3PRBA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 53
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prbA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prbA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prbA03
1J6YA 3GPKA 2KI3A 4DZ2A 1FKLA 2VN1A 4J4OA 3FAPA 3LUOA 1QPLA 2D9FA 3O5IA 5DIUA 3TDBA 1JNSA 1B6CA 2LJ4A 2DG3A 2F2DA 1FKTA 4TYOA 1C9HA 3OOBA 2K8IA 2PV1A 3KABA 3IKDA 2FAPA 3PRDA 3UQBA 3I6CA 1QPFA 3O5EA 5HKGA 1FKRA 2AWGA 2M2AA 1FKFA 4TX0A 2RUCA 1Q6IA 4TNSA 3PA7A 2DG9A 1FKSA 1Y0OA 1U79A 3O5GA 1FKGA 2VCDA 2XPAA 1YW5A 3EY6A 3UI4A 1A7XA 4IQ2A 4FAPA 4LAVA 2ZQVA 1PBKA 4ODPA 1M5YA 3MDYB 2KE0A 3KAFA 3KAHA 4JFMA 2PPPA 1PINA 4ODQA 4ODNA 4DRIA 3JXVA 1J4IA 5HW6A 1L1PA 4JFIA 3KAIA 1FKIA 4ODRA 4JFKA 4ODOA 1Q1CA 2MLXA 4DRNA 3UQAA 3UQIA 1FAPA 2M08A 4MGVA 2XP9A 2IF4A 5HWCA 2RUDA 2XP8A 5HTGA 5HUAA 4J4NA 4QT2A 2OFNA 2RURA 1Q6HA 3NTPA 3UI6A 4DRJA 1NMWA 1P5QA 4W9PA 5BXJA 2UZ5A 1D7JA 4FN2A 4IQCA 1HXVA 1FJDA 3KADA 4DH0A 2KGJA 2KR7A 3KAGA 4W9OA 2KO7A 2L2SA 1Q6UA 3KCEA 1FKDA 2ZR4A 3O5JA 4LAYA 5B8IC 3RGCA 1KT1A 1BL4A 4U86A 2M1IA 2RUQA 2F21A 3O5KA 4JFJA 1F40A 3NRKA 5D75A 3O5RA 4DRHA 4LAWA 1D7HA 3IKGA 4MSPA 1ZCNA 4LAXA 4ODLA 4QIBA 3CGMA 4R0XA 4ODMA 5DITA 3UF8A 4DIPA 1EQ3A 4IPXA 1FKBA 5J6EA 1R9HA 2RSEA 2RQSA 2XP3A 2Q5AA 4DT4A 4DRPA 4G2PA 1TCOC 1T11A 2ZQSA 1ZK6A 2MLYA 1J4HA 2ZR6A 3O5DA 3WH0A 1D6OA 2LPVA 5HWBA 4DRKA 3O5PA 4U84A 1ROTA 3CGNA 2PV3A 1F8AB 1NSGA 5DIVA 1W26A 4DROA 1J4RA 2Y78A 2PV2A 1FKJA 1JVWA 2DG4A 4TW6A 1NMVA 2XP7A 3B7XA 1N1AA 1ROUA 4O2TA 4W9QA 1FD9A 2FKEA 4DRMA 4TW7A 5HW8A 2XP5A 3TC5A 1KT0A 2XP6A 3VAWA 3KACA 1EYMA 3IK8A 3O5FA 2MF9A 1JNTA 4C02B 5I98A 4JYSA 4ODKA 3NI6A 1D7IA 3IHZA 4GIVA 4DZ3A 2PPOA 2XPBA 2ZQTA 2ZR5A 3JYJA 3O5OA 3O5QA 4TW8A 2XP4A 3O5MA 4DRQA 4QT3A 5HW7A 4N19A 5GPGA 2MLZA 3JYMA 4U85A 4G50A 3UI5A 2ITKA 2JZVA 2PBCA 2PPNA 3KZ7A 4ITZA 4NNRA 1FKKA 2N87A 1YATA 4JFLA 5HT1A 2LKNA 3TCZA 2LGOA 2ZQUA 3ODKA 2F4EA 4BF8A 3RFWA 2MNTA 1QZ2A 1BKFA 4GGQA 2KFWA 1FKHA 3H9RB 3O5LA 2MPHA 3PRBA
chains in the Genus database with same CATH superfamily
3AD7C 4IT4A 1RT6A 2TIOA 2D41A 1O2GH 1NK9A 1CJTB 3SQOP 4OS1A 1C2MA 3KG0A 1RTLA 4ECRA 2YNHB 1I3OB 4JZ1A 5D15A 3HHNB 1AHTH 1CJTA 4MG3A 3RLYH 1HKKA 1RA6A 1BHNA 3RXGA 4RW8B 1PJPA 3CUNA 3SCIE 4NZCA 2JC0A 2VU5A 5CCLA 2VIOA 3BEGB 1QUVA 1G30B 1CT0E 2VOOA 1V3SA 1C4U2 1SOZA 3TH4H 3C6TA 1WI8A 2F21A 1NK8A 2DH9A 4M5NA 2ZGHA 5AT1B 7ESTE 1LKZA 4ZIWA 1O2VA 4FUDA 2ESTE 1GHBG 4ZS6A 2YWWA 3DM2A 3RXUA 5F9LA 4N56A 3DRXA 4BXSA 5F8IA 3QYYA 2MGZB 2GV7A 3AB2B 3MMCB 2SNWA 4LIWA 4C8YA 1ROUA 4DU8A 1VC5A 1O2ZA 3B9DA 3LGVA 5HKKD 4C6AA 3ZVDA 1ZBWA 3URDA 2Q66A 1BMAA 5C20A 2V6NA 5I3QA 5JDUB 2J76E 3GJRB 1UTQA 2IVMA 5KG2A 3C6UA 1BITA 1YATA 5J2QB 4JI2J 2BY6X 4HTIA 2IDEA 3D6MB 3DMJB 1UPPA 2A4OA 3Q89A 2OINA 1NJWA 4LFCF 2AV5A 2NU2E 2P3TB 5FBIA 5I42A 3A7YA 1C9TA 1MABB 1QD1A 3H5SA 2V4JA 2F9PA 2MSSA 3CJ5A 3OTCA 4R5EA 2GZ9A 4OYXA 3RR7A 2GAGC 1NMEB 4OZ0A 2VVCA 1WOFA 1ABJH 3K5PA 3L7UA 1SLVB 1GXTA 4QPTA 3F3BA 1X0FA 2ALYB 3RG6A 2XP9A 2RAQA 2C4FH 2MPUA 5JXSA 3MDFA 2EXUA 3SZEA 3ZTOA 1BLUA 1F9FA 3A3NB 4ABEA 5IQQA 2GX8A 2E1AA 5EJLA 3PIOQ 1M5OC 4EBDA 2BD4A 1XBWA 5KFQA 1MD8A 2YXLA 3ZZ5A 3HK6B 1TCOC 3HULA 3G6VA 4NLRA 4CLFA 3GE9A 4X8TH 3WD2A 1D6OA 2GQCA 3EZ5A 3B9EA 1FEHA 3O5PA 2OK5A 1BT7A 2EFGA 2Z3EA 5GCHF 2V3HH 4MQAA 2ACMA 4WKAA 2PA8D 2OUAA 4X4NA 3SNBA 5F8LA 5GAGU 4IRCA 3QLHA 3F56A 4JI8F 1NU7B 1U02A 2C2MB 4KPCA 3MH6A 1IHTH 2JZVA 3TJVA 3HHLA 5D0EA 3GB0A 1O3LA 1ZPVA 3MU0A 1TVRB 3ELHA 3AODA 3D1HA 1U6ZA 3CD0A 3GQCA 1C1BB 2ILYA 4KT0C 1C5NH 3OTOJ 2J5AA 2XLKA 3NXZA 5GMDA 1QBNA 2LEBA 2CZ4A 4ED0A 3C46A 1NSKL 1GJDB 1WTHD 3E0PB 3KYLA 1WCZA 2DNPA 3CH9A 1J8AA 3R3GB 1ELAA 1KXFA 1IBMF 2WYGA 2WK2A 1DQ8A 3PM3A 1ACMB 3PRAA 3QFWA 2QL5B 1F2SE 2ROEA 3M7TA 2MZRA 3MM5A 4QT2A 2RURA 1Q6HA 3BEUA 3UI6A 4MTVA 2VWNA 1G1XA 1TKZA 3T9ZA 4NRUA 3ENQA 5JUMA 3JYTB 8LPRA 2G9OA 3SSQA 2ZHEH 2RSEA 2N3OA 2W5EA 1Y59T 2WV4A 3ETOA 4ZPAA 4A1VA 1T11A 5K8NA 1Y8TA 1SI5H 1WOPA 3N4WA 4J9MA 1QAJA 8ATCB 3HLUA 3ZVAA 1N1AA 1FE4A 1UK3A 1VMBA 3QIPB 4CYUA 1BRBE 2HURA 3DRRA 3HZEA 1UJ4A 4V1Ak 4AFUA 3CJRA 2XPBA 3NAIA 3RXLA 1ZPZA 3SFGA 3DOKA 2H1UA 1M1KT 3DN9A 1OWQA 3DHXA 3NWGA 2DE8A 1C1TA 1G6BA 4MKVA 4YZUA 1UW7A 1BIOA 4DWIA 1MKXH 3L9ZA 4MNKA 1LW0A 3EPIA 1SGEE 1O2PA 3CCWA 1QPLA 3KQCA 4OX9J 1WF0A 2SGDE 1RYRA 1OS5A 2SFAA 2WVBA 4NMLA 3I9ZA 1FKRA 1QSSA 3GTYX 1LHDH 1RXPA 4CT9A 3K59A 5DO2A 5DJ7A 3RXQA 2AF6A 3ARSA 4HI1A 1S6OA 5AJ3F 1SGTA 2VINA 1PINA 3TNVA 2GIFA 2DCLA 1S9FA 1GJBB 5KG3A 3CB4A 2OPQB 1TELA 3F41A 2EEYA 5ETOA 5KTQA 1WF1A 3PFOA 4Q0BA 5C25B 3DCAA 4OI3A 3GV5B 1FFGB 2WPDD 4OX9F 3ARVA 2ZR4A 4X8SH 1Y5IB 2W7SA 3NCPA 3SDEB 1IBKF 5KFYA 2CKWA 2I0XA 3QIDA 4D8NA 1Q5VA 4BNRA 2CXEA 2Y0BB 2XO7A 1W1PA 1NFWA 1GMWA 2E5JA 2QLBB 3P8FA 2V68A 3G71S 3F68H 3BGRA 1BTHH 4ZKSU 1E15A 2PV2A 2B4PA 3TK5A 2DNOA 3AOAA 1YQHA 1X4GA 3AJ2A 3VHQA 4HL9A 3TX0A 5D8HB 2FJXA 2W7PA 5HW8A 1YHQS 3VAWA 3TAQA 3WBZA 4P2SA 4DSFA 1T31A 4GIVA 2O8TA 1UWAA 1E6YA 3FSXA 2JFDA 3JAMU 4ZP6A 2C8ZB 2ZBRA 4ECYA 