3PRNA

E1m, a104w mutant of rh. blastica porin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEWSSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3prnA00
3EMNX 4FSPA 4FT6A 5FVNA 4RJWA 3VY8X 3NSGA 5JDPA 2XE1A 2XG6A 1HXTA 3SZVA 3A2SX 3PRNA 2XE5A 4FRXA 3SYSA 1HXXA 3SZDA 3POXA 2Y0HA 3VZWX 3T24A 1GFQA 4FRTA 4JFBA 1OPFA 4GCPA 5DL5A 4AUIA 1OSMA 2ZLDA 1MPFA 2PRNA 1BT9A 2J1NA 2XE3A 4D5UA 2PORA 3WI5A 4KR8A 1PRNA 3O0EA 4LSEA 3VZUX 3POQA 2FGQX 3T20A 3VZTX 4D65A 1E54A 1GFMA 3WI4A 3T0SA 2OMFA 2O4VA 5DL8A 4GCSA 4KR4A 5DL6A 2ZFGA 3PORA 4LSHA 4RJXA 1BH3A 2Y2XA 1GFNA 2XE2A 3FYXA 4BUMX 4FOZA 8PRNA 1HXUA 6PRNA 3SY9A 1GFPA 7PRNA 1PHOA 3HWBA 3POUA 4KRAA 4D64A 4C69X 4FMSA 2Y0LA 3HW9A 5DL7A 2K4TA 3SY7A 1H6S1 2J4UP 5PRNA 4LSFA 3JTYA 4GCQA 3K19A 2Y0KA 4FSOA 2ODJA 4LSIA 3UU2A 2FGRA 2QTKA 1GFOA 3VY9X 3UPGA 3SYBA
chains in the Genus database with same CATH superfamily
1ZHZA 3DA4A 3EMNX 4AFKA 4FSPA 4AYEC 4FT6A 4O3XB 4O4XA 4RJWA 3NSGA 5FVNA 3V8UA 3VY8X 5B5EO 5JDPA 1YS5A 2XE1A 4PJ0O 5KAFO 1MM5A 3LK3B 3PQSA 4Z3TA 2XG6A 1T16A 5TISO 2IWWA 1HXTA 2MNHA 3AAEA 4XNLA 3SZVA 4N75A 4UB6O 3A2SX 3PRNA 2XE5A 4JCHA 1ZHXA 4AKRB 4FRXA 5IYUA 2WVPA 3SYSA 1HXXA 1QJ8A 3SZDA 4B61A 3POXA 2Y0HA 5G3AA 3LK2A 3RBHA 2W80C 3DWOX 4C4VA 3VZWX 4E1TA 3T24A 1GFQA 2R89A 5GTHO 3AA1A 4FRTA 4JFBA 1OPFA 4FZLA 4RLCA 5G38A 4GCPA 4O49A 5ADXK 2JMMA 3HOLA 2X9KA 4U9CA 2Y7SA 1T1LA 3AA6B 3QRCA 2F1CX 4GHBA 2R4NA 2GE4A 5DL5A 2KZ7A 1OSMA 1THQA 2KC0A 2KXPB 4AUIA 4AZLA 4C00A 4RL9A 1ZHYA 1MPFA 2PRNA 2ZLDA 3AA7B 3GP6A 1BT9A 3C5OA 2J1NA 3WU2O 2XE3A 3AAAB 1ZHWA 3UAQA 4G76A 4D5UA 2PORA 1P4TA 3TZGA 3WI5A 4KR8A 1PRNA 4K3CA 2F1VA 3BS0A 4XNKA 5G39A 5EE2A 3O0EA 5AFUK 3BRYA 4LSEA 4PR7A 4AYDC 3PF1A 4QQ1A 3VZUX 3POQA 2FGQX 3LK41 4IL6O 2M07A 3DA3A 3AAEB 2R4PA 2AXTO 3PGRA 3PGSA 3KZIO 1S5LO 4GF4A 3T20A 3VE1A 3VZTX 4D65A 1E54A 4E1SA 1GFMA 4C4VB 3LK2B 1ORMA 2W81C 5GTIO 2XTQA 3QRAA 3T0SA 2OMFA 2O4VA 2XTRA 5DL8A 5E79O 3DZMA 3WI4A 3AA1B 2XMXA 1G90A 1Q9GA 4GCSA 5GV0A 4KR4A 2R4LA 2JQYA 3AA0A 4AKRA 1IZNA 5DL6A 2KZ7B 2ERVA 5G26A 2ZFGA 3G7GA 3PORA 1BXWA 2X27X 4N59A 2LHFA 4LSHA 4N74A 4RJXA 1BH3A 2Y2XA 1GFNA 2XE2A 2N2LA 1QJ9A 