3PRFA

Crystal structure of human b-raf kinase domain in complex with a non-oxime furopyridine inhibitor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
262
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Non-oxime inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 76
structure length 262
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3prfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3prfA01
3DJ6A 2VTNA 4WUNA 3Q5IA 1R0EA 5BMMA 3W55A 3JPVA 2R3PA 4BCFA 4EOQA 4JBOA 5HNGA 1XR1A 3BCEA 4GKHA 4DH3A 5EYKA 3DCVA 3RMFA 2XBJA 3EIDA 5F1ZA 1GIHA 3D83A 5CAOA 1G5SA 2VTRA 5HZNA 2VGPA 4QP2A 1GIJA 3COIA 3DDPA 3E8EA 3LLTA 2AC5A 3NWWA 4FSRA 2JBPA 1BL6A 4U8ZA 4YJQA 3H10A 4C8BA 2W4JA 3TUDA 3ACJA 3I5NA 4J71A 5KKRB 3VW8A 3HUCA 5HG7A 2F2UA 5TR6A 2DQ7X 5AV1A 3LFAA 4AP7A 4HVGA 2F49A 2J90A 3HRBA 4YJUA 2ZYBA 3N9XA 4DAWA 4MCVA 4IZ7A 4RFMA 4RJ7A 3TV4A 1YVJA 3QKKA 4D58A 4DE4A 4HZSA 1UU7A 2Z7QA 4M84A 2WB8A 1ERKA 1OPKA 5CF6A 2P55A 4WIHA 2X1NA 5CVGA 4YZNA 2UZBA 2E9NA 4I5HA 3EYGA 4AGWA 4EWQA 3ULZA 4CCUA 2B9JA 4FODA 4IZAA 3WI6A 4B6LA 2YM7A 3G2FA 1M17A 4O83A 2XEYA 3ORTA 3Q6UA 4IB0A 4FKIA 2VTOA 2BUJA 4TRLA 3KU2A 4U40A 4G3DA 2ONLA 5H8BA 2R2PA 4O2ZA 1YDTE 4JDHA 5BVNA 4O7TA 3EQGA 3ANQA 3OY1A 3ZU7A 4L3LA 4QNAA 3PRFA 1MRUA 3LFBA 1H08A 2GCDA 5D1JA 3AD6A 3ZONA 4TYJA 3L1SA 4E4NA 2UW3A 3R04A 2VZ6A 3FUPA 1YDSE 4IJ9A 3P7BA 4RG0A 3FQEA 1CKJA 5T68A 4BI1A 5IQCA 1JLUE 1G8SA 5KZIA 3ZRLA 3PE1A 4A9TA 5TF9A 4D0XA 5DVRA 5L6WL 3R7GA 2VX3A 4V0GB 2PVJA 4AZSA 2RF9A 2W1HA 2V55A 2X4FA 3FI3A 1STCE 5L4QA 4YJOA 2XKFA 3MYGA 5M44A 2OH4A 4O0WA 4WSYA 5IF1A 3WZUA 4DGGA 2C69A 4D2TA 1Q8WA 2EXMA 5JFSA 2OIDA 4MH7A 5HE0A 4H1JA 4MKCA 1XKKA 1FPUA 3TIZA 5AFVA 4GK2A 4IW0A 4NT4A 5I3RA 2I7QA 3MFTA 3VWAA 3Q2JA 3U55A 1KSWA 1P4OA 4W4XA 3P0MA 4P4CA 2G2HA 2WXVA 2WMWA 2YM5A 4BKZA 4MXOA 4ZSLA 2FYSA 3ZZEA 3NAXA 3DKGA 3IK3A 4KKEA 1YDRE 3ANRA 3V04A 3UQFA 5EKOA 3OXIA 1IASA 4UZHA 4RZWA 2ETKA 4UN0C 4M0ZA 4WRSA 4QTDA 2IVUA 4II5A 4DLJA 3UZRA 3QD2B 3WYXA 1KE8A 2WNTA 4FNYA 2CGXA 4DBXA 3RAKA 3KK9A 4JRVA 4JG7A 5AP2A 2KTYA 3A8XA 5EW8A 3TIYA 3RKBA 5I9XA 3TKUA 4PTGA 4U44A 3QRUA 4M66A 1BMKA 5CU6A 4EUTA 1YHSA 1WVWA 3D5XA 3LW0A 5AP4A 4ORKA 1KV2A 3CXWA 1WBPA 3QWKA 1YXTA 5CS6A 4JIAA 3ZSHA 3KMMA 4QT1A 4UWYA 3MV5A 4G6NA 1R0PA 3C4XA 3QD3A 2C6DA 4BR3A 1TQMA 3A2CA 3JXWA 3ORIA 1H1RA 4PDSA 5C1QB 3KKVA 4ACHA 4J95A 5JZJA 1R3CA 2YIRA 4K6ZA 3UBDA 4F64A 3GU7A 4ZZOA 1A9UA 5AUXA 3LM0A 1YQJA 2O8YA 3CPCA 4BCMA 5DRDA 4MXCA 4Y8DA 2YZAA 2WOUA 4K18A 4W4WA 2XKEA 3RAIA 3UJGA 3BHHA 4M0YA 5AUTA 1GY3A 4R7IA 1ZYLA 3V01A 5CEMA 4O7NA 1UWHA 4E6CA 4FYNA 4XJ0A 4DFUA 5ACBC 5L2QA 2XK3A 3I6WA 2C3KA 3UOHA 2X2LA 4FTMA 4K11A 4C4HA 2V22A 4HOKA 4B8LA 4EK4A 1WFCA 3MH2A 1NW1A 4H05A 5IA3A 1XBCA 3CKXA 4MD8E 5IA4A 4FF8A 3DLSA 4RPVA 3C50A 5DRBA 4E7WA 4EONA 5D7VA 4B99A 4IE9A 4DGNA 3LQ3A 4Q9ZA 5HKMA 3PG3A 3R2BA 3ZSIA 3CLYA 4O91A 3R8VA 4AS0A 4C4EA 4YPSA 4CMUA 2HWOA 3QLFA 3O51A 4ENXA 4XP3A 4YTHA 3ROYA 2BTSA 4CRSA 1WBSA 4IFGA 4JRNA 2PVKA 3ZTXA 4ZS0A 3OD6X 4KINA 2IVTA 5DH3A 3GCUA 1ZMUA 4FVQA 1JKLA 5ACKA 3ZLXA 3IO7A 4QMQA 4YSJA 1OL2A 4OT5A 2ACXA 5F20A 1H1SA 1F5QA 4R3CA 4WD5A 2B52A 1Q97A 3ALNA 2Y7JA 2WQOA 4BY9E 1IAJA 3CPBA 3ENMA 4JR3A 4GT5A 2EU9A 4BCPA 4FT9A 3EWHA 1Q61A 3HV3A 4QYFA 4OTRA 2PY3A 3LFNA 4BCKA 3HAVA 3PXYA 4FV9A 3FMJA 4RVMA 5IMEA 2XNGA 3FMNA 5KKRC 3OWKA 4FTCA 4IB3A 5JKGA 5KMIA 3DBFA 3OWLA 4L42A 3A7GA 1WVYA 4FTIA 4S33A 2R64A 2W7XA 3ZOSA 5AIKA 4ZY4A 2YIWA 2PMIA 4FEQA 2J6MA 4EJ7A 4XRJA 3I81A 5FEEA 4C4GA 3K5UA 1WAKA 5HX8A 2XEZA 3ZM4A 4I3ZA 4X3FC 5EYCA 5JH6A 1ND4A 1WBWA 5E91A 3OEFX 3L8XA 4L68A 4LOPA 2WO6A 2Q0BA 3H9FA 4EC8A 1KE9A 3JVRA 4BDJA 3WF6A 3QC9A 4U41A 4K1BA 4BICA 2LAVA 3LFCA 2REIA 1QPEA 4BI2A 2YISA 4IDTA 4NFMA 5CU2A 1E1VA 3R7VA 5LVNA 1YXUA 4EH7A 3N4UA 3OWPA 3QQFA 1PXMA 1O9UA 3HMOA 4RLKA 2OFUA 4FIIA 4GU9A 1AGWA 2WQMA 3RZFA 2XKDA 4IAKA 3WF5A 4EZ7A 3C5IA 4DGMA 3SVVA 2BILB 1FVRA 2BRGA 4AN9A 4ZAUA 2ITUA 3ZBFA 1W83A 3TV6A 4FT7A 4Y85A 1XH7A 4ZOGA 2YZLA 4RVTA 3GXLA 1RJBA 2J9MA 4MEDA 1R78A 4YPDA 3EZRA 3QHRA 3FLNC 3TV7A 3Q9ZA 2ZMCA 5KBRA 1KV1A 3E7OA 5LWMA 4O2PA 2QOCA 4ZZMA 4D5KA 4I4EA 3I0QA 1F0QA 3UODA 3R7UA 4DN5A 2B53A 4R1VA 2WELA 4P90A 4RA5A 5AP5A 1IG1A 2HENA 1U54B 2I0HA 4AZEA 4OAVB 3LXPA 2FH9A 3QUPA 4FZDB 4AT3A 4O0UA 5CEPA 2OG8A 3A61A 2V62A 3AD5A 5E8VA 5HLPA 2W1CA 2Y9QA 4CFUA 3DAJA 4DITA 4E26A 4Z3VA 3VS7A 5CF4A 3COHA 4BDBA 5J79A 4NJ3A 2C6OA 2R7BA 5M56A 3V5TA 4YC6A 3TWJA 2GTNA 3AG9A 4L7FA 3QCYA 5BVOA 3WE8A 3NUUA 3UIXA 1OZ1A 3LLAA 1NVRA 2JIUA 3DLZA 4J8MA 5A4LA 5HX6A 5E8TA 2UVYA 4TNBA 4PL3A 2G2FA 4HCUA 4DH1A 5FUTA 2AUHA 2VX0A 5H2UA 3REPA 4BIDA 4FL3A 4DTBA 3HRCA 2CN8A 2JDRA 4O6EA 1LP4A 5AUZA 3QFVA 5D10A 2X6DA 3GU4A 3WILA 2QG7A 4C2WA 3EHAA 4PP7A 4HVHA 4HJOA 1G8AA 3PXKA 4A4XA 3R2YA 4ZSGA 5BMSA 4JX3A 4A07A 5HO7A 4IB1A 3ZFXA 2G15A 2XKCA 4YC8A 5GJFA 4YUQA 1SVEA 2F7XE 4YZCA 3ZYAA 3V6SA 4EBVA 5F4NA 4CZYB 3FE3A 3T3VA 2OXYA 4FL2A 5DEYA 5AV3A 5KCVA 3TL8A 5CANA 3NNXA 5CY3A 2OXXA 2FB8A 2GMXA 3EN5A 3R8LA 3QTXA 2R5TA 2Y6MA 4MXXA 3NW7A 4QQCA 1L8TA 1ZYJA 5DGZA 5IQAA 