3PRBA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 53
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prbA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prbA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prbA03
2MLZA 3IK8A 3H9RB 4O2TA 5D75A 2OFNA 1BKFA 5B8IC 1TCOC 4DROA 1J4IA 4R0XA 5BXJA 3KCEA 3O5PA 4DT4A 1FKFA 4DRIA 4ODPA 1R9HA 2XP6A 2ZQUA 2LJ4A 4IQCA 3CGMA 5HTGA 1B6CA 4FN2A 2AWGA 4JFLA 2F21A 4JFKA 1FKJA 1ROUA 1F8AB 2M08A 2PPPA 3O5KA 2LGOA 3KAFA 5HT1A 1HXVA 1FKTA 4TW6A 3O5IA 1FKDA 3LUOA 1FKSA 2ZR5A 4DRPA 4NNRA 1EYMA 2KGJA 3IKGA 5DITA 3JXVA 4DRHA 4LAVA 1W26A 4QIBA 3JYMA 4DH0A 5HW6A 2KI3A 3OOBA 1Q1CA 3UI6A 4TW7A 2PV2A 4LAYA 1FJDA 1FKIA 3MDYB 1FKHA 1JVWA 1FKBA 4TW8A 4TNSA 4ODKA 1YW5A 3I6CA 4IPXA 4MGVA 3UI4A 5HW7A 1M5YA 1N1AA 2XP4A 4JYSA 2RUDA 3UQIA 2LKNA 3O5FA 2LPVA 3NTPA 4W9OA 4U86A 2KFWA 2ZR6A 3GPKA 3O5GA 4G50A 3O5MA 3KZ7A 4JFIA 4LAXA 3TDBA 1D7HA 5HKGA 2N87A 4LAWA 3UQAA 3KADA 2IF4A 1Q6UA 4G2PA 4ODLA 2XP9A 5GPGA 1FKGA 1P5QA 2XP8A 1FAPA 1D7IA 2Y78A 1PBKA 4QT2A 3UQBA 2ITKA 3JYJA 2PV3A 4ODMA 2RUQA 2FKEA 3KABA 3KAHA 2DG9A 4ODRA 5HW8A 1NMWA 2DG4A 4QT3A 5HWCA 3RGCA 2KE0A 1J4HA 2MLYA 3PRBA 4U85A 2XPBA 3KAIA 1U79A 3O5LA 5DIVA 4DRJA 1L1PA 3TCZA 3EY6A 1NSGA 1QPFA 3O5DA 3ODKA 3RFWA 4TYOA 1FKLA 1T11A 3KACA 2RQSA 2PBCA 1BL4A 1D6OA 4DRKA 3TC5A 1YATA 4BF8A 1A7XA 2Q5AA 3O5QA 4ITZA 5HUAA 1J4RA 4GIVA 3VAWA 4N19A 2M1IA 4IQ2A 2K8IA 1Y0OA 2UZ5A 3KAGA 4DIPA 2ZQTA 4DZ3A 1C9HA 3NRKA 3UI5A 1F40A 2KR7A 4J4OA 2F2DA 4C02B 5HWBA 4W9QA 3O5OA 2MF9A 3O5JA 2MLXA 1KT0A 2RSEA 2MPHA 2VCDA 2XP5A 4MSPA 4ODQA 4FAPA 4J4NA 2F4EA 4TX0A 2KO7A 2PPNA 2DG3A 3WH0A 5DIUA 2D9FA 4ODOA 4DRQA 1JNSA 4U84A 1FD9A 2XPAA 4DRMA 4GGQA 4W9PA 5I98A 2PPOA 3IKDA 2ZR4A 1KT1A 2XP3A 4DRNA 1Q6IA 2MNTA 3B7XA 1Q6HA 1QPLA 1FKKA 2PV1A 1ZCNA 3O5RA 2RUCA 2VN1A 2FAPA 2L2SA 3FAPA 3CGNA 4ODNA 3IHZA 3NI6A 3UF8A 2ZQVA 1PINA 2M2AA 1FKRA 2XP7A 3PA7A 5J6EA 2JZVA 1ZK6A 2ZQSA 1EQ3A 4JFJA 1NMVA 1QZ2A 4DZ2A 3PRDA 1D7JA 1ROTA 1JNTA 4JFMA 2RURA 1J6YA 3O5EA
chains in the Genus database with same CATH superfamily
2MLZA 1APSA 4I8JA 1WORA 3AXKA 1MU2B 1O3GA 1MU6B 2MJNA 1XUHA 2ZQUA 3MZIA 1P11E 2UV8G 2AGOA 4IG3A 1C1UH 2F21A 4YOEA 1W8BH 1E34B 4DV0J 1MH0A 2DT2A 3BBFA 1TL1A 3MNXA 1FFSB 1IX5A 5I25A 4GC6A 2L9NA 3TR5A 1MKXK 2JEGA 2Y1JA 1NKCA 4CH7A 2GCTB 4H6SB 3UI4A 2CADA 2G55A 2HNDA 2C2ZB 4FUCA 3M8PA 4HFPB 4WMEA 3DOLA 5KFXA 1TKTB 1SVPA 3IG1B 5CHBA 4J9UE 2QA2A 3UVJB 1QVFR 4ABHA 1KXAA 3P8GA 1YWUA 2BQ7B 3PDNA 4WMFA 4MVNA 3MR2A 5F8HA 3PEHA 4RL1A 2H9HA 4Q8FA 1FKLA 4A48A 2YH0A 1HWKA 4NFFA 2FI3E 4IG3B 3PRVA 3NKKA 4RN6A 3P92A 2ZQTA 4DZ3A 4BS2A 1Q0NA 5DF0A 4IRDA 1GJ7B 4IT6A 3CWJA 3MM6B 4FN5A 3FEXB 3SJKA 4F36A 1T3NA 4UDMA 2V0NA 1NT1A 3OY5U 2JX2A 1UWBB 1S82A 4B2CA 4M5LA 2RKIA 4DQRA 2UUJB 2XP7A 3ITHA 2WSSD 3BB5A 3MD1A 3PM3A 3L6PA 4LSNA 2KFYA 5F53A 3DLKA 1HAGE 4ICLB 4L75A 1HJVA 1V2QT 1V5IB 1GHBG 2DK2A 3LALA 4K1EA 1AWHB 3SQHE 1SJ3P 1VQ5S 1ZBVA 2NXJA 1MNEA 1GMCF 1X4FA 4LFAF 2DNQA 1DY8A 5HSPA 4EFAC 2PV2A 1GX5A 1GI9B 1M9UA 1L0ZA 1FD2A 3MM6A 3QDZB 2NXUA 3SJIA 4I33A 1AXQA 4LIRA 5CMXH 2YNGB 2V6AA 2HVYB 4LRCA 1PILA 2DSUA 2MSSA 4DU7A 2RUQA 3DSGA 3F2FA 3FCVA 5HP1B 1IOEA 2V4QA 2M88A 3LT3A 3SQEE 3R2CJ 3OVAA 2FYQA 4F67A 2KYXA 3WD4A 3QZ8A 1CT2E 3EGVA 4YS2A 3MR6A 1YATA 1WEZA 4AUKA 2FO9A 2G2YA 1LHCH 2DGSA 3RC6A 2LXUA 4F4ZA 3GU0A 3PX4A 4EZ6A 3D0GE 2ALZA 4DPUA 1V3ZA 3A12A 3CZ8A 4FUGA 1PQ5A 5DP8A 4NMXA 4KV8A 2PTCE 5AE2A 3LP2B 1EZSC 3Q8RB 2KVIA 2QF8A 3MM9A 4HVZA 2L74A 2F9DA 1TB6H 3UDCA 3DRRB 4DR3F 4YXWD 2IM0A 1UVNA 3Q76A 4WCEQ 5G0RA 3HFKA 4DV5J 1GBBA 3BGRA 2RT3A 2OPPB 2BDBA 3W5YA 3A8JA 3R3GB 4X84A 4GSOA 1A0JA 1MTWA 3AS1A 2FTMA 1FY5A 1C1BA 1FESA 2GJFA 1V2OT 1N36F 2H5JB 2WCXA 2ZM6F 2O5DA 3MEGA 2G5VA 3IC1A 1C1QA 4DR7F 1K0TA 1QA7A 1SQFA 1M1KT 1T8LA 2M0GB 4L3KA 1NHUA 5HIZA 1SQAA 3SMZA 1CPZA 4YB7A 3NTPA 4I64A 4FU7A 1P01A 1RT3B 1HWUA 3N5FA 1YTYA 2Z3EA 3MM7B 3QGIA 2BJ8A 4OX8A 2XNDD 4NLTA 4GAWA 2DNGA 1FF2A 3CJKB 2DH9A 3MU1A 3DRRA 4B3OA 3QO9B 3M1VA 3PLBA 4KPCA 1YM0A 4AT1B 2VIHA 4Z1MD 1BWEA 1UMJA 3LONA 2FB0A 3D3BJ 3I4HX 1O39A 2FUG9 4HI1A 2WYJA 3CDAA 1P9QC 1MAYA 1PYSB 3M5NA 3R7BB 4DV3J 2QFJA 1NJIT 2B51A 1QRZA 2ZOFA 3O5JA 2ZOMA 3QT8A 1GHWH 2ASYA 1URRA 4MTPA 1HQUA 2EW9A 2Z2LA 1CQMA 1S0VA 2C2DA 3MMCA 2ZDMA 2RH3A 4GC7A 3S6EA 1FKOB 2QV6A 2Z94A 3G6LA 1C5PA 4YY3J 4KKOA 1ZGIA 3PV2A 1YLCA 5KG4A 3AT1B 2Q6BA 2H5IB 2J6TA 3PRDA 1TU0B 4O0NA 2FPHX 4OI6A 4J9QA 1HYLA 1RJXB 1U1KA 3W65A 5EOKA 3WC0A 3EUNA 1F8AB 4L74A 4IQMA 4DPOA 1JNEA 2BVRH 2KL8A 3GPAA 1HAVA 4WKAA 1I94J 1HNVA 3TEGA 4DR1F 1GBJA 1Z4UA 2TIOA 3FCWA 1EUFA 3LANA 2YBVA 5B7WA 3PWBA 2FTLE 3KMQA 2K3KA 1EATA 1GDUA 2WK4A 3HSZA 1D7HA 2VG7B 1HBNB 1P0SH 5HN0A 2OLWA 3ET6A 3MPWA 1NB2A 1EZXC 1NO9H 3AASA 4C2MA 1QIXB 2FVRA 3OL8A 2A3AA 1N34J 3RGCA 5E7OB 1S72S 3WHIA 2ZKTA 3TVZA 1SR0A 3E01A 2P9CA 4UDWH 1RXPA 2WV9A 4GVLA 3Q8UA 4WE1B 1P6TA 1FK9A 2L3MA 3QMQA 4ZVFA 1O5FH 8AT1B 2Z3CA 4C8NA 5B09A 1N32J 1DDJA 4X1PU 4QIGA 2VNTA 3SGBE 1IQFA 3LP0B 1BHXF 4HR2A 5L1KA 1T9WA 2GX4A 3WIVA 3ARSA 4CWBA 2GKVE 3WDOA 3Q8PB 1GQEA 4YOJA 1BJUA 3H5CB 2A18A 4AG1A 1H1BA 2NZCA 2BX6A 1C5ZB 2B8QA 1TONA 2ZDLA 1U2RA 2P8OB 2C3MA 1C1CB 4PG5A 2EY4C 1RLCL 1UTMA 4LZ4B 3ZYDA 4DV3F 4MK8A 3MOCA 1THRH 1BQNB 1CLFA 4L6V3 2XP6A 3EGNA 1YLXA 3CGMA 2BLOA 1G6BA 2LGOA 1FKTA 3W61A 1DUAA 3W66A 4RU9A 2ILYA 1ESBA 3TQ1A 3PACA 2XG8A 4CI0B 1C5NH 2CVEA 1LPZB 4ZMAH 4X66J 4YOIA 3CCUS 1R8BA 3ZZOA 2PSZA 3TANA 4MDSA 4LAWA 2BEFA 2Z56B 5IQ6A 2DT3A 3GV7B 2SGPE 3HMJG 3VXFH 3DOLB 3N6MA 1B7FA 1CGIE 2OCVB 4LF7J 2B4PA 2V94A 3CC2S 3UVJA 3ZO7A 3GS9A 3CMAS 2LPRA 1OO0B 4I2PA 1VJWA 4OZ3A 2BLQA 5DM6Q 4NWLA 2CV3A 2FX6A 3Q0AA 4N19A 3OFGA 2BRLA 2A32A 3UOPA 3PMAB 4NEZA 4C02B 3NUMA 5T7LA 1CC7A 2GMHA 1ZYOA 3KQDA 1HJ9A 2MPUA 2CG4A 2VU5A 3AB4B 4GGQA 1U1OA 4B73A 1E1QD 3WBZA 1JXPA 4MPKA 1BTPA 5DDPC 2JLGA 3SCKE 1H4WA 2HRYA 1JLEB 2XGPA 4V19J 1FXRA 1T03A 5TJXA 1CEZA 2VG5A 1O2MA 1D7JA 2AJ1A 2PI5A 4ISHH 2MZTA 2OK5A 1BOQA 1FDNA 1JLAB 1O2WA 5LSLA 4DR6J 2BE9B 1REVB 2CPDA 2X1FA 3BSQA 4WK3A 1UK3A 2FM2A 2PKSB 4PXBA 3KQCA 2CF9H 4RW7A 5GAEI 5KFOA 3GY2A 2EKYA 3F6UH 1OY6A 4WF8A 4FXWA 1QD1A 1D9AA 4MYUA 5A76A 1CS4A 2ZVSA 3QYYA 4NZCA 1N1AA 2AF6A 4JI1F 4Q22A 3UQIA 4EYHB 1PPCE 1RT7A 3PX6A 2IM3A 1BJVA 2VASA 4Q7XA 1QRXA 2V9WA 1K1NA 1ZHRA 4BXWA 2ZCHP 3TJNA 2PSXA 2GGVB 2CDRB 4VGCC 1JXEA 2RF2B 2QLBB 4FF2A 3NY0A 3EY6A 5D4OA 1O2RA 1VQ9S 3HCXA 1HAHH 3IN5A 4F4AA 1FY1A 3F9GA 4IG0B 1RTLA 2VU8E 3IWMA 2OUGA 1VQ8S 4B17A 4JZEH 5KT6A 4ZA1A 4CLFA 3NCLA 4NLGA 2O3DA 2DT9A 4DURA 1QJ1B 1CBWB 1FIZA 2D41A 4CYUB 4CH1A 4WWSA 5CCLA 4LFAJ 2K8GA 1HPZB 2V68A 3J7Z5 2KZMA 2VIPA 2E7XA 2N7YA 2FVSA 1IWGA 2CNNB 4Y79A 1JWWA 1TFWA 2NPFA 3LU9B 1BHXB 4WYLA 3A84A 4FOUC 3ISNC 1KLIH 4O03A 1C0UB 3JQMA 4GVBA 1SGFG 2HBZB 3RB3A 3NGDA 2W9CA 4IN1A 5AJ3F 4H4FA 1W2KH 4DS4A 2V6NA 4KAIA 1ZPBA 2BD4A 2CKWA 4OM9A 4X1QU 5A0AE 1LL6A 4N76A 3PXGa 4C0BA 1MMDA 3SJOA 2OTJS 4EEYA 1BMNH 2C42A 3I0SA 2DNMA 3CIMA 3GPKA 1PSDA 3KDOA 2WPKS 1KLMA 1DSUA 2GX8A 1DQAA 3MM7A 2GQQA 4DS5A 1LG2A 3BJYA 1OQ3A 2ZZUH 1U79A 3FBEA 4MPWA 1NCLA 4Y00A 3TUZC 4LK4A 1XMQF 3I5AA 1ZGVA 5DSFA 1EB0A 1KY9A 4MNMA 3O2IA 1YJNS 3FEZA 3I5BA 2NREA 3DLGB 4DV7J 3SOSA 4Z7CA 1F40A 2Z2ZA 3O5OA 2FJDB 3J81Y 1TGSZ 3KIDU 3BDEA 2PPOA 4JI4F 2F8MA 4NFEA 2OC8A 3FFGA 2ASLA 1OP2A 4P6QA 2Z9GA 4INKA 2K7KA 1KFSA 4JBCA 3DM2B 1Q81T 1URNA 3RXHA 2LQ8A 2J6UA 1UCYH 4RKUC 2EFOA 5J4QA 1L1JA 1VHIA 2C2EA 1OWKA 1M1HA 2V63A 1BRBE 2DNYA 2GMJA 4JI6J 1XK8A 1BQYA 4P9SA 4UE7H 2FHOB 2MKHA 4K5RA 3BGOP 5DQGA 3KCGH 4NE9C 4C0OC 5DG6A 1VLYA 1RWKB 3I5CA 3P17H 3NGTA 1UEVA 2Y6TA 1W9UA 4ZJOA 4K0KF 4ZPTR 1JKHA 1SJ1A 2ZE2B 4WU2A 3QNWB 2RG3A 4MPXA 5J2QB 4G65A 4H4KC 4UW2A 1LKZA 1IKWA 1VJQA 1RWVB 4M5KA 3RC5A 3MD3A 1NMWA 4N8OA 3QLHB 4K2YA 2XC4A 1RWPB 2HHHJ 4B3MF 2LFVA 1P2MA 5ETOA 4KE5A 4W98A 1SCJB 1OY9A 4QZVB 3ZIAD 2UU9F 2CZVC 3H7TA 1BL4A 3DU6A 3K8VA 2WOMB 3CCLS 3O5QA 4V1Ak 5I3QA 3MH4A 1E6NA 1D3QB 1QR3E 5GAHU 2WTFA 1ZSKA 3V0XA 1FLEE 5HQ8A 1HIYA 2KO7A 3PTBA 2R2RA 3OL9A 2RRBA 1GXUA 1UZDA 3B7XA 3F0PA 3HKZD 2P3TB 1Z2LA 3GYNA 3VVTA 4YM9A 1BTUA 2FHJD 1JMTA 2E1PA 1IKVB 1EHNA 4YOGA 4TU7A 2C3SA 1CHOF 3E6PH 1OXGA 4V19X 2YXLA 4ZVGA 2WVBA 2JJ4D 4ZVPB 2Q6FA 3VZHA 2QT7A 3VPKA 1PQ8A 1RWMB 3EWGA 2XS7A 4RBVA 4ML4A 1S0MA 5IK2D 2PMWA 1Q8LA 1WDIA 3KAFA 1VJAU 4Y0FA 3UY9A 1TIOA 2OELA 1JLCB 2KHCA 2OD4A 4OS7A 5T41A 4HBOA 3GY6A 2BKOA 1SFQB 4KHPJ 1QB9A 2IA6A 2E5GA 3NAIA 1S4EA 4ZCNA 1V2MT 3GFHA 1TNIA 1UTAA 3QGHA 5EQQA 4PXEA 2HQ3A 4YHHF 1KLNA 1G7CB 1X4BA 2ZWPA 5EW1H 1CT0E 2Y7XA 1BMFD 1QAJA 2JH5D 1D0EA 4DX5A 2DG9A 3CT9A 4CLYA 2IIHA 1FDBA 5A8XA 3DLEB 3ULHA 3AOAA 2W2PP 5EU8A 4PROA 4WXWA 3SGQE 1HR0F 2BW7A 1RCXB 2FOAA 1QL7A 1R89A 1YF4A 2BHGA 4GPGA 5F8JA 1WOFA 1GBEA 2MZ1A 4OV1A 4DQSA 1JLCA 1ETRH 1EKBB 1NDCA 1P9SA 2E1MC 1KT0A 3VAGA 3SHAH 1DJ0A 1RISA 3DNCA 2XMTA 3CUNA 4F4XA 1DXPA 1XNQJ 4GHQA 4WJG2 4CO2A 1XJWB 1PGZA 1TUVA 2F23A 3RRHA 1T8NA 2OINA 1TZ0A 1UVSH 2B6AA 4PG4A 2Z2YB 4MK9A 1UP1A 1HIAA 4CH8B 3QGPA 1VQ7S 2AJ0A 1AFIA 1GHVH 4OLOA 1Q8IA 1S48A 3RXEA 3V81A 1NKBA 2CZ9A 1SJ4P 1Y11A 2FDNA 4I7YH 4F02A 3A8AA 2WW8A 5K0HA 4J5OA 3RU4D 1ZAVA 1HJXA 2AP6A 4U01A 3BGLA 5ETKA 4OI4A 2PO4A 4ELTA 1F5RA 1VI7A 2RJZA 3KLVA 3IBCB 1TX7A 3M30A 2I8EA 3ISND 1T0TV 1O2ZA 3H7OA 1Q6UA 2W1BA 3RXQA 2MKYA 2OO4A 1QBOA 2BY6X 1EB1H 2XWBI 4DOQA 3BR8A 4M5HA 2XZTB 2ZBPA 1KKHA 3SBMA 4NYZA 3CW2C 1SC1B 1D6RA 1GTEA 3I9ZA 2JIZD 1AD8H 1NU4A 4KGXB 1E37B 3GTYX 3SV4A 1SR5C 4GIVA 3CJ5A 1ZBKA 2AWZA 2XGQA 3ITHB 1UHBB 2WPJS 2GIQA 3QN7A 4NA1A 4IG0A 4FNIA 1HHSA 3QZQA 3HHDA 4J9LA 2JLFA 4Y8YA 3WH0A 4IKAA 3EGZA 4U84A 1ZA2B 2SNVA 2DNPA 1XKAC 4UUWA 4DVAU 1WHVA 4X4VA 2MHEA 1DE7H 3V4IB 1O6IA 4IMQA 1NPMA 1UTOA 4D76A 3EA8A 2DRDA 1GI6A 3NI6A 1P8GA 3PZPA 3ARTA 2JZVA 2WRMA 1NPPA 1HPZA 5C25B 1X6NA 1C2KA 5GAHI 1VITF 5HQMA 2N3OA 3L9ZA 1LOUA 4CO0A 4OZ0A 4K5ZA 4NCYA 1NBMD 1V2LT 2K06A 4TN2A 4S3KA 1C5QA 2R7UA 5JB8S 2E9ZA 2K2PA 4CT9A 3OYPA 3R5JB 4DGJA 4TW8A 3RXDA 3JB9k 4I68A 7ESTE 2DHXA 5D0EA 3PJXA 5B0FA 4J9RA 1DSTA 1F1BB 1UZHA 5AE3A 3HVRA 2W7AA 4NGAH 4QT2A 1JX4A 2DNZA 2A2QH 2E29A 3C16B 1BBRH 5HWCA 1SQRA 2V3OH 1YSJA 1N54B 3O5DA 4NLXA 3CCSS 2VWNA 3SUGA 3FAOA 1ZRKA 5DDQC 3MPVA 3TGJE 1YIJS 1XNRF 1G1XA 1NHVA 2E66A 1GBHA 1KVIA 3JSRA 3J80Y 2DTJA 4QR1A 2J92A 5C5OA 2RQKA 3V6JA 4QYRA 1WC5A 4TY9A 5LM7E 3TUIC 2XC9A 3PW4A 2J5AA 1SV5B 1HDTH 1NY22 2DRBA 3P8NA 5F8NA 3EVWA 3UPEA 2RS2A 4DZDA 1TL7A 1R8HA 3FRZA 1DTTA 3GCWP 5AXKA 3Q23A 3W9JA 2WV4A 1QB6A 3S9CA 3TUPA 3T1HF 1SOZA 2H4YB 4LZ1H 3DM2A 2OSRA 2PFDA 1S6PA 4X1SU 1VQYA 3ZZRA 2R2SA 2PI6A 2PIIA 2VC1A 2ALYB 3U98H 1C4CA 4M5DA 1RWWB 1U02A 2LEAA 3BO3A 1QAYA 1T8EA 3RMMH 3UQVA 4JI0F 3OSNA 2KO1A 2UUAF 2ZHWH 3PV5A 1FY8E 3OBIA 3OEHD 3RDZA 3M5MA 2RNEA 4LQ3A 6LPRA 2RUDA 3ZZ7A 2FVCA 4D9RA 4JFIA 3CCVS 1PC5A 2KFNA 1YLNA 1LHGH 4LF4J 4OS4A 2GFFA 3KABA 5H9EJ 2L08A 4QIVA 5BRRE 1E38B 3MMCB 4RJVA 1GDNA 2EVZA 3PRBA 4QIFA 3JQJA 1O6XA 1ZAWA 1SG8B 2G0IA 5DG9A 4DRKA 1A7XA 3W5ZA 2SGDE 4JZDH 1G2EA 1XMBA 1NK0A 2HRUA 4DR1J 1AUSL 2B9EA 3QK1A 2Y8YA 3KK3B 1S1TB 1LVYA 4ZLPA 1AVXA 2CHAC 2PDAA 4C3KA 5FXLA 2Z7FE 3EE0B 2LNCA 4X2WA 4OZ1A 2RDLA 1HWJA 3K5PA 1P2OA 1IBKF 2ZGHA 3HJVA 4CH0S 5CHAB 1BE4A 1LHFH 4S3JA 1DZ5A 3FC9A 1VBXA 2NXNA 2H2ZA 1VOMA 1NFXA 3ET6B 5TCAA 4HTCH 3ZV8A 2QYGA 3PX0A 4ZP9A 1UKUA 2PW8H 3KN2A 3D3CJ 2IDLA 1LPGB 1O3LA 1TBQH 3VB4A 1CULB 1YWXA 2NPIA 2IA0A 1V2ST 1SKYE 1NKEA 2GZ8A 4Y76A 3RM8A 3D7SB 3QX5H 3C6TA 2LEPA 4NCBA 3P8FA 3HK6B 4UEHH 2YX4A 3H09A 2RE1A 4M5MA 4LSLB 1G32B 5KECA 2K3IA 4LF7F 1O5EH 1KFWA 2VFUA 2IRUA 3GSIA 1PBKA 3CMES 2J8AA 4NLSA 3AVZA 2WLZA 2MKCA 3Q2TC 1XHGA 2OQ5A 5K14B 2GGPB 1GJ9B 1TRYA 5F8ZA 5B0EA 3S01A 3DLEA 1EP5A 1GMVA 2FLPA 5L39A 4RSPA 4TY6A 4I56A 1KLTA 2G41A 1O3EA 4DV5F 5I42A 1BQNA 3M2UB 1FN8A 1FE4A 2OSQA 3BSOA 1C5XB 1N5YA 4K4WA 3MPUB 4ID5A 4OYBA 3TZXA 4P73A 3B9DA 2NXCA 1YGYA 1RU2A 1ZPWX 1Z8IB 1BDAA 1EZUC 1UTNA 3VAKA 3TNVA 4WFAQ 2WV5A 2J98B 1A5HA 5CXTA 2P8OC 3ELAH 5D75A 3BM7A 5K14A 1PFXC 3RGIA 5BJRA 4OI0A 4AX9H 1THSH 1PYTD 2I5JA 4IQCA 2LELA 1X31C 3N4WA 3EZUA 1XVOA 3VV2B 2P94A 3RP2A 2C2MB 3ZZCA 3B9AA 1T02A 1NFUA 2VPXB 3T62A 1EP6A 3SBKA 1VISA 1NJXA 4AB8A 1HKKA 2YH1A 1A2CH 3I6CA 3M2UA 1V2TT 1XR6A 2EXUA 5KG1A 1OP8A 1U6QA 4NZ7A 1RFNA 1GL1A 4Y6IA 3SV7A 4J90A 4DV2J 1FKGA 3LC5A 1QSLA 3J81j 1RTJA 4LFCF 5J1PA 2WBRA 1TGNA 1BUXA 1WDTA 1MW7A 2N4DA 2RU9A 5ETVA 3N6LA 2KZ4A 3Q8VA 5B08A 4NZ0A 1W0ZU 2RRNA 2YKPA 3RMEA 1Z6EA 3FOAA 2OLHA 1T03B 3MEGB 3D23A 5ETTA 2OEKA 3KLIA 1COWD 4CIOA 3QFHA 3H4DA 1VQNS 3EYZA 3NRKA 4JI0J 3UI5A 1S6QB 1HNXJ 1FQ3A 1JLAA 3UQOA 2HRTA 4J4NA 1SGIB 1REVA 3L7PA 3SGAE 4X8SH 4AB9A 3SHCH 1U2FA 1WCZA 1BITA 2AMCB 4DN9A 3PWCA 5BYQA 2VWLA 2VN1A 5T6GA 2ZZTA 3KG4A 2IM2A 3CF5Q 1OS8A 4EBCA 1GMDG 4ELUA 1Z1JA 2ZKUA 1LWEB 2E7WA 2PUQH 3I6PA 1A3EH 1RTJB 4JFMA 3N28A 2FS8A 2CK3D 1S9EB 1NNDA 3TGIE 2LJ4A 1VBZA 1PPFE 1ANCA 3GSDA 3JS9A 1FRHA 2B4OA 4LVNP 3M9MB 4HTJA 1QQ4A 3CS0A 1O8BA 2XC5A 3PTNA 5DO4H 4B71A 3ZYEA 1O35A 5GMKa 4AGKA 2AGQA 1F3VA 3JQKA 3LWMA 1E6ZA 1IBMJ 1V2VT 3UPFA 1ELAA 4H4MB 1SJQA 1DY3A 2HHTA 2CJBA 3MWBA 3H5XA 1KVKA 2VH0A 1MMJN 1UPMB 4K4XA 1U6ZA 1YZ6A 1PPBH 1GBLA 3SEOA 2WSFC 5HVGA 1ZJDA 3ZVDA 4MFBB 3FXYA 3V5RA 1ESAA 5IM0A 5TCCA 2B4UA 3GG0A 3ARYA 2XLKA 1HW8A 1UA0A 4FUJA 3FBBA 1JLQB 1JMOH 5AVDA 3TU7H 1TUWA 2IHR1 3G86A 4NIWA 2STBE 1MN7A 4ABAA 1EOLA 5JBAS 4FUHA 3JXOA 1XUIA 4DV1F 2GQCA 1EARA 2ZP0H 3CDBA 4PR6A 3K6ZA 5EX3A 5KG5A 5KFWA 2PD1A 1O3KA 2KM0A 2DYAA 1S0OA 2FESH 1NH7A 3M8SA 1DTTB 2Y1RI 1A4WH 2GJGA 2RQ4A 4C48A 4JI7J 4MKBA 3AS0A 1TMBH 4Q7NA 1BQMB 4R0JA 4IMZA 2VVUA 3WD1A 4X64J 1O31A 2C8XB 1SYTA 4FYYB 1UEKA 1FPHH 2J4IA 4O0IA 4LFBJ 4MTVA 2AZ1A 3TZWA 1EP4A 4C8LA 3O44A 4IGDA 1ZTLA 2CQ2A 2GD4B 3DLGA 4I8GA 5CD4A 2JJ2D 2ODQA 3I56S 5F8IA 4C3LA 1X4EA 2Y78A 2BM0A 2HWIA 5GVQA 3VGCB 1LQ9A 5C24A 1UJ5A 1FN6A 1OPHB 2DNKA 4U95A 1HNWJ 1YJTA 3C27B 5HVHA 1N48A 3KHGA 1YPKH 4JI6F 1B64A 1WG5A 2TBSA 1LHDH 3NMAA 3PEJA 1EKRA 3F73A 2KRBA 2XHCA 3PYGA 4NLPA 4OX7A 4XTTA 1V2WT 3J7YI 3PO5A 2SNWA 3T5LA 2AIPA 2A2XH 2QC2A 3K89A 2PWXA 3GISB 3HD1A 3FZ2A 5FX5A 4P2FA 3SV8A 1O51A 2F4EA 1O2QA 3M1VB 1YCPM 2D9PA 1IQIA 3DGPA 4ZJQA 1EP4B 2VPYB 1YY3A 3MNCA 3KEEA 2VB6A 2N4CA 1W9PA 2BE2B 4O3PA 4UFGH 4DIIH 1Y5IB 4I2PB 1W1TA 5EWGA 2VONA 1GJ4H 3ENSB 3F2GA 2H1YA 1C1PA 3M5LA 1HA1A 2LXFA 2EC9H 4DWSB 1YJVA 3SYZA 1F0TA 3HVTA 1XTZA 3GYXB 2FX4A 1W1VA 2BQWB 3JTOA 1XNQF 4I69A 4FETA 2CQHA 4WKRA 4RW6B 3P5TL 5J1EB 3PR4A 2A1DB 4JI2J 4DR4J 3I0RB 3OTOJ 2D1JA 4WVPE 5HM2A 1F5AA 2BQ3A 4QIBA 1Z2ZA 3W2VB 2WONB 4QWBA 1MABB 1F9HA 4LAYA 1F5BA 1CJUB 1JVWA 1CJVA 5J2NB 3SJ9A 2F4FA 3C6TB 1RAHB 2ZNYA 1K47A 2V50A 3OHAA 1SI9A 4AQYF 1IM6A 2PR3A 3GG1A 4I6AA 4RR5A 4MNJA 4Q0BA 1VIXA 1WAWA 3MXHP 4BOHA 4EUVA 4N56A 1LW2A 1J5EF 1JXVA 3IRWP 2DO0A 1NSKL 1RB0A 4X0WU 2N7CA 1TVRA 2GHVC 4YR0A 3M7TA 4AY1A 4FF1A 2BVXH 4EYIB 3ZZTA 1BHNA 3TZZA 3U02A 3SNBA 1GI7B 4NA3A 1GJ5H 5EQRA 4FF4A 2NZ4A 2YWGA 3CDEA 2XSJB 5JBTA 2GZOA 1GVLA 2F9UA 1SIWB 1O5CB 3CO9A 2WONA 1W1YA 1Y5LB 5DP6A 2GO8A 3MEEA 2WM0A 2ZH1A 2NSCA 3IXQA 5D4PA 1VQPS 3QJLA 4XK8C 1DLEA 1AROP 2V3MA 3U1IB 3EE3A 1U4BA 2ATLA 3BR9A 2VC0A 4ZHRB 1MD8A 2P6SA 2YKNA 3SNDA 3AA8A 5BYRA 1T95A 4WPAA 4DROA 4CRAA 4WJXA 3JSMA 3DHXA 