The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
223
|
structure length |
223
|
Chain Sequence |
b'MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
FKBP-type peptidyl-prolyl cis-trans isomerase
|
molecule tags |
Chaperone, isomerase
|
source organism |
Methanocaldococcus jannaschii
|
publication title |
Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb |
total genus |
53
|
structure length |
223
|
sequence length |
223
|
chains with identical sequence |
B
|
ec nomenclature |
ec
5.2.1.8: Peptidylprolyl isomerase. |
pdb deposition date | 2010-11-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00254 | FKBP_C | FKBP-type peptidyl-prolyl cis-trans isomerase |
A | PF18046 | FKBP26_C | FKBP26_C-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Thrombin, subunit H | Thrombin, subunit H | ||
Alpha Beta | Roll | Chitinase A; domain 3 | Chitinase A; domain 3 | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |