3PSHA

Classification of a haemophilus influenzae abc transporter hi1470/71 through its cognate molybdate periplasmic binding protein mola (mola bound to molybdate)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
326
Chain Sequence
DRIITDQLDRKVTIPDHINRAVVLQHQTLNIAVQLDATKQIVGVLSNWKKQLGKNYVRLAPELENMAMPGDLNSVNIESLLALKPDVVFVTNYAPSEMIKQISDVNIPVVAISLRTGEVGEKGKLNPTLTDEDKAYNDGLKQGIELIAEVFEKKQQGDELVKAAFANRKLLADRLGDVSADKRVRTYMANPDLGTYGSGKYTGLMMEHAGAYNVAAATIKGFKQVSLENVLEWNPAVILVQDRYPDVVPQILNDQGWANIQALKDKKVFLMPEYAKAWGYPMPEALALGEVWLAKALYPQRFQDVDLDKMVNDYYQKFYRTSYKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Classification of a Haemophilus influenzae ABC Transporter HI1470/71 through Its Cognate Molybdate Periplasmic Binding Protein, MolA.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal transport
molecule keywords protein HI_1472
total genus 112
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3pshA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3pshA01
3TEFA 3EIWA 2PHZA 2MINA 4XPIA 2Q8PA 5JPDA 5M29A 5KOHA 4UTOA 3ZK7A 4OXRA 3AEQA 4FNAA 3NU1A 1K75A 2PS3A 5HX7A 5KOJA 3TNYA 1QH8A 5JG7A 1K0FA 1QGUA 2O1EA 4G07A 4UDOA 4HMOA 1M34A 3HH8A 4INOA 4HMPA 5HDQA 2XV1A 3AESA 3EIXA 2XH8A 3AEUA 4ND8B 4TKVB 4B8YA 1H1LA 4WNAA 5AFSA 4HMQA 3K1AB 3R5TA 4H0FA 2PS0A 1N4DA 4LS3A 5M2QA 3ZKAA 2PS9A 2YNMC 3AEUB 4ND8A 5JOQA 4DBLE 4NNOA 4TKUB 1FP4B 5KOJB 4GICA 2M6LA 3AETA 5GGYA 3TLKA 2WHYA 1MIOA 2OV1A 3U7QA 4OVKA 3AEKB 3ZK8A 5M34A 2AFHB 1ESZA 2YNMD 3AEKA 3BE5A 2AFHA 5BVHB 5B58T 4MX8A 1G21B 1M1NA 5JJ5A 2R79A 3G9QA 4TKUA 1G20A 3PSAA 3MINA 3R5SA 3UJPA 5I4KA 1N2CB 3MFQA 1KAHA 5CR9A 3ZK9A 1M1NB 2PRSA 4IRMA 3HJTA 1G21A 1EFDN 1N2CA 1TOAA 2XUZA 1L5HB 4G09A 3AERB 2Q8QA 4M7OA 5BVGB 2OSVA 2R7AA 1K7SN 2AFIB 3MWFA 3BE6A 3LHSA 4LJSA 2WI8A 2OV3A 2OGWA 4WNAB 3MD9A 5M3BA 4INPA 4UDNA 2M6KA 4HN9A 2AFIA 1KARA 4MLZA 5FLYA 3CX3A 3K1AA 2RG7A 1PSZA 1K2VN 1H1LB 1QGUB 4FILA 1QH8B 4WZAA 1QH1B 4WESB 3PSHA 5CX1A 1M34B 3AEQB 1FP4A 3GI1A 3ZTTA 4MO9A 2X4LA 2XQVA 4PAGA 1L5HA 4TKVA 3HXPA 4NNPA 4OXQA 4MDYA 3MWGA 2ETVA 2XY4A 1KAEA 1QH1A 4WESA 4CL2A 5GGXA 5CX1B 1N2ZA 4FKMA 1M1YB 4WZBB 3AESB 5BVHA 2XDQA 3MINB 5KHLB 4PM4A 4H59A 5KOHB 3PDIB 1G20B 3AETB 3LI2A 5BVGA 4WN9A 2MINB 3PDIA 1MIOB 4FI3F 4XPIB 3U7QB 3AERA 4WN9B 4WZAB 1N4AA 1M1YA 2QI9F 4WZBA 4K3VA 4N01A 1PQ4A 2XDQB 4BBPA 4UTPA 1XVLA
chains in the Genus database with same CATH superfamily