3TVKA 4DCPB 3IRXB 3ARWA 1Q0NA 4NWKA 3BBCA 5F03A 3UD3P 4B3TJ 5EXLA 1EB1H 4OS7A 2RCEA 2MKSA 1GXUA 1R8AA 1YJTA 2BB4A 1U4BA 4NOHA 3PO5A 3VGUA 5L46A 2DPJA 4KKOA 4KHPF 1GI2A 1D6RA 2AZ1A 3CD7A 2VG5A 2YKMB 1KDQB 3EA8A 3MUTP 5J2PA 3MR7A 3AW1A 3DD2H 2R8IA 4Y34A 2VFVA 1HBNA 1NJYA 2P95A 2VVUA 3NWRA 1E35B 4TYAA 1GBAA 3LC5A 2AFQB 4FNHA 1SH3A 2ZU1A 1P9UA 1JRSA 2DK2A 1ZSLA 2KX4A 4LF2A 3TAPA 1RAGB 2M88A 5LGOA 4LF8J 1SVPA 5LT5A 2HGTH 4CO5A 3V7TA 2CWXA 2TGTA 5A8KA 3SU3A 2ZU5A 3FFGA 1TGSZ 3T2NA 4ZCIA 3BQ2A 3T1AA 3HO1A 2PV9B 3PM9A 4TW6A 1HKJA 1U1KA 4KP0A 4Y71A 1O38A 2NLWA 2OP9A 5EXMA 4CH8B 2B0FA 1ZSJA 2Y6TA 4UT4A 1DVAH 3O5FA 1V2RT 3S6EA 1TMJA 3H5YA 4DV7F 2XP4A 4DQQA 2DHAA 4LF8F 4G1QA 3JYMA 2M2BA 1IM4A 1YVFA 3NGKA 2D74B 1F0UA 3G4SS 1HAZB 3BTDE 2QA2A 4JV2A 3CCQS 4C11A 2NU0E 1UP1A 2PGBB 3ARRA 3RDZA 2DGWA 2O01C 2B6AB 1QSLA 4DR3F 4PG7A 1P27B 2GT7A 2A2CA 4C0HA 4OHVA 1N6YA 2AMCB 4J9KA 1AFQB 2RRNA 4LSLA 1TL3B 3I6PA 1HNEE 1GMUA 4HTCH 2BLWA 3KOAA 3PA7A 1LWCA 3JSBA 4NE9C 3MXHP 1N1LA 4DT7B 4IQ2A 4U9RA 5JYIA 2WZ1A 3V2UC 2GDEH 1EP4A 3PW5A 2H65B 1PYTA 2ZC9H 1SL2A 4MTPA 1MCTA 3UQIA 5L1LA 3NMAA 2FY1A 4QR1A 2GV1A 3R6LB 2PW8H 2JOQA 2DYAA 5BXJA 3HJVA 3MNXA 1VBKA 4UTGA 1AI8H 2FOHA 5DN6D 2FJDB 5L38A 4ZVFA 2LCWA 1RYSA 4EK2A 3OFHA 2A0QB 3ZZZA 2JVRA 4ZHRB 1Z8RA 3Q8QB 3CPWR 2QFJA 4AT1B 4DT4A 1YP9A 5E0OA 7GCHG 4O44B 1U0HA 3H40A 1Y5LB 3KMSA 4MFBB 4FBTA 1IKYB 5KG7A 5B0BA 1WKLA 4LF6F 3NY0A 2EBEA 4CQ1A 1SC8U 1DZ5A 3H5CB 1T02A 1LWEA 3CSKA 3G8SA 3F9GA 3PG9A 2V94A 3D67A 2BDGA 4TW8A 1RAOA 1YJVA 4MNMA 3ET6B 3SHCH 4B3MJ 1TKXA 1U7LA 4WWYA 3UR0A 1YKTA 2OLGA 3A84A 1P9YA 3A8EA 1GBCA 2KM8B 1VRTA 1L4ZA 4NCAA 4MAVA 1C1RA 3NXPA 2YQ1A 4R5PB 2PSZA 4QT8C 1AKSB 3T1HF 4I68A 1KQGB 2EEKA 3VGTA 1HAHH 3DFLA 1ZBVA 1XMBA 1VS3A 2VPXB 4AE5A 1MMDA 1CSOE 2KH9A 4DR3J 3ZZ4A 4USUA 4YEAA 2CG4A 3R5AA 1J14A 3GS9A 4BAKB 2VHGA 4RKJB 3FSYA 4WXIA 1D8ZA 1MTUA 5C5OA 3KAIA 2VKZG 3OTJE 1FAPA 2M08A 1CGJE 2KN4A 4DV2J 1WUNH 2ZTXA 2DT3A 1YPMH 3CZ8A 1HNWJ 3UDEA 4OZLA 1KS2A 1TL3A 3PVXA 1SC3B 2V2VA 2FD2A 1DX5M 2G0JA 4X1NU 4Y7AA 1ARBA 1GHWH 1EATA 1NY22 4OJGA 1GMVA 1A46H 4DWSB 3BJYA 1PFXC 3E8LA 2GCTC 3ZZ0A 1P9QC 3O5DA 1VK3A 1UA1A 2WPJS 1MKWK 2B4OA 1O6IA 2Z0GA 3BTQE 1OMSA 3FQKA 3G82B 2F9UA 4YT6H 1YRTA 9ESTA 3TPIZ 1BCUH 3O8BA 2XCAA 1JB0C 1HDTH 1VHIA 1KLTA 4Z7YA 3A87A 3MTYA 2DR6A 1FF2A 3HHEA 3M8PA 5IT9U 3VPKA 5GPGA 1RWOB 2J7KA 1K1QA 2PKAA 1K0TA 4KGAA 1SHYA 1S6PB 3A4TA 4BC9A 2HGNA 2ATLA 2RF2B 4Y6IA 1RWMB 2DIUA 2CUYA 2C90B 1AZSA 2M70A 2XMTA 3D6HB 2KFNA 5IQ6A 1WQVH 1SGFA 2HOBA 4WMDA 2RIJA 5AFYH 2ZHAA 2AX0A 2I6WA 1XUGA 5B0CA 4I8KA 3FXYA 4DUZF 3EVOA 1RGVA 1S79A 1JXLA 5D4NA 1NDCA 1M5YA 1DWBH 2KRBA 3U1IB 1ZRBA 1UTAA 3OR1A 3MECB 2VDHA 2G41A 4Y0YE 4DV4F 2BQUA 1DQAA 1NZAA 1FVSA 4KYZA 5K14A 2E1PA 3MHYA 4CRGA 1VQNS 2WHOA 3ZVFA 1H2TZ 5KG6A 5F53A 4P2XA 1VC6A 2ZQ1A 3P8GA 3IA0A 3QGGA 4JFJA 4AXIA 4OGXA 4U8YA 1CQQA 1CA8B 7FDRA 3LAKA 5JVGQ 4ECTA 3EE0B 2F83A 3C2PA 3DUXH 5F8XA 5D0GA 5DQGA 4ATNA 2E5LJ 1AT1B 3OA5A 1S6PA 1F5LA 4LF6J 2QF8A 2W7UA 2Y8YA 1DITH 2UXDF 5F8JA 2CQ3A 1T8EA 1UTLM 1UEVA 4NLSA 1YPLH 3LIWA 1ESBA 4F49A 1P2KA 3PIPQ 3GIJA 1S0NA 3CJKA 2ZQTA 2VWMA 3PFEA 3EGNA 1HIAB 2PMZD 2CV3A 2F4FA 1XKAC 4JI0F 5D3GA 2NYHA 2H1YA 2ZJQQ 3ET6A 3SDEA 6GCHG 1SJ1A 1A0LA 3VF0B 4HI3A 4PYAA 2DH7A 1ZHPA 1GRJA 2FOGA 3RGIA 5T1VA 3PYFA 3RXTA 4DXLA 4AZ2B 2HAIA 3R5DA 3OXGA 3DCLA 1FKSA 2FHKA 1N6XA 2VCDA 1CT2E 2HBZB 4RBVA 4JI1J 3N99A 5IC6B 2HFZA 1B0TA 1AU8A 2AP6A 4P02A 1R7IA 3ZO7A 4DUZJ 1Z1IA 5EUHA 2EC2A 1C1QA 3WD3A 2B5JB 1JNEA 4K69A 1H6KX 1W25A 5C2ZA 2GX4A 1HWIA 4BBYA 2HNYB 2FHOB 4Z2LA 2J6SA 4MPUA 1TZ0A 3TK6A 1H7WA 1X5TA 2PWXA 2ALZA 5DKMA 2FHJA 2U2FA 3G6ES 5KFEA 4TNOA 1IBMJ 1SV5A 3OD2A 4DX5A 4LFBF 4KE5A 3ZTQA 3HT0A 3GCTF 2M9KA 2A3JA 2DEJA 3B54A 2RU3A 2DCUB 3HDSA 2LU1A 3HCXA 3ZZ3A 1YY3A 1AFQC 2QV1A 1CE5A 2BXUH 4WKHA 1WNOA 3SYZA 1MROB 1C2PA 3DYAA 1CQMA 3M9MB 1DARA 4LF9J 4OS6A 1EZQA 2DSWA 3OY5U 1HD0A 1F0TA 2OAUA 1DY8A 1G3EA 3IC1A 3KUGA 2KAIB 1PPBH 1V6HA 3FDSA 3VVTA 3UCZP 5HSPA 4DR5J 4ISIH 4JI0J 1JLCA 3M7QA 2BJ3A 3CCZA 1T03A 2P93A 2F43B 1GXLA 2J0WA 4I6WA 4DIIH 3I55S 2ZDKA 1P2QA 3RAXA 3NRLA 1FRJA 1RISA 1SH2A 4AD6A 1NRKA 4IFVB 1L1PA 4MH8A 1CA0C 2RH3A 3U27A 3OFGA 3PZPA 5HUAA 2V8PA 4ISNA 4X6OA 2OPSB 2PIIA 1S0QA 1GI6A 4PG4A 1OO0B 4OGYA 2Z56B 2RS2A 5T14A 3LPRA 3I96A 4OYMA 3NOGA 1SVDA 4J37A 2K7JA 1QTMA 2AZ3A 3ISZA 2RQKA 4K0KF 1EQ3A 2AMQA 1UVKA 1V2QT 1LK7A 4ZCNA 4Y2IA 2ZFTA 2TGDA 3LWLA 1O36A 2ZR6A 2E5LF 2DO4A 5K5MA 3CGNA 1O30A 1MWZA 3FCWA 3T5LA 4XDCA 1NO8A 1E6ZA 4B9TA 2OELA 1IN0A 2KRRA 3IM9A 4URSA 1FN6A 5I3UA 3U7JA 3PMJA 1MMNA 2W2NP 3TC5A 2ZH6A 1ORFA 5B7WA 4GCHF 4JYSA 3O8CA 2ZGBH 3N7DA 2UVRA 4B9LA 2YBVA 4ED3A 3H98A 3KEEA 3JZ2B 3PTWA 4K8BA 1O31A 5DF0A 1MKWH 1ANEA 2A3EA 1C2GA 3SN8A 3M8YA 1S10A 5L2YH 3FBBA 2ZDAH 3VGCC 5HQLA 3DRSB 4Q22A 3EDRB 3UO0A 4UF4A 1HKMA 3G96A 4QW8A 3CIMA 2BOHB 3M7VA 2LEAA 3PRDA 1NT1A 5HGGA 1HBOB 3PEHA 1F9EB 2MB0B 2PKAB 2C1EB 4A8OA 4YOEA 2ZQVA 4JFMA 4JI5J 2FVPA 1EAXA 4NLXA 4MYUA 1ZTJA 1TKTA 1Z1ZA 3AXMA 4AYYB 1FJSA 1WDTA 