3FYXA 4AYMC 2R4OA 2R88A 4BUMX 1ZHTA 2WJRA 4FOZA 4O3WA 4G75A 8PRNA 3PQUA 5AFUL 4K3BA 5H2FO 3PGUA 1HXUA 6PRNA 3SY9A 1GFPA 3NJTA 4AKMA 4AYID 1PHOA 3A0HO 2MHLA 7PRNA 4O3YA 3HWBA 2R8AA 2N2MA 3POUA 4KRAA 4D64A 4C69X 4FMSA 4F4BA 3BRZA 3LK3A 4O3ZA 5T5FA 2Y0LA 3HW9A 2WJQA 4FZMA 5DL7A 3DWNA 4FUVA 2F1TA 2K4TA 4N58A 3SY7A 5ADXL 2YNKA 1H6S1 2J4UP 3LK42 1Q9FA 4FESA 5PRNA 2YPVA 4LSFA 3JTYA 4GCQA 4FQEA 2K0LA 2KDYA 3K19A 4CTDA 3AA0B 3A0BO 4FZNA 4RLBA 1IZNB 3JCUO 3HOEA 5KAIO 2Y0KA 4FSOA 2ODJA 1MM4A 5D5DA 3VE2A 4O4UA 5B66O 3AA6A 4LSIA 2LFUA 4PUXA 4AYNA 4UB8O 2IWVA 1QJPA 2KXPA 3UU2A 2FGRA 2M06A 3AA7A 2QTKA 1GFOA 3VY9X 3UPGA 3SYBA 3AAAA 3KVDD
chains in the Genus database with same CATH topology
1ZHZA 3DA4A 3EMNX 4AFKA 4FSPA 4AYEC 4FT6A 4O3XB 4O4XA 4RJWA 3NSGA 5FVNA 3V8UA 3VY8X 5JDPA 1YS5A 2XE1A 1MM5A 3LK3B 3PQSA 4Z3TA 2XG6A 1HXTA 2MNHA 3AAEA 4XNLA 3SZVA 3A2SX 3PRNA 2XE5A 4JCHA 1ZHXA 4AKRB 4FRXA 5IYUA 3SYSA 1HXXA 1QJ8A 3SZDA 4B61A 3POXA 2Y0HA 3RBHA 3LK2A 2W80C 3VZWX 4E1TA 3T24A 1GFQA 3AA1A 4FRTA 4JFBA 1OPFA 4FZLA 4RLCA 4GCPA 4O49A 5ADXK 2JMMA 3HOLA 4U9CA 2Y7SA 3AA6B 3QRCA 5GV0A 4GHBA 2GE4A 5DL5A 4AZLA 2KZ7A 1OSMA 1THQA 2KC0A 2KXPB 4AUIA 4RL9A 1ZHYA 1MPFA 2PRNA 2ZLDA 3AA7B 3GP6A 1BT9A 3C5OA 2J1NA 2XE3A 3AAAB 1ZHWA 3UAQA 4G76A 4D5UA 2PORA 1P4TA 3TZGA 3WI5A 4KR8A 1PRNA 2F1VA 4XNKA 5EE2A 3O0EA 5AFUK 4LSEA 4AYDC 4QQ1A 3VZUX 3POQA 2FGQX 3LK41 2M07A 3DA3A 3AAEB 4GF4A 3T20A 3VE1A 3VZTX 4D65A 1E54A 4E1SA 1GFMA 3LK2B 1ORMA 2W81C 2XTQA 3QRAA 3T0SA 2OMFA 2XTRA 2O4VA 5DL8A 3WI4A 1G90A 3AA1B 2XMXA 1Q9GA 4GCSA 4KR4A 3AA0A 4AKRA 1IZNA 5DL6A 2KZ7B 2ERVA 5G26A 2ZFGA 3G7GA 3PORA 1BXWA 2X27X 4N59A 2LHFA 4LSHA 4RJXA 1BH3A 2Y2XA 1GFNA 2XE2A 2N2LA 1QJ9A 3FYXA 4AYMC 4BUMX 1ZHTA 4O3WA 4FOZA 4G75A 8PRNA 3PQUA 5AFUL 1HXUA 6PRNA 3SY9A 1GFPA 4AKMA 7PRNA 4AYID 1PHOA 2MHLA 4O3YA 3HWBA 3POUA 2N2MA 4KRAA 4D64A 4C69X 4FMSA 4F4BA 5T5FA 3LK3A 4O3ZA 2Y0LA 3HW9A 4FZMA 5DL7A 4FUVA 4N58A 2F1TA 2K4TA 3SY7A 5ADXL 2YNKA 1H6S1 2J4UP 3LK42 1Q9FA 4FESA 5PRNA 2YPVA 4LSFA 3JTYA 4GCQA 2K0LA 2KDYA 3K19A 3AA0B 4FZNA 4RLBA 1IZNB 3HOEA 2Y0KA 4FSOA 2ODJA 1MM4A 5D5DA 3VE2A 4O4UA 3AA6A 4LSIA 2LFUA 4PUXA 4AYNA 