3OROA 4LGDA 2CKPA 4K9YA 2YM6A 4QPMA 3QRJA 4W4YA 2WAJA 3R21A 3C9WA 4O7RA 3DKFA 3I1AA 4DF3A 3F5UA 4G5PA 4GVAA 3U9NA 4CT2A 4G2FA 4WBOA 1PYXA 4C35A 2LGCA 4CYIA 4LOOA 3PWDA 4CV9A 1BX6A 1I44A 1JKTA 3QQUA 4B0GA 4KRDA 5GZ9A 4AFEA 4CEGA 4DEGA 2JD5A 4NKAA 5E7RA 4IAFA 3TUCA 5CNNA 2HZ0A 2ITYA 2ZVAA 4BKJA 4XG2A 3C0HA 3GB2A 2PZYA 3DFCB 2VTHA 2VO7A 4XBRA 2YM4A 3FPMA 3ODZX 1Q99A 5T3QA 3F3TA 4O0SA 3RTPA 4BCQA 5AR2A 4CFVA 4NEUA 3TDVA 3RK7A 3HYHA 2PHKA 2PVYA 2BIKB 3FMEA 5HVJA 1YI3A 3PXRA 1VJYA 5CENA 5CU0A 5E8YA 2H6DA 2V5QA 5AV0A 4DFZE 5LVMA 3P1AA 2W0JA 5BUEA 2R3QA 3BIZA 4JJRA 1XBBA 2ITNA 1APME 4QP6A 1LUFA 5HIDA 4G31A 5G6VA 4NL0A 2XA4A 1XQZA 4CQEA 4Y72A 3O2MA 3DU8A 1OIRA 2Z7RA 2CDZA 3IDCA 4QMOA 2CCHA 4CMTA 1OUYA 3TKHA 4OT6A 4XG9A 5JFXA 1YXXA 3KXNA 4FKQA 4G16A 4M69B 5JFVA 3ZC5A 4BZOA 5EDPA 4UMRA 5BNJA 4I0TA 4TYHA 4MYGA 3CTQA 5EW3A 1Q24A 3K54A 1OBDA 2JKKA 3QZGA 3BLQA 1PKDA 4LYNA 4XCUA 4KD1A 5FG8A 2WMTA 3FSKA 4IAIA 1Y57A 1V0OA 3NNVA 2VTTA 4UY9A 4ZIMA 4U43A 2RFSA 3UQCA 3LPBA 3UVRA 4ASZA 3D5VA 5DR2A 5A54A 4BHZA 2O0UA 4GEOA 2BTRA 1T46A 3NYOA 1H0VA 4OW8A 4XH6A 3H0YA 5CX9A 2C30A 1IRKA 2GNGA 2I1MA 2UZUE 5AJQA 3I5ZA 4FZAB 3L8VA 2UZLA 2VWWA 4N6YA 3FL5A 4DT8A 3LQ8A 3BQRA 2J2IB 3POOA 4DFYA 3QZFA 5EM7A 2YDIA 3HX4A 5HBEA 1GZKA 4F6UA 1H24A 5GIOE 3A60A 2VWVA 5EI2A 3PWYA 1Q5KA 2EWAA 3AC5A 3R01A 4Y5HA 5CU4A 4B9DA 1OMWA 2IJMA 1P2AA 2XJ1A 2VU3A 4U45A 4L44A 1JQHA 3KQ7A 4GIHA 5M53A 2YACA 4UMQA 3AT2A 3ZMMA 3OBJA 1OKZA 1W82A 3AMYA 3NIZA 3HVCA 5FEQA 4IX5A 3MW1A 3SXSA 5IQHA 3HMIA 4BIBA 2VRXA 2FSOX 3V51A 4YHJA 4RIWB 4AW2A 4ARKA 4O21A 4S31A 5AP1A 4K2RA 2YWVA 2Y4IB 3GT8A 4ALVA 3MH0A 2JIVA 3QD4A 4XG8A 3PY1A 3W32A 2JDSA 2P4IA 5J87A 2A27A 4QRCA 3WF7A 3CCNA 3FMDA 4EHEA 3JR1A 5FLFA 4TKSA 3OTUA 5FDXA 4QYEA 3O23A 3E7VA 4ZEGA 5HD7A 3SG9A 4LUDA 4M12A 2E9OA 4AW1A 2X8EA 3TNHA 3Q4TA 2CMWA 4B4LA 1TVOA 3H9OA 1LEWA 3QD0A 5KE0A 2OJ9A 4GMYA 4LFIA 4XLVA 3ORXA 3RHXA 2XZSA 3TZ8A 3WARA 4F9BA 2X7FA 4RLLA 1V0PA 4FKVA 1CMKE 2YWPA 1Y8GA 4KS8A 3O50A 2QCSA 5HEZA 4IJPA 3IDPA 1ZRZA 2OH0E 4AX8A 5LMKC 3LMIA 3VULA 4F70A 3F5XA 1DAWA 3Q5ZA 3R71A 4M7IA 5M08A 3CQUA 3LQ5A 2V7OA 3OOGA 4FKSA 5L8LA 4C4FA 5LOHA 1OL7A 2HW7A 3F7WA 4USFA 4JAIA 4D1ZA 2PL0A 5I0BA 2VO0A 5KMKA 3OVVA 3QCQA 2ZJWA 3LMGA 4AZFA 1H8FA 3KN5A 5KHXA 2GNHA 2B9IA 2WTCA 3PY3A 5AUWA 3R8ZA 4QYYA 2IZUA 2BRHA 5EOBA 4NKSA 5EI8A 2XK4A 4CYJA 2XNEA 4YJTA 3VHKA 4CG9A 2XH5A 4EH6A 4TPTA 4YZMA 5A4EA 5ANOA 3EKNA 3Q9XA 5HCXA 3DKCA 5HTBA 5HD4A 2W96B 3BGZA 5CTPA 3U8WA 2CPKE 4ID7A 3Q96A 2OU7A 3QBNA 2NPQA 5AAFA 2WU6A 3QZHA 5J1WA 3W2QA 2B54A 3A4PA 4FKLA 1NA7A 4OGRA 4M15A 2O63A 5B2LA 2QOBA 3BBWA 4XG6A 4UWCA 4UZDA 1NY3A 3D9VA 2OZAA 4AW0A 3D2KA 4J7BA 3OT8A 3H3CA 5IQIA 5EW9A 3TCPA 3UP2A 3ZO3A 4F65A 1UVRA 4RC2A 3VBYA 3RK5A 3GCSA 3FKNA 4NYEA 4C7TA 4FE2A 4QP8A 2EXCX 3VUKA 2QURA 4QP1A 2OW3A 5HIEA 2XMYA 4RJ6A 4ERKA 4RWKA 4FZFB 3OEZA 4DEBA 4J1RA 5K3YA 3ZH8A 3ZZWA 2W5BA 2HW6A 3CTHA 3VUGA 4DG3E 3VF9A 2ITOA 3RAWA 3VJNA 4DH5A 2IW9A 5J5TA 1Y8YA 5AR3A 4ZJVA 4IHPA 4RSSA 3EFLA 4DCEA 2BPMA 5CZHA 3CE3A 3LM5A 2P0CA 3RBWA 3DXNA 3SOAA 3KK8A 3BLHA 3MB7A 2ZDTA 4QP9A 5DI1A 5FM2A 3U54A 3LCSA 5AP7A 4HCVA 5H3QA 4AZTA 2GQSA 1UNGA 4PPAA 3R7IA 5A4CA 3KRRA 2C1BA 3FZOA 2X8DA 2XNNA 4ZTLA 2UW4A 3AQVA 3ETAA 4YBJA 4GRBA 1M7QA 2XK6A 3IDBA 3L8PA 5DNRA 5M4FA 4KBCA 2GFSA 4KIKA 3LCDA 4QYGA 1RE8A 2O5KA 4AN3A 2NNWB 2DS1A 1J1CA 1PMNA 2FUMA 3ZSGA 5CT0A 3KA0A 4RFZA 3MPMA 1B39A 3IONA 4PPBA 3DZQA 2QOOA 1B6CB 4FUXA 3UC4A 1GNGA 2YIXA 3KXXA 3BE2A 4JI9A 5KMOA 4R3PA 4FG7A 3TT0A 3AXWA 4DGLC 4AW5A 3CEKA 4FTQA 3UG1A 5EG3A 2FVDA 4GT4A 3P23A 1Q62A 2VN9A 1WBVA 3PVBA 1YXVA 1QPJA 2AC3A 2OK1A 3LJ1A 4I5PA 4IC8A 4L52A 3TJCA 3DFAA 4UMTA 4FV3A 2Q0NA 2QOLA 3QQHA 5HIBA 2E2BA 4XV2A 2C0OA 4IBMA 2UW0A 2ZDUA 2ZV7A 3SHEA 5FTGA 3VQUA 3D15A 4DTAA 2P2IA 2R3IA 3V8WA 2WEIA 4WUAA 1IA9A 2BZHB 3QGYA 3EJ1A 3E5AA 4RVLA 4BN1A 4CQGA 3OW3A 4JAJA 2A19B 4EZ5A 1W7HA 4CFXA 5LCKA 1XO2B 4FVRA 2XCHA 3ULIA 5CNOA 4FEXA 3DKOA 3FY2A 4YZBA 2H9VA 3G0EA 2O64A 4F0FA 4LI5A 4AQCA 5L3AA 3ORZA 3SD0A 4BDIA 2CNUA 5AWMA 5DN3A 3R6XA 3U4UA 4E6QA 4PMTA 4QMYA 2OFVA 1FGIA 1U46A 1U5QA 4JBQA 4BBEA 1URCA 4QQ5A 4TWPA 4F0GA 4ANSA 3EQRA 4IXPA 4FI1A 2ITZA 3SAYA 2JDVA 1BI8A 3ZEPA 4OTDA 3A7FA 1E9HA 3U4WA 4IAYA 5K4JA 4S30A 4NCTA 1FOTA 3HP5A 5FTQA 4W9WA 2W99B 3NYXA 1DI8A 3NRMA 3QTQA 2GDOA 3QF9A 2XNPA 4G3GA 2W1EA 2XIKA 3AD4A 3IOPA 3V8TA 1ZARA 3VUTA 3E88A 3QKLA 3TNPC 3LIJA 4ERWA 3PXFA 3G0FA 5CXZA 3MA3A 3E8CA 4JDKA 2YHVA 4J53A 3D2IA 3FI4A 4KIOA 3ROCA 3VRYA 3IW6A 4IX4A 3E63A 2IPXA 5IUGA 2QKWB 3W33A 4Q2AA 2H34A 3QTSA 3F3WA 3T9TA 2GPHA 3G6GA 1PXJA 5HG8A 3BU3A 4AACA 5ETAA 2VTJA 2RIOA 4LL0A 2YCFA 1ZYCA 4PDYA 4ZZNA 3KRWA 4O82A 3SGCA 3A99A 5AUVA 4BCJA 3B8QA 4ZTHA 3PJ2A 4O22A 1SVHA 4NJDA 3WIKA 4MQ1A 3P79A 3BHVA 4IADA 3MTLA 4HYSA 4WBBB 4DEEA 1IAHA 4ZJIA 5BUIA 2OI4X 2PSQA 2YDKA 2J5EA 3OMVA 4CZTA 4DFXE 1PW2A 2PTKA 4Z7HA 3UC3A 4YSMA 3E3PA 1YWNA 3MY1A 4HVIA 2GSFA 3MBLA 3DJ7A 1O6KA 2ETRA 3FQHA 5D11A 5M55A 4A9SA 5J5SA 5K5NA 3DA6A 2HYYA 2O2UA 3AC4A 3EH9A 1PKGA 2G2IA 3ZRMA 4NW6A 4C62A 3FSFA 2XNBA 3UYTA 