA 3SQEE 1DAXA 1TNJA 4DRIA 4JI2F 3R1LA 4KB7A 1TL1A 4R8UB 3D6FB 4DU7A 4NLQA 1H8ED 2CPHA 2SGPE 3ZZOA 1MKWK 1HJXA 1UVIA 2DPJA 1OHHD 3MNXA 5D0EA 5KFKA 2BRKA 1BITA 1Z1JA 3KJQB 4O3PA 1P05A 3PLPA 4DFJA 3AB2B 1PPGE 4ZXXH 2PEHA 4X4RA 5EQRA 1WTGH 2F9NA 2ZIQH 3CIMA 4AXIA 3PR9A 1IBKF 5G4DA 1FKSA 4N19A 3CJ0A 2BKPA 2K3IA 1EB1H 1A0HB 2QJ3A 3UD5A 2SGEE 5K14B 4AGKA 3PWCA 4AY1A 4LR9A 5EW1H 4ID5B 2F9PA 5B0EA 3MURP 3D0IE 2W3KA 1URRA 1PKUA 2F21A 3CCSS 2DPIA 2PA8D 5DDPC 2XXLA 5A8XA 4X64J 2IDLA 2ASJA 5L2YH 2ZP0H 4DPYA 4B9NA 1Y11A 2O8MA 4THNH 2BW2A 2OH2A 4U8VA 3QGPA 3KCGH 2MTLA 5HMZA 1UVOA 3MR5A 3GIMA 1W14U 3MEEB 4FKXA 3SORA 5F0UA 4DN0A 3PX4A 2VWOA 4M5NA 2O9OA 1R0CB 1PYTC 3UO0A 3SGQE 2SGAA 5C67A 5BR8F 4DR6J 3ET6A 1O6XA 3GDSA 2XNDD 4ABAA 3K89A 4PUOB 2DEJA 1GMHG 1XMOJ 3FFGA 4U7CA 1N5SA 1O2SA 4B9VA 5K20B 4XRNA 3CJ4A 1J5OB 2L41A 3RM8A 2QYCA 1RAIB 1J16A 1BMAA 1CC8A 2GNKA 2YNFB 2KYZA 2GX4A 4ETXA 1NRRH 3MM5B 1NJXA 2ZZTA 4JP8A 5B0DA 3QZQA 4IG3B 2ESTE 4IN2A 1Y8TA 4ODNA 2IJFA 1FLEE 2OC0A 1OWIA 2ZUAA 4OX9F 2I5JA 3RBXA 1OX1A 1GJDB 1SB1H 3A3NB 2CPEA 4ELVA 2VPZB 3QJLA 1DQ8A 3KJNB 4NGAH 4LXBH 1TPPA 3FZBA 2OEMA 3SU2A 2ANYA 1WUNH 3FFIA 3I82A 3ZVCA 1KVJA 2R4FA 5KAKA 3M32B 3U1LA 4Y34A 1GDNA 1HBOB 3ODFA 1ETTH 1KXBA 4ABGA 1Q8IA 2J6SA 4J9UE 2FM2A 1LW2A 1RQ0A 3P5TL 1F9HA 1WG4A 5F53A 2HMIA 3MAQA 1MTWA 1HW9A 1FY3A 3F41A 2W7SA 5B7WA 2F8HA 1PQ5A 4D9QA 2HBQB 1LHGH 1SGEE 1VHIA 2DY1A 1O39A 2QLWA 1IKXA 4TNOA 4UEHH 4N41A 5J4SA 1R6VA 1WKKA 2DXEA 4IS5A 1FY4A 1DFPA 3PW2A 4Q4LA 3TANA 4OMFG 1RHQB 1TABE 1FCAA 1TOMH 2HLCA 3PJWA 1OSCA 5E0OA 1O2ZA 4LQ9A 1M90T 3GPKA 3VALA 1A5IA 1C2EA 3HKZD 3M35A 3TNVA 3W9HA 4OS7A 3ARQA 1G6BA 2FYQA 3DI6A 3BS9A 4WIQA 4IT4A 1JLAA 4UFGH 1H98A 2XB2D 2UU9J 1TQLA 3EVMA 1WSVA 4O4RA 3H2VE 4ODPA 1B6CA 1Y5IB 1A1RA 4OS4A 1LW0A 2DRDA 1VQ6S 3ODKA 4A7IB 2DGOA 1K9TA 1LVBA 1EASA 1U0SA 4P10A 3GY5A 2DNOA 1RXPA 4HTJA 4KGMA 1C5OH 2DXDA 3RMLH 4ASHA 4X8UH 3M05A 1KQSR 3G6YA 4DRJA 4ZDNA 3QO9B 1OS8A 2BANA 2V4QA 1X4FA 2FODA 3IRXB 4ZPBA 2XP8A 4PXCA 1SL3A 5HJYA 1X9MA 5T7LA 1XUIA 4ZN1A 1RT6A 3GYXB 1NSAA 4LT6A 1WTFA 2Z9GA 3O5OA 3I9ZA 5A0YA 5LMNJ 2ZWLH 1M5OC 1NFYA 3LOUA 4RL1A 4QOTA 1EP4B 5KFNA 3TI0A 1TA2A 1FY8E 1VRUB 1OSSA 1C5TA 3DGPB 4IMZA 5DETA 3NUMA 4JFLA 1UK4A 1FKDA 4HARA 2GZOA 3M8YA 2RDJA 2QL7B 5E0GA 1WELA 4RT1A 2FKEA 1SL2A 4ABDA 4USKA 5DG6A 1UTJA 4OS1A 4N5SA 4WBFA 1IQIA 1MTUA 2C3MA 2KXNB 2DCLA 5DEZA 5IFMA 1TNKA 2DBBA 1HL6A 3UR9A 4Y2AA 1LHFH 3TEGA 2WVFA 4ES1A 2H1YA 2ZCHP 2RU9A 3UQBA 2MF9A 1S0VA 3SYZA 1C1BB 1HQEB 4TQRA 4EFAC 3MO6A 1W26A 1O30A 2FOGA 1SL0A 3V13A 3OL6A 1YPJH 1WNOA 3LWLA 1F9EB 1P03A 2CAJA 4ZUHA 1BA8B 2EC0A 3PZPA 1TLDA 2KI3A 3OJSA 2DG9A 5L1LA 5ESBA 3GIJA 2FI3E 4KRWA 3SZEA 2VWNA 1D7IA 4URQU 3OFHA 3TQ1A 2E44A 1Q82T 1VQ8S 3M3TA 4KH0B 1VITH 1VOMA 3QGGA 3AD7C 1T32A 3KHHA 4F36A 3OY6U 3M1VA 3C19A 4UE7H 1TAWA 3WBZA 1WHXA 2ATCB 1OPZA 4DZ3A 2DT9A 4E2FB 5DGBA 1DM4B 3ARSA 1N5YB 5C5JA 1P9YA 2ZPRA 2B0GA 2AIPA 1KOHA 3I4PA 3KLFA 5GAHI 2B8PA 3ATWA 3U8RH 5EOKA 1QHRB 4F02A 1S9EA 4KGXB 5ETMA 5JMNA 3PRAA 2Z8QA 4OZLA 3GY7A 1N88A 1Q6IA 2BJ1A 2GIRA 2AS9A 1S5ZA 1G32B 1TL4A 3S7KB 4C8OA 1KLIH 1UW7A 4UDMA 2NSCA 2E5JA 1SCJB 3Q83A 3KG0A 2AF6A 1L3VA 2VH6A 3O5DA 2MGZB 5F8LA 2OBOA 2AJ1A 3ZZDA 