2C3OA 3C19A 1S1XA 4NXMJ 1HBNB 1W2IA 3MM6B 1L3TA 3I0SB 1DJ0A 1P2OA 1A5GH 2OKQA 3OX7U 4UFGH 2B3TB 3K57A 3M05A 1HFDA 4LRBA 3QZRA 2VG5B 1NUEA 2DSZA 4A6LA 2FP7B 2G0CA 4K8RA 2W6JD 2XMVA 3QJPA 2X1GA 2FIUA 4B75A 1N36F 2I2YA 4TQSA 1VKYA 3LGHA 4MVNA 1HWKA 5THWA 4Q7YA 1R27B 1QTFA 3BF4A 1LK5A 4DDFA 2QO3A 4FVDA 4X8VH 1EIBA 3MYWA 4TKTA 4M5DB 1LFPA 3VAGA 1KTQA 3PW7A 1C2LA 1LG1A 3EE7A 1QAXA 4X4UA 3NKKA 4FUIA 2J9CA 1KLJH 1H8HD 3PYEA 2K06A 2Z6BD 4D9RA 4A8KA 1O2MA 4IH7A 2R8JA 2FJAB 4USMA 5HT1A 4K4SA 1VQLS 2P3UB 4ZHAA 3MAQA 2MKIA 3R5CA 4TLRA 3U1JB 2ZH9A 1O2UA 1BMQB 1HMVA 1NESE 4LQ3A 3HVWA 1DRZA 2KU7A 1AXQA 2VFSA 1JIRA 3E91A 1RGQA 3L3CA 1Y0OA 6CHAC 3P49B 4FAPA 1EJ7L 1YW5A 5LH8A 1SPBP 1A7XA 1PYOB 3K6ZA 5C2GA 2H9ZA 4FDFA 4JYTA 5A8RA 3DRRB 1HQUA 4BAQB 1XUKA 1TFVA 1ZPBA 3M2UB 4DV4J 4BAHB 1SJQA 2W8KA 2B5TB 1RHRB 1T05B 4DSJA 4K5RA 3GPAA 3RTVA 5EOKA 2AJ0A 3EPGA 4X2YA 3DDNA 1CVJA 4D9QA 2MKJA 1GOIA 3GMGA 3UF8A 4Y65A 1GI1A 1ZA2B 3VVUA 3JB9k 4ZHRA 3WIVA 1UCYE 3SOSA 4DCDA 5K8OA 1SFIA 2HS4A 2DNLA 2B56A 2W2OP 2PFDA 1UK2A 4ZN3A 1HYLA 1S99A 1UEKA 1SGCA 2DGXA 1GJ5H 1L2EA 5FDLA 3M4XA 1EJMA 1UW4A 3BPDA 5IT4A 1EQ9A 1GL1A 2HQDA 2FC9A 1CBKA 1KD1T 2QLXA 1ZPCA 4U95A 5HK4A 3VQSA 3W1EA 4AGJA 2Q6GA 3S9BA 1HNVA 2CPIA 1WSSH 4C3LA 4QPXA 1AFEH 3ATLA 1FY8E 1ZA1B 4ECQA 4J9QA 2PP6A 3HHKA 4ABAA 4V19J 3HFKA 3S0NA 2WW8A 1D9DA 2XGQA 1C1UH 2CQ2A 4KIAA 1WNEA 3P3DA 4NLYA 3WHIA 2ASUB 2LDIA 4J9UE 2HWIA 4LBPA 1XMQF 2RDLA 2CNKB 4FYWB 4JI5F 4LSNA 1DWEH 4K1EA 1KFSA 4LF4J 1LVMA 3DXSX 1LPZB 2HFVA 2FIRH 4WYWA 3RXSA 2JVOA 1Y11A 1RCXB 2XP8A 2FODA 2RNEA 1MTVA 2AGEX 2F4VF 1Q86T 3MEGB 3IWLA 1R6YA 4QU7A 1S4FA 2ZBQA 3BTGE 3N79A 3VV2B 1REVA 3CCES 1FFQA 3N0VA 1OWJA 3E8OA 5BRRE 1TFXA 1NNDA 2HHPA 5DDQC 4Q7NA 3CJ2A 2B7BB 4MNVA 2WPMS 2N7YA 3GCWP 4OHZA 1TFWA 3RRGA 3PYDA 3VG8A 2OMOA 4U84A 4DROA 5CH7B 4NASA 3BGOP 1T4VH 5DS7A 4LT6A 2IFXA 1Y3WA 4DZ6A 5HL7Q 2UUAF 4EZ6A 1P2IA 2KDOA 2R8KA 3JAMY 2FEQH 1A0JA 3F0NA 1MU2B 2YNFA 3ILJA 1D3QB 2YBTA 5HP1B 1MNEA 1URNA 1M5VC 3GSDA 5HBMB 1T05A 7AT1B 3C3LA 2XBWA 1X9SA 2PBCA 5G4BA 2QFIA 1G2LA 1TV6B 1BKFA 2CYYA 1HAGE 4U01A 1BTWA 4RLEA 4EU0A 3GPKA 3E3XA 2AEIH 3R9LA 1FFSB 2IMOA 3DMJA 2XNRA 1HKIA 1NFXA 4OFZA 2NCKL 4RU9A 4D7FA 1G4CA 4RT1A 1AMHA 3S7HB 2RQCA 2W9CA 3LGNA 1PPHE 4YESB 5A8WB 3I82A 7GCHF 5EGYA 3PV8A 3V12A 4K1TA 5LJ3Y 2GFFA 2C3SA 3UPEA 3TA2A 4O3RA 1LOUA 1H0GA 1WTBA 4YTAA 3SJ8A 2VVVA 4CO4A 2KCOA 4Q2KA 2HRUA 2W3IA 3ARZA 3T5JA 2ZNYA 3H90A 4DUYF 2MKKA 5E8EH 3D1OA 4YUDA 2FZZA 2LPRA 2B9XA 2V4QA 1Y3YA 2M3DA 4F04B 3GIIA 2F1FA 2XP3A 1HA1A 1NDLA 2BRKA 1QDUB 2BD7A 3CMAS 3ELAH 1ZOTA 1TMBH 3LTOA 4BCAA 2GC8A 3KJVA 4WK3A 4J9OA 1FRIA 3DRYA 1KKHA 3RB3A 3KLHA 4XRNA 1AUSL 3KG4A 4F3QA 3N6MA 2F91A 2J97A 4FP9A 1DXPA 4ECSA 2OPQA 1AN1E 5CXTA 3CW2C 2CVIA 4WP9A 3C6UB 2G51A 2Y9HA 2K0QA 3Q83A 2W1BA 4FETA 2ITKA 3SHAH 1YIJS 3EYDA 1PYTD 2L9NA 1VIOA 1D09B 1Q81T 1U6BA 1PQ8A 1RT6B 3BIVH 2XYPB 4MKBA 2JH3A 2V69A 2V2KA 1KXCA 1DT2A 3WC0A 3A89A 1VF8A 4Q8FA 4NLOA 5BR8F 1K0VA 3BN7A 4FXGH 4C2MA 3A86A 2XO6A 1Y5AT 3QTVH 3H20A 5B0DA 2SXLA 1U48A 5KFSA 2X1BA 5H9EJ 1JWWA 1C5YB 1A9NB 1LKBA 2H9HA 1O3NA 2PUXB 2ZI2H 3LGMA 2ZH2A 4ECZA 4FYDA 4BXWA 2J9DE 1EXFA 1W10U 1AB9C 3UQAA 1YPKH 2IPQX 1J15A 1F7ZA 3N5BA 5IZHA 1TX6A 3V81B 3BTWE 1XJWB 1KIGH 2XULA 3BSNA 3MM8A 1C5UA 2OGUA 2OJ3A 3UDLA 5LM7E 4W9OA 3IG6B 5HLFB 2STBE 3LU9B 2GMTC 1R8CA 3QNWB 1C5OH 3SNDA 2BVSH 2FVQA 4KTQA 4OS4A 3ZYDA 4LSNB 2H3EB 3KHGA 5FXLA 3ZNUA 3NL0A 2RHSB 3UN3A 5E2OA 1KXBA 2BZ2A 1RK8A 1WG4A 2YNHA 4CI0B 3ARPA 3AH6A 1W7XH 3RW6A 1DLKB 4CHAB 1GGDC 3KK3A 2C3YA 2MQ8A 2B7CB 2XOKD 4WIIA 3UDVA 1IQGA 5IT0A 4C02B 3LGUA 3QFHA 3NI6A 3FP8E 3H2UB 4QWAA 3BEFB 2ZE2B 2DGQA 1X6NA 3SU4A 3K89A 4A1TA 4X66F 4LFAJ 3ZZOA 4AB8A 2OSQA 1RADB 4TY9A 3TQEA 1IKWB 1RT2A 4HKQA 3EDQB 4NZ6A 2GS8A 1WC5A 3MR5A 2G00A 3M2RB 1CBWB 4PG6A 4DUTA 1VIXA 3ONQA 3EGZA 2HGLA 3W2WB 1K2I1 4YR2A 2V35A 2A32A 2XBPA 3CEDA 1T03B 1W0JD 2ZWOA 3T6JA 3UCUP 2ZJRQ 2V0NA 4LFAF 1EFRD 3LWMA 4TY6A 4NXNJ 4UFFH 1D3WA 1NN6A 2XZDB 3W61A 1NH7A 2WAQD 1P10A 4WXWA 3R5BA 5AXKA 2ZVSA 2YX7A 3D3CJ 4I2PB 3SZNA 3AQOA 4IR1A 4HACB 3TYTA 2LMIA 1K1MA 2FJBB 1S48A 3U69H 2CAJA 2R7VA 5C42B 5C1XA 2BBEA 2HHHF 4X4PA 2Y8WA 2HNDB 3KDNA 3IAS9 4FVBA 2ZU3A 1HJ8A 2ANMH 2UXCF 4USTA 1EKSA 3KJNB 2LPVA 1C5WB 3A3OB 5EX0A 3I0SA 1RTJB 5FPYA 4CO2A 1BBRE 3KN2A 2GMJA 1TU0B 3EGKH 1RIWB 2W25A 2ZDNA 1VFJA 3LQVA 3MCOA 2U1AA 2ZHBA 1EAWA 2QMXA 1P1TA 1YJRA 5DDOC 4WJG2 1FY1A 4JI7J 2BYAX 3QGJA 2G8TA 5DETA 1SFQB 1DURA 5KFWA 4LSZB 4TYDA 5I46H 3UI5A 3LJJA 3WC2A 2MXYA 1D3TB 2HK2A 4INLA 2RKIB 4PABA 4K5ZA 2MZSA 2R8GA 4MIAA 4X66J 2DE9A 4M5DA 2WM0A 1TE0A 5KT2A 1QSYA 1W14U 1FKTA 2AGPA 4DCOB 4NLDA 1QA7A 2BVRH 2X3DA 2XC5A 2IJRA 1QPFA 1FJGF 2ZTYA 2WPLS 5L30H 1UJ5A 5H9EK 2Q1JA 3MH5A 1DICA 3TJNA 5J2QA 1AUTC 2BHGA 3GIMA 3KHRA 2ZH4A 1FVQA 4S0MA 4B3OA 2IC3A 3SORA 4PG5A 1QBVH 3ETMA 3TEHB 1Y3VA 4ODRA 4X1SU 3V3MA 4G6VB 2ULLA 3UNSA 1E79D 1HJAC 2B7DH 4DPWA 3RU4D 3ADAC 2ZCLP 4FPRA 3BYRA 3M5NA 1TGTA 1RT3A 1GMCG 2R2SA 2E29A 1NH8A 4ZVOB 3DI6A 4CO3A 1JLGA 4IW4E 