1F2SE 5CH7B 1V2JT 4D8NA 1HQ2A 4BHQA 5KFIA 1BRCE 4FXDA 2O9OA 1CJKA 2CFXA 4K5SA 4U67Q 2ODPA 4CYUA 3A83A 2AOSA 4W90B 2EA3A 3CJTA 3ENVA 1FDAA 3O5FA 1HKAA 1TAWA 3B9FH 1QM9A 3KZ7A 5L38A 3KADA 1OWXA 2RIJA 1E44A 1UWAA 2BJ3A 3HD2A 2C22A 2FY8A 3HGPA 3P6ZB 2RSQA 2RHQB 2WPHS 5E3CA 5DGBA 3ARVA 1C1OA 2BXUH 2Z2MA 3OTOF 3T9NA 5A0BA 2KH9A 5GIBA 5HJYA 2EFGA 2PEBA 2GS8A 4R25A 1EIBA 2Y80A 1Y5UT 1EX8A 3R9LA 1HIAB 2B7DH 5KOXA 1UVJA 1S1VB 3CHDA 2DSVA 4WTOB 3BN7A 2AJQA 1NJYA 1NXIA 4L73A 1C2DA 5ETXA 2AX1A 4B9UA 1GHZA 1KIGH 5F8TA 3I0SB 4J9PA 1TPAE 2PT0A 2IJNA 3ONQA 6FD1A 2QJ3A 1Q3XA 5LPFA 4KO0A 3ZNUA 2AIQA 1VIOA 3C66A 1KQKA 2AGPA 4I6WA 5D15A 1X5TA 2C2NA 1FKRA 2HWLB 1KWMA 3MM9B 3RM0H 2DBBA 3G71S 1TX6A 4FU8A 5DP9A 5LJ5Y 2HBYB 1J9CH 3J7YU 5L46A 1W2BR 4J91A 1HQEB 1QJ6B 1KS2A 3LDXH 2FOGA 3CC7S 3FQLA 1ELEE 1KYNA 3W8PA 1AQ7A 2ZR5A 2BD9A 2QYIA 2XULA 1C1BB 2ZCLP 4ZVRB 3H2LA 2ZOGA 4HI2A 1RRKA 1B0PA 2EFNA 4RW9A 3RXMA 1OKXA 2E5HA 4CLWA 4IO9Q 2JHEA 3W63A 3V13A 5GNDA 5AE1A 3HULA 5IFMA 3CHEA 1Y59T 3O5MA 3R5AA 1U1QA 4FUEA 5J2MB 2MQOA 1U25A 1ELFA 2YWEA 1XBWA 1RT3A 3FBFA 1WDDA 1T9TA 3DOKA 4IYQA 3GJTB 4RW8B 1RS0A 3SXLA 2H65B 1DRZA 1ZTTA 2V3HH 1S1WA 3ENQA 1AZSA 4ED3A 3EJMA 3D1OA 3RAMA 1A1RA 4B3TJ 1N5TA 2WHXA 2WPDD 3G6MA 2VBCA 9ESTA 1TFXA 3O8BA 1SGRE 1SC6A 4M8LA 5ESBA 3TVYA 1EOJA 4TPYA 2W8LA 4FKYA 1L3KA 2BACA 5D0GA 1G3CA 1RADB 3TJAA 3MWIU 1TOMH 3OTJE 3QZRA 2IPOB 1K1QA 3GONA 3CD0A 4F8RA 3D54A 1GBCA 1P2QA 4PTMA 4QIEA 1GI1A 2BABA 2J9DE 1S97A 4YR2A 4ES1A 3UWJH 2XCAA 3E2EA 3UAIC 2DISA 2FQQB 4OI2A 1PYTC 3N7EA 2B5JB 1QURH 3T26A 2BOPA 2BZ2A 4ZHMU 4H4OB 1LHEH 4Y2CA 3QATA 2VDHA 1HBUB 4RW8A 5HBFA 3HZEA 3I9V9 2FVQA 4EO6A 4UOGA 1ACMB 3CJ3A 1S1WB 2NU4E 4ES2A 2ULLA 3HM9A 4E2FB 1S7IA 2FTRA 1ORFA 2E5JA 2ZFTA 1K1PA 4DX6A 2VWMA 5SZTA 9LPRA 5T6DA 2QV1A 2OPRB 2UXCJ 2IJOB 2ASDA 2LMIA 4DQIA 4ZPWR 4IPXA 5DM7Q 1SLXB 1R0AA 4LF4F 4XFQA 4WWYA 2ZH3A 3QWPA 3W2WB 4Z2KA 1RAGB 5K20B 3T41A 1LK5A 4CRDA 1XUKA 2B9XA 4UY8T 2W9CB 4AFFA 3LPYA 4DQQA 3F9EA 4FVMA 4FPIA 3IGNA 1WTGH 4KH0B 5E2PA 5CYMA 4LT6A 4X4SA 4NZLA 3RXUA 3STJA 3A87A 1H0GA 3AHPA 4ENOA 1QPFA 1R0BG 5GDSH 4K4SA 4QQBA 2FEQH 1ZH5A 5D3GA 3N7OA 3S69A 2KJWA 3L33A 5C2CA 4BCAA 2IRYA 2B7BB 4NOHA 1O2OA 1S12A 2YNBA 4CHAB 3EVMA 2GCHG 1QSYA 1RGQA 2NYHA 1QQUA 2MF9A 2FD2A 2MLXA 2VVVA 1ZM2A 4OHWA 1XKBC 2QLFB 3HF5A 3LP0A 2P5VA 1X4HA 3L3CA 5D4LA 4WKYA 2DXFA 1FKAF 4ED8A 3CJSA 1TR0A 3DA9B 3KYFA 2KCOA 4CRJA 1TKZA 4DL4A 4Y10E 2QLWA 2HLUA 2K1RB 3G9CA 5CYQA 3NGUA 4ZPBA 1DWEH 3P5BP 1FJGF 4WXOA 2EULA 1C5WB 3DLHA 1CE5A 2YOLA 2Z0GA 4YHHJ 1FTRA 2PEHA 4LUBA 1W10U 4P00A 3LWLA 4PPZA 1R0CB 4Y28C 1PPZA 1OGGA 5BXIA 1QA0A 3G2XA 1QL8A 1HKJA 1EYMA 1KQGB 2PC6A 4ZKSU 3EGKH 2FJXA 4ELVA 3UI6A 5DJBA 3R7NB 4G1QB 4ZVQB 1M1GA 1TKXB 4K50A 3LH3A 2J0SD 1BZXE 2HHPA 4MAVA 2BX3A 6FDRA 4A47A 2J76E 4K60A 2A3BA 3R6GB 2E7VA 3BTQE 3NXPA 1SQEA 4C11A 3EQ0H 4QT3A 5E5NA 5DG7A 2APOA 5IWAF 4C8YA 3FNNA 4ID8A 2XMMA 2J5UA 1WF2A 4LF8F 3SN8A 1TVRB 3MM5A 3AAWB 4Q8EA 5EJ1A 1C5MD 3TEHB 7AT1B 5T1VA 2VPWB 3U27A 1CHOG 5J2QA 3NPSA 2IDEA 3GV5B 2F3CE 4DR2F 4CNZA 3US5A 1ELDE 4X4RA 4FVBA 1WSSH 1OMSA 1YG0A 4NLRA 3OV7A 4RUHA 4K1SA 2OFHX 2RDEA 5KFUA 4A1XA 3GOVB 1MWZA 1X0FA 2DJWA 2FC9A 2MZJA 1RU1A 4ZKAA 2GHWA 1I3OB 3NMRA 1LXJA 5IZHA 2V9KA 1BMMH 3RLWH 5J6EA 1QCPA 2HHQA 5C0UA 1DBDA 3MU4A 4NIYA 5A09A 2AIRB 3NCQA 4ZHRA 1I1GA 2PGQB 1TRMA 1O0DH 2HYIB 3RMOH 2UUKB 3UOUA 4P2XA 4ZKNU 2JVOA 3FY1A 1FCAA 3GIIA 4IH5A 4M63A 3D0IE 4C8KA 2R9PA 1QSSA 4X2VA 1FRKA 4K0KJ 3JYMA 2JEFA 2PSYA 2BDAA 4TW7A 2DUCA 3Q8YA 2F4LA 2CJYB 1WEYA 3QGGA 3PV8A 2XYAA 2DKOB 2O8UA 1Q2WA 2EKNA 2BE7D 2JL9A 1FJEB 2YBTA 3CXCR 4K4TA 4CLLA 2MKJA 2VBXA 1GVZA 4P72A 1O2IA 4TLRA 3MM8A 1JJHA 1O2GH 2XBWA 1N33J 3TARA 1A5IA 1IBMF 4B6FA 1NWSA 7FDRA 3F3BA 5C42A 5LMUJ 3SNCA 1UWBA 2ZITA 1X9SA 2Z58B 5IXUA 4C0HA 3MQKC 4CM0A 1IJFB 4YEAA 1WD6A 2CPJA 2ZWOA 1HAPH 2QL9B 1S9GB 3GB0A 4KRWA 5IC6B 3UDEA 1DY9A 3ATLA 2CPEA 1KT1A 1YPJH 2BZAA 1GK8A 1V2PT 2A6OA 3WQVA 4KJIA 1C2FA 2VFVA 1XR5A 2J8SA 4DSLA 5E3PA 4DSFA 3UNQA 5EQSA 4OHZA 2FLRH 1P2KA 4DL0C 1LFPA 2R8JA 4XBBA 1F92A 1GPFA 3M8YA 5B6LA 2M4MA 5AXNA 1PIEA 2QSWA 2VQEF 5KFJA 4ECQA 1JRSA 2H6MA 4AFZA 3PR5B 2MHNA 2CJAA 2ZI2H 3CJ0A 2ROPA 1SPJA 1Z8JB 4I6YA 4YO9A 4NLQA 3TJ9A 4ESTE 1TAQA 1K8AT 2ZD1B 4Y71A 1TQLA 2J7WA 2NUHA 3VVUA 4C98A 1BBRE 2QGRA 2OC7A 2LU1A 2QIQA 1KBRA 3NWGA 5DDOC 2ZTXA 1PC4A 1QFKH 5FD1A 1C1SA 3IR7B 1S6UA 1ELCA 1FNXH 2HGMA 1L1GA 4OYXA 1KXCA 2BX4A 3JAMY 1D8YA 2YX1A 5HQLA 2D3ZA 4WU3A 3VG8A 1NTPA 2HIYA 4ETXA 2KG1A 3TO8A 4WBFA 3KQBA 3DOKB 4FU9A 5DIVA 1YJUA 4KFBA 5HO4A 3MO3A 3M30B 1TALA 5KFMA 1YKTA 2HW3A 3VAWA 2ANKH 1JB0C 2HZAA 4PYDA 5EG4A 1J5OA 4QBUA 1K21H 5EPNA 2RMLA 4KB7A 2VODA 5C3NA 4UFDH 2XZDB 2CPFA 5KFYA 5GAEU 2IVYA 3IGVA 1DLOB 2YX7A 2XPAA 5K9FA 1Q86T 2ZD1A 1T3OA 4N5SA 1H2TZ 3BTKE 4R0IA 3M9OB 5HMZA 3SU2A 4MMOA 3CEDA 1Z1IA 2G8TA 1H8HD 4ODNA 3WY8A 1HAOH 5DP5A 1U1LA 1C1WH 1L5UA 4ECXA 3MTJA 2B5JA 4ABFA 3H9RB 4BLGA 1DURA 1AIXH 4HI3A 2P2CB 3CHFA 1AB9B 4H4OA 1OSCA 1GI4A 5HAOA 3TZYA 3K5LA 4P7VA 4BDPA 2YQ0A 