3NCGA 4RJ3A 3V5QA 5IQBA 3FZRA 4UYNA 4WRGA 2PUPA 2E9PA 5AUYA 3NIEA 2HY81 1FVVA 2NO3A 4TWNA 1M2QA 2C5XA 3TNIA 3AC3A 3FV8A 4JIKA 4UXQA 2UW8A 4A9RA 5BYYA 2C47A 3CJGA 5DT3A 3ZC6A 3BGQA 2WD1A 3DT1A 4RX7A 4AZWA 4WT6A 4TL0A 2UZWE 4O7LA 4BDAA 4X2GA 5L6PA 4U79A 4WO5A 1JWHA 4CGAA 5ICPA 4ITJA 5AA9A 4G6LA 5M4UA 4ANBA 1JPAA 2J7TA 3BYMA 5HCZA 4CSVA 4KAOA 1J3HA 3MFSA 1VR2A 5M07A 5A46A 3FZ1A 4HNIA 5LMBA 3R28A 4USDA 4RX8A 5CSHA 4BF2A 3TM0A 2PZRA 4JG8A 1FMKA 3MI9A 4XV9A 3OW4A 3O7LD 3PZHA 4XV3A 4ZTQA 4E6DA 3EQHA 4L43A 2W05A 2C3JA 2CHLA 4G6OA 3R83A 4D2VA 2VUWA 4WKQA 3PG1A 5HU9A 3UPZA 4XG4A 3M1SA 5IU2A 3KREA 3UZTA 3IOKA 4JBVA 3HAMA 3EQFA 4MVFA 4NUSA 4X3FA 4CFNA 4L3PA 4BVUA 3R30A 3WZJA 2XNMA 3EQDA 3W10A 4DYMA 3EN4A 5KHWA 4O7VA 4UXLA 4CVAA 4F99A 3D0EA 2PUUA 3MTFA 3OCGA 3E64A 3UO4A 3GU5A 2R3OA 3MH1A 2WMSA 2XM9A 3HMMA 2YITA 3OF0A 2FSMX 4FKJA 3GBZA 3PTGA 2IVVA 3QQJA 4FTJA 5F94A 2OIQA 3QWJA 3MGYA 2BRNA 4I94A 4OTHA 4M8TA 2CKEA 3KXHA 2ZB0A 4U97A 3ZUTA 3GUBA 3I6UA 3RPRA 5F9EA 4IM0A 2OJJA 4RJ8A 2IZRA 4ZY5A 3FJQE 5CAPA 3R1QA 3MWUA 4QMMA 2F7EE 3BYVA 5TT7A 4FYOA 4ZTSA 4BGHA 3QQLA 5HLWA 3RCJA 3UIBA 3BX5A 3BHUA 5FBNC 3D5UA 3QL8A 3W2SA 4PTEA 5A9UA 4R77A 5J9YA 5KX8A 3FXXA 3C51A 2CLQA 1A48A 2Y4IC 3Q6WA 3O7LB 4V05A 3W18A 3NUSA 4MXZA 4O1OA 3HLLA 4IWDA 5ANJA 4AUAA 3OTVA 2GQGA 2YERA 4HPTE 4ZTMA 5LWNA 3TJDA 4KRCA 3ZUVA 3PUPA 4MQ2A 3VNTA 1KWPA 5E9EA 3U9CA 3VS1A 3POZA 5DEWA 3FMLA 3LCKA 2B4SB 2PVLA 3DAKA 3GP0A 3EFWA 3ZFMA 3MESA 4GCJA 4YP8A 3QTWA 2PVNA 3PP1A 4RRVA 4Y83A 3N4VA 5HG9A 4RA4A 4M13A 5CSPA 5IA2A 4YLLA 5DIAA 1H25A 4G3CA 5DMZA 3FI8A 5CT7A 4NTSA 2GTMA 3P78A 1V1KA 3JUHA 2OJIA 1U5RA 2QOKA 2R9SA 5B2MA 4HGEA 3O17A 1IEPA 5DG5A 2SRCA 4FIGA 2W06A 3UOKA 3C13A 3C0GA 2BFYA 3HV6A 4NM7A 3CY3A 3OUKA 5EHLA 3CGFA 3ET7A 4LG4A 3JVSA 3M11A 2QC6A 2VO3A 3FBVA 3KXMA 1NVSA 3DK6A 2VTQA 1Q3DA 3OC1A 3FC1X 4M14A 5KZ0A 5IA1A 4ANNA 2JKMA 4DEIA 5E1SA 1Q8YA 1FVTA 1TQIA 3LFEA 2Z02A 5JT2A 2OBJA 4DHFA 2O65A 3Q53A 4ITIA 1ZYSA 4HW7A 4IX3A 4HPUE 4P5ZA 5A14A 3AT3A 4KS7A 5AUUA 3GFEA 4OAUC 2YLFA 3KRJA 3OCSA 4FIHA 4LRMA 4IVBA 3ZHPC 4GYGA 4OTIA 3VBTA 4O7WA 5DLSA 2QOFA 5D12A 2QU5A 2UW9A 4X6RA 1H26A 3KFAA 4FT0A 2J0LA 2VGOA 3LFDA 4IM3A 1HCLA 3NR9A 4BKYA 3HMNA 2EVAA 1OB3A 3LJ2A 3HGKA 3BQCA 3FKLA 5BYZA 3TZMA 3ORKA 2Y0AA 3MPAA 3Q4CA 3CGOA 2JFLA 4G9CA 4RJ5A 3SXFA 3RGFA 4TYGA 4E93A 4E6AA 3D4QA 3VJOA 2QOHA 2OLCA 2VTPA 3JY9A 3PJ8A 5HOAA 4LOQA 3NCZA 1H1QA 2HZNA 3ITZA 5LMKA 4O86A 4TWOA 4QP7A 5HLNA 3GCPA 3PY0A 4DTKA 5E90A 5TOZA 4TNDA 3SW7A 3KVWA 4FTRA 3C4WA 2YM8A 4ITHA 3RHKA 3GOKA 4FSUA 4HGLA 1H1WA 4D2WA 4CZUA 1QCFA 3R9DA 5D7AA 1YHWA 2IN6A 2RGPA 2CCIA 5HO6A 4G9RA 3GNIB 2R3GA 1Z9XA 1PYEA 3W2PA 3NNWA 4RIXB 3LHJA 4YJPA 5IQFA 3D94A 4OTFA 3DDQA 2HXQA 4MK0A 3B8RA 4FKPA 5CVFA 2PVMA 4YO4A 1J7IA 2IW6A 4EK8A 4I24A 5IG1A 2AYPA 2XIYA 3KXGA 4EOMA 2PUNA 2WIHA 5HG5A 3GCQA 1HCKA 4FV2A 4MD9E 1VZOA 2C6KA 4ACDA 3R22A 3FMKA 4I23A 5CEIA 3FHRA 4FNXA 2C6MA 5HVKA 2C0TA 4G1WA 3PSDA 5DA3A 3ID6C 4FSYA 5AIRA 2VV9A 3ACKA 4GVJA 1W8CA 1RQQA 4U0IA 3KVXA 4BWXA 3AT4A 1Q8UA 3DNEA 4L46A 5L2TA 2YM3A 2WTJA 3MY0A 3AC8A 4RQKA 3DAEA 4GUBA 3PLSA 4YLJA 3VS6A 1WBNA 3ERKA 4M97A 4RX9A 4WHZA 3TNQB 2R7IA 5D41A 3WZDA 4PUZA 4E3CA 3U6HA 4CD0A 3H30A 4KBAA 2RFDA 1PXLA 1DS5A 3NSZA 4HNFA 4J96A 5ANIA 4WNPA 4KIPA 1Z5MA 1VYZA 4BRXA 3DBEA 2OXDA 3T8OA 2R0IA 1PF8A 1OIQA 3DQWA 4KWPA 3LMHA 4Z7GA 3VUMA 2QD9A 3FZTA 3G6HA 5KBQA 4FGRA 2JKQA 1G3NA 3CJFA 3R73A 4JXFA 4X2KA 1PXIA 5LVLA 2C4GA 4U80A 4AA4A 3VS2A 2ITTA 4EJNA 3G51A 1JNKA 1H07A 3I0OA 4NH1A 2X81A 5DR6A 1H28A 4MXYA 4E73A 4W9XA 3NS9A 2I6LA 2C6EA 3EMGA 3IGOA 1QMZA 2A1AB 5IA0A 3PXZA 3QLGA 4QPSA 4NM5A 4LRJA 2WGJA 5KO1A 4E20A 3PP0A 2F7ZE 5EQEA 2ERKA 4F1OA 4YURA 2VWUA 4OBQA 3QX4A 2ZV9A 3SLSA 4K33A 3BKBA 2IW8A 3VBQA 2OF2A 3BU6A 5C01A 4BL1A 2IZTA 1CSNA 3NPCA 4QMXA 4U6RA 4F7JA 3C0IA 3GEQA 2WTIA 2V0DA 5ANGA 3EN9A 3MS9A 1M52A 4O0RA 3HECA 1BI7A 1OECA 4QP4A 2UW6A 4FV8A 4GG7A 2VTMA 5CF8A 3SW4A 5JGDA 3KULA 3LFSA 1S9IA 1SNUA 1LR4A 4NTTA 2PK9A 3NX8A 3F3ZA 2XUUA 5KMMA 1SMHA 5CYIA 4A9UA 3WF8A 2PZ5A 1DM2A 2W17A 4NSTA 5K0XA 3UO5A 3W1FA 5HBHA 1X8BA 4AAAA 3C4EA 3QGWA 4JT3A 5J8IA 2G1TA 4R5SA 3HL7A 4Q9SA 2XYUA 2B9HA 3FMHA 5CI7A 3CD3A 3WIGA 4XX9A 2B0QA 3F2RA 5C8KA 2HELA 3P9JA 1BL7A 3CIKA 3LAUA 3MVLA 4FICA 5CSXA 5ANDA 4E4MA 4X21A 4GFGA 4EOLA 3HV7A 4LRKA 4FV7A 3W16A 4C58A 3Q32A 3G9LX 1UA2A 1OPJA 3QRKA 2UZTA 4FTUA 5CI6A 4BWPA 4EYMA 4AWIA 2V7AA 4S2ZA 3RPYA 4KBKA 5AADA 2JITA 3LXNA 5TE0A 5KMNA 4ANOA 1GZNA 3MIAA 3P4KA 5H9BA 2ZMDA 4GT3A 4MF0A 3TNWA 4QMUA 4IWQA 4LMUA 4TYIA 3EL7A 4BDGA 4E1ZA 2E9UA 3T9IA 1NT2A 3RPOA 2WMXA 2ZM4A 2VWIA 3ODYX 3P7AA 2H8HA 4FT5A 3Q3BA 4I1ZA 3R9OA 3R8PA 4XG3A 5A4QA 1PXNA 3QRIA 3DS6A 2QO9A 3QUEA 4IZ5A 4X0MA 5E92A 3UVQA 2I40A 5CEQA 2CN5A 4R3RA 4GK4A 2CNQA 4U9AA 4D9TA 5HBJA 1KUTA 3RNYA 1SZMA 3ZXZA 4L45A 3K3IA 3NZ0A 3ORPA 4L3JA 1GZ8A 5KNJA 4MNEB 4UB7A 3AMAA 4PWNA 3QCSA 1UU8A 1MRYA 4MWHA 3RPVA 3RK9A 2ZB1A 2W4OA 4RJ4A 3WF9A 3E92A 4CLIA 1SVGA 2A0CX 3CD8A 4EQMA 1NXKA 2A2AA 4RGJA 4I6QA 5HGIA 4AF3A 2UVXA 4C4IA 5K0KA 3PRIA 4S32A 2WFYA 4C02A 