3PRNA

E1m, a104w mutant of rh. blastica porin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEWSSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
molecule keywords PORIN
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3prnA00
2XE5A 3POXA 2ODJA 3FYXA 3A2SX 4FOZA 2ZLDA 3VY8X 1PRNA 3WI4A 3SY9A 3VZUX 2O4VA 4LSEA 3T24A 4RJWA 3POQA 3SZDA 5FVNA 2Y0LA 3UU2A 4BUMX 4FSPA 3VZWX 4LSHA 3SY7A 2K4TA 5PRNA 3HW9A 3HWBA 5JDPA 2ZFGA 3PRNA 2J1NA 3NSGA 2PORA 2XG6A 3JTYA 3O0EA 2Y2XA 4FSOA 5DL7A 2XE1A 1HXTA 3EMNX 3UPGA 3POUA 4AUIA 1OSMA 4KR4A 3SYSA 3SZVA 4D64A 1E54A 4FRTA 1H6S1 4FRXA 1BT9A 4RJXA 2J4UP 2FGQX 1GFQA 8PRNA 1HXUA 2Y0HA 3K19A 3T0SA 2XE2A 4LSIA 1GFMA 4JFBA 7PRNA 1GFPA 2XE3A 4KR8A 4C69X 2PRNA 2OMFA 4FT6A 1MPFA 2QTKA 5DL6A 6PRNA 4GCQA 3WI5A 1BH3A 4D5UA 4GCSA 4FMSA 3VY9X 5DL8A 2Y0KA 1GFNA 3SYBA 5DL5A 1GFOA 1PHOA 1OPFA 4KRAA 4D65A 1HXXA 2FGRA 4LSFA 4GCPA 3PORA 3VZTX 3T20A
chains in the Genus database with same CATH superfamily
2XE5A 3PGUA 3POXA 2ODJA 2R4OA 2M07A 4G75A 3FYXA 3A2SX 4FOZA 4C4VB 2ZLDA 4N75A 4Z3TA 3VY8X 1PRNA 3UAQA 3SY9A 5TISO 2O4VA 1IZNB 3VZUX 4LSEA 3T24A 3AAEA 3AA7B 4C00A 3A0HO 2KZ7B 4RJWA 3POQA 5KAFO 3SZDA 5FVNA 2Y0LA 2R4NA 1T1LA 3AA1B 4FZMA 3UU2A 2F1VA 4BUMX 4AYNA 4FSPA 2R4PA 3VZWX 4LSHA 2F1CX 4QQ1A 1Q9FA 5H2FO 2MNHA 3LK3A 2R4LA 3SY7A 2K4TA 3LK2B 3DWOX 4FUVA 3V8UA 5PRNA 2JQYA 3HW9A 4B61A 4PJ0O 3HWBA 5JDPA 2ZFGA 3PRNA 2J1NA 2JMMA 5B66O 3NSGA 2ERVA 1T16A 4GHBA 2PORA 4AKRA 3WU2O 2XG6A 2LHFA 1BXWA 2KXPA 3BRYA 3KZIO 4AYDC 4PR7A 4K3CA 2W80C 3JTYA 3AAAA 3O0EA 5G39A 2Y2XA 3AA0B 4FSOA 1QJPA 4UB8O 2KC0A 5DL7A 4O3WA 2M06A 4U9CA 5EE2A 2XE1A 2R88A 4O4XA 1HXTA 2Y7SA 3EMNX 4O3YA 3UPGA 4RLCA 3A0BO 2YPVA 4RLBA 5ADXL 3POUA 3AA6A 5KAIO 4AUIA 1OSMA 1ZHWA 3BRZA 4FZLA 4KR4A 2R89A 1THQA 1ZHYA 2KDYA 4N59A 5GV0A 2X9KA 4AKMA 3SYSA 3SZVA 4D64A 1E54A 1MM4A 3PGRA 3AA7A 1MM5A 3DA3A 2MHLA 1H6S1 2N2LA 1BT9A 4FRTA 4FRXA 4O3ZA 4RJXA 2J4UP 2FGQX 1Q9GA 2W81C 3AA1A 3QRCA 4FQEA 1GFQA 4N58A 5D5DA 4G76A 5G26A 2IWVA 4IL6O 8PRNA 4JCHA 3LK2A 1HXUA 3RBHA 2Y0HA 3K19A 3T0SA 2XE2A 2XTQA 1ZHTA 3PQSA 4O4UA 2YNKA 4UB6O 5AFUK 2LFUA 4LSIA 1GFMA 5GTIO 4C4VA 4F4BA 3PGSA 3DZMA 4JFBA 