4F2SA 2KO7A 3QATA 2JFKA 4AXJA 4INKA 1FRXA 2GT8A 2JEIA 2BDCA 4OI2A 3JQMA 2XBVA 4U67Q 1S59A 1BUIA 1E36B 3FP6E 5J6EA 1MMJN 1KNZA 1F9HA 2CQIA 3KIDU 2ABYA 2Y1JA 4WPAA 3FOAA 3KLIB 2BDPA 5C1UA 3FKSD 5T6DA 4A8MP 2XSJB 1SIZA 1V2PT 1CLFA 3S9CA 2X3GA 2HHUA 1XUHA 2MY8A 1RWWB 1H3DA 5AHGH 3HK3B 1TOMH 4FS2A 4H4OB 4JCNA 3OL6A 3Q24A 1TIOA 4RBTA 1A0OB 2AJQA 3M32A 1XEZA 4GRSA 1UVTH 1W12U 4JZEH 3A8IA 2R4FA 2NS1B 2OFGX 1OY9A 4QYZK 4K4ZA 3O2IA 4JI6J 5KFLA 1AVWA 3AK5A 5B09A 1D3DB 4BOHA 1JOUB 1HI8A 2Z2YB 1RB0A 3C15B 3FMWA 5A6PA 3D28A 3LH3A 4CRAA 4Y28C 4ED4A 4XE4A 1QZ8A 1NSAA 1TPOA 1IBLF 3RXIA 4DG4A 2I1RA 1L3VA 1MROA 2QLWA 2CJIA 2HVIA 1S85A 4NZQA 3BTHE 2IBOA 3GLJA 5EIYA 3D54A 4DV5J 3M8QA 1TOCB 3EZUA 1BMLA 4DI6A 4DX8H 1T94A 3KUEA 4NRTA 2XB2D 2R7UA 3NTPA 2GVDA 2BQ7B 3QLPH 2VPWB 4DWSC 4KHPJ 3VAHA 2Z4PA 4DQSA 4X2WA 3N01A 4ZK7M 2QJ3A 4FUBA 1WC1A 3BMBA 3CJTA 3CCSS 5F8ZA 1RHMB 4ECWA 4K4YA 3D0GE 1D7HA 2ZDOA 2ZCHP 4IS5A 2V2QA 2VOPA 2LXUA 1UHBA 3UVJA 3AA8A 4X6NA 2QGRA 1P9SA 4LBIA 1FONA 1C5SA 4B2CA 4M5GA 4F0MA 1S9EB 2BE7D 4RW9A 1BOQA 3IBFB 3KACA 2AEFA 2MJUA 3AOBA 3FQLA 4OZ5A 3O5MA 4DGJA 2BY5X 4WBFA 3BDPA 2ZDLA 2VBYA 2QN6B 1K22H 2BTCE 2BY9X 2UXBF 2W7OA 3RXRA 1C2EA 2NWNA 1AE8H 3CO0P 1RT4A 3FRZA 3DRPB 2IOTA 3CD5A 1G2EA 2J98B 2FESH 1KFWA 3ATKA 1DS2E 1MUEB 1M0SA 1O2YA 5DGAA 4M63A 3PY8A 5GAEU 5H4IB 1AROP 3F0OA 5HJXA 1O3MA 4HHHA 2CN0H 4XSKU 1FY3A 1FXDA 1D2KA 4DR7J 4TY7A 1GJ6A 4MK7A 4GKJJ 2CJAA 3MMGA 2OPRB 3WD0A 2MQNA 4IDKA 5KFKA 1UEUA 3QRRA 1QJHA 2PGCA 3AROA 2VFTA 3X1LB 1PC5A 3AJ1A 4B9UA 1V2UT 1RAAB 3IWXA 1Z8GA 4PROA 2FQQB 2PLXA 5EHHA 1ICEB 3UAIC 1GJAB 1XERA 2HRVA 3T25A 4DF4A 3A81A 3O5TB 3WX8A 2IBKA 2Z9JA 3PV5A 2CQCA 2PTNA 3BZQA 2ZM6J 1YZ6A 3CGMA 3MCNA 4DIPA 4C48A 3V13A 3KQDA 4C97A 4WFNQ 2XQCA 2B9EA 1FT8A 4L3NA 1W9PA 1C1PA 3U1NA 2A3BA 4ZDNA 3D7SB 3QO9B 2CJBA 2ALVA 5BXIA 2UUBJ 2VIDA 1SSXA 4F8RA 1FD8A 5C24A 1B0FA 1TFYA 3MECA 2W3KA 2WONA 4F02A 2ZGXH 1KT0A 3KK1B 5LPEA 1JNTA 5I98A 4X2VA 1SBRA 4EI2A 1TKTB 3I5BA 2HRYA 4I7YH 1YLNA 2G4TA 1QRWA 5SZTA 3I5AA 4QBUA 1DANH 3KZ7A 4EGLA 2WVFA 1FRLA 1GBEA 2VJUA 2LKNA 1FDBA 2LDYA 1NU9A 2KFWA 1X5SA 3M8QB 4JI4F 3HKWA 4MPXA 5A2MH 2IMWP 2CPFA 2OLHA 5FJ4A 1LWCB 2NXJA 2AYEA 4ES2A 3I6CA 3PJ9A 1MTNB 3GV8B 2R7WA 1TUWA 3RRHA 1O3FA 1T0TV 2QIFA 1K8AT 3PMBB 2WPIS 2TBSA 1VYAA 3TA1A 1JXEA 1SQTA 4AL6A 4OHYA 2QX0A 2RT3A 2ZUGA 2PI5A 1GVKB 4FYVB 4KSEB 2OSRA 2MZTA 3PHTA 4G1QB 3TQ1A 3KCEA 1UZDA 3P17H 5BYQA 2FO9A 3HVRA 3ENVA 3N7OA 4Y2KA 1PBAA 3SQHE 3R3TA 3KHLA 1N5QA 2KT5A 4CH1A 3B9FH 2MQLA 4DV1F 1O5GH 3L95X 4YN3B 1W13U 1Y5BT 1GCTB 3WH0A 1HXEH 4WE1B 3QQCD 1G3DA 2VF3A 2BLQA 2YKAA 3M2VA 3VB3A 1X8DA 4ISOA 4AQYJ 4O2TA 2BOKA 3Q3XA 2HVHA 4C8LA 4UQGA 3FNNA 4K50A 3R5GA 5IT9Y 1UTJA 5KOWA 3MF5A 2VONA 3R27A 1FKOB 1HJ9A 3QUMP 1ZZFA 4DUYJ 2XI3A 5JMNA 3W5ZA 2W4DA 4DU7A 1NRNH 1IJFB 2EC9H 3HATH 1SGRE 1CQNA 1AWFH 3PTBA 2W2QP 4JP8A 2EFVA 3NUMA 5LPFA 1UKUA 3KHHA 4ED5A 1LQEA 1TA2A 4GGQA 2DEIA 4LXBH 3GCXP 4PCQA 2HBRB 1YCPH 2UUJB 2MMYA 3W9IA 2JETC 2R3UA 4K2JA 2DNGA 2DH8A 3ATMA 4X84A 1LW2B 1FV9A 1ZGIA 3T5KA 1K9MT 1D8YA 1TRNA 3A82A 4UZBA 1MD7A 2HLDD 2O9QA 2I6SA 3FJ2A 1NWRA 3KABA 5JBBS 4FYYB 4CLPA 5KAKA 4J2YB 5FPSA 1XWLA 4ZLPA 2DG9A 1S9GB 4BTTB 4QR2A 4KGVB 1EAIA 2CRLA 2NSBA 1U8SA 5A0AE 4Q44A 2BMGB 1PYSB 2WZQA 3TGJE 2M7SA 3ENAA 3M3VA 1VGYA 3CGIA 3SGQE 2HS3A 4Z1MD 1LMWB 4FUCA 2OIHA 4MFBA 4IQCA 4NCGA 1NKBA 1APSA 1V2NT 1VRUA 5BR8J 4ELVA 3BTFE 2GCHG 3IWMA 2HIYA 3K65B 1HJXA 2HPQH 3PWBA 1HRTH 2VC0A 2J95A 1RJXB 4Y2AA 1RCOB 1RZMA 1JWTA 2N3LA 1AZZA 4LRDA 2XS2A 1F0RA 1A0HB 1P0SH 1P2NA 2DIVA 2GGPA 3VZHA 2ZIQH 4ABHA 2F65A 5C0TA 4VGCC 1JQGA 3LJOA 2E5GA 3DGVA 1HPZA 1W2BR 1CSJA 2P4VA 2HNYA 3MMBB 2ZHOA 1Q2WA 2L6OA 5FAHA 5DP7A 3MEEB 4F4OC 2GVZA 1GNKA 1NB2A 5E3QA 2CJQA 1TMUH 2MKYA 1C5QA 3DC2A 3MOZA 4C7QA 1VQYA 4WCEQ 5EODA 3L33A 2HBQB 2DR7A 2ZC3A 1S9GA 3SV3A 1IM6A 2C8XB 2FTLE 5HANA 3IXQA 4DL0C 4URIA 3F44A 4X1QU 3FAPA 1JJ4A 2OBQA 2Q1LA 3R7SB 3BSCA 1T8MA 4H4KA 3IS9B 5HQMA 1C2FA 1FWLA 2OPRA 3T1YJ 2C42A 2CHAC 3QRQA 2YMSB 1O51A 4PXBA 4Y2CA 2BJ7A 4LAVA 3SQGB 3RC5A 2BLVA 1DOJA 5EW1H 4XBCA 1RTIA 2CQ1A 3PJXA 2J0XA 3AVZA 2Z9IA 4RNOA 4JYUH 5C2CA 4OHWA 1NJXA 3TANA 2J2UA 4O3OA 2MKCA 1SJFA 6AT1B 3TX8A 1JLFA 1VQ6S 3TU7H 3RGCA 1T4UH 3L09A 3ZC4A 3AS0A 5H1SV 4NZLA 2B43A 4JI1F 1BQMA 4USVA 1HD1A 4YT7H 4HT7A 1VBZA 1TP7A 1SJRA 4RWWA 5IM0B 4OZ3A 3KK3B 3UDCA 4DR1J 1S9EA 4AL5A 1HHTP 2C2ZB 2BY8X 1FKJA 2VBZA 2Y1IA 1M5PC 3CDUA 1EDQA 1UVUH 1RWXB 3CJ3A 3UWTA 2RVJA 1RE1B 1N0VC 2C3MA 5BYRA 2HHWA 4P8WA 2B31A 2FOCA 1ESAA 3GSIA 4RW4B 4PZVA 4YM9A 3X3UA 6GCHF 3EJMA 3GY4A 1A1RA 5ETPA 3CF5Q 4KKDA 2DJWA 1AW0A 1Z6EA 4CLTA 1LXNA 4OYZA 1FKOA 3IRXA 1T9UA 1EETA 4ED2A 3QGHA 2GQ2A 2RF2A 3NWUA 4ZKRU 3MEKA 4ZP8A 4JZIA 4U32A 1ZH5A 2IA6A 2KJVA 2B9YA 3FVYA 2GDDA 1THPB 4LZ4B 2FJWA 1AVGH 1GHVH 4K4TA 2JIZD 3E01A 4DRNA 1TX8A 1G7CB 3DLBA 2RA0A 1NDPA 3V4IB 2ZH7A 2XWXA 1XN9A 4B3OB 4X4QA 4ABIA 4DRJA 1ESTA 4X2BA 1HAYB 1XC9A 4DBQA 2QN5T 1FJGJ 4YS2A 2KB2A 5AXNA 5DSFA 2XC0A 1K1SA 4F36A 4X62J 5IV4A 5KFMA 2QLFB 2F7VA 1NK6A 