4DL6A 2V35A 4F04B 4FN2A 4RNFA 1X60A 3V4MA 3EDRB 1B0TA 1TQ0B 2YNIA 4R8UB 1BY9A 1D3PB 1BBRK 2NQPA 2DIVA 3E91A 1FKBA 1NRSH 3VAFA 2HPUA 1RT2B 2BQUA 4U86A 2R7VA 5AFYH 3QZ7A 3MURP 3BQ2A 2JH6D 2CQ0A 3TYTA 1PQ7A 1V6DA 2J94A 2MQ8A 2GVZA 4YZUA 3JYJA 4CLKA 4X4QA 2ADCA 1EJAA 4MIWA 4RKJB 2B7CB 2HEKA 2I6WA 1XUJA 2SFAA 2HQGA 5KFTA 4AN7A 2V67A 4CT8A 1IVZA 2Y5FA 4PKDB 4ED4A 3BTHE 4HL9A 4RNNA 4NSVA 4LR7A 3POTA 1HCGA 1X6LA 1HGTH 1NK4A 1CQQA 2XNRA 4DU8A 3ALGA 1TMMA 3M6WA 4R8UA 3OX7U 4TYAA 4JK5A 2CXEA 1ZR0A 1HNZF 4JUZA 4W9PA 1CU1A 1FRJA 3J80U 2XY6A 2P9GA 3FZDA 4NLUA 4JYVH 1ZCNA 4C97A 2U2FA 4OZ5A 5KT3A 2VIWA 1PINA 1PG5B 3KLEB 4U30A 5KT4A 2BDYA 4JFJA 3RBXA 1QZ2A 4CH2B 1GCTC 2SGFE 1D4PB 1FRLA 3N9UC 4HARA 1HBNA 4N8NA 3TITA 1GWAA 3SZ2A 1C5TA 5L2ZH 1EQMA 3BTEE 2V8HA 1QJ7B 4ABIA 3FZZA 1PO6A 2WYGA 3VB7A 2QMXA 1X4AA 1EFRD 3SJ8A 1C9TA 4C7QA 4ZVOB 4WY3A 2ZBCA 1FK9B 4Q4LA 4ANDA 3OT9A 2QXJA 2R7TA 1U6FA 3I87A 5J2PA 1KOOA 1GCDA 3O6QA 4M5DB 3NGSA 4ODMA 1JNZB 1NK8A 1TGCA 2ROGA 2XXLA 3D6FB 1X9MA 3M05A 3Q86A 1RTFB 5I3UB 3J7AN 1N6YA 1RIWC 3KMSA 3LGNA 4UQTA 5LSRA 1KTTB 5HIYA 2KU7A 4QYZK 1RAJA 2VD3A 4USWA 4FBUA 3VHQA 1Q82T 1S57A 4YUDA 3STIA 4KT0C 3LUYA 5U47A 3HVWA 3T3FA 4A8SA 3SUFA 4I8KA 3I78A 2G1HA 5JJBA 2WLYA 5E0JA 1HB0B 1G2MA 2VA3A 3PHEA 1CT4E 3B78A 1IQGA 2EI6A 2FIRH 2AJ2A 4NEYA 4G1PA 1X7AC 3HHEA 4I67A 1WKKA 1Y3WA 8KME2 3CD6S 3IHZA 2F5GA 3M7VA 1HI1A 3WQWA 4P2SA 4MLFB 1RT1A 4XBCA 1A3BH 3AAUA 2CJKA 1YBTA 3ILOA 3H2UB 2ALPA 2AMQA 4PQUB 1C5UA 1FRIA 1KR4A 2BJDA 4WK1A 3ARQA 3IM8A 2HIQA 5CD4H 4M5IA 1K44A 2YKQA 5A8RB 4M5NA 2ZM6J 3D9BA 5FPYA 2DGUA 1HHQA 5HKKD 1QDUB 1Y5AT 2ANYA 2AGGX 3F0NA 1NBEB 3OOBA 3WC2A 2BD8A 1GHAG 3RU0A 1YRTA 3MFHA 3H25A 3LGHA 2KCYA 1F5KU 2PUXB 3FUYA 3A3PB 3ZTSA 3SU5A 4DV6F 4GRSA 1BTYA 1A6LA 1U0SA 2I2YA 3QWUA 2ADBA 4NA8A 5EWFA 1MG7A 4ZVSB 2YNHA 3THPA 1J15A 2DXDA 1O30A 4IFYB 4O3UA 4BAKB 4WXVA 1DARA 3MEEB 5BYSA 2LP4A 1RT1B 3QIDA 2GV1A 2VBYA 3MHWU 4TYOA 1RT5A 3QT7A 5KEDA 5L30H 4PQUA 2M5YA 1A7GE 1ANDA 3MUMP 1U0HB 3Q8QB 3TK6A 1PPGE 4RO0A 3M2RB 5LL6d 1UMAH 4DJBA 3A7ZA 2GGPA 2V0BA 1UFLA 1UCYE 1ZB5A 3JAMU 3L7OA 1V2KT 1BT7A 1Q79A 4NASA 2G51A 4J9KA 1F7ZA 4HYKA 5A8ZA 1NWRA 3P8BB 1ZHPA 1S0QA 3BH6B 3UD4P 3MH5A 4E7RG 3GYGA 2ASJA 4F3OA 2ZC4A 4JV1A 1YX2A 2WW4A 3DMJA 2D1CA 3TA0A 2FOBA 1TNLA 3OLBA 2FJAB 4P52A 4TNOA 1XMOJ 4AFQA 2STAE 1B3TA 2IPQX 8LPRA 3ZVCA 5D77A 1BWVA 2ZCKP 1JK9B 1BUIA 2AX0A 3UTUH 4F55A 1U0HA 3LPEA 1SLWB 2ZECA 4HT7A 1X5SA 1KSNA 3OFEA 4CBOA 4DOZA 4B02A 4Z0KA 2H54B 4E7NA 2EG2A 3FSYA 4A1TA 2P6TA 4ED6A 1ZBCA 1ZOMA 1OHHD 4B2AA 1EQ0A 4J7CA 2C4FH 2ESTE 1FAPA 1SC3B 2SGAA 4RLEA 3QSIA 1NESE 4ZCKA 1JIRA 1AT1B 3AJ1A 4J9MA 2ZJQQ 3KGPA 3CS7A 5H9EK 3GICB 4DRJA 1FWLA 3ARPA 2LKZA 4MK7A 1Q78A 3GY5A 4MNXA 1JJCB 3TWZA 3LGYA 2K1QA 3EAJA 3SV6A 1T94A 2FOHA 4FPRA 4Z7YA 5CQGA 1C4AA 4ED7A 3MMBB 1ZTKA 4UQGA 1L4ZA 1W13U 1VITG 2W7UA 3IR6B 1YITS 2PPNA 2DG3A 1O2YA 2XYPB 2R8IA 4ERDA 3F56A 2I9SA 1OWIA 3A8KA 1RAEB 4MNWA 4DV4F 3ZZ5A 2UXBF 1ZOTA 4RW9B 2PKAA 5CABA 2Y0SD 1FX2A 1N6QB 5GQBA 5EXMA 3MTKA 4KHRA 3PW2A 5E3RA 3R7SB 4DF4A 1GI3A 5J2MA 1Y7PA 2Z9KA 1DFPA 3EMTA 3N79A 1R27B 4N47A 2ROEA 4JFKA 2M08A 2RDJA 3O5IA 2VQFF 5F3ZA 1YRXA 3W3SA 3JYTA 4DRHA 2OKQA 2GW8A 5DJ7A 1JNDA 3S7HB 3QOKA 3NS6A 2ETNA 3EM1A 3HO1A 1YDLA 1LWEA 2D9OA 2Y0BB 4B3MJ 2ZHEH 1NK6A 4G50A 4QT8C 4U7UK 5HKGA 1LJYA 4Y0YE 2ZC9H 1HD0A 4Z2XA 2W25A 3K5OA 2BE2A 4WFXA 2FOEA 4KHPF 2G2ZA 4U7CA 1T31A 3DU5A 3A81A 2ZG0H 3DDKA 3KWMA 4DFPA 3ZZ9A 4Y2IA 3FANA 5D0RA 1ULRA 1DANH 3UR6A 3BEGB 2Y5GA 1C4U2 1MAXA 2LVWA 5GPRA 4URSA 3CJQA 1HXFH 4RW6A 5J1EA 2Q5AA 1UVUH 1ZS6A 4ITZA 2ZBRA 3ESTA 3A1YG 1OIAA 1AE8H 1CJTB 2DGWA 4I86A 3GDUA 3EXYA 3BEIB 3D49H 4X2YA 3Q00A 4BWMA 1G9IE 2C28A 1FIWA 2H3EB 2LYVA 3KK3A 2V2VA 3WL0A 4CCHA 4TSFD 1O5JA 2OD3B 4BAMB 3QSYB 1WI8A 3UDVA 2A45B 2KJVA 4LBHA 3OQ2A 3PA7A 2R9LA 5KFHA 2QFIA 1N1LA 3VAHA 1MD7A 1A61H 1JLQA 2CQ4A 5BR8J 2BXJA 4KGKA 1KEKA 3KLEA 3G6YA 2A0QB 2W6JD 3KCEA 4MT1A 2AKWB 1BXNA 2RS8A 3GMGA 4M1KA 3UR0A 2BLWA 4YESB 1UCNA 2X1AA 3DOMA 4PZVA 4XBDA 3O8DA 4RZRA 1PBUA 4ZIWA 2KM8B 5HW6A 4XAKA 2H4WB 1FNOA 2CQDA 2VFSA 2JEJA 3RXCA 5CE1A 3D66A 4GUXA 3FSIA 3GCTF 2ZNKH 3HDSA 1UTKA 4WK9A 1F5LA 2E9RX 4OHVA 4AFUA 3TH4H 2HVHA 2XWYA 2VDIA 2OGUA 2BM1A 3RXBA 2W01A 3RM2H 1LNQA 1WOPA 3DGVA 4URQU 4NYPA 1F0RA 1IKVA 3MMJA 3VGUA 2ZH7A 3CDWA 2AGIX 1TV6B 2ZNZA 5HXFA 4OYPA 1FMGA 1INCA 4E8UA 1FONA 2YPYA 4WZMA 3DOMB 3H90A 4J9NA 2VBWA 1T05B 1WNOA 2MZSA 2BW2A 1HJAC 2XRCA 5I42B 1Q7LB 2B3TB 1ROFA 2XBXA 2YKMB 1R7IA 2FGOA 3H42A 1C2EA 2DGTA 4NIXA 1HJAB 1NRNH 1TMUH 3OL7A 4MJKA 1K1OA 1JLGB 1H2VZ 1B0EA 1SGTA 5EXNA 2CJIA 1NMEB 4G1QA 3LKWA 3OY6U 1SBRA 1WELA 2ZPRA 4ES3A 3E51A 4FS2A 4HHHA 5BXJA 4ZLNA 4WIWA 3RBZA 4ZN3A 4ISOA 1E36B 2C3UA 1TK0A 4GCHF 5GAGU 1S1VA 2AGEX 1NK7A 3RXRA 1HXVA 7FD1A 5HM9A 1CA8B 3DI6A 4I31A 1U7LA 3D68A 2HNYA 4PYAA 1YPMH 1WNEA 4P8WA 3PLPA 3B8JA 4JYSA 3W8GA 4Y2KA 1YGCH 2HKEA 4OJ3A 3RM9A 4DWSA 2XCFA 2KM8C 2DR7A 3OJUA 3NRLA 2DD8S 3MFIA 1OYTH 4ODRA 4CLTA 4IOAQ 1Y8TA 3VQSA 5LMUF 1QZ8A 4FF3A 1SHHB 1DLKB 