4AFKA 3LK3B 7PRNA 3DWNA 4XNKA 3AAEB 1YS5A 1ZHZA 3C5OA 3NJTA 1QJ9A 4CTDA 4GF4A 1GFPA 1ORMA 2XE3A 3PQUA 4K3BA 2WJRA 4KR8A 5G3AA 5E79O 4C69X 1G90A 2PRNA 3HOLA 2OMFA 4AYMC 2XTRA 4N74A 4FT6A 4O49A 4AYID 1IZNA 1MPFA 3LK41 4XNLA 2QTKA 2WJQA 4E1SA 5ADXK 5IYUA 2KZ7A 5DL6A 6PRNA 4GCQA 4PUXA 2AXTO 4FZNA 3AA0A 3WI5A 1BH3A 3VE1A 4D5UA 2F1TA 1QJ8A 3QRAA 4AKRB 4FESA 4GCSA 4RL9A 3TZGA 3VE2A 2KXPB 3PF1A 4FMSA 3BS0A 3VY9X 3LK42 5DL8A 5T5FA 2XMXA 2GE4A 2Y0KA 4AYEC 1ZHXA 1GFNA 3SYBA 3WI4A 5GTHO 2K0LA 2IWWA 2X27X 5DL5A 1GFOA 3DA4A 1PHOA 1OPFA 4KRAA 3G7GA 2R8AA 5G38A 4D65A 1HXXA 1S5LO 4E1TA 3JCUO 2FGRA 3AA6B 3AAAB 4LSFA 5AFUL 3HOEA 5B5EO 4GCPA 3PORA 2N2MA 3GP6A 1P4TA 3VZTX 4AZLA 3T20A 3KVDD 2WVPA 4O3XB
chains in the Genus database with same CATH topology
2XE5A 3POXA 2ODJA 2M07A 4G75A 3FYXA 3A2SX 4FOZA 2ZLDA 4Z3TA 3VY8X 1PRNA 3UAQA 3SY9A 3VZUX 2O4VA 1IZNB 3WI4A 4LSEA 3T24A 3AAEA 3AA7B 2KZ7B 4RJWA 3POQA 3SZDA 5FVNA 2Y0LA 3UU2A 3AA1B 4FZMA 4BUMX 2F1VA 4AYNA 4FSPA 3VZWX 4LSHA 4QQ1A 1Q9FA 2MNHA 3LK3A 3SY7A 2K4TA 3LK2B 4FUVA 3V8UA 5PRNA 3HW9A 4B61A 3HWBA 5JDPA 2ZFGA 3PRNA 2J1NA 2JMMA 3NSGA 2ERVA 4GHBA 2PORA 4AKRA 2XG6A 2LHFA 1BXWA 2KXPA 4AYDC 2W80C 3JTYA 3AAAA 3O0EA 2Y2XA 3AA0B 4FSOA 1QJPA 2KC0A 5DL7A 4O3WA 2M06A 4U9CA 5EE2A 2XE1A 4O4XA 1HXTA 2Y7SA 3EMNX 4O3YA 3UPGA 4RLCA 2YPVA 4RLBA 5ADXL 3POUA 3AA6A 4AUIA 1OSMA 1ZHWA 4FZLA 4KR4A 1THQA 1ZHYA 2KDYA 4N59A 5GV0A 4AKMA 3SYSA 3SZVA 4D64A 1E54A 1MM4A 3AA7A 1MM5A 3DA3A 2MHLA 1H6S1 2N2LA 1BT9A 4FRTA 4FRXA 4O3ZA 4RJXA 2J4UP 2FGQX 1Q9GA 2W81C 3AA1A 3QRCA 4N58A 1GFQA 5D5DA 4G76A 5G26A 8PRNA 4JCHA 3LK2A 1HXUA 3RBHA 2Y0HA 3K19A 3T0SA 2XE2A 2XTQA 1ZHTA 3PQSA 4O4UA 2YNKA 5AFUK 2LFUA 4LSIA 1GFMA 4F4BA 4JFBA 4AFKA 3LK3B 7PRNA 4XNKA 3AAEB 1YS5A 1ZHZA 3C5OA 1QJ9A 4GF4A 1GFPA 1ORMA 2XE3A 3PQUA 4KR8A 4C69X 1G90A 2PRNA 3HOLA 2OMFA 4AYMC 2XTRA 4FT6A 4O49A 4AYID 1IZNA 1MPFA 3LK41 4XNLA 2QTKA 4E1SA 5ADXK 5IYUA 2KZ7A 5DL6A 6PRNA 4GCQA 4PUXA 4FZNA 3WI5A 3AA0A 1BH3A 3VE1A 4D5UA 2F1TA 1QJ8A 3QRAA 4AKRB 4FESA 4GCSA 4RL9A 3TZGA 3VE2A 2KXPB 4FMSA 3VY9X 3LK42 5DL8A 5T5FA 2XMXA 2GE4A 2Y0KA 4AYEC 1ZHXA 1GFNA 3SYBA 2K0LA 2X27X 5DL5A 1GFOA 3DA4A 1PHOA 1OPFA 