2F57A 5IKWA 4AA5A 3WOWA 3FL4A 4BTFA 3CQWA 3D5WA 3R9RA 2BAKA 1PJKA 4CFFA 4WNMA 1WBOA 3I7BA 3GGFA 2X7OA 5JN2A 2HXLA 5H8EA 4BDFA 3A62A 4MXAA 1XH5A 5AR4A 4PMSA 2J4ZA 1J91A 3HNGA 3L8SA 4M69A 4ANQA 5JZNA 4GSBA 2QKRA 5FM3A 1H0WA 2DYLA 4C59A 5EQPA 4YHTA 1GIIA 1B38A 3UMWA 3BPRA 4YU2A 3IW8A 4TTHB 2HIWA 2OICA 3MFUA 2EB3A 3GC0A 1MQ4A 1UWJA 4C38A 3LFQA 4WG5A 4X3JA 4ZLOA 4YC3A 3TEIA 3BWJA 3BELA 4JDIA 3VS4A 3RM7A 3FQSA 4ACGA 2W1IA 5F95A 3FWQA 4N0SA 5FXSA 3MN3A 4ASDA 4CNHA 3K3JA 2QVSE 1REJA 2BRBA 2XK7A 4FNWA 4ANMA 3VW6A 3LXLA 4X2NA 4QMSA 4ZSAA 4CV8A 3JS2A 4PPCA 5BVWA 3F5GA 1LPUA 1FQ1B 4WSQA 5HE2A 3MIYA 3R63A 4NM0A 1PXPA 2NRYA 1Y6AA 4L6QA 4EBWA 3RJCA 1I09A 2BKZA 3COMA 3ZCLA 3GC9A 2OIBA 3UNZA 4DH8A 2VD5A 4H3BA 2YA9A 2UVZA 4J97A 4KKHA 4U81A 4WG4A 3VBXA 4MNFA 2H96A 3VUDA 4I4FA 4APCA 1CKIA 5GNKA 1GZOA 2ITXA 1W0XC 5CZIA 5M57A 4Q5EA 4FL1A 4MWIA 3LVPA 3UYSA 4PL5A 4FEWA 2XRWA 2XNOA 1RW8A 2Q83A 5GINE 4TW9A 5KUPA 2J51A 3D7TB 2PZPA 3PXQA 4RWJA 4YTIA 3O8TA 1WVXA 5EDRA 4D4RA 5CAVA 3NW5A 3RM6A 3RINA 2XJ0A 1K2PA 2BROA 4L01A 3NAYA 2JFMA 1W84A 1M14A 1H00A 5C4LA 4YJSA 1XH8A 3NVMB 4FEUA 3Q52A 4U3ZA 4G3EA 4XS2A 3MA6A 2C6IA 5IISA 3C4FA 3DBDA 3MY5A 4LV8A 3KCKA 2QONA 2UW7A 2YABA 4NIFA 4XBUA 4BGQA 4D1SA 3EFJA 4EC9A 4EH4A 3IW4A 3ORMA 5IDPA 4BCIA 3TUBA 2Z8CA 3F3UA 3CQEA 2XBAA 3OZ6A 5ITAA 3R9HA 3QZIA 4EH2A 4NU1A 4BDCA 2WMRA 1QL6A 4EUUA 2WMAA 2QLQA 2B55A 4DA5A 1W98A 5KMLA 4O84A 1M2PA 3OFMA 2W5AA 3RWQA 3NMUF 5FQDC 5GHVA 3F6XA 3DPKA 3IQ7A 4ZXTA 3QX2A 3EOCA 3UOJA 5ANEA 4BDHA 2C0IA 2OO8X 4O96A 5A6NA 2BALA 3GI3A 3KULB 3FLQA 4FUYA 4JQ8A 4PY1A 3PJ1A 1Q41A 1U54A 4QTCA 3IGGA 5AM6A 3JYAA 4CG8A 5B0XA 5GJGA 2XVDA 3R02A 3R1SA 2GS2A 3UG2A 4XNEA 1WCCA 3OCBA 2JC6A 4FKWA 3TI1A 3ZO1A 1XWSA 2QR8A 3S4QA 3BYSA 2UZEA 3NUAA 5CAUA 2B9FA 2HWPA 3MVMA 4Y73A 2QR7A 3TZ9A 3VVHA 2YAKA 3C4CA 4ZTNA 3E87A 4O1PA 4FIJA 5AEPA 4DEDA 5L8JA 4RIYA 2C5VA 1ZZ2A 2ONLC 4J52A 4DEHA 2IWIA 1UNLA 4KABA 2GFCA 4PNIA 3QTZA 4JNWA 4N4SA 5HO8A 4D0WA 5JK3A 4F0IA 2VX1A 3UO6A 4GKIA 1UKIA 4LQMA 5ETFA 3ZO4A 3ZS5A 3OY3A 3DZOA 3RNIA 2BAQA 3Q4ZA 4TYEA 5T6KA 2ZM3A 5JFWA 5GIPE 4JVGA 2OJFE 2J0JA 4FNZA 4GL9A 3O96A 2OGVA 3LXKA 3TXOA 4IVDA 4KSPA 3UPXA 4NZWB 4UWBA 3FMMA 5FXRA 3ZXTA 2X6EA 4FG8A 3VBWA 2VWZA 5BQ0A 2VNWA 3ZUUA 3LCOA 4CMOA 3VC4A 4HVSA 4B7TA 5EHYA 1QPCA 2OWBA 4LMNA 3W8QA 5I9WA 3D7ZA 3P5KA 4R1YA 5CWZA 4BWKA 2W1ZA 3PIZA 4HYUA 5GZAA 1K3AA 2BKKA 2FGIA 4X2JA 4RWIA 3IS5A 3L9MA 2PULA 2PYWA 2HZIA 3C4ZA 1ZXEA 2DUVA 3HA8A 4NWMA 4QTEA 5DWRA 3PYYA 2WPAA 4PF4A 1XH9A 4FV1A 3ATTA 4YNEA 4CKIA 1BYGA 5IH5A 1PMEA 4A06A 4X7QA 1BKXA 3IW7A 3QAME 4FKGA 3F3VA 5HNBA 2WMBA 4L7SA 3PA3A 5EOLA 4UMPA 2RG5A 4F63A 5CSVA 1R1WA 3SQQA 4A4LA 4JBPA 2UZNA 3NEWA 4BTMA 3UNKA 5GZ8A 4E8AA 3A7HA 1DAYA 2BIYA 3FZPA 3HA6A 4HCTA 4JR7A 5FBOA 4MBLA 3UTOA 2G9XA 3OT3A 1JAMA 4IB5A 4MNEA 3SOCA 1JOWB 2JAVA 4GK3A 2IG7A 3D14A 4C37A 3FLSA 4JX7A 4MF1A 3GQLA 4IDVA 4F08A 1YRPA 4FKTA 4AOJA 4CFWA 4BCHA 4MAOA 4C36A 1OBGA 2X8IA 4QTBA 5HHWA 4BDDA 4EI4A 1YXSA 2R3HA 4TT7A 1REKA 4DFBA 2X2MA 5CLPA 4TXCA 4GV1A 5CF5A 4UV0A 4XRLA 2YCSA 4RFYA 4XUFA 3MVJA 4X2FA 4XG7A 3O0GA 4ZMEA 3PFQA 5AAGA 5CXHA 4ZLZA 2WMUA 2WIPA 2GS7A 2WEVA 3PJCA 3TTJA 2XIXA 2X7GA 3MH3A 4FSWA 2J0IA 3OUNB 4IC7A 3ZBXA 3UOLA 4FK6A 4AFJA 2JIIA 3EQPA 3IPHA 3BEAA 3Q9YA 4FT3A 2Z7SA 3AC1A 3KCFA 4KIQA 5LVPA 5JEBA 4PP9A 3BLRA 2ESMA 3EYHA 3VN9A 1J7UA 4I5MA 4F9CA 3HDMA 5A4TA 3EN6A 2QO2A 3TTIA 4AOTA 3SDJA 4V01A 3B2TA 2RG6A 5CU3A 5EYMA 4I6BA 2PZIA 4DBNA 4D2PA 1Q8ZA 2F2CB 2BHHA 2GS6A 2ITWA 4HZRA 4DLIA 2ZV8A 2C68A 3R7OA 5JMSA 2C6TA 4DEAA 4IWOA 3N4TA 3DQXA 3SG8A 4GW8A 3NVKI 5B2KA 5CQWA 3GOPA 2YJRA 3FYJX 4F9WA 2CNVA 5BPYA 5IMXA 3F2NA 3HKOA 2CGVA 5FTOA 3UNJA 2X9FA 2R3KA 4HGTA 1GOLA 4ANLA 3QA0A 1HOWA 4OTGA 3HZTA 3NW6A 4L53A 2HAKA 3GCVA 5FDPA 1ZWSA 5EQYA 3EQBA 4OUCA 1R39A 2GHGA 5CVHA 5HORA 4FTTA 4WG3A 2W5HA 1JSTA 1LEZA 1MUOA 3OXTA 4XOYA 4C3PA 4RC3A 3QQKA 5C8NA 4IMYA 1KE6A 4YZ9A 5TO8A 3UP7A 4AZVA 3QTRA 5E1EA 4C0TA 4FG9A 4FOBA 4L8MA 4ENYA 5JGAA 2E9VA 5AX3A 4AOIA 4IVAA 4BDEA 3QYZA 2CKQA 3SC1A 4Z9LA 4FIFA 5IUHA 4M68A 4NK9A 5AR5A 4UBAA 3DXQA 3AOXA 4EOKA 3UDBA 5DT0A 4IQ6A 4CCBA 4X6QC 4LGGA 2EB2A 5EM6A 5FD2A 3GC8A 4NM3A 3Q2MA 2C5OA 3PE2A 4V0GA 2B1PA 5I3OA 4FIEA 2C5NA 5IQDA 2XJ2A 4D5HA 5HQ0A 1OIYA 3RAHA 3DTCA 3F5PA 2FSLX 2UUEA 2CGWA 2P2HA 2YIQA 3KN6A 4IAZA 4FSTA 5JQ5A 1OPLA 5FXQA 4DINA 5AV4A 3Q9WA 2QQ7A 4EYJA 2WQEA 2FSTX 3ZRKA 3ZEWA 5E8SA 1FINA 3K2LA 4GJ2A 4GS6A 5HESA 3V8SA 4YO6A 4F7NA 5M06A 1JBPE 4EKLA 2PWLA 3S0OA 3PLAE 3U6IA 2YJSA 3EN7A 1P4FA 4C57A 3QKMA 2GNFA 4O7ZA 4FBXA 3LOKA 2YDJA 4TWCA 4AE6A 4PQNA 4O6LA 5JSMA 4TY1A 5IDNA 5I9UA 4BCNA 4XV1A 5IPJA 4YMJA 1ZOEA 5ANKA 1UU3A 3GC7A 3R1YA 3G5DA 4K0YA 4WA9A 4GJ3A 5JGBA 1WBTA 4V04A 3V6RA 4XLIA 3KF7A 1WMKA 4U42A 4D4YA 2P3GX 4DH7A 1K9AA 3BE9A 4PX6A 2VNYA 3M2WA 3VQHA 4P2KA 1EH4A 2BRMA 3H0ZA 3I60A 4HYHA 4W8EA 3NGAA 5DE2A 3UIMA 2ITVA 4CKJA 2CLXA 4QQTA 4O0VA 3CR0A 4FTOA 4RIXA 2XCKA 1DI9A 5FP6A 4TN6A 4E4LA 4W8DA 4IVCA 4I22A 3E3BX 4GG5A 1FMOE 4BTKA 1ZLTA 2ITPA 5EK7A 2CKOA 2UW5A 4ZY6A 2YCRA 1P5EA 1CKPA 3HV5A 3RWPA 3RI1A 