1QJPA 2KXPA 3UU2A 2FGRA 2M06A 3AA7A 2QTKA 1GFOA 3VY9X 3UPGA 3SYBA 3AAAA 3KVDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMN X;  4FSP A;  4FT6 A;  5FVN A;  4RJW A;  3VY8 X;  3NSG A;  5JDP A;  2XE1 A;  2XG6 A;  1HXT A;  3SZV A;  3A2S X;  3PRN A;  2XE5 A;  4FRX A;  3SYS A;  1HXX A;  3SZD A;  3POX A;  2Y0H A;  3VZW X;  3T24 A;  1GFQ A;  4FRT A;  4JFB A;  1OPF A;  4GCP A;  5DL5 A;  4AUI A;  1OSM A;  2ZLD A;  1MPF A;  2PRN A;  1BT9 A;  2J1N A;  2XE3 A;  4D5U A;  2POR A;  3WI5 A;  4KR8 A;  1PRN A;  3O0E A;  4LSE A;  3VZU X;  3POQ A;  2FGQ X;  3T20 A;  3VZT X;  4D65 A;  1E54 A;  1GFM A;  3WI4 A;  3T0S A;  2OMF A;  2O4V A;  5DL8 A;  4GCS A;  4KR4 A;  5DL6 A;  2ZFG A;  3POR A;  4LSH A;  4RJX A;  1BH3 A;  2Y2X A;  1GFN A;  2XE2 A;  3FYX A;  4BUM X;  4FOZ A;  8PRN A;  1HXU A;  6PRN A;  3SY9 A;  1GFP A;  7PRN A;  1PHO A;  3HWB A;  3POU A;  4KRA A;  4D64 A;  4C69 X;  4FMS A;  2Y0L A;  3HW9 A;  5DL7 A;  2K4T A;  3SY7 A;  1H6S 1;  2J4U P;  5PRN A;  4LSF A;  3JTY A;  4GCQ A;  3K19 A;  2Y0K A;  4FSO A;  2ODJ A;  4LSI A;  3UU2 A;  2FGR A;  2QTK A;  1GFO A;  3VY9 X;  3UPG A;  3SYB A; 
#chains in the Genus database with same CATH topology
 1ZHZ A;  3DA4 A;  3EMN X;  4AFK A;  4FSP A;  4AYE C;  4FT6 A;  4O3X B;  4O4X A;  4RJW A;  3NSG A;  5FVN A;  3V8U A;  3VY8 X;  5B5E O;  5JDP A;  1YS5 A;  2XE1 A;  4PJ0 O;  5KAF O;  1MM5 A;  3LK3 B;  3PQS A;  4Z3T A;  2XG6 A;  1T16 A;  5TIS O;  2IWW A;  1HXT A;  2MNH A;  3AAE A;  4XNL A;  3SZV A;  4N75 A;  4UB6 O;  3A2S X;  3PRN A;  2XE5 A;  4JCH A;  1ZHX A;  4AKR B;  4FRX A;  5IYU A;  2WVP A;  3SYS A;  1HXX A;  1QJ8 A;  3SZD A;  4B61 A;  3POX A;  2Y0H A;  5G3A A;  3LK2 A;  3RBH A;  2W80 C;  3DWO X;  4C4V A;  3VZW X;  4E1T A;  3T24 A;  1GFQ A;  2R89 A;  5GTH O;  3AA1 A;  4FRT A;  4JFB A;  1OPF A;  4FZL A;  4RLC A;  5G38 A;  4GCP A;  4O49 A;  5ADX K;  2JMM A;  3HOL A;  2X9K A;  4U9C A;  2Y7S A;  1T1L A;  3AA6 B;  3QRC A;  2F1C X;  4GHB A;  2R4N A;  2GE4 A;  5DL5 A;  2KZ7 A;  1OSM A;  1THQ A;  2KC0 A;  2KXP B;  4AUI A;  4AZL A;  4C00 A;  4RL9 A;  1ZHY A;  1MPF A;  2PRN A;  2ZLD A;  3AA7 B;  3GP6 A;  1BT9 A;  