4NFEA 3QO6A 5L6NH 3LKWA 2QYIA 1KONA 4F48B 2O5DA 1W26A 4ECVA 1K47A 4NSVA 1RHUB 4BDPA 4C8NA 5A8KB 1X6LA 3CWJA 4DL7A 1N32J 1RBOB 4P71A 4TU8A 4K0KJ 3F1SB 2YWHA 3U8TH 1ID5H 3FZDA 2RKIA 3HPOA 5AE1A 1LDTT 5J1NA 2JJ1D 4P9SA 3H4BA 1GBFA 1GGDB 2FJVA 4PTMA 1EZUC 2IJNA 2HK3A 3GY2A 4OQJA 1FKPA 1RT3B 3N5FA 3NNAA 1WXRA 1HLWA 4Q45A 2Z57B 1BRAA 2FWWA 4NIVA 1KTVA 3LAMA 2PEHA 2G13A 3A12A 2I6QA 1R0CB 2HWTA 1QCPA 2A5AA 2YKMA 1Q5YA 5C25A 4OJHA 3SV4A 3HHLC 5ESTE 4ACBA 1FD2A 2BQ6B 4RW6B 3DU5A 2YQ0A 2ZD1B 3CHFA 2G1HA 1P5QA 2UZ5A 2UP1A 4CH7A 2OTVA 4JOUA 3D4JA 3CHCA 3QGIA 3ZIAD 2BABA 4A7IB 4EFAC 5HP1A 2BVXH 4ZHLU 2EKNA 1GJ9B 4HTJA 3J7YU 1OWHA 5DLGA 4ZVGA 1RTDA 4IT6A 3UR9A 5HXFA 5E0GA 3MM9B 2DXDA 2JJ2D 2ZKUA 1TNKA 4B76A 4IDKB 3W9JA 5CZXA 1F3VA 2BOAA 3W2WA 5LMNF 5KG4A 3EGVA 3Q76A 3FCHA 3THTA 4KFBB 2PUQH 4AGKA 3ZZBA 2MTLA 1K28D 1M1GA 2LKZA 1LNQA 4MLFB 4R8TB 4NA1A 5B0AA 3K6YA 1S49A 2V50A 4USIA 1HNXJ 4UE7H 1UWBB 4N8OA 1ELFA 4HHJA 3LPEA 1C5XB 4J9NA 3DRPA 2MZJA 5GVQA 2ZE2A 2LU2A 1K1LA 3AW0A 3PW0A 1HCGA 1NRSH 3CCJS 1ZGVA 5C42A 1TNJA 2QXJA 3VALA 1C2HA 2VH0A 2DB1A 2VFRA 2RS8A 2ZC4A 2VIPA 2F8HA 8GCHG 2IM1A 4IG3A 3ZZRA 3D6TB 4CTAA 3B8HA 1EKBB 4DOZA 3WX4A 3GDSA 3BV9B 3RUOA 3RJMB 1Y3XA 3Q00A 3OV7A 1CGIE 2HQGA 1IBLJ 3W66A 1NB7A 2C93B 3HVTA 2SGAA 1RWNB 5SGAE 3IR5B 4DSIA 2CZ9A 3T29A 1BTYA 1H0HB 3OT9A 2FLRH 1TTHB 4NCBA 3US5A 1UFLA 1NBMD 2WPHS 4NWBA 3IGNA 3V81A 3UNYA 2GHWA 3DXBA 4ZVEA 3EVWA 3AD8C 5FPTA 1HJWA 3KLGB 1FNXH 5HO4A 3S7KB 5J1EB 1SBWA 5LMUJ 2G2OA 1AZ8A 1NROH 2C2DA 2CQHA 3AS3A 1DY9A 1RT1A 3UFCX 2FVRA 4NLPA 1AO5A 2RUSA 2ZEBA 1HHQA 2YKQA 2UWLA 3KCGH 3J7A1 2R0KA 5KGOA 1W7WA 1XNRF 1H74A 2CPJA 2DSVA 6LPRA 2GIRA 2ZOGA 1BQNB 1TRMA 4WF8A 3CP7A 5CHCB 4BANB 2O8LA 1SQFA 2WV9A 1UVJA 1RKJA 1W0YH 4LF7J 2PHBA 1ZBKA 3BG8A 2FXRA 1S1VA 2ZQUA 3M6WA 3SNCA 3M2UA 1NKCA 1KN6A 4P6QA 4C3KA 1RD3B 4NLUA 2QMUB 2GJFA 4DPUA 2FI3E 2UV8A 5H9FK 3OAAD 2J8AA 2V8DA 1P8GA 2KFYA 4LF1A 1KWMA 3ZFVA 2NU3E 1KY9A 2G8ZA 3T1YF 4GVLA 2L9DA 2ZHFH 3KF2A 2ZHQH 2FGOA 3D3BJ 3TOQA 3OFEA 2CQ0A 1B7YB 4I86A 4O3SA 3OFND 4UFDH 3BR8A 2E1CA 3OVAA 4BTUB 2MLXA 9ATCB 2BM0A 5GMKa 2KXNB 3GG1A 1CA0B 4K4UA 2V6AA 4MAKA 1BC6A 1S0OA 1O2QA 3QX5H 4K2YA 1S1WA 1NPMA 1BL4A 2ASYA 1JLGB 2GMLA 1P06A 3T5FH 2BQRA 3DI6B 2UWOA 4L72B 1FY4A 1TGCA 5DP8A 2FOEA 4YMEA 3MPUB 4LZ1H 4WFYA 2UUYA 5TCAA 4E98A 2NXNA 4CNYA 5LMUF 4OYIA 3GY5A 1AB9B 1TV6A 1W1TA 3MGJA 1XIQA 5EDWA 4WFXA 5ETNA 2YNAA 4Q7AA 2ZFHA 1KP6A 3BKTA 2C3UA 3NAHA 3KLHB 1U49A 1PQAA 4UW2A 1S72S 3UW1A 3VB6A 2DY9A 1B0VA 1PC4A 3KJVB 1L3UA 2HEKA 4QIEA 2EVZA 4IYQA 4ELUA 4X4OA 2BQ3A 2AJ4A 4J9RA 4YHHF 4DL6A 1DTTA 4RN6A 4WMFA 2AGOA 5LSOA 1V2LT 2GA7A 5KG5A 2PSYA 5KFFA 1EZZB 4LF7F 3A8AA 2EFOA 1ZZZA 2AGGX 4CREA 1FIZA 2EQNA 2ZUAA 1MTSA 1IKXA 2WOMA 3LOXA 4K2XA 4I33A 2GCHF 2BJ8A 3K5MA 1IBCB 2D1CA 3SV7A 2DUCA 2K3KA 3DSOA 1L5UA 1Q8IA 2PR3A 4QYRA 3KAFA 2BOPA 2QL9B 1THSH 3F2GA 1E0FD 3F0PA 1N34J 2HZAA 2WHXA 1Y7PA 1VQ4S 3KLFA 3TLOA 1TNLA 3QIPA 1RBAA 1C1CA 3H4DA 4HACA 4WU2A 3WW7A 2PTCE 2D2DA 2L74A 3SBMA 1L0ZA 2CIMA 4AX9H 3NRBA 3GY8A 1WKKA 3OW2R 2BE2B 1UL3A 2Z9GA 1H98A 3QWPA 1S7IA 4JV0A 3PDNA 3UR3C 2BEFA 1U1LA 1MG7A 4U7CA 1KVKA 2VKRA 3DOMB 1ZK6A 2MLYA 2XHWA 1UFWA 1YCPK 2XEXA 4CTAB 2UUCF 1BBRK 1IQMA 1JBUH 3QZQA 2F3JA 4U7UK 1N34F 2WYJA 3E90B 3EX7B 3DM2B 1G9IE 3HKJB 2GO8A 3C14A 2XMWA 2EI5A 1D9IA 1UO6A 5J1EA 2EA3A 2NPIA 4P73A 1J27A 2HQFA 1SB1H 2J6UA 2OPSA 2X1FA 3M1VB 1Q8LA 3MI7X 1REVB 2Y1RI 4P8VA 1Q8KA 1C4V2 1S0MA 2XBYA 1YJUA 4Y6DA 4J4OA 4UOFA 5DIUA 2PDAA 1JNSA 2QGFB 4IO9Q 4EWTA 4OJ1A 3VQTA 1T8NA 2P59A 1WUUA 4JI3J 1O3PB 4FZVA 2I5JB 1VQOS 5B0EA 2AWGA 1H9LB 1W8BH 1GJ8B 5DQIA 1DTTB 3K5OA 1C5MD 5E41A 2D3UA 1C2DA 1GVLA 3BEIB 2NXCA 3FFIA 3I56S 2HNZB 3M9OB 3ZZ9A 5J2NB 1CC7A 3IBCB 4ODOA 3WQWA 2J34A 3PACA 5K8PA 2VB0A 2F5GA 3NMRA 1C1SA 4WK1A 1ELBA 2FOAA 1LWXA 4XBDA 3V0XA 4A48A 4NYZA 1ZYOA 4I56A 2BX6A 3ZXWA 1NRQH 3VR1A 1X4FA 1B64A 1JNDA 3P6YC 4P00A 1ZRKA 1CS4B 4OIXA 1GMWD 2JEFA 1V2VT 1SL3A 5LXYA 3NGRA 4MSPA 1XXFA 2OQUA 5CHBA 1KXAA 1TAWA 4IPXA 3RBDA 1B7FA 3KLEB 5J2MA 2YH0A 2G81E 1RSCA 1V5VA 4FU9A 3UE2A 5JJBA 4CR9A 4MKAA 2BJDA 1UWBA 2CQDA 8RUCA 3OVSA 3C27B 3JQJA 3UIRA 2R3VA 2AKWB 1XUIA 1TQ0B 3PMAB 1J9CH 4Y79A 2XGPA 4HGCA 4PEOA 3O1LA 2ZGCA 4C8ZA 1GMHF 2R8HA 1NEEA 1YBAA 2HMIA 4F55A 2FLBH 1NPPA 2BJ9A 2CNOB 3I31A 2NREA 1VQKS 1XR5A 1QAIA 2JL9A 2XY6A 1A4WH 1YLXA 2BD2A 4RW6A 2YKNB 1WI6A 2Q6FA 1FDNA 4R0EA 1IQFA 3F9EA 4GC6A 1VQSA 2OEMA 2VBXA 3RAMA 3O5EA 2HLCA 2JH5D 4FUHA 1JIMA 1O2LA 5GADI 2BDAA 2C28A 4ZITA 2A2QH 1UA0A 4CRFA 3FRYA 5EWFA 3UUZA 2VQFJ 1GBDA 2HQIA 4TWYA 2OC7A 1OX1A 3L7OA 4XK8C 1SCJB 3RM4A 1PJ7A 1FKPB 1WSRA 4M5MA 1EJAA 2ZHWH 3L4BC 1D7JA 1ZTKA 1GJCB 3MM6A 1TR0A 2L2SA 3O5JA 3UCGA 2OTJS 3V6KA 3KTQA 1YK9A 2AU0A 4AOQA 1WEXA 1HBOA 1N5YB 1YDLA 4OV1A 1FJ7A 3HM9A 3ZZPA 1C1MA 4R0XA 1RT1B 3I87A 1NO9H 1RAFB 3OHAA 1R9HA 4YR0A 3AA9A 1K1OA 1O2TA 1F5CA 1V9OA 1HWUA 1OPHB 2WTFA 4HR2A 2LQ5A 1P02A 1Q3XA 1BD6A 1QB9A 2A7HA 1TK0A 3T19A 2IRUA 4NLWA 3SCJE 3MU1A 4QIFA 2L41A 1TQ7B 1DPOA 5ETLA 4NLTA 3I4PA 3PO1B 