3KAIA 3ILLA 5JDUB 4X4UA 6AT1B 3AW0A 2UVVA 1G3EA 1D6OA 2XW9A 2LQBA 1P12E 1L1NA 1SL0A 5PTPA 1GI0A 6CHAC 2O1PA 2D8WA 2VQFJ 4QCLA 2MQPA 2QA4G 1RI7A 2W9BB 2PKSC 1T8MA 2FI4E 3F1SB 3D4JA 3V81B 1RTKA 4FXGH 1SPBP 2RVJA 2J0WA 4ALZA 1GBFA 2RQMA 1GL0E 1PCAA 3WQPA 3CE8A 4DRNA 3DXBA 5A8KA 4ASHA 5BPEA 4W5UA 3DC2A 3KJVA 5ITHA 4Y11E 1ITXA 2E1RA 1G2LA 3H8YA 3GFXA 3O1LA 1O2UA 3PV4A 4B2BA 1P2NA 2MMYA 2CQPA 5CCMA 3R5GA 2BD2A 4AE5A 5B8IC 4S0MA 2C90B 1E15A 1C9PA 3MPDA 2IOTA 4LRDA 3NK8A 3AY0A 4WFZA 2CJ9A 1S49A 3VB3A 4OX6A 2W3KA 2CDQA 2HQFA 4K4ZA 3ILJA 5E33A 1HFEL 4LAVA 3E3XA 1LVMA 1FJDA 5EDWA 4AORA 3CP7A 1BMLA 3EIPA 2OQUA 1RIWB 1QTNB 3C14A 3M9NB 4MNVA 3LTOA 1UHBA 3GY3A 4Q2LA 2CG8A 1QVGR 1NSAA 4KGAA 1E6PA 4ECZA 2IJD1 4JZFH 1ZPZA 3QT6A 1TQ7B 2EK6A 5EHHA 4Y2MA 1R8PA 4NLWA 5L6NH 5HVFA 1AE5A 4U85A 3MMAB 4ZHAA 1T7CA 1UETA 5KT2A 4N41A 1B7XB 3P3DA 1CS4B 1NUEA 4OGXA 2JC1A 5CYJA 4I1TA 3MOJB 1D3TB 1O5AB 1FFWB 3TOQA 4F3QA 4OX9J 4OI1A 3FK4A 5C25A 3IAM9 1FVQA 2DH7A 2J2UA 5KFKA 1G3OA 3M8QA 1I51B 5F8MA 1J2VA 3UD5A 2DE8A 3SU4A 3PO1B 4CDIA 1R0AB 2XP5A 4AGJA 2EC2A 2EEKA 3CCQS 1LCYA 1XIQA 3C8YA 4Q2KA 4TU8A 4KH1B 3SNAA 4IUFA 4FUBA 1ZHMA 1XR7A 1BA8B 3ADAC 1JLBA 1EZQA 1F6TA 3BKUA 3J7ZT 5E0OA 2XO6A 1ITPA 1E6YA 2CF8H 1TL4A 4FVCA 3E1XB 4IOBA 4USTA 2H51B 3QRQA 4R8TB 1WHWA 3UW1A 1C5LH 3S9BA 1M5SA 1REGX 2OLGA 3V2UC 2HOBA 3CNQP 4R5EA 2QA9E 2XOKD 3W9HA 3UD3P 2VIQA 1NROH 1HNZJ 2E9TA 2WAQD 1YCPH 1YPEH 4TW6A 3UUZA 2Z9LA 1BIOA 3C3LA 5IWAJ 2BOAA 4Z37A 3T5KA 5G4BA 1H7WA 3W1YC 1V3XA 2OJ3A 4NZ6A 5B0GA 2KXHA 1C1RA 3J81U 3R5BA 2VL1A 2FOFA 4GKKF 2XBYA 4FDFA 3MDFA 3L95X 2A2CA 3GILA 1CTNA 3RM4A 2MDAA 1JLBB 5CYQB 4ANEA 1N8OB 1SLUB 1RD3B 1E6YB 3ZFVA 1OJ4A 3CCMS 3HHLB 3N01A 2AMPA 1JWTA 4YB6A 5D4NA 5L1JA 2BOHB 4ZPVR 1WTBA 4JI3J 2XB2D 3KUHA 1N5SA 2TGTA 2MQNA 4ZVTB 5HGGA 3Q24A 4BAQB 2RDDA 1IKXB 1SUQB 3BN4A 4PWWA 3BSAA 1IBKJ 1AWFH 1IBCB 2MPHA 4A4JA 1TKXA 4CRBA 1SJFA 3OXFA 1XUGA 4DR5F 3T5HA 3A82A 1AZSB 3GR0A 3IM9A 4YDXA 1FT8A 1NDLA 2CUYA 1FDPA 2DITA 3A7VA 3QLPH 1LKBA 4C11B 4GKJF 2GQ2A 1DHMA 4AXIA 3ETOA 3VGSA 1K1IA 1MTNB 1AVGH 1QGFA 5DKMA 4AL7A 1U26A 3KL6A 3M2VB 1J4IA 2WVFA 2MY7A 1RTDA 1FTCA 3DKDA 5K8MA 2BANB 3ARXA 1GI5A 2Q3PA 1SB1H 1FDDA 3BPDA 1SC8U 2AEIH 2UUBF 4OQJA 4KELA 4LIWA 3AAVA 3MR7A 3HVTB 2Z3DA 2BQRA 5B0CA 4PQAA 1U09A 1PQAA 3P45B 3FSXA 3ZZ3A 3Q89A 4IR9A 5HW7A 2Z9IA 1S99A 1HBUA 2BLVA 4YB1P 2GIRA 2J9DA 1DQ9A 4OHYA 2JSXA 5FDLB 4X2BA 3DRXA 3IS9A 4LOYH 1WSVA 1SGQE 4INLA 3PY8A 4KP0A 1VRTB 1J27A 3E8LA 3OVBA 3R97A 4P74A 3P6YC 4ACAA 2BM2A 2MQLA 4ZAEA 1KD1T 1FV9A 3ODKA 1HAZB 1W7GH 4ZVHA 4J9OA 2OTVA 4ECVA 1Z8GA 3NOCA 2I0XA 2P8IA 4KTUA 2R42A 3W2WA 2A3CA 2GVDA 4K8YA 2FHJA 2YQ3A 2QMWA 3MAQA 4OYZA 1SB6A 3A86A 1U45A 1KDQA 3MCSA 2PV9B 2CAJA 2XSJA 3JZ1B 2FC8A 4NLOA 1X5OA 4IH7A 4ZVEA 2D69A 2FIUA 5JVHQ 1W1PA 5THWA 3ZVGA 4ITSA 1Q6HA 3AODA 2YKMA 3A3OB 2J0XA 2GZ7A 2W8KA 4Y8XA 3H7HB 3FO8D 3LJOA 4WF9Q 3NL0A 1HAXB 4JV5F 1RHJB 3QWCH 4O44B 1BTZA 5A6PA 1R3NA 4DLEA 3OSYA 2BB4A 3DLLQ 2YKNB 2KHDA 1GVKB 4DW2U 5FBEA 4JFLA 4DN0A 1WWHA 3KKFA 3TJOA 2MGZA 5KFQA 5KTQA 1N33F 1OPZA 1OPIA 2YTCA 3TLOA 3DI6B 2R0LA 1S9GA 4UUXA 5EJZA 1D8ZA 1NPRA 3WKZA 3QIPB 5A8WA 2A5IA 4JB8B 2HHHF 4YFUA 4PUOA 3ZZ4A 3GCHC 4A8OA 2ANWA 4QW9A 3WD3A 1W0JD 2PV3A 1N5YB 1W14U 1GT8A 2CWKA 4DJZB 1OQ6A 4QPXA 2UUCF 1Q5VA 3BMBA 1TBZH 2DEJA 2B9YA 5KFGA 2G52A 3LGUA 2XTTB 4IW4E 3M7QA 3AB2B 1S5ZA 2CJQA 1MZAA 4EWTA 3ENWA 4RT1A 2GIFA 4USVA 2HNTE 2HURA 3ZZDA 3KF2A 5DQHA 1KTSB 2CXVA 3QJPA 1UAWA 2PMZD 2J7KA 1O3AA 2J0QD 4RX6A 3B82A 2MGZB 2OBOA 1HKIA 1E1RD 2PHBA 3WX8A 5DG8A 3FQKA 1E0FD 3FRYA 2FS9A 1S77D 2CRLA 3WD0A 3M5OA 5A8WB 4IRKA 3MR5A 2DHSA 1S83A 4K8RA 2YKAA 4PUOB 3BGUA 1FJ7A 1P27B 4L3NA 4USUA 4TY7A 1NH6A 1BD6A 2BXTH 3OFHA 3LH1A 1QJHA 1SI5H 2GJ2A 2AH4X 1JNTA 1WI6A 2IY5B 3D5MA 3OHBA 2OPSA 3PMBB 1LWCB 1WHXA 3QUMP 2XMVA 4YT6H 1OGBA 4IFYA 1LW0B 4TU9A 5HT1A 3Q8SB 3F2HA 1K9MT 4DUYJ 4MQAA 4WJBA 1X0PA 2KGJA 2QX0A 3IKGA 3CVKA 1SGEE 2A5AA 2QA1A 3HX9A 4K2JA 1Q31A 4KGMA 2ZBIA 4HH0A 4Q63A 2RA0A 2RDIA 4HEA9 4K4UA 3SV3A 1IQJA 1M5HA 4PG7A 1O3OA 4RWWA 3R5DA 1TL3B 1U1RA 4A8MP 1GMDF 2R7XA 4LBIA 3I29A 1WHYA 4OIXA 4U2WA 3UIRA 4B74A 1X8DA 3KQEA 4MNYA 1A0HB 1B5GH 4KBIA 3NZIA 2WK2A 3K0JA 1EB2A 1GRJA 2HQDA 2OH2A 3SV9A 1O37A 4BBYA 5DP4A 3KHHA 2M1IA 2PGBB 2SXLA 3M32A 2HQCA 3BXWA 3DMJB 3PNIA 1RTZA 3G4SS 2CGAA 4TLQA 2Z9JA 4D3HA 3BIVH 4UZBA 4TX0A 1AB8A 3UN5A 1O3DA 4DRMA 1SGFA 2ZGXH 3LJJA 2R3VA 3RXTA 4RUAA 1JRTA 3TJ8A 2LCWA 4K7QA 3ZZZA 1HNIA 4UTGA 3FAPA 2P59A 3MNSA 1I94F 1H9HE 1UW9A 1R31A 4A1VA 1K9TA 1H6KX 3DYAB 2F91A 4HZHA 4R0XA 2OXSA 3H4BA 4AXJA 1J14A 1SJRA 1HV7A 4IDKA 2A4OA 5HMWA 5GWZA 2F3JA 2Q79A 4ZVUB 4YTAA 4CHAC 2HQIA 3OL6A 3V4IA 2V8DA 4Y34A 1TL5A 4FVDA 4EBEA 1O5BB 3M32B 1JLFA 2GMTB 5IM0B 1DT2A 5ETNA 2HBQB 2DGVA 2QA4S 1D9IA 2XP4A 4O9VA 2QXGA 5AXMA 3MEDB 1W7WA 1QY7A 3MMBA 3HHLC 1WBGB 4LAXA 1H72C 1ZMJA 2CPIA 4KC5A 5HBMA 4YLUA 3H5YA 1GNKA 4ED0A 1Y5NB 1YBWA 2BRKA 1GBIA 1KONA 3M8WA 4JI7F 3H5SA 3PJ9A 2F83A 1EAUA 1V6HA 1SVDA 2ZGCA 2MEWA 1HYSA 4F0HA 3WX4A 4HLBA 