2WQNA 3F9NA 3E8DA 5AA8A 2NRUA 3EFKA 2BMCA 2OF4A 4LGHA 4IM2A 4E5WA 4EZ3A 3SA0A 4YNOA 4IZYA 3EB0A 2NP8A 3ZDUA 3UZPA 5LMAA 3W2CA 4U7ZA 3HRFA 4OTQA 5E8WA 3RCDA 2R3FA 3PSBA 4Y95A 1PHKA 5I9VA 4ZP5A 3MSSA 3DGKA 2YAAA 5EFQA 5HCYA 5IA5A 3FPQA 5I5ZA 2YFXA 5K4IA 3FY0A 4N70A 4EK6A 2PE1A 1FGKA 1JSVA 3R1NA 4BYJA 4ACMA 4D55A 5L8KA 3KRXA 4ZMFA 1OITA 5E8XA 3NUXA 4KB8A 4AGCA 4C34A 3W8LA 3PA5A 2YEXA 2PMOX 3CC6A 3ELJA 3ZLYA 3KC3A 5HICA 3OCTA 4I6HA 4AT5A 5FRIA 5J1VA 4ASEA 1P14A 2Z60A 3PJ3A 4CKRA 4QMLA 3ALOA 2WMQA 1OKVA 2VWYA 5EHOA 3PPKA 4C2VA 4EEVA 3I79A 5G1XA 1H1PA 4L67A 5LARA 1Q3WA 4EK3A 3H4JA 4PDOA 2WTVA 4I20A 4BYIA 1J7LA 4XP0A 4C4JA 5M4CA 1WZYA 3AGLA 3F69A 3AMBA 1URWA 3JY0A 3GVUA 3PDTA 2FO0A 4F9YA 3NNUA 2QG5A 5K5XA 2YN8A 3SRVA 5AR7A 2F4JA 4H1MA 2JAMA 3U6JA 4BC6A 4D4VA 3O8UA 5E4HA 4BCOA 4OTPA 1RDQE 2CSNA 1ATPE 2IVSA 3KGAA 3FLZA 4U5JA 5FP5A 4EL9A 4FSMA 1ZOHA 4P7EA 1YWVA 4AA0A 2X2KA 2A4LA 2BDJA 2KULA 1OVEA 4G5JA 3PSCA 2XF0A 5HE1A 4KUJA 1XH6A 2WKMA 4F9AA 4D4SA 1F3MC 4D2SA 5HTCA 5CEKA 1AD5A 3Q4UA 4NCTC 2BAJA 3HMPA 2ZOQA 4IAAA 4KKGA 5HI2A 1UU9A 4CTCA 3RZBA 1OKYA 4DT9A 2ZV2A 4USEA 4R78A 3UMXA 2GNLA 5I9ZA 2PUIA 5JRQA 5BVEA 3EZVA 4I0SA 4JQ7A 4XP2A 4W4VA 3QYWA 3PIXA 1KOAA 5AP6A 3UVPA 5BYLA 4I41A 4XMOA 2HZ4A 3A7JA 2VO6A 5HNIX 3Q60A 2JEDA 2HOGA 3BGPA 4FTNA 2R3RA 5J7BA 2J0MB 2X39A 1KE7A 5FGKA 4F4PA 3SRVB 4GUEA 4QTAA 1JKSA 3BBTB 4JS8A 5CAQA 3QC4A 3KMWA 5IEXA 1OKWA 2XYNA 4BCGA 2PU8A 1L3RE 4FKOA 2RFNA 4O0XA 5LQFA 1PMVA 3KXZA 3IECA 3LE6A 4YHFA 3F82A 2ETMA 4EH5A 3CKWA 4GFMA 2ERZE 4DFNA 3KEXA 2ZAZA 3VS5A 4OTWA 2XK8A 3DOGA 4YLKA 2Y6OA 2VTSA 4QMPA 2C1AA 3QALE 1YI6A 2OKRA 1SM2A 2P33A 2QO7A 1QPDA 2QOQA 2BHEA 4RZVA 3CSVA 2IZSA 4I6FA 3COKA 4X3FB 3C5UA 3H9RA 1XH4A 5IQGA 2PMNX 3BRBA 4R6VA 3TN8A 5CEOA 2WHBA 4U3YA 4EHZA 3OG7A 2WTKB 3TDWA 2VAGA 3SV0A 3S00A 2JDOA 4IWPA 4WNKA 3Q04A 5HE3A 2HY0A 5A6OA 3ZLSA 4EQUA 4BI0A 1VYWA 2R3LA 1TKIA 4ONAA 4H58A 4TZRA 3HUBA 3F7ZA 4Z16A 1ZAOA 1UV5A 4F6WA 2GU8A 4EWHA 3VAPA 1MRVA 1YOMA 1ZMVA 3QRTA 5DBXA 4EH9A 5IUIA 3EL8A 3F66A 1OM1A 4QMTA 5EM5A 2I0EA 3BU5A 4UEUA 3NDMA 5FWKK 3BWFA 5LXMA 4BZDA 4O27B 4YR8A 5C26A 3B2WA 5BUJA 4IFCA 3ZM9A 2R4BA 4ZTRA 3FLWA 2WTKC 1YWRA 4DFLA 4F1TA 2X0GA 4R8QA 4D28A 2JGZA 4ACCA 3KMUA 4DC2A 2BR1A 4B8MA 4O0TA 1OL1A 2YIYA 4KIKB 5AMNA 2IO6A 2O3PA 4HYIA 4R7HA 3L9NA 1H01A 1YHVA 4G34A 2C3IB 5B7VA 1IA8A 4FTAA 3G33A 3VS3A 2WU7A 1S9JA 3QXOA 3MJ1A 2EUFB 4J98A 4A4OA 3GENA 4PMMA 4I21A 4EKKA 1XHAA 4JLCA 3ATSA 5HTIA 1Y6BA 3DY7A 3WZKA 4RX5A 3HV4A 4EK5A 3DXPA 4HGSA 4H36A 3RP9A 4RBLA 4O81A 5C4KA 2GNJA 2OZOA 2QHNA 2UZDA 1M2RA 4LV5A 5TKDA 4AGDA 3EQIA 4GH2A 4QMWA 3UGCA 3IKAA 4YTFA 3DB6A 1ZMWA 5L6OA 2Z2WA 4CFMA 4A9YA 5AV2A 4GYIA 4EOPA 2RFEA 1KOBA 4YGAA 3SKCA 3O71A 4P5QA 2R3NA 4S34A 2GQRA 2VTIA 2BFXA 4QO9A 5DFPA 3K5VA 4XHKB 3WYYA 4AN2A 3BV3A 3ZDIA 3KRLA 5AX9A 3V3VA 4E5AX 4BZNA 2W4KA 1U4DA 3FC2A 3VUHA 3KY2A 2OZAB 3G9NA 4N57A 3UE4A 2I0VA 5LJJA 1XBAA 4ALUA 3DJ5A 4BIEA 1CM8A 4EOIA 4F7LA 3FDNA 4CLJA 4FV4A 4BHNA 4D1XA 2BVAA 3LZBA 4YJNA 2BZJA 3DTWA 2YLEA 4QP3A 5EH0A 4AE9A 1V0BA 2JKOA 3M42A 3VUIA 4UALA 3P7CA 4E4XA 4KSQA 1O6LA 1MP8A 3OXZA 4EH3A 4YBKA 2W1FA 4PDPA 1TQPA 4QPAA 3U51A 3VRZA 4BBFA 4C33A 4OBOA 4R5YA 3BYUA 3S95A 4BDKA 1YW2A 3NLBA 3L9PA 3A8WA 4JQEA 2F9GA 3GFWA 5LCJA 4IEBA 3PVGA 1PXKA 3QCXA 2X4ZA 5IH6A 2XRUA 3RALA 4AG8A 5D9HA 3DB8A 2WMVA 3ENHA 4EOOA 1GJOA 2BZIB 5JQ8A 1UKHA 4BB4A 4ZSJA 4ZJJA 3V5PA 2VWXA 4XOZA 1ZOGA 3VBVA 1OUKA 1SNXA 1ZY4A 2CGUA 4DCAA 4I93A 4BBMA 4FSQA 4MD7E 3LKMA 3FHIA 2VTAA 4YJVA 3V5LA 3A4OX 4ALWA 3S1HA 4ZSEA 4ASXA 3FXWA 3A7IA 3ZFYA 4RIOA 5AM7A 3F2AA 4L00A 5J9LA 4FKRA 4N6ZA 3DNDA 2GHMA 4QOXA 4CT1A 4CTBA 4UYAA 2YCQA 3F88A 3QHWA 4BTJA 1H4LA 3O8PA 4C61A 4FK3A 5BVFA 4J99A 2UZVA 5I9YA 3CY2A 4ZLYA 4QQJA 2C5YA 3E8NA 4MX9A 5LVOA 3KF4A 4EHGA 2I0YA 4AU8A 4Y5QA 2WTDA 3W2RA 4H39A 5C27A 5H8GA 4EOJA 4APPA 2XS0A 3BZ3A 4GIIA 4NW5A 5M51A 3DK7A 1OI9A 4LUEA 3SXRA 1SYKA 3LFFA 3QUDA 4FTLA 3THBA 1YKRA 2PE2A 3DV3A 3MJ2A 5A3XA 1A06A 3R7YA 1ZYDA 2QHMA 4YTCA 4IH8A 1CDKA 2Y4PA 1FBNA 5ETIA 3HP2A 4XYFA 4FOCA 4G17A 5CQUA 1UNHA 4C3RA 4CRLA 5E8ZA 4I92A 4F6SA 4MBJA 2EXEA 4FZ6A 4XEYA 5BX0A 2R0UA 5I4NA 4NFNA 4MTAA 1M7NA 2XIZA 4FC0A 4I0RA 4RMZA 4DGOA 2QNJA 1MQBA 1PRYA 4QMZA 4HVDA 3WZEA 4QMNA 2HCKA 4C3FA 2VWBA 3HEGA 3ZLWA 4ZS4A 3CP9A 1OL6A 4FZ7A 1CTPE 4Y46A 4AXAA 4UX9A 4CXAA 2QOIA 3FEGA 3PIYA 3R8MA 3E62A 1ZZLA 3GQIA 5HU3A 4OBPA 5AP3A 4FMQA 3FXZA 1VEBA 3QXPA 3NUYA 4WOVA 3PZEA 3VHEA 1J1BA 4PV0A 3R00A 1JVPP 4FA2A 3CS9A 3BYOA 4FGBA 1AQ1A 2OJGA 3CTJA 3OWJA 4Q5HA 4F09A 3I7CA 4PRJA 3OBGA 2RL5A 4FV5A 4O38A 2PPQA 5CALA 1PMUA 3VO3A 3CBLA 2QU6A 2JBOA 4YJRA 3DBCA 2Y8OA 3OHTA 5BVDA 3E93A 2DWBA 1PY5A 4IACA 5DPVA 2Z7LA 3OS3A 4RQVA 4PNKA 4FVPA 4TYHB 2WTWA 4G3FA 4EORA 3UIUA 2ITQA 4BGGA 1E1XA 4ZK5A 3WE4A 4AT4A 1OL5A 3MPTA 2ZM1A 2BZKB 2R3MA 3IG7A 5EKNA 3DK3A 3AC2A 2C6LA 5EM8A 4DG2E 4BFMA 1PXOA 4PL4A 3G90X 3ORNA 5FEDA 2UZOA 4I5CA 1Z57A 3BEGA 1OIUA 2R3JA 2RSVA 3MFRA 3G15A 4FEVA 5DOSA 2QI8A 2VTLA 4EQCA 3QTUA 3T3UA 4LL5A 3GU8A 3V5WA 4OR5A 4EH8A 3PVWA 1XJDA 4O0YA 3TG1A 3RPSA 