2IMOA 3LKWA 1JWTA 1H6KX 1AO5A 3EMTA 3CD5A 2ZHBA 3CCJS 3UFCX 3KNAA 5CZXA 1AVWA 5FX5A 1W7WA 1O3DA 1QAXA 3KQBA 3UIRA 3MMAA 3K8VA 3EDXB 3BV8A 5B0BA 1EFRD 1WC0A 4I56A 3OFND 4IG0B 1ELEE 1SKWA 4FPIA 3TITA 2V8PA 4WZMA 5T6GA 3ZZ7A 1Z6EA 2W4CA 4K59A 1WYKA 2FVQA 2G81E 1NDKA 3DYAB 3MMBA 1DSUA 2Q5AA 2FTMA 2B5TB 1HNVB 2PEBA 3Q8PB 2JETB 4MAVA 2JJ4D 1S97A 5FL7D 3OR1B 4LBIA 2AYBA 4IC5A 1OP2A 2DSWA 3RXCA 2F9VA 5HWBA 2WCXA 1O0DH 1AW0A 4UFEH 1L3SA 3A7VA 2UUCF 2CK3D 4RNNA 5DQHA 2GGPA 3P45B 1FN8A 1Y3YA 1HKIA 3HVTA 5HROA 3H59A 1K0HA 2I9SA 3PTBA 1O32A 1QBOA 3PLBA 1ROUA 3AQOA 1EQMA 2QLBB 2QN6B 2VV5A 2RF2B 3LH1A 2ROPA 3GY4A 1SV5B 4XTTA 4KH1B 5D75A 4PQAA 1Q7YT 1GXLA 3KIDU 3IKDA 2QA2A 1E6VA 4UTGA 1HLWA 5T6DA 3CGNA 3HSZA 1ZAVA 3MO9A 3MMCB 3VCDA 2LP4A 5KGOA 4ZKSU 5KFQA 2KRBA 2X3GA 3DOMB 4HBOA 2L48A 1MMJN 3MPVA 2VGCB 4DCJB 3LP0B 4USWA 2V69A 2DITA 4DRQA 2XCFA 1R8HA 5KG4A 1FKKA 4F4AA 5LSRA 2HZAA 5D8HB 3HPTB 5J2MA 1KSPA 2YQ3A 1FJDA 3LGMA 5KFIA 5CHAC 1WF1A 1BL4A 1FRJA 1HBTH 1NKEA 3M7QA 3CJQA 4ILRA 3QFHA 3M6XA 4FETA 2YKMA 2P4VA 1VQKS 4AZ2B 4MQAA 3HMJG 2MYFA 1CQMA 4K4ZA 4PEOA 3ULHA 5F8TA 3PKMA 1TBRH 4MPWA 2NXEA 1H9IE 2VIWA 3GISB 1P3CA 1RWPB 1HKKA 4YESB 1VR1H 2O8TA 1IJEB 3UDEA 2STAE 4GVBA 3BZQA 4CLWA 1JLQB 1MKXH 4UQGA 2OIHA 4KPYA 1CJKB 1NPKA 1GVLA 2KHCA 1S10A 5GCHF 3SI3H 1LPKB 3G6LA 2NPFA 4BXSA 3ZXWA 4YHHJ 3P6YC 1NBME 2ZBIA 3MO3A 3DA9B 3G96A 1FJCA 3PRBA 3MM8A 1A9NB 3UQOA 2KT2A 3DLEA 2DEIA 3VQTA 1C5VA 1GMDG 4I6WA 2W7AA 1O5JA 1QVFR 1A4WH 3HT3A 1PGZA 2BM1A 1PQ7A 1AE5A 1HXFH 1TALA 2A0QB 3DOMA 2CADA 3M8RA 2BD3A 1S59A 4GGQA 2J6UA 4ECVA 1HHSA 4ZXYH 3NNAA 4F4XA 1YITS 1EQ9A 3QT8A 4I8KA 3RM2H 1UMJA 1GK8A 3MMCA 1T8OA 2C4FH 4WP3A 3HFVA 2YWEA 2DKOB 2PSZA 4NZLA 4ISHH 3P49B 1HFDA 2GFFA 3W62A 3EA7A 3O8CA 3H09A 2B0FA 1C5YB 3EAJA 4WKFA 5GQBA 2HRTA 3M8QA 1S0NA 1RT3A 1NC6A 1W12U 2A3CA 4DR1J 3ARTA 5BRRE 3AW0A 3Q8RB 3D7SB 1W11U 3H42A 5FPTA 4WXWA 3M9OB 4Y71A 1A5GH 1TAUA 2Z0GA 2W24A 2ZZMA 5M2UA 2J8AA 2G8ZA 4U8YA 2IRUA 1SL1A 3I77A 4LREA 2E9RX 3SHAH 4FP9A 3MCNA 2NXJA 2YWHA 2IYGA 1K8AT 1CO7E 4IRDA 4WZQA 3UDVA 1FX0B 4OIXA 4YOEA 2QV1A 2AJ0A 1A0OB 1HLTH 1O5CB 1C1TA 2KKHA 3LONA 2Q6GA 2D74B 2XMJA 1CJTA 2UUBJ 1LL7A 3LGIA 7GCHF 2BX3A 4DV5J 1EETA 3PFEA 3UB0A 1Q7LB 3OTDA 2D7SA 1MU6B 4ABFA 1KVKA 2HPQH 2XP3A 2YKOA 1MCVA 4KT0C 4P8VA 3L09A 3OQ2A 1T05A 1K47A 1QAIA 4LAVA 2OELA 1S6QB 5E7OB 3DRSA 1YPHE 3TGKE 2X51A 4DR3J 2VG7B 3QSIA 1QM9A 1GI6A 2R2UA 2MZ1A 2OINA 1WAWA 3STIA 4OI3A 4KKDA 3FBBA 2J0WA 2H3EB 2QY0B 2NLWA 2PGCA 4TW7A 4F2SA 1N1AA 1SUQB 4AYBD 4H42U 3I0RB 2WBRA 4RKUC 1RHUB 4FYYB 4ZPWR 4QR0A 3GOVB 2HNTF 4PROA 4ID8A 1HDTH 1S9EB 4AXJA 3BV9B 3G4SS 4L76A 2RVJA 5HP1A 1C0UB 3QT6A 3TAMB 1IR1A 3KLFB 1T4VH 1F5RA 1SGIB 2B9YA 4DRMA 2B4UA 1C2MA 4ZK7M 2RUCA 2GIFA 2AMQA 4N56A 1LOUA 2DGVA 2RUGA 4MYUA 3P8BB 3QRQA 3M1VB 1O3KA 3SZ2A 1ZM2A 1F6TA 2ZH9A 1WDIA 1JIRA 2ZC3A 1K1PA 1TR0A 5B0AA 2HFVA 1C2KA 1C9TA 5C7PA 3SQGA 2LQBA 1Q6UA 1ZHRA 5KG2A 1QFKH 4GKJJ 1P11E 2KXHA 3OTPA 5F8MA 4PWUA 1H7XA 1ZMJA 4NMLA 1HD1A 4FUGA 4CBOA 4FUHA 4UOGA 2RUQA 1G3EA 3T25A 4UONA 2KJVA 1SOTA 2X1GA 4LJMA 3VV2B 4C3KA 2OPQA 3DNCA 1HJ9A 5EX3A 3H5SA 2FHJA 1LWCA 3BSQA 5DM7Q 2VC1A 4LF9J 1ZS6A 5F8IA 1J4HA 1LK7A 5C2ZA 1EZSC 1VS3A 2KCAA 2ZWPA 3PYDA 