1OPIA 1N8RT 1BQXA 1UTKA 3CTRA 4QWDA 4RWXA 3NEKA 3RAQA 1OY6A 4ZVRB 4X4RA 1UVLA 5I3UB 4G50A 5GCHG 2ZWLH 2YOLA 2YX1A 1AB8A 4KHRA 1SPJA 5EWGA 2HW3A 4W90B 1F5RA 4FKXA 2A4GA 2FLNA 2KI3A 3W64A 3PCOB 3O8WA 3J7ZT 3H09A 1YITS 4GVBB 1YPHC 4FS1A 3MQKC 3HF5A 2FUG9 3DGPB 2A1DB 2A5KA 1JJCB 1WEYA 1FRKA 2FI4E 1FDPA 3MPWA 5EGMA 1AE5A 3N6LA 4C0OC 4ZHMU 3ZVCA 2GCFA 1LTOA 3DSPA 3WIUA 3PLPA 4Z37A 4IQMA 2OFHX 2I8EA 1YG0A 1PAUB 1GX5A 1WKJA 4HH1A 1SKUB 5B0FA 3TAMA 3NGSA 1FFRA 2IAJB 4DOQA 2A6OA 2CHAB 3DT0H 2YMSC 3MM7B 2ZPSA 5GAEI 5D75A 3P92A 4B3MF 1GBBA 3SYJA 4ODLA 4S3KA 1HW8A 2XYGB 2VICA 2CGAA 2GZ7A 3SNAA 1NRRH 3NZIA 1VCWA 4CH2B 4KTSA 3DDKA 3UNQA 2X51A 3T41A 2R2TA 1V5IB 1ZLRA 1Z6JH 2XTJP 2KAIA 5F3ZA 2KXFA 1SYTA 4LOYH 2P3FH 2JJ4D 3RU4T 1HBMB 2AIQA 1QJ6B 3U1LA 3AAWB 1C5LH 2W9BB 2EKYA 4OI6A 1SI9A 1EUFA 2WRMA 4RKOB 2EFNA 1OWDA 5HMXA 2R7OA 1P1LA 4YXWD 5KG1A 1CVWH 1NHVA 1P6TA 4V19X 3ATWA 3ZZTA 2Z9KA 3J81Y 3UD4P 4GMKA 2PT0A 3ZZDA 1C9HA 5FDLB 4JZFH 5ETVA 5KFBA 5M2UA 4MNJA 2ATCB 3QJLA 1QGFA 1C0UA 1HNXF 3PHEA 3MMJA 2DNYA 4ICLA 4A8SA 4X64J 2BJEA 2RA3A 3KXDA 4O3QA 3SV6A 4I8JA 3BBFA 4URGA 4NXMF 1V2MT 4IQXA 3WDOA 1NMWA 3MEDB 1NJIT 2FLOA 4DCJB 5KT7A 2HHQA 2K1RA 2XCNA 3UD5A 3MM9A 4ZXXH 4MJKA 1OYTH 1RTDB 4B73A 1LVYA 3LO3A 4TY8B 2DSUA 1ZCNA 3CHDA 3RM2H 1MWQA 4HT5A 3L7PA 3MCSA 1BTZA 2CQ4A 2DHGA 3AS2A 1JLAA 3LP0B 3FKBA 5CYQB 4WFAQ 3RMEA 3HK2A 3GILA 4NFFA 1XQIA 4ZH8A 1TK5A 2ZZMA 1NU4A 2P16A 1SV5B 5FHTA 4IMZA 1MN9A 1YKWA 1TPAE 1L3SA 3TRGA 4ZCKA 3CJKB 1S1XB 3Q8RB 1PO6A 1WOSA 1D7IA 5D3GB 2ASJA 3O5OA 4WKYA 5E33A 2HNTE 1YGYA 1UMAH 4JYAJ 4L73A 1Q4RA 1QRZA 4I8LA 4HVZA 1S0RA 2LQ9A 3O5LA 3W7BA 3Q22A 1O3JA 3ODKA 1YPGH 1ELDE 1CBWC 2GTBA 4DY7B 4NI2A 3CMQA 1ZTLA 1VRUB 1U09A 4U6PA 2HRTA 2R2MB 2J7UA 3RRKA 2J0SD 4I8GA 5I3PA 2QCYA 1BY9A 3M8WA 1K1IA 3S1TA 2TGPZ 2ROPA 1IQJA 3S9AA 4RW4A 1TNGA 3MDYB 5IFMA 4ODQA 3M36A 3W94A 1QVGR 3NPSA 4M9FA 4PXEA 5KT6A 2LELA 5CA5A 1ZETA 3OR1B 1YCPM 2J0QD 3RXFA 5F41A 3QRPA 4LR7A 1GHXH 2KGJA 3KQ5A 5KFXA 4ANDA 3CMES 2Z58B 2ZVIA 5DGJA 2M0GB 3PMHB 4LF5J 1KOHA 3ISND 4LF4F 3EXYA 3V4MA 1H2UX 4X4TA 2DPIA 4ZPDA 3PR4A 3SUFA 1GAOA 2E1MC 2XY5A 1LG2A 2VC1A 5DO4H 1U1PA 1YRUA 3BV8A 1S81A 8GCHF 2UUTA 2VQEF 5KFGA 3MCMA 1EETB 1SUQB 3KJQB 3K9XB 4NIYA 2KI2A 1WD6A 1Y9OA 1E6NA 1CT4E 3DA9B 2VG6B 1TL1A 4ABFA 1RTIB 1PCAA 2P5VA 1TL5A 1GCDA 2BD3A 3BTKE 2LLZA 4Y76A 3M8PB 5FD1A 1NHKL 2B51A 4OYWA 1CG2A 1H1BA 1SC4B 5FIIA 1AUJA 1QZ2A 2EWHA 1W1YA 2QV6A 1RI7A 3D1QA 2QE7D 1WSVA 1ETSH 3MO6A 3CDBA 2XYHB 2H48B 5F3TA 1RT5A 4WXVA 1HNIB 1RAHB 1Z8IB 2KG0A 5HKGA 2DRAA 2V3MA 1U0SA 4P8UA 1CC8A 3BDEA 1V6DA 1YPJH 4TLQA 5GAHU 1KLNA 1EIYB 1UTOA 2DGUA 2N4DA 3D5MA 3BG4B 3ODFA 2TRMA 5IM0A 4JFKA 1ZM3A 2P6TA 2GIQA 4O03A 2FPZA 4I32A 1DXWA 3EDXB 1JKHB 5CMXH 1UVMA 3A13A 2RHQB 1RBLA 3RC4A 2XLJA 5E3AA 1KT1A 2W4PA 4CO0A 4JB8B 4W92B 2C2OB 1S76D 3KNXA 4LF9F 2C8WB 1CJUB 4KO0A 4DV0F 4F4KA 1UAWA 1S12A 1NZ8A 2Q5AA 2YQ3A 2ZFSA 3M7UA 2JLGA 5ADZA 1CHOF 5HIZA 1YJWS 2TPIZ 2Y7XA 5C24B 1GDNA 4INHA 4PQUB 5E3PA 1V2OT 3SGAE 3B78A 5I4MA 4K4VA 2J98A 1F2GA 3BSQA 2DT9A 2XC4A 4Q7ZA 2QIQA 1JLCB 4P7TA 6FD1A 1DFPA 1I94F 2GMHA 3HFZB 4ZOSA 1LWEB 3FANA 4M5KA 4E8UA 1FZZA 4JYAF 2Z3CA 1VC0A 4JMYA 2JZ5A 4DLGA 4LJMA 1IKYA 1ZAXA 2H9TH 1XVOA 5L2ZH 4ANCA 2JLEA 4KHMA 4I67A 2QF5A 1GG6C 5L1IA 2HFOA 4PRFA 1WDIA 2BANB 2ALPA 3UFAA 3E0NB 4A4JA 5GPIB 4PUOB 3V5RA 2FAPA 1SGPE 2E9RX 3BPSP 3W60A 1HNZJ 2XXLA 1I94J 1Q82T 2ZHDA 1A3EH 2ZDMA 3M8ZA 3OBIA 3RM0H 1EB0A 3NGDA 3TUZC 4EBEA 1O5JA 4C0BA 3DOLB 4A1XA 1DSUA 2F63A 4KAIA 2HNTF 1SIWB 3HSZA 4M5JA 1HXVA 2ZOFA 4DH0A 3K5LA 1CEZA 4I4BA 2M1IA 1S1UB 1XNQF 2EG1A 3QSIA 3TP2A 4R5PA 2LXIA 4FUJA 2MEWA 2NU1E 3H7OA 1N33F 5DK1A 2BXTH 5C0UA 3Q86A 4DR6F 1BWVA 4ZLNA 1KSPA 3RC6A 2JH0D 2Y78A 5ETKA 4EO8A 1VCQA 3TZXA 1LJYA 4IRDA 1PPCE 3F9HA 3RXKA 5J4QA 1UW9A 2XM3A 3V6HA 3MH4A 2XS5A 2H54B 2Q79A 3TJ8A 2LVWA 1IR2A 5JBTA 1SQEA 1O5BB 1XM1A 1O6XA 5CYMB 4KPYA 1DUEA 1JLQB 3H5XA 1IR0A 3SFUA 1FKHA 4DQPA 1QA0A 1B0PA 3QZ8A 2VG6A 1NKEA 3GV7B 3NS7B 5HM9A 2OTLS 2K3IA 2CPEA 3CDWA 1KHWA 5T7LB 1EQ0A 1MLAA 1F5AA 1EP4B 1W11U 2OBOA 3S8SA 1RWVB 1TL1B 2DHSA 3A80A 4NWLA 1ZYQA 3UOUA 2THFB 3O5GA 3NP5A 1H8IH 4JI3F 3SJIA 2Y7ZA 3I0RA 2J8SA 2Z3DA 1HNZF 2R2RA 4ABGA 1RWUA 1ZAWA 2HQCA 3KLVA 2KM0A 5DP3A 5IWAF 2PEBA 1Z71A 3KADA 3MFIA 1F92A 3JZ1B 3WIJA 6ESTA 4MPKA 5DJBA 3H2LA 4IFYA 4ZKAA 1VHFA 2D3O1 2GHVC 1Z7KA 5HROB 2IC3B 5MLCV 4OL8A 2OEJA 5DITA 1RT7B 1ZOMA 5DP9A 3MPDA 3PXGa 4YDXA 4C8MA 5DDRC 4CR5A 2YVSA 3NGUA 2B8PA 1GT8A 2OCVB 4C3MA 4CLUA 4ZCMA 2ZWPA 1S84A 3B8JA 1SL1A 1X9WA 3UWIA 3H8YA 1WHVA 1HLTH 3KLIA 2CNNB 2GJ2A 2B9WA 2FVSA 2WVCA 1ZS6A 1Q53A 4PPDA 3ARQA 1O5FH 4MDSA 2MYFA 1AQ7A 2PA3A 3V6DB 1SMFE 3WL1A 1DQ9A 3TITA 2V34A 5KFZA 5B08A 5L1JA 3CD6S 2FOBA 3KHVA 1BDAA 1FDDA 1R0AB 4ZJLA 3RM9A 4NI2B 2CQBA 2DGVA 1Y4ZB 3PRBA 3A8JA 3R2CJ 4ISHH 2EK6A 2HLUA 4ID5A 1U1MA 1U24A 4FU8A 4FXVA 1VITH 3D6FB 4DPTA 1ZHRA 5JVHQ 3BF6H 1L1GA 1QE1B 2HHXA 2PD1A 1HV7A 1MU6B 4NZ0A 2CF9H 1H7XA 4I1TA 1PG5B 5DG8A 5L9XA 4GVBA 2PE8A 9RUBA 1DWCH 4IBLH 1VJWA 2G4UA 