1UK4A 4X1NU 4CRGA 4IDKB 4DV7F 1N0VC 2DB1A 2Z4PA 4NZQA 4RW4A 4FNHA 3V12A 2OP9A 2ZGBH 4DG1A 1N34F 4R0EA 4K8BA 5I98A 1NHKL 3TJUA 1IN0A 3FP7E 3O8RA 3GP9A 1JNSA 2HPQH 2XWXA 2GDDA 1SGYE 3TX0A 2G81E 1SKSA 2IFXA 1RWUA 4CZCA 3ZZPA 4UFEH 4WP8A 2PE8A 2WVEA 3A7TA 1GHAF 5I3UA 1KQSR 1ZZNA 2YKOA 8RUCA 2K1RA 2B5TB 1RWOB 3UI3A 4I8HA 3RW7A 4AQYJ 1MKWH 2EK1A 3K59A 2U1AA 3W94A 2QL5B 2XY7A 1VRQC 1MROB 5SUHA 3QRRA 3ARZA 4PXDA 3B9EA 4HT5A 4FYVB 3T19A 5IT0A 1HI0P 3SZNA 2LPVA 2ZR6A 1AKSA 3UB0A 2IMWP 2LQ5A 1D1UA 4E05H 1NS3A 4GCHG 1IHSH 1AU8A 1ZAXA 5HLFA 4NRTA 3GCNA 2G4UA 1OYDA 5CHCB 3VCDA 5GMEA 1VRTA 4EBDA 4DSKA 3DD2H 4EZ9A 1VF8A 3KJQB 1YPHE 2YPZA 2IYIA 3NKYA 6GCHG 2P3FH 1VCPA 1K28D 1TUGB 2HFOA 3R8YA 3IP0A 3LP1A 2HGLA 3RXGA 4DHVA 5KFPA 2F2DA 3A4TA 2QY0B 5ETQA 2AHME 2E5IA 2WPMS 1RHKB 4HKQA 3LO3A 3PYHA 3HSGA 2M7SA 1QPLA 3RG6A 5DQIA 5IC4B 2GT7A 3NRBA 3RXSA 4X2XA 3TAMB 7LPRA 2TRMA 3HLUA 2ZQVA 2ZBQA 2V8VA 1EQ3A 1O3FA 4LF5J 3NBPA 5FJ4A 1GTHA 2Y1LB 2SGQE 4ODPA 2LA4A 4LR8A 5EIYA 1FZZA 2QN6B 1M0SA 4O44A 2MTLA 3GE9A 1AUJA 5F41A 4OYMA 3C6UA 2L6OA 1GMHG 3BG4C 3DSOA 4JMYA 1LQEA 1R43A 1BRAA 2L48A 5JMNA 1C1VH 3BTGE 3S7KB 1IQLA 3JXVA 1QE1A 4ECTA 4D3GA 1O2LA 4C6AA 3SFGA 4DWSC 3E0NB 5F8XA 3FVFB 4Y0ZE 2F63A 5L9NA 5DEZA 1HMVB 3P8OA 1U49A 4A8WA 2Q43A 1TFYA 1YYY1 3MU0A 5IYTA 1YC0A 2HZCA 4DLGA 5KFDA 1IKYA 4GLYA 1FXLA 1ZM3A 3UR3C 3UNGC 3PLKA 5HYOA 3A89A 5ETPA 1LO6A 1LK7A 3NBPB 1NLKL 5KFCA 4CQ1A 5HI7A 1XM1A 3TCZA 2R8GA 2HHVA 4NYOA 2YMSD 3EPIA 2XMKA 4ECWA 1LL7A 3PYDA 2M8HA 1A7SA 3PVXA 2LEBA 1UK2A 5DLFA 4ZHLU 5C67A 1S6HA 2OPQA 1FJSA 2XS5A 1VKYA 4JV0A 2C2KB 3GLJA 1AW0A 2DR6A 1LWFA 3OUYB 1TKDA 3BREA 2LA6A 3CHCA 1E6VB 1YK9A 3F68H 3MAHA 3BF4A 1M5OC 5FHTA 1GH8A 3OTDA 4ZDNA 1DXWA 3UNSA 3WZ0A 2B56A 1NBME 3MCOA 2HNYB 4WYWA 5IV4A 3BO4A 3WWFA 4USMA 4LJMA 5C5JA 4NI2A 1IKYB 2PP6A 2RURA 1Y4ZB 2FHMA 3U28C 1EHWA 1ARBA 1HXEH 1P2IA 2GVFA 5ETMA 2UVWA 3GY7A 1IQHA 1UVOA 2FLLA 1C4Y2 2G4TA 3FMWA 1TNGA 1TNKA 2DT0A 3PFEA 2V8GA 1HR0J 1JIMA 1FXDA 2QE7D 2KDOA 1ZETA 2RD5C 4ISNA 2ZH8A 3RXFA 3HI9A 4LF8J 4I2QA 5F03A 1LWFB 3OUYA 5F8GA 2XY5A 3SI8A 1OYQA 2IF4A 1K22H 1AA1B 4DXLA 2B31A 1N8RT 3GFZA 4ZROA 2B0FA 3CSKA 2UV8A 2D3UA 3RXPA 1TL3A 4B9MA 1FKPA 3G6XA 4NWBA 2MLYA 3LOUA 4JP8A 1GBTA 4VGCB 4ZKOU 1IXKA 3CCZA 4K1TA 2PBCA 1K1SA 3CCWA 1UTLM 3M36A 5DK1A 2VFRA 3VFEA 1RWNB 3KLGA 3PKYA 1TNHA 3ATWA 2B5UB 2A7HA 1C9HA 4YN3B 1EXFA 4F4KA 3G8TA 4W9QA 2JWNA 4JI3F 6CHAB 1VQLS 1J5OB 2VOOA 3LA0A 2ZU3A 4ATNA 2VBZA 2D9FA 4DRQA 2RRAA 1RTIB 3PYEA 1LG1A 3T2NA 1QTMA 2KB2A 3VGTA 1RT5B 1GMHF 3DRPA 2LQJA 4YLQH 2AW0A 3KJNB 3U1LA 2FLNA 2VH6A 3MH6A 1C2LA 2LQ9A 3T27A 2F8HA 5LT5A 3EX7B 1XRVA 2F9NA 1FI4A 4LXBH 3KK1B 1C1TA 4M95A 3G87A 4ABJA 5JYIA 1O3IA 2M52A 1O34A 4WP9A 1TKTA 3T1YF 2FXRA 2ZJRQ 1SL3A 1CJTA 2OMOA 2V2QA 2JZ5A 1T9XA 1DWBH 3L7UA 1SH3A 2IPHA 2YNIB 3EVOA 1U47A 3ETMA 1S84A 1U1PA 3MCMA 1F9FA 3AOCA 4ZKRU 2XEXA 2OC0A 3VGCC 4BNRA 5C2ZA 3SQGA 2W4DA 2XNIA 2HNZB 2JC0A 3MEDA 5GPGA 2OMLA 1RE1B 3CNRA 3D6MB 2UVUA 3MU8A 1VRUB 3KLFA 1ZYQA 1L3TA 3DRYA 2ZDOA 1UFKA 4M9FA 4INHA 4KTQA 2MZRA 1WF1A 4D7GA 3HK2A 1A46H 1WU1A 2F4VJ 1IAUA 2V34A 2BJ7A 4OLPA 4ZP8A 3FMBA 3AD7C 4B3SF 3HHNB 1HJWA 2RKIB 5JPMH 2RAQA 2KR7A 2H1UA 2ILNA 5EUHA 4RW4B 2AYEA 3OJSA 2OBQA 2EPIA 2B43A 1Z6JH 1S4FA 1NB7A 4QWDA 1RBOB 4KHMA 4EMDA 5A0CA 3UF8A 2WUCA 3THTA 3FKSD 1GJCB 1H0IA 1S1UA 1BTHH 1HWLA 3UN3A 1TE0A 1VRUA 4DFKA 3T6JA 1O38A 1MMNA 3TGKE 4XE4A 1L3SA 1FKFA 1RBAA 2HFVA 2YNGA 2W24A 4BTIB 1K73T 4KTSA 3D1HA 1AFQB 2XMJA 3LUOA 4IQXA 3CD5A 1T05A 2H5EA 1IQKA 2GDEH 2H5CA 1N6QA 3RBEA 5AHGH 2RCEA 2Q1LA 3NNCA 2ZUGA 2V2ZA 2L9WA 3BSNA 3MCNA 2ZZMA 2F8EX 2N87A 4JV2A 1WQSA 2DCUB 2R3YA 2Y5HA 4M5JA 8ATCB 3TIUA 3UQBA 1MBMA 5L1LA 3DDIA 5HW8A 2CIMA 4TKTA 2BY8X 2XI2A 5A2QU 2ZFPH 2EI5A 4F4OC 2BMBA 5HLFB 4NCAA 1UW7A 2R2UA 1C1MA 4ZK7M 1GOIA 3LP2A 4X6MA 1O3BA 4ABDA 3IBWA 5E3AA 1K9OE 3QAUA 1RYRA 3RMNH 2XTJP 4LREA 1O2SA 1N0UA 2AYWA 1ZBTA 4QJVA 5T6FA 3CTRA 1O2XA 4JYUH 1XWLA 1NDKA 4DCJB 2HFNA 4ED5A 1S9FA 2ZA5A 1CQNA 1RHUB 3D6TB 2NU0E 1EDQA 2ZPSA 2XHWA 1E6RA 4DPWA 1HLTH 2VICA 1EIYB 1HD1A 4MH8A 2BKNA 1S5SA 4CTAB 4CO4A 3TAMA 4LVOP 4LBPA 4Z2JA 7KMEH 4USJC 3N0VA 1FXYA 1GBMA 2DO4A 3QTOH 2QGFB 1WC6A 3VZIA 1FERA 2HRVA 2OP5A 4XDEA 4CR5A 1QBVH 3TPIZ 2R2MB 1FX0B 2V4JA 3GFYA 1O2TA 5FL7D 4I7FB 3L4BC 1BGXT 3QO9A 1HPGA 5A8RA 3AQPA 1KTVA 1T32A 3PIOQ 4K2XA 2F43B 2OIHA 5C7PA 2GVDB 5KG6A 4ANCA 4CLPA 1A9NB 1SQTA 4QU7A 4U8VA 3TK9A 3NS7B 5LXRA 1O2KA 2FJBB 2G13A 2UUCJ 3LF0A 4CM2A 4Z2HA 2WVDA 2PMHA 1U1MA 3EGWB 5IT9U 4Q80A 1C2GA 2FLBH 2XBPA 2YNHB 1G36A 4YDDB 2R8HA 4GO7X 3AH6A 2AD9A 1KSPA 2CJXB 4LRAA 4TPIZ 1Q4RA 3OPKA 4Y2AA 1CVWH 2VJ1A 1FKOA 2B8OH 4X65F 1O5DH 3SU6A 1S6LA 2FZCB 2GP9B 3A3NB 2HWHA 4DF8A 2AMDA 4B08A 4KKOB 3GIKA 3WWBA 3OEED 4DL5A 1J4RA 1F0XA 2V8PA 3MECB 1NRKA 3KHLA 1LVOA 2ACMA 4J9SA 4WFNQ 2UUTA 5HWBA 3A8CA 1LW2B 1D09B 2JDJA 1Z8RA 2KN4A 3M2RA 4P75A 3RTVA 2UZAA 3G82B 3BYPA 1WC3A 5C1UA 4ECSA 2UUYA 3DHWC 2YMSC 2L41A 2HNTC 2BUNA 5A6WA 3CO0P 1GJDB 1D9FA 1PAEX 4F49A 5A8YA 5BR8F 1EPTB 3MAAA 4ZS6A 