2KM8B 4K50A 1R3NA 3SCKE 1WSSH 2PGQB 2R8JA 4P75A 4XBBA 2VZ9A 1EPTC 2ZC9H 2DISA 2LU2A 4DPTA 3A80A 4U67Q 3ILOA 3UN2A 3FSIA 2J98B 1A7SA 2XY5A 2G4BA 3QN7A 3RXLA 2UUFB 1AROP 3H4BA 4BTIB 4MDSA 3AK5A 4GSOA 1BMQB 4U86A 3D3CJ 2G0CA 4RW7B 1L0ZA 3BEFB 4RKJB 2C28A 3BBBA 1HRTH 3TDBA 5KG5A 1Q3XA 3BMBA 2NU2E 3PRDA 1X5PA 1HR0F 3F9HA 4B02A 4X2WA 2ZDKA 2QA1A 1DJ0A 3ZTPA 2HVEA 1EXFA 4QQBA 3DXBA 2HFOA 3MCMA 2TGTA 1SHHB 1U45A 4HEA9 3GIKA 1WHYA 1DXWA 3LIWA 3R8YA 4B3MF 1JXVA 5AXMA 1SQGA 2E66A 2HQ3A 4MPKA 4DXLA 2DNZA 2O01C 1GPZA 2PPPA 2V8DA 2X1FA 2MQQA 3OU0A 4WTYA 2YX4A 5LJ5Y 1AZZA 4OX6A 2XGPA 1TRYA 4E7RG 1AIXH 3VEQB 1TGTA 2AX0A 5A2QY 3J7YU 4AN7A 1YJVA 4F04B 4PQUB 1VF8A 2OCVB 3OXGA 4CHAC 3OA5A 4UZCA 2Y7XA 3W5XA 1KEKA 4ODKA 2DG3A 3L3TA 3CHFA 1AXQA 3M2RA 4XK8C 1OQ3A 5DG8A 2PFDA 4KO0B 2EULA 1NSGA 2FLLA 1GHAF 3LJJA 1O2JA 1KLMB 2WB4A 1GGDB 3M2UB 4NA2A 3HHNB 1O3CA 3BPSP 3S9CA 3DT0H 4K1TA 1Q78A 3TVZA 2D1CA 1D9DA 2VPYB 4B9MA 4HACA 3HCXA 1F0RA 2Q66A 3W95A 4U96A 4CNYA 4C8KA 1Y3WA 5KFEA 3EPIA 4J9NA 2J9EA 1SC3B 1T8MA 4JI7F 1TAQA 4AGJA 3ELAH 2CPIA 4J1YA 1H7WA 2QLJB 1OOKB 1K1NA 4NOHA 3FEXB 3M6WA 3D6HB 2KGJA 4DSFA 2ZJQQ 5GJ4B 2OFHX 2H9HA 1D3QB 2B9EA 3EGZA 1MU2A 2W6JD 3SV8A 3OD2A 4URIA 2CPXA 2FOBA 1JLBB 3BTME 3IXQA 1DZ5A 1LXNA 4F4WA 5F8JA 3T28A 2QRRA 2O8UA 1WC4A 4QIGA 4ECZA 3CULA 3MR6A 4U32A 1VBYA 3DLGB 2F9UA 1SI5H 5A2MH 4R25A 4J2YB 3FFIB 3LW5C 3P96A 3GONA 1S77D 2CNOB 1O36A 1G2EA 2HNTE 3UDCA 1E15A 5M2RA 4KQZA 3OUYA 4ED1A 3RXAA 3TZYA 2ZZUH 1AFJA 2GJ2A 1Q95G 3BTGE 3M30B 2W7UA 1Z2ZA 4WYWA 1OMSA 4KTCA 3M9MB 1O3MA 2HHPA 4CH7A 5CHAB 4RUHA 3D28A 2XYHB 1IXKA 2JJ2D 1UCYK 1ICEB 2MEWA 4FU9A 1T9WA 2ZDAH 2FVSA 4MKYA 2KO7A 1J5OA 1T7PA 3W9IA 4ITSA 1GHZA 1T0TV 1HAXB 1PC5A 1Q5VA 2EFPA 4Q5VA 1E1RD 1SKSA 2QC3A 4OHWA 1N54B 3Q8UA 4DJZB 1ZM9A 1FY1A 2RDIA 1RHJB 1MWZA 3R5GA 2DR5A 2JVOA 3K5PA 3KJFB 4X4PA 1N36J 1CU1A 4OQJA 2PTCE 3A8BA 4Q7ZA 5HW6A 1JLFA 1FFQA 3W5YA 4TYOA 1JNZB 2UUJB 1XNRF 1QJ7B 2XLJA 1ZTKA 1RTIB 3AROA 1TUVA 3DGVA 1AYEA 1HHTP 5HMWA 1TYNA 2IOTA 4X6NA 4WK9A 3V6HA 4FXVA 2UVWA 1GXUA 3KACA 3IR5B 4DRNA 3ARYA 5DQGA 3RC4A 4I31A 2C22A 1HAVA 5K14A 2R9LA 4MAKA 3WWBA 4OS2A 2RS8A 2BEFA 4LBPA 4GPGA 3OAAD 3MDYB 3KL6A 2CQ3A 1T03A 4W92B 3D65E 1LEOA 3MI7X 3NS7B 4NYOA 1CA0C 2M3DA 1V2OT 3JYJA 3RM9A 3W63A 1YPMH 2G4UA 3RU0A 1MAXA 2IJD1 2M4MA 1RTDA 3Q00A 5F6MA 2DRBA 2FLRH 1NKBA 2BD9A 4RW4B 3DMJA 3E51A 2ZU4A 3BKFA 3BH7B 3GB0A 2R2SA 4B3MJ 2OXSA 1LVYA 2XPBA 3W94A 6CHAC 4BAQB 4CH0S 1G2LA 2A0FB 1MLAA 3DRXA 3ATIA 2RKIA 1ZPVA 1N32F 5IWAJ 5A2QU 2PV3A 3J81U 1DRZA 1P27B 1XM1A 4JI5F 1QA7A 3TCZA 1B99A 3CS7A 2C3PA 3UTUH 4NA1A 4D3HA 3PO1C 1TKTB 1ESTA 1FWKA 3I31A 1GWAA 4OZ1A 1Y00A 5KFTA 1RD6A 4N8OA 4OI0A 2C2RA 2OTJS 3M2RB 2MZTA 4FAPA 3A8KA 4ABEA 1UVTH 3DUXH 3G8QA 2QA4S 2DTJA 1KLNA 2FX4A 4WU3A 1JLBA 4TNSA 4MNJA 2NUUG 4PQUA 2VWLA 4F2RA 1R8BA 3N6MA 1CS4B 4ZHRA 1U48A 2ZR4A 1H72C 4N7TA 1P2NA 2M5TA 4Q7XA 2RS2A 1MUEB 2DNPA 1CTNA 2BA9A 1VQ9S 4O3RA 1C2DA 3O44A 2FEQH 1O31A 4R0IA 2HK2A 3CENA 2ZD1A 1PPZA 4WF9Q 1R8PA 4H4FA 2BQ6B 2RSQA 3PXGa 4DVAU 4ZN3A 1NWUA 2GCHF 3IN5A 1F8AB 1S0RA 3TA1A 2OPPA 2F83A 3DU5A 5FBIA 3GLJA 4MK7A 2XEXA 1QNJA 2QGRA 4FF4A 1VI7A 3M2UA 2R0LA 3LUOA 3RXPA 4LAYA 3FZZA 1O5BB 2RUDA 4QPXA 4L74A 3UD4P 