1GI4A 1O3KA 2ZFQH 3TK9A 1MBMA 3STIA 5HTGA 4OYBA 2RDIA 4I2QA 1MQ6A 1RU1A 1H73A 2AJ1A 4XOJA 2OPPA 3BBBA 4ZKNU 1FI4A 1S5ZA 3H59A 4OZJA 1HI1A 2HVXA 4ED6A 4LVNP 1XNQJ 2VH7A 3P70B 1W2KH 4ZPBA 1U0HB 1FX2A 3AD9C 5K7RA 4NA2A 4I7FB 3P95A 4IMQA 4F4YA 2ANKH 3OSYA 2H4WB 3CXCR 4UY8T 1YBWA 3ZZYA 1SR5C 1J4HA 2NUUG 3GZ7A 2GZ8A 2R3YA 3SI4H 4W9QA 4HEA9 2W01A 3M2RA 4DRMA 2VJVA 2ZITA 2VQEJ 4RUAA 2VPYB 3GCOA 1F5BA 4Q2MA 4WFZA 1UJ6A 4NSYA 3G2XA 3HD1A 2O67A 2ROGA 2ZQ2A 5LSRA 1UK4A 1P03A 2K8GA 3IBWA 4ZJOA 2B0GA 1JLEA 3WZ0A 3P5BP 4WU3A 1SHHB 1VRQC 4NLVA 3BG4C 1H2VZ 3U1MA 4X1RU 4A5TS 5HVGA 4S3JA 1F0SA 1LQ9A 1GMDF 1QLNA 2BY7X 1X0PA 4RW8A 4CYUB 1WG5A 1T7PA 1CS4A 5CABA 4ITSA 3O8DA 4YQWA 3LC3A 4W4MA 4TYOA 2UUKB 5EG4A 1FNOA 1BTXA 2VJ1A 2PMWA 1AVXA 7LPRA 3W5YA 1SR0A 1VZQH 4DR4J 1DLOB 4ZXYH 1A6LA 4Y0ZE 1P04A 2D7SA 4ZA1A 5CD4H 4J9PA 3P5TL 5HWCA 1KC8T 2FX6A 5HJYA 3LANA 3RMLH 1DUAA 4FN2A 4KY3A 4B9MA 3M61U 2AYGA 1CPZA 5TCCA 1FERA 4ZIVA 1C5RA 2WSEC 5F0WA 2HZVA 3HJFA 1UETA 4E05H 1MTWA 1O2XA 1LW0B 3O5RA 3M3SA 1V2KT 2GNKA 1CJKB 3IG1A 3G6MA 4ELTA 1NM2A 4Q80A 2IPHA 4N47A 2VIQA 1OWXA 4AY1A 1O3BA 1YGCH 1ROTA 4ETZA 1NSGA 1A5IA 3RXAA 2J9EA 1IVZA 1NMVA 3DSGA 5J2MB 2M8HA 5BYSA 2Y0SD 1KQKA 2TGAA 4IUFA 2W9BA 1UTPA 3WY8A 3IHZA 2RQMA 5D0RA 1E9LA 4MPWA 3O8RA 4KTCA 4DHVA 2LNCA 3KNGA 1OYQA 1NSQA 5A2QY 4U96A 2AS9A 3GJQB 5E3RA 3C15A 1ELGA 4YO9A 4HG6A 4O3TA 4FXWA 5KFUA 1HAVB 1XMNB 1SB6A 3O5IA 2GCTB 2LJ4A 4FN5A 5GDSH 1DDJA 3OSNA 1LV5A 2HVEA 2PV1A 4GUXA 3JSMA 1JX4A 5KT3A 3MM7A 1BTPA 3Q2TC 4AFFA 2J38A 2P8OC 5EW2H 1YJNS 3MM5B 4X0WU 1LPKB 2XZWA 2PGQB 4H4FA 5H9FJ 4DV5F 5GXPA 1E6YB 3OE7D 3B8SA 3J7YI 3GIRA 3LOUA 3U98H 2VNTA 3KJFB 2HPPH 1RJJA 2RD5C 4WIQA 1MAYA 1DLEA 2BQWB 4W9PA 1LWFB 5GIBA 3QT8A 4DJBA 1MZAA 4RU2A 1GBIA 1GBMA 3POTA 3OTDA 4ED8A 1VLOA 4Y8XA 3C14B 5DPAA 2IJOB 4IOBA 2FLPA 5CHAC 5EN1A 4FYXB 1O3GA 4DFKA 1W9VA 1FKBA 3SI3H 1GMCF 3HX9A 4KV8A 2Z2ZA 3UNRA 2HALA 1GMDG 4H6SB 4RUHA 2ZQSA 3OR2A 3I77A 1WOOA 5EXNA 2W9CB 2IVFB 5EU8A 1IXKA 2MQPA 2FC8A 2ADCA 4XIUA 3G6YA 1YJ7A 4MK8A 2BM1A 3CE8A 1HHSA 4I6AA 1XR6A 4OS2A 3UN5A 1YJ9S 2AYMA 4Q0BB 2MF9A 4QIVA 2Q6CA 1B5GH 4Q7XA 2O8MA 4J1YA 2QF0A 2HFUA 3DLKA 3TVZA 5KFDA 4AFZA 4N19A 2APOA 3GYMA 1ITXA 2UVWA 5HBMA 1KHVA 4J91A 4N8NA 2HQ3A 1ZSKA 3WWBA 2YKNA 3BN9A 2O3DA 2ZBIA 2NR0A 1ANDA 3FVFB 5AVDA 4JYVH 2WINI 1G3OA 2BLOA 3AY0A 3R1HA 5G0RA 1C4CA 3DLHA 1ANBA 4RZRA 1S1WB 5EQQA 3TGKE 1LWFA 2AH4X 4B3RJ 3BTEE 1FKFA 1O2JA 3HSJA 2RJZA 3RB0A 4WJXA 3CDEA 1FKGA 1VBXA 5G0RB 1IKXB 3MU4A 2QF3A 1UTMA 1JMOH 1C5VA 5A0BA 3JTNA 1FI8A 2GW8A 3T62A 1U25A 1DWDH 1KTSB 1I1GA 4DLEA 2QA4G 1G3BA 2HNDA 3PEJA 1WG1A 3C6TB 3LH1A 5BJRA 2IM2A 4Z0KA 4QCLA 4P52A 2Y5HA 1O5CB 4NL5A 1HAOH 3EICA 1G2MA 1GDUA 1JJ2R 5I42B 1BMMH 4G1IA 4AYVB 4RJVA 4Q4LA 5L39A 1A61H 1BB0B 3BSAA 2Y80A 2WCXA 1RRKA 4QJVA 2DHHA 2IHR1 2MKHA 2AIRB 1TBQH 2IY5B 1WTGH 1RUSA 3T6BA 2ZU2A 4ZROA 3OL7A 1ZPWX 1ZZNA 3G8TA 3UPFA 1GBHA 2QAAA 5HLFA 3ODDA 2Q43A 2CPDA 2UUAJ 4ILLA 3RW7A 5GPRA 2HNZA 2PSXA 3WQPA 2CPZA 3I9V9 3ZZ6A 1YTYA 3CS0A 3QTOH 2CJXB 4L3KA 2ZH5A 2QF4A 1IR1A 2A1BA 1XX9A 5JBAS 2NZCA 3M35A 1RD6A 4RUBA 3OJUA 2STAE 2B4VA 2WUCA 3I5CA 1O3CA 3RXOA 2YMSD 2DNMA 2C3PA 4RO0A 3ENWA 1RT2B 3HVTB 2V9KA 4P2FA 4PG8A 5CYJA 3FZBA 1H72C 3SXLA 3IP0A 3UN2A 3LGYA 1FE0A 3SQEE 5KFIA 2XPAA 1KSNA 5F8GA 1IHSH 4NLGA 4RNMA 3DOMA 2H5EA 2EI8A 2VGCB 2HLTA 4ML4A 2PKSC 4CBNA 1WTFA 3M6VA 1OS8A 4NYPA 4L76A 4FUGA 1L1NA 3Q0AA 1PGZA 4FOUC 3B23B 3GISB 1EAUA 1X7AC 3OY6U 3C66A 3MUMP 3PW4A 2FMJA 2DGSA 3NLCA 5G4DA 2KR7A 1TNHA 2FX4A 3L6PA 3QAEA 1BQYA 1F6TA 2F40A 3CO9A 1TL7B 3NS5A 3MM8B 4AFSA 3GFZA 4KGKA 2IYIA 5ETSA 2MY7A 5A8YA 3B82A 2XG8A 1RTHB 2BX3A 2VH6A 3D68A 4DL3A 2KCAA 3TH2H 1N8OB 4UUWA 2YNGA 1P2MA 3GONA 2OI2A 3ESTA 5HQ8A 4WZMA 4TVAB 1N48A 2QEXS 2IJFA 4KGXB 1A5HA 5ETTA 1BZXE 4JZDH 1NXIA 2NSCA 2XCFA 1HQ2A 2XNQA 4PKDB 2V3OH 1E6VB 2UUCJ 4U85A 1RA7A 2R42A 4UUXA 1QR3E 5K0HA 4CLLA 2WOMB 1HYSA 4DR6J 2O9OA 2Q6BA 1Q7YT 1ZTTA 2VIWA 3BYPA 2D9PA 3BO2A 1LKAA 2DNKA 2CJKA 5ABWA 2OPPB 3TJOA 3SNEA 3NCQA 3DLKB 1O2OA 4CLSA 1E6RA 1ZJDA 1QJ7B 2JDID 4AORA 5SUHA 1Y0HA 5DGBA 3QGNB 3SU5A 2IYGA 2KHDA 1GCTC 2BRLA 4LUBA 3KLFB 3ZZUA 3VWSA 5KFPA 3A7TA 5KECA 2GMTB 2PN6A 3WWFA 1R8HA 2IN2A 2AD9A 5E2QA 1QE1A 3UOPA 1FJDA 4ABJA 2H4YB 2M52A 4NIXA 3BR9A 3N7EA 3OUYA 1OIAA 2E1RA 1KVJA 2C2KB 4ZP7A 1D3PB 2ODYB 3CENA 1NFYA 3A7ZA 1T95A 4BHQA 4ER8A 3SCKE 3AASA 4ZVHA 4HHUA 1GI3A 3OXFA 2R7RA 5TJXA 3ZTPA 4YB7A 5ETRA 2UXDJ 4RR5A 1GDQA 1VDHA 1ARCA 1Q31A 2FS9A 1SGDE 2NYIA 2XP7A 2CK3D 4F26A 1OSDA 5HMZA 3EM1A 2V4JB 3E3TA 3LONA 3ISNC 2DHXA 1TK8A 3OSPA 2YPZA 1P3EA 3W8GA 1KQFB 2VGCC 2FTRA 2V8VA 1RFNA 1WC0A 3MNBA 4KELA 1WC6A 4XDDA 1K1JA 4GKKJ 2ZD1A 4NGAH 4JFLA 3SV9A 3BREA 2XW9A 3ICLA 2VA3A 2MNTA 3GDUA 1ZJKA 2Z7FE 4YFUA 3TWZA 3N9UC 8AT1B 3VCDA 1UJ1A 4MK9A 1D9AA 4WH8A 2HWHA 1SQOA 3LPYA 1FA0A 1SGQE 2DG3A 4AB9A 3SIPB 1MZDA 1VJ9U 4OM9A 4TPIZ 1LVBA 2C2RA 4YLUA 5GQBA 3MPVA 1XHGA 4RW7A 5A76A 1PJ6A 1RWKB 2MGZA 2GP9B 3IWNC 1QVFR 2HVDA 4AC9A 4GO7X 3HMJG 2VASA 2EPIA 5LMNJ 5F8TA 2CQPA 3ZV9A 4JI2F 