3C5O A;  2J1N A;  3WU2 O;  2XE3 A;  3AAA B;  1ZHW A;  3UAQ A;  4G76 A;  4D5U A;  2POR A;  1P4T A;  3TZG A;  3WI5 A;  4KR8 A;  1PRN A;  4K3C A;  2F1V A;  3BS0 A;  4XNK A;  5G39 A;  5EE2 A;  3O0E A;  5AFU K;  3BRY A;  4LSE A;  4PR7 A;  4AYD C;  3PF1 A;  4QQ1 A;  3VZU X;  3POQ A;  2FGQ X;  3LK4 1;  4IL6 O;  2M07 A;  3DA3 A;  3AAE B;  2R4P A;  2AXT O;  3PGR A;  3PGS A;  3KZI O;  1S5L O;  4GF4 A;  3T20 A;  3VE1 A;  3VZT X;  4D65 A;  1E54 A;  4E1S A;  1GFM A;  4C4V B;  3LK2 B;  1ORM A;  2W81 C;  5GTI O;  2XTQ A;  3QRA A;  3T0S A;  2OMF A;  2O4V A;  2XTR A;  5DL8 A;  5E79 O;  3DZM A;  3WI4 A;  3AA1 B;  2XMX A;  1G90 A;  1Q9G A;  4GCS A;  5GV0 A;  4KR4 A;  2R4L A;  2JQY A;  3AA0 A;  4AKR A;  1IZN A;  5DL6 A;  2KZ7 B;  2ERV A;  5G26 A;  2ZFG A;  3G7G A;  3POR A;  1BXW A;  2X27 X;  4N59 A;  2LHF A;  4LSH A;  4N74 A;  4RJX A;  1BH3 A;  2Y2X A;  1GFN A;  2XE2 A;  2N2L A;  1QJ9 A;  3FYX A;  4AYM C;  2R4O A;  2R88 A;  4BUM X;  1ZHT A;  2WJR A;  4FOZ A;  4O3W A;  4G75 A;  8PRN A;  3PQU A;  5AFU L;  4K3B A;  5H2F O;  3PGU A;  1HXU A;  6PRN A;  3SY9 A;  1GFP A;  3NJT A;  4AKM A;  4AYI D;  1PHO A;  3A0H O;  2MHL A;  7PRN A;  4O3Y A;  3HWB A;  2R8A A;  2N2M A;  3POU A;  4KRA A;  4D64 A;  4C69 X;  4FMS A;  4F4B A;  3BRZ A;  3LK3 A;  4O3Z A;  5T5F A;  2Y0L A;  3HW9 A;  2WJQ A;  4FZM A;  5DL7 A;  3DWN A;  4FUV A;  2F1T A;  2K4T A;  4N58 A;  3SY7 A;  5ADX L;  2YNK A;  1H6S 1;  2J4U P;  3LK4 2;  1Q9F A;  4FES A;  5PRN A;  2YPV A;  4LSF A;  3JTY A;  4GCQ A;  4FQE A;  2K0L A;  2KDY A;  3K19 A;  4CTD A;  3AA0 B;  3A0B O;  4FZN A;  4RLB A;  1IZN B;  3JCU O;  3HOE A;  5KAI O;  2Y0K A;  4FSO A;  2ODJ A;  1MM4 A;  5D5D A;  3VE2 A;  4O4U A;  5B66 O;  3AA6 A;  4LSI A;  2LFU A;  4PUX A;  4AYN A;  4UB8 O;  2IWV A;  1QJP A;  2KXP A;  3UU2 A;  2FGR A;  2M06 A;  3AA7 A;  2QTK A;  1GFO A;  3VY9 X;  3UPG A;  3SYB A;  3AAA A;  3KVD D; 
#chains in the Genus database with same CATH homology