1WG1A 4DPOA 4KBIA 2Z56B 4ZLPA 4CO0A 3E2EA 4KKOB 3CJKA 3PV4A 1RT4B 3CGIA 3BTKE 3HK3B 1Y5UT 3EWGA 1F5AA 4LFCF 3SNAA 3LT3A 1OYEA 2FDNA 1LO6A 2BOAA 1K0VA 5KEDA 4CTAA 2DNYA 1Z71A 4IOCQ 3FY1A 1WTBA 1O2PA 1RP5A 1C0TA 4FU8A 2ZFHA 4L3KA 2BOKA 2PV1A 2GX8A 4PXEA 4CO3A 1NK4A 3C27B 3PEHA 3HULA 3V6DA 2D9OA 2XGQA 5JDUB 1N5VA 5AJ3J 2H54B 2IYIA 2N3LA 1ARCA 4FPRA 2C3SA 3QT5A 2WSSD 1FJSA 1O2OA 1DTTA 2MZJA 3PEJA 3HVRA 2QF4A 4FOUC 4ML4A 4RNFA 2BRLA 5D4NA 3AAWB 1LQ0A 4ACBA 3RXBA 2ZGXH 2FI5E 3F2HA 2MLYA 4LF7F 1S7HA 3WC2A 2DIUA 4ZMMA 2HVXA 1SKRA 5EN1A 2AOSA 1WC6A 4JZ1A 1MG7A 3CJRA 1FKHA 1BZXE 3GS9A 3DFLA 3L33A 4BAKB 1YX2A 5IWAF 3JS9A 4XO0A 5IM0B 2VQEF 4IH6A 1RTHA 3M8PB 1UVLA 3PM9A 2H51B 3OSYA 5FPSA 3MM9B 1NDCA 2CHAB 3CCTA 3ZZ9A 2C8ZB 3WH0A 1O5DH 1ZBVA 3SGAE 1H0GA 2RCEA 3S7HB 2QIFA 3Q3KA 1DLOA 1W13U 2V9WA 8LPRA 5F8GA 1LWCB 4RWWA 1GBJA 1UCNA 3MTYA 2R3VA 4A4JA 3FEYB 4Y8XA 4L6V3 3RUOA 3WKZA 2H5DA 2IM1A 4OJHA 1YJ9S 3PLKA 2Z6BD 3RXJA 2QL5B 5J2QB 2HS4A 3ITHB 3FO8D 1JLGB 2A2QH 3KFWX 2EBGA 4U85A 3CCRS 4ZCIA 2XMVA 2AYWA 5H9FJ 1CHOF 1I51B 4OGYA 1BTUA 1G30B 2RQCA 3GJRB 3MEDA 3P6ZB 3Q8QB 2B51A 2N87A 4P2FA 1T3NA 1SPJA 4PYDA 5E2QA 2CDQA 4F4ZA 3Q76A 2ZQSA 1KBRA 3GY2A 3M2VA 4D76A 1WOFA 3A1YG 1J14A 2HPUA 2K8GA 5LOQA 1UWBB 2VNTA 4ZA1A 4EBEA 5EPYA 2KFZA 4DQQA 2VVVA 4ZPTR 5EGYA 1K1MA 2HFZA 2POKA 4CRDA 5D6GA 3CJ3A 5G4BA 4WIIA 1AY6H 5JPMH 1VJ9U 2CQ1A 2WONA 3A84A 6FDRA 1SUQA 4NASA 4WFAQ 2ZG0H 1NH7A 2AD9A 1YJRA 3RTVA 3A8DA 5T6FA 2TGAA 5ETQA 1RUSA 1ZTWA 3LOXA 1ZETA 2MQ8A 3RBEA 2ROGA 3SJ8A 1XJWB 1F60B 1HV7A 3H2UB 5BJRA 5L38A 4UFFH 1GMCG 4C3LA 3RR7A 3DRSB 2CVEA 1BKFA 1V2MT 3LH2S 3B78A 1E6NA 1IQFA 5K7RA 1O2VA 4HKQA 1W2BR 3P8FA 5E8EH 1ULRA 1GJ6A 1VDHA 3FMWA 3MAAA 3ZVBA 1UK3A 5GAHU 4RNMA 3RXDA 3C6UA 3FQKA 2JEIA 2YNHA 1O3PB 4NLTA 4KV8A 4EEYA 1ELDE 1VQNS 1TVRB 4P74A 3DLEB 3PROA 4ALZA 5I4MA 2CV3A 1IQGA 4UOHA 3NGSA 5F0WA 5C0UA 4XDDA 3KK2A 2H5JB 1WI6A 4I8HA 1HJWA 3G6ES 1CJKA 1R31A 2H5IB 4K4SA 1ZK6A 1KT0A 2HQCA 1WJ9A 4AD6A 1NK9A 2V8HA 2B8QA 2XYAA 1T3OA 3FCWA 3TA2A 5C20A 2OPSA 3MR2A 2IAJA 3Q8YA 2Q6BA 3BIVH 2DNNA 3ONQA 1U1MA 1JXPA 4FNHA 3GG0A 1AB8A 3A83A 1JXEA 4DUTA 4DRPA 3BH6B 4CLLA 3G8TA 2YKMB 3CH9A 2AGPA 1ORFA 3D49H 1U26A 3J80U 4I68A 1YVFA 3F9EA 2ESCA 5C94A 2OQUA 2XW9A 4ZHMU 5CABA 2J92A 2W2QP 1XK8A 4WXOA 1Z8RA 2XP5A 2QXIA 4FUBA 3NY0A 1P2IA 2FVCA 5AFZH 4X4TA 5HYOA 3MM8B 2BJ8A 3GJSB 4ZVPB 4OZ0A 2LMIA 3WL0A 3RB0A 1R9HA 1GBAA 4FVBA 1EKRA 3EM1A 3W2WA 3ZFVA 1G3OA 1WI8A 1LHCH 2EQNA 2CIMA 3S8SA 5H9EK 2C8YB 3U1IB 3ALGA 2KI2A 3A13A 4O0IA 1O5GH 4ZPCA 4X2VA 3DSGA 1E6VB 1AI8H 3U1JB 1SV5A 1W10U 3OPKA 1OWJA 1X4HA 2FHMA 1QIXB 2RF2A 3UNSA 2CXEA 3KLIA 5CDFE 2AZ3A 1Z7KA 3QRPA 1F5CA 4B9UA 1SJQA 5KFHA 2BB4A 1CGIE 5A0AE 4P2XA 1V2VT 2WW4A 1FXDA 2GGPB 4TYAA 4FF1A 4ESTE 4ZP6A 2R2WU 4C7QA 4QWDA 1NRQH 4OYIA 1LL6A 1FFSB 4BBYA 1FESA 2IPQX 2ALPA 3R5JB 4WVPE 4ECXA 4ABJA 3X1LB 1WC5A 5J2MB 2V2ZA 4OJGA 2FLBH 4RLEA 4OV1A 3Q89A 4EUVA 3N7EA 1VGYA 4MVNA 3NGKA 3I9V9 2AGGX 2XC0A 3B54A 1RBAA 1TGBA 4PKDB 5IXUA 1GAOA 2ALYB 2CG4A 4S0MA 4MG3A 3ARUA 1U79A 5F03A 2I6SA 2JL9A 4VGCC 2DG4A 4H4MB 4ENOA 4AQYJ 1T9XA 2XWAA 4PR6A 4DX8H 2E9TA 4KSEB 4A8WA 3NXPA 1SC1B 5T41A 1VJQA 2UV8A 2HHVA 2ATLA 4RU9A 2MGZA 3EXCX 3F1SB 1GX6A 