4KRAA 3G7GA 4D65A 1HXXA 4E1TA 2FGRA 3AA6B 3AAAB 4LSFA 5AFUL 3HOEA 4GCPA 3PORA 2N2MA 3GP6A 1P4TA 3VZTX 4AZLA 3T20A 3KVDD 4O3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XE5 A;  3POX A;  2ODJ A;  3FYX A;  3A2S X;  4FOZ A;  2ZLD A;  3VY8 X;  1PRN A;  3WI4 A;  3SY9 A;  3VZU X;  2O4V A;  4LSE A;  3T24 A;  4RJW A;  3POQ A;  3SZD A;  5FVN A;  2Y0L A;  3UU2 A;  4BUM X;  4FSP A;  3VZW X;  4LSH A;  3SY7 A;  2K4T A;  5PRN A;  3HW9 A;  3HWB A;  5JDP A;  2ZFG A;  3PRN A;  2J1N A;  3NSG A;  2POR A;  2XG6 A;  3JTY A;  3O0E A;  2Y2X A;  4FSO A;  5DL7 A;  2XE1 A;  1HXT A;  3EMN X;  3UPG A;  3POU A;  4AUI A;  1OSM A;  4KR4 A;  3SYS A;  3SZV A;  4D64 A;  1E54 A;  4FRT A;  1H6S 1;  4FRX A;  1BT9 A;  4RJX A;  2J4U P;  2FGQ X;  1GFQ A;  8PRN A;  1HXU A;  2Y0H A;  3K19 A;  3T0S A;  2XE2 A;  4LSI A;  1GFM A;  4JFB A;  7PRN A;  1GFP A;  2XE3 A;  4KR8 A;  4C69 X;  2PRN A;  2OMF A;  4FT6 A;  1MPF A;  2QTK A;  5DL6 A;  6PRN A;  4GCQ A;  3WI5 A;  1BH3 A;  4D5U A;  4GCS A;  4FMS A;  3VY9 X;  5DL8 A;  2Y0K A;  1GFN A;  3SYB A;  5DL5 A;  1GFO A;  1PHO A;  1OPF A;  4KRA A;  4D65 A;  1HXX A;  2FGR A;  4LSF A;  4GCP A;  3POR A;  3VZT X;  3T20 A; 
#chains in the Genus database with same CATH topology
 2XE5 A;  3PGU A;  3POX A;  2ODJ A;  2R4O A;  2M07 A;  4G75 A;  3FYX A;  3A2S X;  4FOZ A;  4C4V B;  2ZLD A;  4N75 A;  4Z3T A;  3VY8 X;  1PRN A;  3UAQ A;  3SY9 A;  5TIS O;  2O4V A;  1IZN B;  3VZU X;  4LSE A;  3T24 A;  3AAE A;  3AA7 B;  4C00 A;  3A0H O;  2KZ7 B;  4RJW A;  3POQ A;  5KAF O;  3SZD A;  5FVN A;  2Y0L A;  2R4N A;  1T1L A;  3AA1 B;  4FZM A;  3UU2 A;  2F1V A;  4BUM X;  4AYN A;  4FSP A;  2R4P A;  3VZW X;  4LSH A;  2F1C X;  4QQ1 A;  1Q9F A;  5H2F O;  2MNH A;  3LK3 A;  2R4L A;  3SY7 A;  2K4T A;  3LK2 B;  3DWO X;  4FUV A;  3V8U A;  5PRN A;  2JQY A;  3HW9 A;  4B61 A;  4PJ0 O;  3HWB A;  5JDP A;  2ZFG A;  3PRN A;  2J1N A;  2JMM A;  5B66 O;  3NSG A;  2ERV A;  1T16 A;  4GHB A;  2POR A;  4AKR A;  3WU2 O;  2XG6 A;  2LHF A;  1BXW A;  2KXP A;  3BRY A;  3KZI O;  4AYD C;  4PR7 A;  4K3C A;  2W80 C;  3JTY A;  3AAA A;  3O0E A;  5G39 A;  2Y2X A;  3AA0 B;  4FSO A;  1QJP A;  4UB8 O;  2KC0 