1IR3A 1JSUA 1Y91A 4RIYB 1YI4A 2QLUA 3NYVA 5KMJA 3OOMA 3UQGA 4E5BA 3S2PA 2XB7A 3FKOA 3ORLA 3PA4A 3FYKX 1JKKA 3SX9A 5AP0A 1O6YA 4LM5A 3N51A 5C8MA 2JDTA 4FV0A 1GAGA 3MB6A 2GHLA 5IEVA 2W9FB 2BDWA 1YOJA 3NUNA 4FSZA 4O7YA 2GNIA 2PVFA 3QTIA 1OGUA 4RWLA 2XM8A 4WNOA 3RVGA 3V5JA 5DR9A 4A7CA 5CSWA 3KL8A 5C9CA 4JL9A 4EHVA 5IH4A 5JRSA 2W9ZB 4KA3A 5EDQA 3TKIA 3TZ7A 1U59A 3P86A 4JG6A 4PTCA 5GJDA 1T45A 2XP2A 2W1DA 4H3PA 4FX3A 2XK9A 3VS0A 3WBLA 5E8UA 5EI6A 4Z55A 3QA8A 2WOTA 2PVRA 3FAAA 4IANA 4IX6A 2PMLX 5DYJA 3BV2A 4K8AA 4QMVA 4IIRA 1ZY5A 2RKUA 2G01A 3BI6A 3GU6A 3PPZA 4OLIA 2QODA 1BLXA 5EYDA 4D2RA 3FZSA 4J8NA 3HDNA 4FSNA 2PE0A 4QD6A 2UV2A 2WZJA 3C7QA 4MBIA 3VIDA 5J7HA 4R7BA 4F7SA 4MHAA 4F1MA 2BCJA 5HVYA 4M67A 5IEYA 4O7SA 5DT4A 5L2SA 3II5A 2PVHA 3S3IA 4D9UA 5CASA 3F61A 4KNBA 1Q8TA 4RVKA 2C3LA 3I4BA 2WQBA 4NIFB 1YOLA 3C1XA 5J9ZA 2XIRA 4L9IA 4EOSA 4M3QA 2W1GA 3BHYA 3EKKA 3MDYA 4QYHA 5M4IA 5DHJA 4YZDA 2J50A 3W2OA 3FLYA 3OP5A 4H3QA 4JDJA 3BHTA 4FV6A 5K9IA 4RIWA 3NUPA 5J95A 4UMUA 4RT7A 3P08A 3VF8A 3NYNA 2FA2A 2OSCA 3KB7A 3L9LA 3R9NA 3TACA 3U87A 1KE5A 5IZFA 4RC4A 2B7AA 3D7TA 2BDFA 2J5FA 4K77A 3DBQA 3EQCA 4FKUA 4FTKA 3MVHA 2JLDA 4GU6A 5BVKA 3ZO2A 5ETCA 5L2WA 3LJ0A 3QQGA 3R8UA 2CJMA 1BUHA 3QU0A 4DG0E 4JOAA 5L2IA 4PMPA 5AAEA 4GFOA 4FR4A 1H27A 5AR8A 1NVQA 4AGUA 2J0KA 4QNYA 3PVUA 3FI2A 5C03A 5M09A 5IQEA 3PPJA 2HK5A 3R7EA 3AGMA 3LCTA 3R0TA 3IW5A 1Q4LA 2X9EA
chains in the Genus database with same CATH superfamily
3DJ6A 2VTNA 4WUNA 3Q5IA 1R0EA 5BMMA 3W55A 3JPVA 2R3PA 4BCFA 4EOQA 4JBOA 5HNGA 1XR1A 3BCEA 4GKHA 4DH3A 5EYKA 3DCVA 3RMFA 1W2CA 2XBJA 3EIDA 5F1ZA 1GIHA 3D83A 5CAOA 1G5SA 2VTRA 5HZNA 2VGPA 4QP2A 1GIJA 3COIA 3DDPA 3E8EA 3LLTA 2AC5A 3NWWA 4FSRA 2JBPA 1BL6A 4U8ZA 4YJQA 3H10A 4C8BA 2W4JA 3TUDA 3ACJA 3I5NA 4J71A 5KKRB 3VW8A 3HUCA 5HG7A 2F2UA 5TR6A 2DQ7X 5AV1A 3LFAA 4AP7A 4HVGA 1VLRA 2F49A 2J90A 3HRBA 4YJUA 2ZYBA 3N9XA 4DAWA 4MCVA 4IZ7A 4RFMA 4RJ7A 3TV4A 1YVJA 3QKKA 4D58A 4DE4A 4HZSA 1UU7A 2Z7QA 4M84A 2WB8A 1ERKA 1OPKA 5CF6A 2P55A 4WIHA 2X1NA 5CVGA 4YZNA 2UZBA 2E9NA 4I5HA 3EYGA 4AGWA 4EWQA 3ULZA 4CCUA 2B9JA 4FODA 4IZAA 3WI6A 4B6LA 2YM7A 3G2FA 1M17A 4O83A 2XEYA 3ORTA 3Q6UA 4IB0A 4FKIA 2VTOA 2BUJA 4TRLA 3KU2A 4U40A 4G3DA 2ONLA 5H8BA 2R2PA 4O2ZA 1YDTE 4JDHA 5BVNA 4O7TA 3EQGA 3ANQA 3OY1A 3ZU7A 4L3LA 4QNAA 3PRFA 1MRUA 3LFBA 1H08A 2GCDA 5D1JA 3AD6A 3ZONA 4TYJA 3L1SA 4E4NA 2UW3A 3R04A 2VZ6A 3FUPA 1YDSE 4IJ9A 3P7BA 4RG0A 3FQEA 1CKJA 5T68A 4BI1A 4LV7A 5IQCA 1JLUE 1G8SA 5KZIA 3ZRLA 3PE1A 4A9TA 5TF9A 4D0XA 5DVRA 5L6WL 3R7GA 2VX3A 4V0GB 2PVJA 4AZSA 2RF9A 2W1HA 2V55A 2X4FA 3FI3A 1STCE 5L4QA 4YJOA 2XKFA 3MYGA 5M44A 2OH4A 4O0WA 4WSYA 5IF1A 3WZUA 4DGGA 2C69A 4D2TA 1Q8WA 2EXMA 5JFSA 2OIDA 4MH7A 5HE0A 4H1JA 4MKCA 1XKKA 1FPUA 3TIZA 5AFVA 4GK2A 4IW0A 4NT4A 5I3RA 2I7QA 3MFTA 3VWAA 3Q2JA 3U55A 1KSWA 1P4OA 4W4XA 3P0MA 4P4CA 2G2HA 2WXVA 2WMWA 2YM5A 4BKZA 4MXOA 4ZSLA 2FYSA 3ZZEA 3NAXA 3DKGA 3IK3A 4KKEA 1YDRE 3ANRA 3V04A 3UQFA 5EKOA 3OXIA 1IASA 4UZHA 4RZWA 2ETKA 4UN0C 4M0ZA 4WRSA 4QTDA 2IVUA 4II5A 4DLJA 3UZRA 3QD2B 3WYXA 1KE8A 2WNTA 4FNYA 2CGXA 4DBXA 3RAKA 3KK9A 4JRVA 4JG7A 5AP2A 2KTYA 3A8XA 5EW8A 3TIYA 3RKBA 5I9XA 3TKUA 4PTGA 4U44A 3QRUA 4M66A 1BMKA 5CU6A 4EUTA 1YHSA 1WVWA 3D5XA 3LW0A 5AP4A 4ORKA 1KV2A 3CXWA 1WBPA 3QWKA 1YXTA 5CS6A 4JIAA 3ZSHA 3KMMA 4QT1A 4UWYA 1W2DA 3MV5A 4G6NA 1R0PA 3C4XA 3QD3A 2C6DA 4BR3A 1TQMA 3A2CA 3JXWA 3ORIA 1H1RA 4PDSA 5C1QB 3KKVA 4ACHA 4J95A 5JZJA 2AEGA 1R3CA 2YIRA 4K6ZA 3UBDA 4F64A 3GU7A 4ZZOA 1A9UA 5AUXA 3LM0A 1YQJA 2O8YA 3CPCA 4BCMA 5DRDA 4MXCA 4Y8DA 2YZAA 2WOUA 4K18A 4W4WA 2XKEA 3RAIA 3UJGA 3BHHA 4M0YA 5AUTA 1GY3A 4R7IA 1ZYLA 3V01A 5CEMA 4O7NA 1UWHA 4E6CA 4FYNA 4XJ0A 4DFUA 5ACBC 5L2QA 2XK3A 3I6WA 2C3KA 3UOHA 2X2LA 4FTMA 4K11A 4C4HA 2V22A 4HOKA 4B8LA 4EK4A 1WFCA 3MH2A 1NW1A 4H05A 5IA3A 1XBCA 3CKXA 4MD8E 5IA4A 4FF8A 3TYKA 3DLSA 4RPVA 3C50A 5DRBA 4E7WA 4EONA 5D7VA 4B99A 4IE9A 4DGNA 3LQ3A 4Q9ZA 5HKMA 3PG3A 3R2BA 3ZSIA 3CLYA 4O91A 3R8VA 4AS0A 4C4EA 4YPSA 4CMUA 2HWOA 3QLFA 3O51A 3BL9A 4ENXA 4XP3A 4YTHA 3ROYA 2BTSA 4CRSA 1WBSA 4IFGA 4JRNA 2PVKA 3ZTXA 4ZS0A 3OD6X 4KINA 2IVTA 5DH3A 3GCUA 1ZMUA 4FVQA 1JKLA 5ACKA 3ZLXA 3IO7A 4QMQA 4YSJA 1OL2A 4OT5A 2ACXA 5F20A 1H1SA 1F5QA 4R3CA 4WD5A 2B52A 1Q97A 3ALNA 2Y7JA 2WQOA 4BY9E 1IAJA 3CPBA 3ENMA 4JR3A 4GT5A 2EU9A 4BCPA 4FT9A 3EWHA 1Q61A 3HV3A 4QYFA 4OTRA 2PY3A 3LFNA 4BCKA 3HAVA 3PXYA 4FV9A 3FMJA 4RVMA 5IMEA 2XNGA 3FMNA 5KKRC 3OWKA 4FTCA 4IB3A 5JKGA 5KMIA 3DBFA 3OWLA 4L42A 3A7GA 1WVYA 4FTIA 4S33A 2R64A 2W7XA 3ZOSA 5AIKA 4ZY4A 2YIWA 2PMIA 4FEQA 2J6MA 4EJ7A 1OGYA 4XRJA 3I81A 5FEEA 4C4GA 3K5UA 1WAKA 5HX8A 2XEZA 3ZM4A 4I3ZA 4X3FC 5EYCA 5JH6A 1ND4A 1WBWA 5E91A 3OEFX 3L8XA 4L68A 4LOPA 2WO6A 2Q0BA 3H9FA 4EC8A 1KE9A 3JVRA 4BDJA 3WF6A 3QC9A 4U41A 4K1BA 4BICA 2LAVA 3LFCA 2REIA 1QPEA 4BI2A 2YISA 4IDTA 4NFMA 5CU2A 1E1VA 3R7VA 5LVNA 1YXUA 4EH7A 3N4UA 3OWPA 3QQFA 1PXMA 1O9UA 3HMOA 4RLKA 2OFUA 4FIIA 4GU9A 1AGWA 2WQMA 3RZFA 2XKDA 4IAKA 3WF5A 4EZ7A 3C5IA 4DGMA 3SVVA 2BILB 1FVRA 2BRGA 4AN9A 4ZAUA 2ITUA 3ZBFA 1W83A 3TV6A 4FT7A 4Y85A 