1YW5A 3UCUP 1GHAG 2AIRB 1NNDA 4USVA 4DIIH 3TU7H 1HKAA 3S0NA 2OLHA 5H4IB 2BQUA 3HVTB 4ILLA 1GMCF 3FN8A 2NYIA 4DR7J 3QIPB 2XP4A 4NLDA 1P12E 1QAYA 7LPRA 1KVIA 2PN0A 4BOHA 5EPNA 3DLBA 2PI4A 3ILIA 1CE5A 5HGGA 3OR1A 5EUHA 2Y9HA 1P06A 1ZMLA 2VKRA 3M8WA 3RUBL 2A5KA 3DSPA 4QT8C 5LGOA 2W7PA 2KCPA 1P9UA 3CDUA 4FVMA 1SGYE 3V3MA 1IHSH 1XQIA 1HUTH 4FVCA 1C4U2 2D8WA 4CI0B 2QCYA 1E38B 3GY3A 1S7IA 4X84A 1TPOA 4X62J 3S69A 1KOOA 2HZVA 3TC5A 3TIUA 5HMXA 5ETSA 2XC4A 2VG5B 1ZM4A 3J80Y 3B9AA 3T27A 4BTTB 2DPEA 3HD1A 3OYPA 3GU0A 1WAYB 2P5VA 3WIJA 2HGNA 4PXDA 2LKNA 3MU0A 3UWTA 4ECRA 2GV1A 2HNZB 3BDPA 3SEOA 1CGJE 3HHLB 3HPOA 1INCA 4TX0A 3M5OA 3Q86A 1DVAH 1EB0A 4IW4E 3G6MA 4FN2A 3US5A 1B0EA 4A8OA 3GDVA 1FD9A 3BSOA 2RDEA 2V0BA 2HVZA 3IP0A 1LFWA 4K4YA 1EIBA 2XMAA 2VG6B 3NG8A 4UY85 1S79A 1SFQB 1SH0A 5ETOA 3T1HF 2AMCB 1CJUA 1ARBA 1DY8A 3IBWA 1NK6A 5D15A 1FDDA 3TK5A 4WFNQ 2BDCA 3KADA 3HHDA 2HFSA 4MNYA 1QY6A 4QW8A 1W8BH 4F4OC 2XWBI 2VG6A 1HAYB 2UXBF 1GUVA 1MZAA 1Y3KA 2IJNA 2UUBF 2HIQA 3OHBA 2E7WA 3W4RA 5DITA 1XN9A 2JLEA 4UOCA 3GPAA 3IK8A 3ZVGA 1EP6A 1TMMA 1GJ8B 3ZTQA 4AFQA 1HBMB 4P2MA 1V9OA 2B4PA 4CT9A 4YDXA 4NIWA 4CH2B 4ERDA 3RXOA 1HBMA 3OEED 2A4RA 2CG8A 3ZYDA 3KQCA 1S82A 2ZJRQ 2VG5A 3NI6A 2HRYA 2WV4A 4HHHA 3UCGA 5E0JA 1QBNA 5LXYA 4C9DA 1ZHPA 3KQDA 1WF2A 1LNQA 1YPEH 2BD5A 1QRXA 4IN1A 1O2WA 2P3UB 1RACB 3ARPA 2DB1A 2V8VA 1LPZB 2WLZA 1Z4UA 4ZROA 4J91A 1V2WT 2RG3A 5EG4A 1E6YB 4YB6A 2W9BB 3RXUA 4EO8A 2LCWA 3AA9A 1NXIA 1BBRH 4NLRA 1ZR0A 3FVFB 3QZ8A 1BBRK 3SV6A 2HG4A 4FBTA 1ELBA 2V3MA 2JZVA 2BR0A 4DGJA 4NXMJ 2K0QA 3CEDA 4LRDA 2UZAA 1P0SH 3TVJB 1NAQA 3SUGA 2SGFE 4QWEA 1KRPA 1NWSA 1FJGF 1Z8IB 4HT7A 4J9RA 1DDJA 4J9OA 3QMQA 1FNXH 4DN9A 3DGPA 1EX8A 2PUQH 3DM2B 1HARA 2B8OH 2HNZA 1JKHB 3VGVA 2ZH4A 1XNQJ 3RRGA 1ZGVA 3ZZUA 5C5NA 2MMYA 4OX9J 4MLFB 3TJVA 5DZ7A 3QAUA 2GHWA 1I3OB 2FESH 2VASA 4Y2KA 4TY6A 2VH0A 1U24A 2GDEH 5KG0A 1W0YH 1UTNA 1LKZA 1RT6B 1WKLA 3M8SA 2ADBA 4CLZA 3HKIB 1O2UA 2XTTB 2LFVA 2KFWA 2G55A 1IM6A 2R7RA 1ZCNA 4AB8A 2W4PA 3VB5A 1TNHA 2YMSD 4X8VH 4YFUA 1NJIT 1CSOE 1E37B 5SUHA 1MQ6A 3BDEA 1VMBA 2M8DB 2J9DE 3RGCA 2GMTC 2XI2A 2F5GA 3PYHA 1OYQA 2ACMA 2HMIB 3KABA 1FEHA 1VGCB 1C5RA 1FKGA 4WP9A 1X4BA 2GMLA 4RW8A 3VHQA 2UUAF 3Q8SB 3UQSA 2G41A 1TFVA 1E6RA 4K2YA 2OSRA 1KFDA 1JLAB 1MBMA 4DQSA 4HH0A 4P73A 5C42A 2DCUB 5J1PA 2ZTXA 4URSA 1KXCA 3MEKA 3SIPB 3RZAA 1AWHB 1QURH 1OGBA 2ZUGA 4I6AA 1ABIH 3UQVA 4L3NA 4M7GA 2FIUA 1NFXA 1UZDA 5LMNF 4KAIA 3W2WB 1UTPA 3WZ0A 4IG3A 2PN6A 3R7SB 3CDWA 1T02A 2K8IA 3MM5A 2SGDE 1EHNA 2FLOA 4H4KC 1S9FA 4YLQH 3CJTA 2UUAJ 3EE7A 1D7JA 3SNBA 5T1VA 2TPIZ 5IYTA 4WJG2 5HW8A 1TIOA 1XHGA 1BMNH 4WK1A 5EHHA 2R8HA 1M0SA 4P8WA 1RAFB 2QXJA 1A0JA 1N34J 2VFTA 4FUCA 2FJXA 2AJ4A 1RYRA 1CQQA 1RIWC 4K2XA 2APOA 4LMZA 3HI9A 4M94A 1BQMB 3N79A 1C9HA 4DPUA 1O5EH 1UWAA 1BXNA 3RAMA 4JFKA 5GAEU 4OLPA 5IK2D 1V5IB 1DBDA 2E1AA 3BTFE 3ZZCA 5JB8S 3KLIB 5GXPA 2CFXA 4J9LA 4YB1P 2SGQE 2W26A 2B4VA 3NKKA 1JBUH 1LVMA 4ABBA 3SSSA 1IR2A 5HKGA 7AT1B 1RDRA 4A5TS 1QA0A 2GP9B 2I5JB 1BOQA 1QRWA 5J1NA 5HBFA 2KL8A 3VB4A 4KJIA 2GVDA 1QE1B 1RWXB 5JB9S 1JB0C 4AUKA 1TNLA 1MTNC 4TT3D 1O3NA 2ZPSA 1S99A 4MFBA 3T29A 1SSXA 4ED4A 4X8SH 3I6CA 4JI3F 1TFXA 3GSIA 3UVJA 3Q2TC 2CVIA 4B3SJ 2OMOA 3JSBA 