A;  5DL7 A;  4O3W A;  2M06 A;  4U9C A;  5EE2 A;  2XE1 A;  2R88 A;  4O4X A;  1HXT A;  2Y7S A;  3EMN X;  4O3Y A;  3UPG A;  4RLC A;  3A0B O;  2YPV A;  4RLB A;  5ADX L;  3POU A;  3AA6 A;  5KAI O;  4AUI A;  1OSM A;  1ZHW A;  3BRZ A;  4FZL A;  4KR4 A;  2R89 A;  1THQ A;  1ZHY A;  2KDY A;  4N59 A;  5GV0 A;  2X9K A;  4AKM A;  3SYS A;  3SZV A;  4D64 A;  1E54 A;  1MM4 A;  3PGR A;  3AA7 A;  1MM5 A;  3DA3 A;  2MHL A;  1H6S 1;  2N2L A;  1BT9 A;  4FRT A;  4FRX A;  4O3Z A;  4RJX A;  2J4U P;  2FGQ X;  1Q9G A;  2W81 C;  3AA1 A;  3QRC A;  4FQE A;  1GFQ A;  4N58 A;  5D5D A;  4G76 A;  5G26 A;  2IWV A;  4IL6 O;  8PRN A;  4JCH A;  3LK2 A;  1HXU A;  3RBH A;  2Y0H A;  3K19 A;  3T0S A;  2XE2 A;  2XTQ A;  1ZHT A;  3PQS A;  4O4U A;  2YNK A;  4UB6 O;  5AFU K;  2LFU A;  4LSI A;  1GFM A;  5GTI O;  4C4V A;  4F4B A;  3PGS A;  3DZM A;  4JFB A;  4AFK A;  3LK3 B;  7PRN A;  3DWN A;  4XNK A;  3AAE B;  1YS5 A;  1ZHZ A;  3C5O A;  3NJT A;  1QJ9 A;  4CTD A;  4GF4 A;  1GFP A;  1ORM A;  2XE3 A;  3PQU A;  4K3B A;  2WJR A;  4KR8 A;  5G3A A;  5E79 O;  4C69 X;  1G90 A;  2PRN A;  3HOL A;  2OMF A;  4AYM C;  2XTR A;  4N74 A;  4FT6 A;  4O49 A;  4AYI D;  1IZN A;  1MPF A;  3LK4 1;  4XNL A;  2QTK A;  2WJQ A;  4E1S A;  5ADX K;  5IYU A;  2KZ7 A;  5DL6 A;  6PRN A;  4GCQ A;  4PUX A;  2AXT O;  4FZN A;  3AA0 A;  3WI5 A;  1BH3 A;  3VE1 A;  4D5U A;  2F1T A;  1QJ8 A;  3QRA A;  4AKR B;  4FES A;  4GCS A;  4RL9 A;  3TZG A;  3VE2 A;  2KXP B;  3PF1 A;  4FMS A;  3BS0 A;  3VY9 X;  3LK4 2;  5DL8 A;  5T5F A;  2XMX A;  2GE4 A;  2Y0K A;  4AYE C;  1ZHX A;  1GFN A;  3SYB A;  3WI4 A;  5GTH O;  2K0L A;  2IWW A;  2X27 X;  5DL5 A;  1GFO A;  3DA4 A;  1PHO A;  1OPF A;  4KRA A;  3G7G A;  2R8A A;  5G38 A;  4D65 A;  1HXX A;  1S5L O;  4E1T A;  3JCU O;  2FGR A;  3AA6 B;  3AAA B;  4LSF A;  5AFU L;  3HOE A;  5B5E O;  4GCP A;  3POR A;  2N2M A;  3GP6 A;  1P4T A;  3VZT X;  4AZL A;  3T20 A;  3KVD D;  2WVP A;  4O3X B; 
#chains in the Genus database with same CATH homology