 1ZHZ A;  3DA4 A;  3EMN X;  4AFK A;  4FSP A;  4AYE C;  4FT6 A;  4O3X B;  4O4X A;  4RJW A;  3NSG A;  5FVN A;  3V8U A;  3VY8 X;  5JDP A;  1YS5 A;  2XE1 A;  1MM5 A;  3LK3 B;  3PQS A;  4Z3T A;  2XG6 A;  1HXT A;  2MNH A;  3AAE A;  4XNL A;  3SZV A;  3A2S X;  3PRN A;  2XE5 A;  4JCH A;  1ZHX A;  4AKR B;  4FRX A;  5IYU A;  3SYS A;  1HXX A;  1QJ8 A;  3SZD A;  4B61 A;  3POX A;  2Y0H A;  3RBH A;  3LK2 A;  2W80 C;  3VZW X;  4E1T A;  3T24 A;  1GFQ A;  3AA1 A;  4FRT A;  4JFB A;  1OPF A;  4FZL A;  4RLC A;  4GCP A;  4O49 A;  5ADX K;  2JMM A;  3HOL A;  4U9C A;  2Y7S A;  3AA6 B;  3QRC A;  5GV0 A;  4GHB A;  2GE4 A;  5DL5 A;  4AZL A;  2KZ7 A;  1OSM A;  1THQ A;  2KC0 A;  2KXP B;  4AUI A;  4RL9 A;  1ZHY A;  1MPF A;  2PRN A;  2ZLD A;  3AA7 B;  3GP6 A;  1BT9 A;  3C5O A;  2J1N A;  2XE3 A;  3AAA B;  1ZHW A;  3UAQ A;  4G76 A;  4D5U A;  2POR A;  1P4T A;  3TZG A;  3WI5 A;  4KR8 A;  1PRN A;  2F1V A;  4XNK A;  5EE2 A;  3O0E A;  5AFU K;  4LSE A;  4AYD C;  4QQ1 A;  3VZU X;  3POQ A;  2FGQ X;  3LK4 1;  2M07 A;  3DA3 A;  3AAE B;  4GF4 A;  3T20 A;  3VE1 A;  3VZT X;  4D65 A;  1E54 A;  4E1S A;  1GFM A;  3LK2 B;  1ORM A;  2W81 C;  2XTQ A;  3QRA A;  3T0S A;  2OMF A;  2XTR A;  2O4V A;  5DL8 A;  3WI4 A;  1G90 A;  3AA1 B;  2XMX A;  1Q9G A;  4GCS A;  4KR4 A;  3AA0 A;  4AKR A;  1IZN A;  5DL6 A;  2KZ7 B;  2ERV A;  5G26 A;  2ZFG A;  3G7G A;  3POR A;  1BXW A;  2X27 X;  4N59 A;  2LHF A;  4LSH A;  4RJX A;  1BH3 A;  2Y2X A;  1GFN A;  2XE2 A;  2N2L A;  1QJ9 A;  3FYX A;  4AYM C;  4BUM X;  1ZHT A;  4O3W A;  4FOZ A;  4G75 A;  8PRN A;  3PQU A;  5AFU L;  1HXU A;  6PRN A;  3SY9 A;  1GFP A;  4AKM A;  7PRN A;  4AYI D;  1PHO A;  2MHL A;  4O3Y A;  3HWB A;  3POU A;  2N2M A;  4KRA A;  4D64 A;  4C69 X;  4FMS A;  4F4B A;  5T5F A;  3LK3 A;  4O3Z A;  2Y0L A;  3HW9 A;  4FZM A;  5DL7 A;  4FUV A;  4N58 A;  2F1T A;  2K4T A;  3SY7 A;  5ADX L;  2YNK A;  1H6S 1;  2J4U P;  3LK4 2;  1Q9F A;  4FES A;  5PRN A;  2YPV A;  4LSF A;  3JTY A;  4GCQ A;  2K0L A;  2KDY A;  3K19 A;  3AA0 B;  4FZN A;  4RLB A;  1IZN B;  3HOE A;  2Y0K A;  4FSO A;  2ODJ A;  1MM4 A;  5D5D A;  3VE2 A;  4O4U A;  3AA6 A;  4LSI A;  2LFU A;  4PUX A;  4AYN A;  1QJP A;  2KXP A;  3UU2 A;  2FGR A;  2M06 A;  3AA7 A;  2QTK A;  1GFO A;  3VY9 X;  3UPG A;  3SYB A;  3AAA A;  3KVD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...