1XEZA 4BC7A 1F9EB 4OS5A 5KT7A 2E5LJ 1YKWA 3WD2A 5IDKA 4XIUA 4Q44A 3KYGA 2EFQA 1NWTA 1S1XA 3UFAA 2HVEA 5DGAA 4LRFA 1P10A 5T3HA 2NLWA 1YPGH 2VG7A 4QWEA 5IOLA 3RZAA 1KTQA 2ZHFH 2YWHA 3MM8B 1TWXB 3MUTP 1DQ8A 4LGXA 3MYWA 3N99A 5J1NA 2QF3A 2VV5A 2AQ4A 1UJ6A 3MECA 1N6XA 4ZP6A 1D2KA 3RXKA 2KXNB 4LF6F 1ZSJA 1E9LA 3GY4A 3ENAA 1YPHC 2KYZA 5EN1A 2KXFA 2XC0A 1TELA 2UWOA 1FJCA 2D2DA 1VQSA 2ZEBA 5DS7A 4NXNF 1G37A 2CNKB 1ELVA 1C5SA 1CJKB 3BPSP 4DR5J 3QFWA 3HZGA 2G9OA 1KN6A 4J2YB 5F9LA 1S1XB 3BIUH 3B8SA 2VA2A 3TC5A 5I3PA 2E44A 3CJ4A 3WIUA 2KT5A 3DFLA 5IT4A 2GZ9A 3QBCA 1B0VA 1IUJA 1MUEB 2W7PA 1GUVA 2ZU4A 3OR1B 3KFWX 4TQRA 1RQ0A 4KGVB 4DI6A 2QIFA 3P49B 3SYJA 1SIZA 4KPYA 1FKKA 2Y82A 3K9XB 5EPYA 4PABA 1NRPH 1OX1A 3BSCA 1T4UH 2HK3A 3BTME 2DGQA 1Q8KA 2XLJA 4XPCA 1YP9A 3IAS9 2J97A 1NZQH 1XUFA 1KNZA 3CJ8A 1C0TB 1R6YA 3ZVEA 4OZ2A 5A8KB 4KO0B 4YQWA 4FUIA 4GO5X 3T1HJ 3S8SA 4TWWA 5H1SV 1KP6A 5H9FK 3HVAA 5L8RC 2BDPA 4AL5A 1M90T 3NNAA 3MH7A 3SCIE 1QAXA 3HSJA 1ZM9A 2GMLA 1HQEA 3HSDA 2B9LA 2ZH2A 4DY7B 2PN0A 1HBMA 2M70A 2HVDA 2RB7A 3O8CA 3RB6A 1NPKA 2MKIA 1RTDB 4XD7D 3DUXH 3EE7A 1VR6A 3EICA 3ZVAA 2IUZA 3KLFB 3DCLA 3CB4A 1NZAA 3BTWE 1CGHA 5HMXA 1Z1ZA 1FNIA 1FY3A 3C14B 4U7UD 3HT3A 4AG2A 4HTIA 4B9VA 1IQTA 5GCHG 1K0VA 3PMJA 4THNH 4OS1A 2C1EB 3T5JA 3SZEA 2RSEA 1VYAA 2QL7B 3IA0A 4B9TA 3ZTQA 3QT5A 1DS2E 1UVLA 1VBYA 1O33A 1ETSH 3OTPA 5FDLA 4M5GA 5DN6D 3ZZAA 1S6FA 3BG4B 2A5KA 4RW7B 3SI4H 2AS9A 2DIUA 1JLFB 2L9DA 1MN9A 2O92A 2R7QA 5DP7A 4XDCA 3F9FA 1AFEH 1VQMS 4XOJA 2BD3A 2J9EA 2PFFB 1W25A 1HBOA 5LMNF 1RT7B 1HRTH 2B8PA 5HBMB 2AEMA 2AWGA 2VG6B 3OA5A 2BY5X 3QGJA 1FPCH 2XO7A 4X64F 4A8XA 1O36A 4OJ1A 2O8LA 4NNRA 2HAFA 4OYAA 4MKYA 3Q2SC 1RGVA 3FN8A 1GMUA 1ELOA 4ER8A 1AVWA 4RBUA 2D74B 1UR9A 2O8MA 2GC8A 4JI8F 2Q66A 2HS3A 5A0YB 2CVIA 1NZ8A 1OY8A 4O23A 4CO1A 1WUUA 3POTB 4B3TF 3ZTPA 4NL5A 1SSXA 1H2UX 1HI8A 3TAQA 5KFSA 2A31A 2ODYB 3GIRA 4DG1B 3D67A 1VGYA 5KG7A 1BMAA 2JH0D 2HS4A 1L3VA 1RBLA 3W5XA 3ZZYA 2J9NA 2QXHA 3RXAA 1J4HA 3RUBL 3O5LA 1KRPA 2HHWA 5EGYA 5MAOA 2RQSA 1VC0A 3GYMA 4TVAB 3PRAA 1CG2A 1KHWA 4EI2A 2QTWA 4A7IB 1P9YA 1ZLRA 1GMCG 2WBMA 3GWCA 4P02A 5EW2H 2G0CA 1BMQB 4USKA 3QPIA 3MGJA 5AF9H 2XM3A 3HHLA 3CGIA 4IO1A 4NIVA 2HVZA 2MSTA 2BYCA 5KFZA 2N82B 3M8ZA 3ZZ6A 2O01C 1AO5A 1C5VA 1SUQA 3PFOA 4IRCA 1N5QA 1OSSA 2AU0A 2J9CA 4CRFA 1CVJA 1YZ7A 4WKHA 2XYHB 1MKWK 1WACA 4CTAA 2D26C 2Y3YA 1AKSB 2F65A 4KY3A 1TP7A 4K3JA 2ASUB 1GX6A 1FKJA 1KC8T 1UCYK 3Q3YA 3PROA 2HWTA 3IITA 3Q83A 1U24A 1CBKA 1UJ4A 2ZTYA 2J7UA 1TA2A 2V4JB 3U1JB 4CO3A 2Y9HA 3FKBA 2CA9A 2KG0A 4Q2MA 2HLDD 1FWPA 1WTFA 5G0RB 5JXSA 2AYBA 3M2VA 1CA0B 1P3CA 2RU3A 3LP1B 4ZPCA 3UQAA 3V6KA 1DAXA 2DY9A 4IS5A 2BBEA 4OJGA 3M6VA 2HGNA 2GV7A 1VZQH 3AK5A 2OPSB 4NA9H 1LWCA 3TA2A 1PPHE 1H73A 3ZVBA 4P10A 4AYBD 3B6BA 2P95A 3IMQJ 1C2JA 2THFB 1MTNC 1RHQB 4NG9H 3SU0A 4DQPA 1VCQA 3EZOA 4DDFA 5FPTA 4NXMF 1Z7KA 4LQ9A 3P96A 2Q6CA 4DUTA 1H0HB 1J8AA 2V7QD 1R6VA 1W7XH 2Z57B 5E2OA 2X3DA 3A7WA 4JI2F 1YJ9S 1JNRB 1GXLA 4DR4F 3LH2S 4ODOA 2ZHOA 2XP3A 2HPPH 3QQCD 5AFZH 1AMHA 3FDSA 1BC6A 3MFJA 2XMAA 3KJVB 2DSZA 3MAAB 1K0HA 4A6LA 1DWCH 2C8ZB 1BKFA 4NRUA 5EJLA 1FE0A 2HSEB 2RUSA 2IAJA 3NG8A 1M5KC 2ZWLH 1SGCA 1B6CA 3RJMB 4FS1A 1Q95G 1FD8A 3VTIA 1IKWB 2NUUG 1AGJA 4DR3J 2VF3A 3VEQB 4G1IA 2XMUA 3QLHA 1NU7B 1O3HA 3LOXA 5JB9S 4X1RU 5I4MA 1XC9A 5C17A 1DUEA 1YW5A 4UT4A 1TYNA 2YWKA 2IBKA 1W3CA 2LKNA 1X4DA 2HGTH 3B4DA 4X4OA 3NLCA 4OZJA 3WL1A 3OFND 1V3RA 3HXMA 1Q1KA 2DRAA 3BGFA 3K58A 3KAHA 1UVKA 1TTHB 4URGA 3OTEA 2NU1E 1PJPA 1E6VA 5GJ4B 5FPSA 1HNVB 4OZLA 3RXLA 1MCTA 3K6YA 4TXSA 1ZM4A 1H8DH 2ZGJA 3CIZA 5ETSA 4WXIA 3KACA 3MMAA 1KMHB 3SO3A 1YJ7A 2LP6A 3URDA 4IH6A 5F8LA 4PWDA 1IM4A 3JTNA 1EETB 4DPYA 3D0HE 3H59A 4FAPA 3TAPA 3M8QB 3BG8A 2P16A 2XYGB 2AYGA 2WVCA 3LIWA 1Y5BT 1W9VA 4E0DA 1UO6A 3BF6H 3M61U 2QE5A 3SU3A 1Y3YA 5L1IA 2PV1A 4HDGA 3CDUA 4I4BA 2M2BA 3GDVA 2J38A 1O3CA 2W2OP 4B3SJ 1THPB 3ZV9A 4WZQA 2FOMB 1TGTA 2PGCA 5LPEA 3E0PB 4BTUB 2CQBA 4Y7BA 1J17T 1A0OB 4JI4J 2C2RA 1NJZA 3IWLA 3TUJC 4ABGA 1MQ5A 5KAKA 3AA9A 1NFWA 1FKIA 3ARUA 4YR3A 4B6EA 6GCHF 3URCA 1DTQB 1O0PA 1GI2A 1QAIA 3PR9A 5JUMA 3KLGB 4IFVB 1SL2A 1OS5A 2C3YA 4OL8A 1U2CA 1JXLA 1ETTH 1LW0A 2MKKA 1TPOA 3NGRA 5DRKA 4ZXXH 3UCUP 4OYWA 1AN1E 1P1TA 1HNEE 4H54A 5GADI 4B9NA 1NRRH 3DFEA 3GQCA 2BDIA 3PIPQ 5KFRA 2MQMA 1YI2S 3DRPB 2DPEA 1M5PC 2B6AB 4B76A 4C4WA 1LDTT 4AZ2B 1W12U 3UN2A 2DNLA 5KOWA 5F6MA 3GCHB 1HJ8A 3TQEA 4HHUA 2ILZA 3O5TB 4UOHA 1P04A 2ZU2A 2ZHDA 5IT9Y 4OZNA 1N52B 1HL6A 1K1JA 4DL7A 1UVTH 2GTBA 1Y10A 2YNAA 4A8QA 4BXSA 1SKUB 4Z6AH 3ISZA 5CA5A 3OW2R 4LFCJ 2EEYA 4KFBB 4HACA 2NYIA 5KFBA 1JQGA 4IT4A 4Q43A 2RUCA 2FDAA 2BOKA 3CULA 3D62A 2W4PA 2C2OB 4USHA 2M2AA 4K4YA 1NN6A 1MU2A 2CPHA 1LVBA 2VINA 3CH9A 3ZTOA 1SH0A 4WKFA 5T14A 3O5PA 1UPPA 3M3VA 2DNHA 2EC0A 1DLOA 2GHPA 1FA0A 3FP6E 5KG0A 3TI0A 4JYAJ 1HBOB 5IV3A 5EX0A 2BANA 3MOZA 1FFRA 1D3WA 3HFVA 3OE7D 2WSEC 3TJVA 1JLEA 4L72B 3KXDA 4ZOSA 3RRKA 2UXCF 2KI3A 2ZVIA 2HNDB 2QC3A 5D78A 2J34A 1VDHA 4TNSA 2MY8A 5B0DA 8ESTE 2ANMH 1F60B 4QR2A 3AQOA