 2XE5 A;  3POX A;  2ODJ A;  2M07 A;  4G75 A;  3FYX A;  3A2S X;  4FOZ A;  2ZLD A;  4Z3T A;  3VY8 X;  1PRN A;  3UAQ A;  3SY9 A;  3VZU X;  2O4V A;  1IZN B;  3WI4 A;  4LSE A;  3T24 A;  3AAE A;  3AA7 B;  2KZ7 B;  4RJW A;  3POQ A;  3SZD A;  5FVN A;  2Y0L A;  3UU2 A;  3AA1 B;  4FZM A;  4BUM X;  2F1V A;  4AYN A;  4FSP A;  3VZW X;  4LSH A;  4QQ1 A;  1Q9F A;  2MNH A;  3LK3 A;  3SY7 A;  2K4T A;  3LK2 B;  4FUV A;  3V8U A;  5PRN A;  3HW9 A;  4B61 A;  3HWB A;  5JDP A;  2ZFG A;  3PRN A;  2J1N A;  2JMM A;  3NSG A;  2ERV A;  4GHB A;  2POR A;  4AKR A;  2XG6 A;  2LHF A;  1BXW A;  2KXP A;  4AYD C;  2W80 C;  3JTY A;  3AAA A;  3O0E A;  2Y2X A;  3AA0 B;  4FSO A;  1QJP A;  2KC0 A;  5DL7 A;  4O3W A;  2M06 A;  4U9C A;  5EE2 A;  2XE1 A;  4O4X A;  1HXT A;  2Y7S A;  3EMN X;  4O3Y A;  3UPG A;  4RLC A;  2YPV A;  4RLB A;  5ADX L;  3POU A;  3AA6 A;  4AUI A;  1OSM A;  1ZHW A;  4FZL A;  4KR4 A;  1THQ A;  1ZHY A;  2KDY A;  4N59 A;  5GV0 A;  4AKM A;  3SYS A;  3SZV A;  4D64 A;  1E54 A;  1MM4 A;  3AA7 A;  1MM5 A;  3DA3 A;  2MHL A;  1H6S 1;  2N2L A;  1BT9 A;  4FRT A;  4FRX A;  4O3Z A;  4RJX A;  2J4U P;  2FGQ X;  1Q9G A;  2W81 C;  3AA1 A;  3QRC A;  4N58 A;  1GFQ A;  5D5D A;  4G76 A;  5G26 A;  8PRN A;  4JCH A;  3LK2 A;  1HXU A;  3RBH A;  2Y0H A;  3K19 A;  3T0S A;  2XE2 A;  2XTQ A;  1ZHT A;  3PQS A;  4O4U A;  2YNK A;  5AFU K;  2LFU A;  4LSI A;  1GFM A;  4F4B A;  4JFB A;  4AFK A;  3LK3 B;  7PRN A;  4XNK A;  3AAE B;  1YS5 A;  1ZHZ A;  3C5O A;  1QJ9 A;  4GF4 A;  1GFP A;  1ORM A;  2XE3 A;  3PQU A;  4KR8 A;  4C69 X;  1G90 A;  2PRN A;  3HOL A;  2OMF A;  4AYM C;  2XTR A;  4FT6 A;  4O49 A;  4AYI D;  1IZN A;  1MPF A;  3LK4 1;  4XNL A;  2QTK A;  4E1S A;  5ADX K;  5IYU A;  2KZ7 A;  5DL6 A;  6PRN A;  4GCQ A;  4PUX A;  4FZN A;  3WI5 A;  3AA0 A;  1BH3 A;  3VE1 A;  4D5U A;  2F1T A;  1QJ8 A;  3QRA A;  4AKR B;  4FES A;  4GCS A;  4RL9 A;  3TZG A;  3VE2 A;  2KXP B;  4FMS A;  3VY9 X;  3LK4 2;  5DL8 A;  5T5F A;  2XMX A;  2GE4 A;  2Y0K A;  4AYE C;  1ZHX A;  1GFN A;  3SYB A;  2K0L A;  2X27 X;  5DL5 A;  1GFO A;  3DA4 A;  1PHO A;  1OPF A;  4KRA A;  3G7G A;  4D65 A;  1HXX A;  4E1T A;  2FGR A;  3AA6 B;  3AAA B;  4LSF A;  5AFU L;  3HOE A;  4GCP A;  3POR A;  2N2M A;  3GP6 A;  1P4T A;  3VZT X;  4AZL A;  3T20 A;  3KVD D;  4O3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...