1WQSA 3M8SA 3MFJA 1NPRA 3POTB 4Y8ZA 3RB4A 2OFNA 3KLGA 1HAXB 2QRRA 4BS2A 4Q5VA 4LRCA 2HFNA 3GJTB 4U86A 3F73A 4XPEA 5LOQA 4N5SA 1F40A 2HVYB 4ILMA 1CULB 2GHPA 4ETXA 1CTNA 5IXUA 3BIUH 5DG6A 3VAFA 3SUEA 3H5UA 3AJDA 1PPFE 4RL1A 1X4CA 4FF4A 1FJCA 3G6LA 5PTPA 1ELEE 3CJQA 2ZH1A 1DLOA 5CYMA 3PWCA 2KL8A 1O3AA 3SUGA 1R8PA 2MJNA 4QWCA 1H8ED 3PX0A 1DY3A 2AGIX 1FD9A 2LECA 1UFKA 3MOCA 2DO0A 5F9NA 4P7VA 4DVAU 3Q8SB 1UMJA 5GWZA 4X62F 2DNQA 1N5VA 4DRQA 1A7SA 5HW7A 1JXVA 4IG3B 1LO6A 3GYGA 1VQPS 1E38B 3QK1A 5DP4A 1W1VA 4C9DA 3ZZ8A 1O0PA 3CHEA 1RU2A 2LGOA 1NS3A 1QTNB 2VB6A 1JLEB 2MPHA 2BMBA 2L3MA 4L6V3 4HZHA 4R25A 4X65F 3WKZA 1O3DA 4CNZA 1H4WA 3TZWA 4NYOA 4N76A 1HJAB 2CJYB 1ZAVA 2QZ8A 3TI0A 3SQGA 1GTEA 3SV8A 3AFGA 2G5VA 2DNZA 4W98A 2DD8S 4K7QA 1GPFA 1WAWA 4JI8J 1H38A 1EOLA 1P05A 5F8NA 1FDAA 5KFCA 2LQ8A 3EIPA 2CDRB 1J4IA 1UVOA 1TMTH 3UTUH 3AQPA 4BAOB 2IF4A 2DNNA 4J4NA 1GI7B 4ZLLA 1KRPA 3CT9A 1GHZA 2YH1A 2ZNZA 3JSRA 3IS9A 2JDJA 5DP5A 2H5JB 1QIXB 3TVJB 4YOJA 1CU1A 3Q3YA 2JEJA 2ZGJA 3O3LA 1EHWA 3OTBA 1GBJA 2DBBA 1C2IA 1Q1KA 1O2IA 5E5NA 4MIBA 2KVIA 3R8YA 2Y1LB 2XY7A 4R8UA 3MEEA 3W65A 2WUBA 4MMOA 3ILLA 3QJJA 3JS9A 1QL7A 3KNAA 3W8PA 1P2JA 2VA2A 3TIUA 4DSKA 2GVFA 4CDIA 4NEZA 3BXWA 4PQUA 1FRHA 3TA0A 5HMWA 5IS2A 1VQ7S 4C8KA 1DHMA 3EQ0H 1U26A 3GR0A 2GGPB 3BO3A 5K20B 2P9CA 1RHKB 2PKSB 1G37A 1O8BA 3DOLA 1B3TA 1GHYH 3BTTE 2ASLA 2FZKB 1HBUB 3VB4A 2HKEA 1O2RA 1Z4UA 1U1OA 2IDLA 3Q3KA 3IKDA 1QY6A 2JSXA 5EWEA 2BDIA 1M5KC 4CM0A 2ZZTA 3H7HB 4PUOA 2BANA 3EY6A 2D3OR 1UR9A 2RDEA 1URRA 1LQ0A 2OQ5A 4I2QB 4DV6F 1NK7A 2L08A 2CVEA 4NZ7A 1K1PA 2VPZB 4O9VA 1VI7A 3MZIA 4WTYA 4R0IA 4O4GA 5DRKA 3RU0A 3SU1A 4BLGA 2JC1A 3FN8A 5A0YB 3CC2S 3IMQJ 4IH5A 1JCHB 1AA1B 3FSIA 2ZJPQ 3TNSA 5DZ6A 2RUGA 4GAWA 3VTIA 3PX4A 4CIOA 3H0PA 3OTPA 4MKYA 2XBXA 2B9LA 1C9PA 1DSTA 4KGMA 3MU5A 3AS1A 1BMNH 2BJ1A 1JVWA 3ZTSA 3V4IA 3GU0A 2P8IA 2G5NA 1K0HA 2F9BH 4TQRA 1OQ3A 2ZECA 2H6MA 5E2PA 1W3CA 2X7IA 1FK9A 1GBKA 1JLBA 3P6ZB 5T7LA 1NK0A 2X1AA 1S1TB 2B8OH 5D4PA 3SJKA 1LL6A 1R0AA 4JV5J 2LA6A 2XLIA 4OI0A 4WE1A 1TNIA 1X4DA 2DKOB 1SH0A 5HVFA 3T27A 3JTOA 2EULA 1EZSC 5DDPC 5K14B 1ITPA 2FZCB 1AFJA 4I69A 2AEJA 1MH0A 2EY4C 2OO4A 5A0CA 3A83A 2FDNA 3U8OH 1QUPA 4DR2J 1BA8B 2WSCC 3Q23A 3TNTA 1F1BB 3FY1A 1C5PA 3NCLA 4DFMA 4IFYB 1HWLA 2QA9E 2CA9A 1UPMB 1HNIA 1C5TA 3ALFA 3U9AH 4JV5F 2KKHA 3QBCA 1VISA 1TPSA 5AFZH 4ODNA 2CADA 4ANEA 3JXVA 2AHME 1BJUA 2E7XA 3HFVA 3MTKA 1X5OA 4WKRA 1AZSB 3BS9A 4KR0B 3MNCA 2WBRA 1D0EA 1O5DH 1BQMB 5KFNA 1REGX 1P11E 1LHCH 1GG6B 4KH0B 5IK2D 4AL7A 1O2WA 3HD2A 5ETMA 1IQZA 1T3NA 3M5LA 3MAAB 4A8WA 3SEOA 3V6JA 1DTQA 4IFVA 2UVUA 2KFZA 2PFEA 5HMAA 3MMAA 4LREA 1O3HA 4XD7D 1I5OB 1PYTC 4HBEA 3C16A 3CCVS 2ILNA 1XK8A 1AKSA 2QA4S 1HARA 4J9SA 3G82A 3PR9A 5IDKA 5I25A 3RXJA 3B4MA 5B0GA 1YSJA 3O5QA 3ITHA 3SU6A 3B6BA 1R43A 2ZA5A 5CYQA 3DLEA 2YNBA 3LP0A 2PPNA 4ITZA 4DV3F 4G1PA 3Q8UA 2CMYA 2R2UA 1J5OA 1U2FA 3A3PB 2FOMB 1TPPA 1GVZA 3I78A 2VU8E 2XWBI 2P2CB 4OJ3A 2IM3A 4RPFA 3IN5A 1GJ4H 4ID8A 2ZKSA 4GO5X 3W63A 3HVAA 1NJZA 1IOEA 4ZAEA 3M8RA 1C2JA 3BTME 3OOBA 1M5HA 3K58A 2GVZB 2BD8A 4TYBA 4E0DA 3LUYA 3D2WA 2BKPA 1C1OA 3VAIA 2F3CE 1ZU8A 4WMEA 1T3OA 4ASUD 5JH8A 5A09A 4QQBA 2MHNA 1YLCA 2F4VJ 1GJ7B 1LHFH 1K21H 4DV3J 4P2MA 3IR6B 4DG1A 4ICLB 2R7TA 1CJVA 1VGCB 3IO1A 3OTOF 1LHGH 4F25A 3RM8A 1OGBA 1GHBF 2W26A 5C94A 1OQ6A 5EJZA 5RUBA 1NWUA 2DR5A 2R9PA 1ZL1A 1DTQB 2PI4A 1AYEA 4J7CA 1SQAA 2IJD1 2ZTZA 1KFDA 3KK1A 1CHGA 2FDMA 3GYXB 3FEYB 1SGNE 4ODMA 2ZO3H 3ATIA 2J94A 2PI6A 4GHQA 1ETTH 4JUZA 4FPIA 4IRKA 2G52A 1A7GE 2QG9B 4Q43A 1AIXH 2W6ID 4URQU 9LPRA 4LQ9A 4Q63A 2DG4A 2VG7A 1NRPH 1C1WH 2KG1A 4I0WA 1B99A 3UVJB 4TY8A 2FYXA 3D62A 4KH1B 1RT5B 4CRCA 2IPOB 4YY3F 5LL6d 2JETB 3KL6A 2EFPA 4M95A 3ENSB 1O2HA 2MQOA 1BHXF 3MMAB 1WBGB 4FF1A 1LW2A 1ROFA 1Q8BA 4Y7BA 3MD3A 2IIHA 5KFTA 2ANYA 1X31C 2H5CA 1C1NA 4Z2GA 4Z6AH 1HJVA 1SUQA 4F4AA 3W62A 2G2YA 4DR2F 2IAJA 4GC7A 4DIHH 1TGNA 2SGQE 1N6QB 5HN0A 1KTTB 1DAXA 2CPXA 1VBYA 3HGNA 4OI4A 2W7AA 3PRVA 2UU9F 3RXPA 1JKHA 1JLBB 3R7NB 1CHOG 4JFIA 2F9DA 3CC7S 3K0JA 5DLFA 4MGVA 4B1TA 2EI6A 2ZCKP 5IYTA 2K2PA 3M2VB 2F4LA 4NA3A 2YPYA 1RQ0A 1T32A 4OZ1A 3PR5B 2N4CA 4LSLB 4I31A 3KAGA 1JNRB 3G9CA 4QZVB 1LCYA 1SKRA 3EZOA 1IQEA 3ZYEA 2POKA 1HR0J 2XMJA 1Z1JA 2WW4A 3KGPA 2B4UA 1S5SA 4WH6A 1CO7E 3KFWX 1HB0B 4NA7A 5HROA 1Y3KA 4B3SF 1KMHB 1EPTC 1ZM2A 3AAVA 1PPEE 3GFHA 3U28C 3PW2A 4B71A 2Q6DA 4B17A 4PWWA 1R89A 3KK2B 4A8FA 2DGOA 1O0DH 2BACA 2FTMA 3SW2B 1U6QA 2D9OA 2W24A 3OXLA 4M5IA 4YB6A 1ZBCA 1VGCC 3TAMB 3GP9A 4NNRA 4BAMB 2Z2LA 2AERH 1P09A 2K1QA 1N6QA 1N52B 3Q8PB 3RXVA 1EHNA 5KFJA 3I4HX 2BD5A 4B3SJ 4G65A 2F8MA 4MNWA 3J80Y 4ZKOU 3GCTG 2O66A 2HWLB 3N28A 4B9NA 3FZZA 3J7Z5 3RP2A 4ILRA 1Y10A 3BSOA 4D3HA 1L3KA 4ZPCA 4KRWA 3AAUA 2NQPA 1T9YA 3FBFA 3QSYB 4B3TF 3HPTB 2FY8A 5AJ3J 4EYHB 4DV6J 1LVOA 3RU4E 1FTCA 4ALZA 1JK9B 3FEXB 3ARUA 4X2XA 1N56A 4U7UD 1FIWA 2FM2A 1PPZA 5IC4B 4ZPVR 3GFYA 1S83A 1HKAA 1WACA 1TYNA 2AJ2A 1OWEA 4O44A 1NWTA 4LAWA 2VQFF 7FD1A 4CT8A 2E5HA 2AYBA 2SGFE 2F9OA 3TUJC 1HR0F 3E16B 3MEDA