2EC9H 4FU7A 2GKVE 1C2FA 4YR2A 4ECQA 1LFPA 3UOPA 1S1VB 4WXVA 2MKSA 4JI5J 4DPWA 2VONA 3DLKB 4R8UA 2C2KB 3SSRA 1C2IA 3WW7A 3N7OA 4IT6A 3AB4B 4FS1A 2B7DH 2GS8A 2GJFA 3ZV9A 4X4NA 5KFVA 4IOBA 4USMA 1AGJA 3O5JA 2B43A 4LR7A 3RM4A 2OPSB 3FBEA 2YNBA 4M95A 1R0BG 2DT2A 4W9PA 3VXEH 4D3GA 1ZSKA 4OLOA 4OZ5A 1O3IA 3E01B 1XVOA 1LDTT 1MH0A 3MXHP 1XR5A 2P3TB 3KK2B 3D9BA 3L4BC 1T9UA 3TX8A 1WHWA 3DOKB 1LHEH 1S84A 5SGAE 4RBVA 4IR1A 4AFFA 1Z2LA 2QAAA 2HALA 1K22H 1GHYH 2Y80A 1ZOTA 3OFEA 3OE7D 1IQKA 1YHQS 4D9RA 2BJEA 2P16A 2HHQA 4RBTA 4HI2A 2FDMA 2AGEX 1EJMA 2ZKSA 3OL9A 2ILYA 2P8OB 2F8MA 1O3AA 5HN0A 1XMOF 2FJDB 4TWWA 3HDSA 3ZZ0A 1BTHH 3ATKA 4PCQA 4MNLA 1FUJA 3UI5A 2J7UA 4RN6A 4MIBA 1HBNB 1AB9B 3P8OA 1EZXC 1SJRA 3SNDA 1L3KA 3WC0A 5DQIA 1I5OB 4FUJA 5KT2A 2BYAX 1P1LA 1B7YB 3NXZA 3A8JA 2VHGA 3GWCA 3BO4A 1SOZA 4ANDA 2X1BA 1IKYA 5GPGA 2C93B 1XXFA 1U0HA 1QSYA 1TGNA 2LNCA 5E2PA 5EWGA 4JFMA 1C2HA 1Y0HA 4DF4A 5KOWA 5K0HA 1KP6A 3M2VB 5IT9Y 1CSJA 1FKLA 2GHPA 3ZZ5A 1RTHB 2XMUA 1A3EH 2FWWA 2L2SA 3ARZA 5ETNA 3F0NA 2MXYA 2X3DA 2PIIA 1TELA 1SLVB 2G0IA 2J7KA 4E98A 1YTYA 4Y0ZE 1RWOB 2A7HA 4JUZA 4RPFA 3W2VA 1KHVA 4G3IA 3ITHA 4ETZA 3R5AA 5J2QA 2I6WA 6FD1A 3KMSA 4IR9A 1KN6A 3SSQA 2YNGB 1KDQB 2LKZA 2QA9E 2QX0A 4ED2A 2V2KA 3TUJC 4ANCA 1TUWA 2I2YA 1D7HA 2WW8A 4QR1A 1AFEH 2QXGA 1U2CA 2MKKA 1ITXA 3H7OA 3CPWR 4QU6A 3MCSA 1UMAH 2QYGA 4B2BA 4KGAA 4NI2B 2H4YB 5IV3A 3CDBA 4YY3J 1RSCA 2HS3A 3KNGA 5KFZA 1GL0E 1YI2S 2L08A 1O35A 2RHSB 4NA8A 2FZCB 1YM0A 2X7IA 2AGOA 1IVZA 4BLGA 1AD8H 1V2PT 1U1PA 3A85A 4HVZA 2RRBA 3BIUH 5HANA 4LZ1H 1RT1B 5D3GB 5L9NA 4B3OB 5A8RA 4PTMA 3M8PA 1FVSA 2YOLA 2XG8A 2R7VA 1S1UA 1QR3E 1WBGB 2ZWOA 4OI6A 3UAIC 1Y5BT 3NRKA 2DH7A 3CDEA 4OV6A 5HO4A 1G3DA 3C66A 1CBWB 3NGDA 3VF0B 2KX4A 2VBZA 2VA2A 4RR5A 2DO4A 5C17A 2YWGA 4QU7A 1P3EA 3LGVA 1J2VA 3IM9A 1QVGR 4B76A 4MNVA 2W8KA 1VQMS 2C2EA 2VOOA 2GVFA 2VDHA 1EYMA 1HNIA 1YZ7A 1F92A 3OXFA 1ZPWX 4W9QA 2VB6A 4C0BA 1H9LB 3V6DB 2YNGA 1TUGB 3TUIC 2LYVA 3QNWB 1REVA 3O5FA 2XNQA 1TBQH 1GMDF 2AEJA 5JXSA 2E1RA 1T8NA 1YIJS 3LJOA 2F1FA 4FBUA 2BXTH 4CTAB 4ZVSB 5MLCV 1FRKA 2KT5A 3CZ8A 3GFYA 2ZOMA 4ZHRB 2PP6A 3R3TA 5ETTA 1K21H 2G2ZA 3CE8A 2P9GA 4IH5A 3N0VA 1WQVH 2UVVA 3K2YA 4CO5A 2AJFE 2SXLA 4B73A 2ZDMA 1PIEA 4AG1A 3KHVA 2VFRA 2VF3A 4P8XA 5K8PA 3BG4B 4DURA 4LF8F 2BOPA 4BANB 4JI1J 2MB0B 3W1YC 1O5AB 3EYZA 2R2MB 1BMFD 2ZOGA 4X65F 3TZZA 3ITIA 2V9KA 2KG1A 4WCEQ 3T9ZA 1TE0A 2M08A 3D5MA 1MSWD 2DGTA 5HVFA 3A87A 4DQPA 8KME2 5I42B 2ZDPA 3KAHA 1HBNA 3TQEA 3CC7S 4DJBA 1MD8A 4U95A 1RU2A 1V3RA 3MQKC 4F49A 3RR8A 2B6AA 1H2TZ 3W8GA 2DIVA 2Y1IA 2D41A 2CQCA 2ZEJA 3TH2H 1AUJA 3BBFA 3C1KA 1BE4A 2CPJA 2OUGA 3DMJB 1SJFA 3UN3A 4YM9A 2ERRA 1RTDB 3PV5A 3HFKA 1W2IA 2I8EA 2AMPA 1C5NH 2MZQA 3U7JA 3T2NA 1YLXA 3H5YA 4AB9A 1XR6A 4B3SF 1CS4A 3IR7B 1IQEA 1O2RA 3U02A 4CCHA 3RB3A 4LRFA 4MJKA 2AV5A 1TONA 3MFHA 2FZKB 3MWBA 1O3EA 4WFYA 3DOKA 2E7VA 2JRSA 2ZH8A 3NAIA 1BTWA 4JZFH 4F50A 4DL6A 2JOQA 3RXGA 2E5LJ 4P7TA 1SGFG 4KTQA 1JOUB 4I2PB 1X5SA 4GKJF 3UI3A 2ZHEH 3KJVA 2LELA 1C5WB 4DR4J 1QL8A 1RTIA 4M1KA 1NHVA 1RA6A 4DFMA 2FGCA 4DZ2A 2VICA 2BD2A 2AW0A 2DE9A 4Z1MD 1SQOA 5CAAA 4AYYB 2FPHX 3M3VA 3VAIA 1YJNS 3ENSB 1A3BH 1OY8A 4ZVOB 2VD3A 1M1GA 4DV6F 4NXNF 3N7DA 1JLFB 4OYZA 3R27A 