1XH7A 4ZOGA 2YZLA 4RVTA 3GXLA 1RJBA 2J9MA 4MEDA 1R78A 4YPDA 3EZRA 3QHRA 3FLNC 3TV7A 3Q9ZA 2ZMCA 5KBRA 1KV1A 3E7OA 5LWMA 2XAOA 4O2PA 2QOCA 4ZZMA 4D5KA 4I4EA 3I0QA 1F0QA 3UODA 3R7UA 4DN5A 2B53A 4R1VA 2WELA 4P90A 4RA5A 5AP5A 1IG1A 2HENA 1U54B 2I0HA 4AZEA 4OAVB 3LXPA 2FH9A 3QUPA 4FZDB 4AT3A 4O0UA 5CEPA 2OG8A 3A61A 2V62A 3AD5A 5E8VA 5HLPA 2W1CA 2Y9QA 4CFUA 3DAJA 4DITA 4E26A 4Z3VA 3VS7A 5CF4A 3COHA 4BDBA 4F09A 5J79A 4NJ3A 2C6OA 2R7BA 5M56A 3V5TA 4YC6A 3TWJA 2GTNA 3AG9A 4L7FA 3QCYA 5BVOA 3WE8A 3NUUA 4I6LA 3UIXA 1OZ1A 3LLAA 1NVRA 2JIUA 3DLZA 4J8MA 5A4LA 5HX6A 5E8TA 2UVYA 4TNBA 4PL3A 2G2FA 4HCUA 4DH1A 5FUTA 2AUHA 2VX0A 5H2UA 3REPA 4BIDA 4FL3A 4DTBA 3HRCA 2CN8A 2JDRA 4O6EA 1LP4A 5AUZA 3QFVA 5D10A 2X6DA 3GU4A 3WILA 2QG7A 4C2WA 3EHAA 4PP7A 4HVHA 4HJOA 1G8AA 3PXKA 4A4XA 3R2YA 4ZSGA 5BMSA 4JX3A 4A07A 5HO7A 4IB1A 3ZFXA 2G15A 2XKCA 4YC8A 5GJFA 4YUQA 1SVEA 2F7XE 4YZCA 3ZYAA 3V6SA 4EBVA 5F4NA 4CZYB 3FE3A 3T3VA 2OXYA 4FL2A 5DEYA 5AV3A 5KCVA 3TL8A 5CANA 3NNXA 5CY3A 2OXXA 2FB8A 2GMXA 3EN5A 3R8LA 3QTXA 2R5TA 2Y6MA 4MXXA 3NW7A 4QQCA 1L8TA 1ZYJA 5DGZA 5IQAA 3OROA 4LGDA 2CKPA 4K9YA 3UDSA 2YM6A 4QPMA 3QRJA 4W4YA 2WAJA 3R21A 3C9WA 4O7RA 3DKFA 3I1AA 4DF3A 3F5UA 4G5PA 4GVAA 3U9NA 4CT2A 4G2FA 4WBOA 1PYXA 4C35A 2LGCA 4CYIA 4LOOA 3PWDA 4CV9A 1BX6A 1I44A 1JKTA 3QQUA 4B0GA 4KRDA 5GZ9A 4AFEA 4CEGA 4DEGA 2JD5A 4NKAA 5E7RA 3PUFC 4IAFA 3TUCA 5CNNA 2HZ0A 2ITYA 2ZVAA 4BKJA 4XG2A 3C0HA 3GB2A 2PZYA 3DFCB 2VTHA 2VO7A 4XBRA 2YM4A 3FPMA 3ODZX 1Q99A 5T3QA 3F3TA 4O0SA 3RTPA 4BCQA 5AR2A 4CFVA 4NEUA 3TDVA 3RK7A 3HYHA 2PHKA 2PVYA 2BIKB 3FMEA 5HVJA 1YI3A 3PXRA 1VJYA 5CENA 5CU0A 5E8YA 2H6DA 2V5QA 5AV0A 4DFZE 5LVMA 3P1AA 2W0JA 5BUEA 2R3QA 3BIZA 4JJRA 1XBBA 2ITNA 1APME 4QP6A 1LUFA 5HIDA 4G31A 5G6VA 4NL0A 2XA4A 1XQZA 4CQEA 4Y72A 3O2MA 3DU8A 1OIRA 2Z7RA 2CDZA 3IDCA 4QMOA 2CCHA 4CMTA 1OUYA 3TKHA 4OT6A 4XG9A 5JFXA 1YXXA 3KXNA 4FKQA 4G16A 4M69B 5JFVA 3ZC5A 4BZOA 5EDPA 4UMRA 5BNJA 4I0TA 1G8JA 4TYHA 4MYGA 3CTQA 5EW3A 1Q24A 3K54A 1OBDA 2JKKA 3QZGA 3BLQA 1PKDA 4LYNA 4XCUA 4KD1A 5FG8A 2WMTA 3FSKA 4IAIA 1Y57A 1V0OA 3NNVA 2VTTA 4UY9A 4ZIMA 4U43A 2RFSA 3UQCA 3LPBA 3UVRA 4ASZA 3D5VA 5DR2A 5A54A 4BHZA 2O0UA 4GEOA 2BTRA 1T46A 3NYOA 1H0VA 4OW8A 4XH6A 3H0YA 5CX9A 3UDTA 2C30A 1IRKA 2GNGA 2I1MA 2UZUE 5AJQA 3I5ZA 4FZAB 3L8VA 2UZLA 2VWWA 4N6YA 3FL5A 4DT8A 3LQ8A 3BQRA 2J2IB 3POOA 4DFYA 3QZFA 5EM7A 2YDIA 3HX4A 5HBEA 1GZKA 4F6UA 1H24A 5GIOE 3A60A 2VWVA 5EI2A 3PWYA 1Q5KA 2EWAA 3AC5A 3R01A 4Y5HA 5CU4A 4AQKA 4B9DA 1OMWA 2IJMA 1P2AA 2XJ1A 2VU3A 4U45A 4L44A 1JQHA 3KQ7A 4GIHA 5M53A 2YACA 4UMQA 3AT2A 3ZMMA 3OBJA 1OKZA 1W82A 3AMYA 3NIZA 3HVCA 5FEQA 4IX5A 3MW1A 3SXSA 5IQHA 3HMIA 4BIBA 2VRXA 2FSOX 3V51A 4YHJA 4RIWB 4AW2A 4ARKA 4O21A 4S31A 5AP1A 4K2RA 2YWVA 1TZDA 2Y4IB 3GT8A 4ALVA 3MH0A 2JIVA 3QD4A 4XG8A 3PY1A 3W32A 2JDSA 2P4IA 5J87A 2A27A 4QRCA 3WF7A 3CCNA 3FMDA 4EHEA 3JR1A 5FLFA 4TKSA 3OTUA 5FDXA 4QYEA 3O23A 3E7VA 4ZEGA 5HD7A 3SG9A 4LUDA 4M12A 2E9OA 4AW1A 2X8EA 3TNHA 3Q4TA 2CMWA 4B4LA 1TVOA 3H9OA 1LEWA 3QD0A 5KE0A 2OJ9A 4GMYA 4LFIA 4XLVA 3ORXA 3RHXA 2XZSA 3TZ8A 3WARA 4F9BA 2X7FA 4RLLA 1V0PA 4FKVA 1CMKE 2YWPA 1Y8GA 4KS8A 3O50A 2QCSA 5HEZA 4IJPA 3IDPA 1ZRZA 2OH0E 4AX8A 5LMKC 3LMIA 3VULA 4F70A 1DAWA 3F5XA 3Q5ZA 3R71A 4M7IA 5M08A 3CQUA 3LQ5A 2V7OA 3PFYA 3OOGA 4FKSA 5L8LA 4C4FA 5LOHA 1OL7A 2HW7A 3F7WA 4USFA 4JAIA 4D1ZA 2XANA 3W0PA 2PL0A 5I0BA 2VO0A 5KMKA 3OVVA 3QCQA 2ZJWA 3LMGA 4AZFA 1H8FA 3KN5A 5KHXA 2GNHA 2B9IA 2WTCA 3PY3A 5AUWA 3R8ZA 4QYYA 2IZUA 2BRHA 5EOBA 4NKSA 5EI8A 2XK4A 4CYJA 2XNEA 4YJTA 3VHKA 4CG9A 2XH5A 2IEWA 4EH6A 4TPTA 4YZMA 4BJJA 5A4EA 5ANOA 3EKNA 3Q9XA 5HCXA 3DKCA 5HTBA 5HD4A 2W96B 3BGZA 5CTPA 3U8WA 2CPKE 4ID7A 3Q96A 2OU7A 3QBNA 2NPQA 5AAFA 2WU6A 3QZHA 5J1WA 3W2QA 2B54A 3A4PA 4FKLA 1NA7A 4OGRA 4M15A 2O63A 5B2LA 2QOBA 3BBWA 4XG6A 4UWCA 4UZDA 1NY3A 3D9VA 2OZAA 4AW0A 3D2KA 4J7BA 3OT8A 3H3CA 5IQIA 5EW9A 3TCPA 3UP2A 3ZO3A 4F65A 1UVRA 4RC2A 3VBYA 3RK5A 3GCSA 3FKNA 4NYEA 4C7TA 4FE2A 4QP8A 2EXCX 3VUKA 2QURA 4QP1A 2OW3A 5HIEA 2XMYA 4RJ6A 4ERKA 4RWKA 4FZFB 3OEZA 4DEBA 4J1RA 5K3YA 3ZH8A 3ZZWA 2W5BA 2HW6A 3CTHA 3VUGA 4DG3E 3VF9A 2ITOA 3RAWA 3VJNA 4DH5A 2IW9A 5J5TA 1Y8YA 5AR3A 4ZJVA 4IHPA 4RSSA 3EFLA 4DCEA 2BPMA 5CZHA 3CE3A 3LM5A 2P0CA 3RBWA 3DXNA 3SOAA 3KK8A 3BLHA 3MB7A 2ZDTA 4QP9A 5DI1A 5FM2A 3U54A 3LCSA 5AP7A 4HCVA 5H3QA 4AZTA 2GQSA 1UNGA 4PPAA 3R7IA 5A4CA 3KRRA 2C1BA 3FZOA 2X8DA 2XNNA 3W0NA 4ZTLA 2UW4A 3AQVA 3ETAA 4YBJA 4GRBA 1M7QA 2XK6A 3IDBA 3L8PA 5DNRA 5M4FA 4KBCA 2GFSA 4KIKA 3LCDA 4QYGA 1RE8A 2O5KA 4AN3A 2NNWB 2DS1A 1J1CA 1PMNA 2FUMA 3ZSGA 5CT0A 3KA0A 4RFZA 3MPMA 1B39A 3IONA 4PPBA 3DZQA 2QOOA 1B6CB 4FUXA 3UC4A 1GNGA 2YIXA 3KXXA 3BE2A 4JI9A 5KMOA 4R3PA 4FG7A 3TT0A 3AXWA 4DGLC 4AW5A 3CEKA 4FTQA 3UG1A 5EG3A 2FVDA 4GT4A 3P23A 1Q62A 2VN9A 1WBVA 3PVBA 1YXVA 1QPJA 2AC3A 2OK1A 3LJ1A 4I5PA 4IC8A 4L52A 3TJCA 3DFAA 4UMTA 4FV3A 2Q0NA 2QOLA 3QQHA 5HIBA 2E2BA 4XV2A 2C0OA 4IBMA 2UW0A 2ZDUA 2ZV7A 3SHEA 5FTGA 3VQUA 3D15A 4DTAA 2P2IA 2R3IA 3V8WA 2WEIA 4WUAA 1IA9A 2BZHB 3QGYA 3EJ1A 3E5AA 4RVLA 4BN1A 4CQGA 3OW3A 4JAJA 