4WF8A 3NKYA 2UUWA 4YMEA 1GBLA 4CRFA 1P09A 4ODLA 2LEAA 1WQSA 2HVDA 2HURA 8RUCA 3LQVA 3OTJE 2K06A 3KZ7A 1YGYA 3P92A 4P00A 3RXKA 1NEEA 3RJMB 3KCEA 3PMAB 1S1VA 1BRBE 1JJ2R 4JI0J 5LXRA 3DCAA 1DFDA 1CC7A 3I5CA 1NESE 2NU0E 2F3CE 1BQNB 2DT1A 1NB7A 2E5LF 1U2FA 2E1MC 2FJBB 4OYOA 4F48B 3I78A 2GA7A 4BAHB 4F67A 1HWUA 4K5ZA 2IMWP 3W3SA 4P2SA 4TLRA 5A0CA 2Q6FA 2Z2MA 4C3MA 1P8VC 2NS1B 2GVDB 1X8DA 2IRYA 4KTSA 2BV3A 2J38A 3OOBA 4J4OA 3R7NB 2ZH5A 3OUYB 1PINA 4I69A 1D6WA 3GTYX 1HBUA 2XPAA 4ED3A 2VUGA 4Q0BB 2AQ4A 2BE2A 2V50A 3ZTOA 1VCWA 2AYMA 1SVDA 2W3IA 2ZFFH 4OFZA 3BO3A 3H7HB 5CD4H 1OP0A 3IKGA 1YZ6A 2JLFA 2RJZA 4PWDA 1CULA 3UW1A 2XMTA 4ES2A 1OWXA 2ULLA 2EFGA 2PFEA 2MSSA 3IBCB 2RUSA 1GMUA 2ZNYA 1BQMA 2PGBB 4IPXA 3H0PA 3S1TA 2XCPA 4LQ3A 2IBKA 1ZOMA 4IFYB 4MPXA 1DTQB 2G2OA 2OEKA 2ZECA 2XO6A 2A1DB 1KR4A 1BCUH 2J76E 4IO9Q 5EJLA 2LDYA 1IKWB 1VRTB 2R7SA 4AYVB 2COLA 3BSNA 1UTOA 1D9AA 4DR1F 2BVXH 2RQMA 3LU9B 1GCTC 1RT7B 3SU6A 1RABB 3ZVEA 3SU4A 1E6ZA 1H3DA 3BGLA 4CO4A 4NA3A 3MPUB 4NL5A 2CQHA 4CO2A 3IGNA 2KE0A 2DNLA 1H2VZ 2QYIA 3WQPA 2JLGA 1QD1A 4ODMA 2KO1A 3F56A 1D8ZA 3ISND 1C2LA 1HIYA 1GCDA 1M5YA 4USTA 3VAMA 1RCOB 2BQ7B 3HHLD 3MNSA 1LJYA 1V3SA 3GR1A 4ISIH 2UXCF 3DLGA 2R7QA 2OO4A 1T9YA 4B3RJ 3CC2S 3C6TA 1QTNB 2PR3A 3E8OA 1N36F 3PO4A 5B09A 2KDOA 1ZBKA 1E9LA 1ZA2B 2P6SA 5E3AA 3MR3A 2Y1RI 4P52A 3GY6A 1O2IA 4AFZA 4ZMAH 1S76D 3IHZA 3TPIZ 4MNMA 1U7LA 3BR9A 1V2TT 3KKFA 2BABA 1GRJA 2ABYA 2F4VJ 5EW2H 2PKSB 1SKUB 1Y3XA 3W9JA 3ADAC 1HIAA 1W9UA 2RRNA 4Y11E 2FVRA 3KG4A 3SJIA 4QIWD 4DV1F 2A4OA 1LV5A 4IDKA 4F26A 3AAUA 2BLVA 1JNRB 3BGFA 4KIAA 4NNRA 1RFNA 1VLYA 3S7RA 4QZVB 3IFEA 4DDFA 4YB5A 3ZIAD 5CQGA 3T6BA 4NLOA 2F65A 3SV3A 2MJUA 2N4CA 2TGDA 3W60A 2ZR6A 1IAUA 1OYTH 7FD1A 5THWA 1T7CA 1C1PA 1U02A 4QPTA 3EE0B 2ZH1A 5DKMA 1VK8A 1FONA 3GFHA 1D3TB 3A3OB 4OYAA 2CUYA 1W9PA 4R0XA 2WPHS 3CCLS 2QTWA 2IM2A 4KY3A 2ZU3A 3O8DA 3SV7A 4DLGA 3CW2C 5HATA 4D7FA 1CT2E 1HAGE 4J9QA 4DR5J 2DGXA 1O2YA 2EA3A 1LWFB 2KH9A 4N8NA 5J2PB 4DSEA 4LSNA 1KHWA 4JZIA 4Y8ZA 4J9SA 1CT0E 1LWEA 1OWQA 3HFZB 3G6VA 3T9NA 2W9BA 1ZJDA 5BYQA 1X4GA 3T1HJ 1IBCB 1E6YA 1IR0A 2ILNA 1DURA 2WBMA 1BQXA 3CNQP 3EZOA 1M5SA 5FLXY 2XCAA 4DV4F 3GV8B 4MPVA 3RYLA 2KFYA 1EZUC 2VWMA 4ZVEA 3E8LA 1B0TA 4INKA 3F9GA 2EKYA 5DIUA 1ETRH 2FOFA 2D3O1 1R89A 4CO1A 1Q53A 5CCMA 3SNEA 1S57A 2HHHF 4FYVB 4K0KF 3KHLA 1FHTA 1DY9A 1LMWB 2RURA 4O03A 4OZJA 4KGZB 3MEGA 2P59A 1LQEA 1I94J 2R2RA 2LA4A 3R2DJ 1SGCA 1SQAA 2WRMA 4NLUA 2FJAB 4ZS6A 4DRHA 4U6PA 3VQSA 3B82A 3T6JA 4MGVA 3NRBA 4I7YH 2CQIA 3GIRA 2BHGA 5DP9A 3MOCA 1SGTA 3G2XA 4OI4A 2HSEB 4JYTA 4I2QA 3SCJE 1YC0A 2YPYA 1Y59T 2J98A 3RW7A 5KG3A 2CHAC 1HB0B 2GHVC 4ZLJA 3QZRA 4P9SA 1EQ0A 2VODA 3EDRB 1C0UA 2WB1D 1XMQF 2CMYA 2CNLB 4WYLA 3X3UA 2BMGB 3D62A 2XP6A 2J0XA 4K5SA 2V4RA 3I6PA 5LL6d 2OTVA 1S6HA 1RWKB 1VC5A 1AVXA 3DOLA 2ZVIA 3I0RA 1UO6A 2JEFA 1LG2A 3BTDE 3JXOA 2QLXA 4JYVH 5HMYA 2GZ9A 4LR8A 2CQ4A 4A8SA 2W6ID 4G6VB 1W2KH 1L4ZA 1UHBA 1DICA 2CQGA 2K1RB 2YNAA 1C4V2 4X1RU 4AFUA 4J5OA 4LRAA 1CHOG 2C90B 4X4SA 3T26A 3RRKA 5BYRA 1LQDB 1NSQA 4Y28C 4G2PA 3CJSA 4FDFA 1Y7PA 2WM0A 4P72A 3NEKA 1FDBA 4A48A 4B08A 2DHAA 3CMES 4DV0F 1TKXB 2YWKA 1GTHA 2MQLA 2FOAA 3RGIA 4O23A 5CZVA 4J7CA 1BLUA 2DR7A 4FUIA 4KHRA 1F2SE 3Q23A 2UWPA 2QSFA 3IG1B 2WOMB 2BQ3A 4X0WU 3SUDA 4F3OA 3GG1A 1Q5YA 1UW4A 5EWEA 3AS0A 3QTOH 1YG0A 5DP8A 1H1BA 4TQSA 2XY7A 1WUUA 1GX5A 2CJAA 2IVFB 3DRPB 4DF8A 1QCPA 2OC1A 3QIPA 1OWHA 4CDIA 1X5OA 2YTCA 3HVAA 1NWRA 3F0PA 2ASYA 2MZSA 3PW5A 4NZ6A 3ZZBA 3OTOJ 1H38A 4A92A 5DM6Q 3HT0A 2VU5A 2HS0A 2VIQA 4OI1A 4MYTA 4KFBB 3J81Y 1VQ7S 1FRXA 1AWFH 2CYYA 3CJ2A 2N3OA 3LGTA 3OL8A 1BMLA 2IC3B 3G71S 1HAPH 2F23A 5E41A 3KN2A 2WVCA 3AOAA 4EU0A 1PSDA 3GCWP 1HPZB 4WK3A 3QGHA 1FKOA 5CHCB 1GBFA 3B9DA 2Y0SD 4B9TA 1ZGIA 4AL6A 1HCGA 2UP1A 2ZBRA 3LF0A 3Q24A 1K73T 4KR0B 1K1QA 1HAIH 4K4TA 1S1TB 1BT7A 2DD8S 1Z1ZA 1LXJA 2EI6A 3ETOA 2JHEA 4IYQA 1UTLM 3WQVA 1OQ6A 2PA3A 1GBKA 1GBCA 1SGPE 5K8MA 3K5NA 2L6OA 2FI4E 3LH3A 3K7RA 1Y3UA 4NYZA 4NWKA 4NA7A 1VCTA 4EGLA 4F4KA 2KCOA 5HIYA 4INLA 4C8YA 3VGTA 1GNKA 4LFAF 1NY22 4DS4A 1IN0A 5CYMA 3VB3A 1VIOA 4X1SU 4HLBA 4E7NA 1YBWA 1DUEA 3HSDA 2OLGA 7FDRA 1NSPA 2ZHDA 5C24B 2YX7A 1UJ1A 2HGTH 2BXUH 2VIHA 2MHNA 3ZVFA 1VISA 4O0NA 4USIA 1LL4A 5HW7A 3V4IB 2CGAA 2GQQA 2G5VA 1C5MD 5KFGA 3IRWP 3ATMA 2G1HA 1DLKB 1FAXA 2DR9A 2P95A 2A6OA 4K2JA 3NWUA 4XDEA 5LPEA 3AVZA 3U9AH 3V4IA 3CC4S 2NREA 3MD3A 1RGVA 4DUZF 5ETPA 5E3CA 1TA6A 3O5PA 3RU4D 2HWLB 3SN8A 3LGWA 3WHIA 4C02B 4OL8A 4KPCA 2ASLA 1XUGA 4NLYA 4WMDA 1N8OB 2O8WA 4LF6F 4C98A 1RAJA 2XBPA 2XS5A 5CYMB 1P01A 4Y65A 2CQ2A 2IAJB 1DWEH 4QCLA 4ZKNU 3PV8A 1ZPCA 3TJNA 4DG4A 3S9AA 2CWKA 3A8AA 4O3TA 2BACA 5BXIA 4C97A 3LAKA 2VVUA 1F5BA 4RBUA 3HM9A 5HWCA 1U8WA 2ZKTA 3KLEB 4A1VA 5K8NA 1FI8A 1FKIA 1DY3A 2ZCKP 4GMKA 1C5ZB 3VZIA 2Y5GA 1HQ2A 2V8GA 1C5PA 4NIVA 3ELHA 1OJ4A 1UFLA 1P5QA 5A6WA 4JOUA 2ZNZA 1Q16B 4NLWA 2W1BA 3SO3A 3TAQA 1JRTA 3CVKA 1NH8A 2F7VA 1T94A 3NGRA 4NSYA 3K59A 1NJYA 5K8OA 4JI4F 3R6LB 5IT9U 1FK9B 1HPZA 1ZL1A 3HSGA 1X60A 2JVRA 4NE9C 1FFWB 3FK4A 5C24A 3MM7A 3QZ7A 3JQJA 1XR7A 3VB7A 3IC1A 1CT4E 4KC5A 4B9SA 1NMEB 2M9KA 4MNKA 3AOBA 1S0OA 4GKKJ 2J5AA 4LOYH 2ZNKH 2OFNA 1RAHB 3DLJA 4QYZJ 2WHXA 4MK9A 1GHBF 2F9OA 2QZ8A 2FVPA 2WONB 4DW2U 3CJ8A 1J17T 1PYTD 3M7TA 3WWFA 4ODOA 3DRPA 3NLCA 1BJVA 2VIOA 3M36A 2CN0H 2WOMA 4U01A 3D1OA 1VQOS 2BDAA 1H8DH 1QDUB 3DYAA 1XKAC 1O2GH 3BYPA 4I1TA 3GCOA 2CXVA 4Y0FA 1BHXB 1Q4RA 3D67A 1SQEA 4TLQA 1THSH 3FUYA 1KFWA 3DKDA 4X4QA 1YRTA 4IG0A 1O3OA 1SR5C 1UW9A 3U1NA 1JX4A 3LGNA 1F2HA 1TKXA 3CD6S 1Q6HA 3MMAB 5H1SV 3BSAA 4JI6J 1ESBA 3ISZA 3QUMP 1M5VC 2GCFA 2PT0A 1O3LA 5JVHQ 1YPLH 2PMWA 5A8ZA 2P93A 2JFDA 3PMJA 1BWVA 1RZMA 1ZRBA 2M5YA 1VQ5S 1O3GA 1WKJA 3HF5A 5DIVA 2HHHJ 4KFBA 1S49A 2CZ4A 4G1PA 1UHBB 2K1RA 3HHLC 1TNIA 4CRJA 1XERA 1HJAB 5AJ3F 2BM2A 1GHVH 2BZAA 4ZIVA 4Y2MA 3MNBA 4OHZA 9LPRA 4IH7A 1MMNA 4GHTA 3FJ2A 2V7QD 4TN2A 1FWPA 1KSNA 5AT1B 2HNTC 4WU2A 2JH6D 4TY7A 4CZCA 1GI4A 2FY1A 1X5TA 2WSEC 1HQEA 4DR3F 1XIQA 4Y8YA 2F3JA 2XS2A 1ZH5A 4Q8FA 4ES3A 5I3PA 3IG1A 3T5HA 5L1KA 5L39A 4NWBA 2BQWB 2FJEB 3RBZA 1N5YA 4CR5A 3JYMA 2ZDVH 1EZQA 2ZOFA 3NK8A 4ZKAA 2JX2A 1UTAA 2H48B 3FKSD 4ODQA 2M70A 3VAJA 5F3ZA 3PJ9A 2ADCA 4XPEA 4W5UA 3OT9A 2VJVA 2HFNA 2J9DA 3VAGA 3RC6A 2F4FA 3NGUA 1MN9A 2ZITA 3TW0A 2MPHA 4DL4A 4GC6A 3QYYA 1HFEL 2V3OH 4ED8A 4DV2J 4MTBA 4XBDA 3FSXA 2YY3A 4G50A 3FZ2A 1AQ7A 4I6YA 1U6QA 2BZ6H 3PTNA 1GJ9B 1H8IH 3D1HA 1PQAA 1IQTA 4IKAA 1O37A 4JMYA 4RKOB 1E44A 5IZHA 2K7JA 1FPCH