2A19B 4EZ5A 1W7HA 4CFXA 5LCKA 1XO2B 4FVRA 2XCHA 3ULIA 5CNOA 4FEXA 3DKOA 3FY2A 4YZBA 2H9VA 3G0EA 2O64A 4F0FA 4LI5A 4AQCA 5L3AA 3ORZA 3SD0A 4BDIA 2CNUA 5AWMA 5DN3A 3R6XA 3U4UA 4E6QA 4PMTA 4QMYA 2OFVA 1FGIA 1U46A 1U5QA 4JBQA 4BBEA 1URCA 4QQ5A 4TWPA 4F0GA 4ANSA 3EQRA 4IXPA 4FI1A 2ITZA 3SAYA 2JDVA 1BI8A 3ZEPA 4OTDA 3A7FA 1E9HA 3U4WA 4IAYA 5K4JA 4S30A 4NCTA 1FOTA 3HP5A 5FTQA 4W9WA 2W99B 3NYXA 1DI8A 3NRMA 3QTQA 2GDOA 3QF9A 2XNPA 4G3GA 2W1EA 2XIKA 3AD4A 3IOPA 3V8TA 1ZARA 3VUTA 3E88A 3QKLA 3TNPC 3LIJA 4ERWA 3PXFA 3G0FA 5CXZA 3MA3A 3E8CA 4JDKA 2YHVA 4J53A 3D2IA 3FI4A 4KIOA 3ROCA 3VRYA 3IW6A 4IX4A 3E63A 2IPXA 5IUGA 2QKWB 3W33A 4Q2AA 2H34A 3QTSA 3F3WA 3T9TA 2GPHA 3G6GA 1PXJA 5HG8A 3BU3A 4AACA 5ETAA 2VTJA 2RIOA 4LL0A 2YCFA 1ZYCA 4PDYA 4ZZNA 2X0PA 3KRWA 4O82A 3SGCA 3A99A 5AUVA 4BCJA 3B8QA 4ZTHA 4F78A 3PJ2A 4O22A 1SVHA 4NJDA 3WIKA 4MQ1A 3P79A 3BHVA 4IADA 3MTLA 4HYSA 4WBBB 4DEEA 1IAHA 4ZJIA 5BUIA 2OI4X 2PSQA 2YDKA 2J5EA 3OMVA 4CZTA 4DFXE 1PW2A 2PTKA 4Z7HA 3UC3A 4YSMA 3E3PA 1YWNA 3MY1A 4HVIA 2GSFA 3MBLA 3DJ7A 1O6KA 2ETRA 3FQHA 5D11A 5M55A 4A9SA 5J5SA 5K5NA 3DA6A 2HYYA 2O2UA 3AC4A 3EH9A 1PKGA 2G2IA 3ZRMA 4NW6A 4C62A 3FSFA 2XNBA 3UYTA 3NCGA 4RJ3A 3V5QA 5IQBA 3FZRA 4UYNA 4WRGA 2PUPA 2E9PA 5AUYA 3NIEA 2HY81 1FVVA 2NO3A 4TWNA 1M2QA 2C5XA 3TNIA 3AC3A 3FV8A 4JIKA 4UXQA 2UW8A 4A9RA 5BYYA 2C47A 3CJGA 5DT3A 3ZC6A 3BGQA 2WD1A 3DT1A 4RX7A 4AZWA 4WT6A 4TL0A 2UZWE 4O7LA 4BDAA 4X2GA 5L6PA 4U79A 4WO5A 1JWHA 4CGAA 5ICPA 4ITJA 5AA9A 4G6LA 5M4UA 4ANBA 1JPAA 2J7TA 3BYMA 5HCZA 4CSVA 4KAOA 1J3HA 3MFSA 1VR2A 5M07A 5A46A 3FZ1A 4HNIA 5LMBA 3R28A 4USDA 4RX8A 5CSHA 4BF2A 3TM0A 2PZRA 4JG8A 1FMKA 3MI9A 4XV9A 3OW4A 3O7LD 3PZHA 4XV3A 4ZTQA 4E6DA 3EQHA 4L43A 2W05A 2C3JA 2CHLA 4G6OA 5BV3A 3R83A 4D2VA 2VUWA 4WKQA 4DDIA 3PG1A 4LDTA 5HU9A 3UPZA 4XG4A 3M1SA 5IU2A 3KREA 3UZTA 3IOKA 4JBVA 3HAMA 3EQFA 4MVFA 4NUSA 4X3FA 4CFNA 4L3PA 4BVUA 3R30A 1W2FA 2XNMA 3EQDA 3W10A 3WZJA 3EN4A 4DYMA 5KHWA 4O7VA 4UXLA 4CVAA 4F99A 3D0EA 2PUUA 3MTFA 1ST4A 3OCGA 3E64A 3UO4A 3GU5A 2R3OA 3MH1A 2WMSA 2XM9A 3HMMA 2YITA 3OF0A 2FSMX 4FKJA 3GBZA 3PTGA 2IVVA 3QQJA 4FTJA 5F94A 2OIQA 3QWJA 3MGYA 2BRNA 4I94A 4OTHA 4M8TA 2CKEA 3KXHA 2ZB0A 4U97A 3ZUTA 3GUBA 3I6UA 3RPRA 5F9EA 4IM0A 2OJJA 4RJ8A 2IZRA 4ZY5A 3FJQE 5CAPA 3R1QA 3MWUA 4QMMA 2F7EE 3BYVA 5TT7A 4FYOA 4ZTSA 4BGHA 3QQLA 5HLWA 3RCJA 3UIBA 3BX5A 3BHUA 5FBNC 3D5UA 3QL8A 3W2SA 4PTEA 5A9UA 4O4DA 4R77A 5J9YA 5KX8A 3FXXA 3C51A 2CLQA 1A48A 2Y4IC 3Q6WA 3O7LB 4V05A 3W18A 3NUSA 4MXZA 4O1OA 3HLLA 4IWDA 5ANJA 4AUAA 3OTVA 2GQGA 2YERA 4HPTE 4ZTMA 5LWNA 3TJDA 4KRCA 3ZUVA 3PUPA 4AXDA 4MQ2A 3VNTA 1KWPA 5E9EA 3U9CA 3VS1A 3POZA 5DEWA 3FMLA 3LCKA 2B4SB 2PVLA 3DAKA 3GP0A 3EFWA 3ZFMA 3MESA 4GCJA 4YP8A 3QTWA 2PVNA 3PP1A 4RRVA 4Y83A 3N4VA 5HG9A 4RA4A 4M13A 5CSPA 5IA2A 4YLLA 5DIAA 1H25A 4G3CA 5DMZA 3FI8A 5CT7A 4NTSA 2GTMA 3P78A 1V1KA 3JUHA 2OJIA 1U5RA 2QOKA 2R9SA 5B2MA 4HGEA 3O17A 1IEPA 5DG5A 2SRCA 4FIGA 2W06A 3UOKA 3C13A 3C0GA 2BFYA 3HV6A 4NM7A 3CY3A 3OUKA 5EHLA 3AKJA 3CGFA 3ET7A 4LG4A 3JVSA 3M11A 2QC6A 2VO3A 3FBVA 3KXMA 1NVSA 3DK6A 2VTQA 1Q3DA 3OC1A 3FC1X 4M14A 5KZ0A 5IA1A 4ANNA 2JKMA 4DEIA 5E1SA 1Q8YA 1FVTA 1TQIA 3LFEA 2Z02A 5JT2A 2OBJA 4DHFA 2O65A 3Q53A 4ITIA 3ML1A 1ZYSA 4HW7A 4IX3A 4HPUE 4P5ZA 5A14A 3AT3A 4KS7A 5AUUA 3GFEA 4OAUC 2YLFA 3KRJA 3OCSA 4FIHA 4LRMA 4IVBA 3ZHPC 4GYGA 4OTIA 3VBTA 4O7WA 5DLSA 2QOFA 5D12A 2QU5A 2UW9A 4X6RA 1H26A 3KFAA 2IF8A 4FT0A 2J0LA 2VGOA 3LFDA 4IM3A 1HCLA 3NR9A 4BKYA 3HMNA 2EVAA 1OB3A 3LJ2A 3HGKA 3BQCA 3FKLA 5BYZA 3TZMA 3ORKA 2Y0AA 3MPAA 3Q4CA 3CGOA 2JFLA 4G9CA 4RJ5A 3SXFA 3RGFA 4TYGA 4E93A 4E6AA 3D4QA 3VJOA 2QOHA 2OLCA 4QEBA 2VTPA 3JY9A 3PJ8A 5HOAA 4LOQA 3NCZA 1H1QA 2HZNA 3ITZA 5LMKA 4O86A 4TWOA 4QP7A 5HLNA 3GCPA 3PY0A 4DTKA 5E90A 5TOZA 4MUQA 4TNDA 3SW7A 3KVWA 4FTRA 3C4WA 2YM8A 4ITHA 3RHKA 3GOKA 4FSUA 4HGLA 1H1WA 4D2WA 4CZUA 1QCFA 3R9DA 5D7AA 1YHWA 2IN6A 2RGPA 2CCIA 5HO6A 3NFGB 4G9RA 3GNIB 2R3GA 1Z9XA 1PYEA 3W2PA 3NNWA 4RIXB 4QDVA 3LHJA 4YJPA 5IQFA 3D94A 4OTFA 3DDQA 2HXQA 4MK0A 3B8RA 4FKPA 5CVFA 2PVMA 4YO4A 4O4EA 1J7IA 2IW6A 4EK8A 4I24A 5IG1A 2AYPA 2XIYA 3KXGA 4EOMA 2PUNA 2WIHA 5HG5A 3GCQA 1HCKA 4FV2A 4MD9E 1VZOA 2C6KA 4ACDA 3R22A 3FMKA 4I23A 5CEIA 3FHRA 4FNXA 2C6MA 5HVKA 2C0TA 4G1WA 3PSDA 5DA3A 3ID6C 4FSYA 5AIRA 2VV9A 3ACKA 4GVJA 1W8CA 1RQQA 4U0IA 3KVXA 4BWXA 3AT4A 1Q8UA 3DNEA 4L46A 5L2TA 2YM3A 2WTJA 3MY0A 3AC8A 4RQKA 3DAEA 4GUBA 3PLSA 4YLJA 3VS6A 1WBNA 3ERKA 4M97A 4RX9A 4WHZA 3TNQB 2R7IA 5D41A 3WZDA 4PUZA 4E3CA 3U6HA 4CD0A 3H30A 4KBAA 2RFDA 1PXLA 1DS5A 3NSZA 4HNFA 4J96A 5ANIA 4WNPA 4KIPA 1Z5MA 1VYZA 4BRXA 3DBEA 2OXDA 3T8OA 2R0IA 1PF8A 1OIQA 3DQWA 4KWPA 3LMHA 4Z7GA 3VUMA 2QD9A 3FZTA 3G6HA 5KBQA 2XAMA 2JKQA 1G3NA 3CJFA 4FGRA 3R73A 4JXFA 4X2KA 1PXIA 5LVLA 2C4GA 4U80A 4AA4A 3VS2A 2ITTA 4EJNA 3G51A 1JNKA 1H07A 3I0OA 4NH1A 2X81A 5DR6A 1H28A 4MXYA 4E73A 4O4FA 4W9XA 3NS9A 2I6LA 2C6EA 3EMGA 3IGOA 1QMZA 2A1AB 5IA0A 3PXZA 3QLGA 4QPSA 4NM5A 4LRJA 2WGJA 5KO1A 4E20A 3PP0A 2F7ZE 5EQEA 2ERKA 4F1OA 4YURA 2VWUA 4OBQA 3QX4A 2ZV9A 3SLSA 4K33A 3BKBA 2IW8A 3VBQA 2OF2A