4PXAA 4GRDA 5UKDA 1PR2A 2ACKA 1DCFA 3PIIA 1MV5A 3PNLA 4NPHA 3IYLW 1T8TA 3FPJA 2GARA 1KQPA 2Q45A 1L5QA 2V0CA 3FIJA 1FXWA 4TMXA 4WHMA 1ZMBA 3NLLA 4LY6A 4ER3A 5KKCA 1TYZA 5TQJA 3AFOA 5K03A 3T4XA 2BIFA 4F97A 4N5MA 4MRMB 5EQDA 2R1VA 1VHDA 2QR5A 3B5IA 3B3QA 3OQVA 2R65A 4LQLA 3BJEA 3DDUA 3MQFA 3H75A 2VIIA 4Y8VA 4YMGA 1PGJA 3AZPA 4F4DA 3BMQA 3ZIAA 1YB7A 1ZVKA 4HVCA 4PYJA 4XWKA 2CE7A 3ZJ5A 5T8KC 1DKOA 4LNHA 3EBPA 4RLSA 4RADA 4LF6B 3HJGA 3BDIA 4GZ5A 3ZCQA 4PZCA 2DKOA 3U39A 4AJ1A 2JFHA 2NZVG 3AKZA 3KYCB 1YMUA 2QV7A 3I76A 4PSUA 3BA1A 4IDPA 4J0EA 5AWFC 4MUYA 2OV1A 4R7GA 1ZJJA 5EMNA 5GJCA 5BNIA 1T0JB 1P29A 4PHHA 5BT8A 1PG2A 4U7JA 2AFHA 4FWBA 2ZVQX 4KWEA 1CU1A 2DERA 121PA 1JXMA 2EG5A 2J0EA 2LTAA 3IDAA 3KQPA 2FZGA 3LBHA 2R6ZA 4R05A 2XGSA 3L9WA 5KTPA 5JWRA 3N0TA 5HS6A 4N6GA 7MHTA 1H9BA 1E2JA 1PFWA 3Q7EA 1QONA 1YHNA 3B82A 1HFJA 1QHXA 4R01A 2PRSA 3T5BA 4ABYA 3PHLA 1KERA 3NVMB 1MH9A 4NJOA 3IBTA 3ISJA 4KPYA 2GJ9A 4XR9A 5CT4A 1OI7A 3QE3A 4NFHA 1VMEA 5AW9A 2W6CX 3DM5A 4BAUA 1SA0A 5IAJA 1EK6A 5GONA 3T4PA 3A4MA 4CM6A 1K7SN 4UUQA 3JR7A 5EUMA 1GPWB 3TB4A 3PBKA 2Y71A 1AKUA 4DLPA 3H17A 3FR8A 3PUZA 1H5NA 2JLXA 3P9CA 4AY5A 5E4FA 2YC4C 2CLEB 1QR6A 5CB4A 3MXOA 2EFCB 1NVFA 2PH3A 3DP7A 5BR7A 4ND5A 2Y1CA 2OXTA 4FNOA 5AOCA 1P6QA 4B79A 4OKNA 3WO1A 2YFKA 1T2NA 3G2KA 2VBFA 2G9VA 3IOMA 4N8DA 2DB3A 2RIRA 2EKBA 3TXYA 1ID8A 1U3DA 1NX9A 1C50A 3WGUA 4PTLA 2VQEB 3M34A 1JIIA 2OGUA 4W5RA 4QUKA 4GBJA 4V2UA 1JFFB 3R09A 4WQMA 4B44A 1AMUA 3HXPA 1YTUA 1KZ9A 2PQ2A 1J9GA 3HVKA 1TPZA 4CUKA 4GLOA 3F6RA 3LQ4A 1QIMA 1WXQA 1BDJA 1F8UA 2BBOA 2ZCVA 1NM5C 1ISIA 1VGRA 4KQMA 2B1QA 3I72A 3RC1A 1ISPA 1U5BA 2VSOA 3OZUA 4IIVA 4CHTA 4KO1S 4NH4A 4RENA 3N7TA 3ZU4A 4JUDX 1M7BA 3HB5X 4BTEA 1V2HE 2C4WA 1NZDA 1OXTA 2ODBA 2OECA 4II7A 3LPDA 3V1YA 5FO1A 3GFQA 2B1IA 1P5HA 4U9IS 1WMAA 1ISGA 2VPPA 1WZEA 4IXWA 3QWIA 4ZT3A 1OGJA 1F2TB 1F2UB 2L69A 3D3NA 2VNHA 3P96A 5GIOE 1G2OA 4DMUB 5ITZA 3BREA 4C30A 3UUWA 5MN4A 3VR5A 4LVNA 4JLBA 2ZWVA 3SSNA 1LVGA 1KU6A 1W0JA 5T41A 4BX0A 3DOFA 4ZDIA 3AL3A 3CN9A 4ESHA 3CUUA 3ESQA 4MUHA 1ULSA 2VYVD 3WYNA 3WC4A 1OX4B 3LC1O 3DMYA 4TWRA 3HKDA 5KYTA 4OQDA 4KJZA 2W00A 4R2MA 1VLHA 3RRXA 1SCNE 4D92A 2MMGA 1E9AA 3B1VA 2MSWA 3WS7A 3GUUA 5KPDA 4JX9A 4D81A 4WNCA 2B8JA 1G98A 4JUAA 3AMVA 2I2BA 5C8YA 4AJIA 2XUIA 2K4MA 2VHXA 4M1SA 4QPJC 2GERA 1OWLA 2HBYA 3B8EA 1FDOA 3M9LA 4GOXA 2OE2A 4KXVA 1QRRA 2J7PD 2ANCA 2P5YA 3OUTA 4I8XA 3TRKA 3GNLA 1AQUA 5JS2A 1XTVA 2A0UA 4QBHA 2PT5A 4JITA 2CLFB 3FKSD 4EYKA 1ETUA 3PR1A 4AJ4A 2XUQA 1I5RA 4C5AA 3C6XA 2ATEA 3PNQA 4YAOA 1A0OA 2VNIA 3E3NA 3KVNA 2E5WA 4MMYB 5AKXA 3ZVKA 5DOVA 1EQ2A 1E3WB 3GGPA 1EK1A 2O3JA 2I8AA 5MN6A 3RU2A 3QUAA 1GAEO 1THMA 3P26A 1HZJA 4B6RA 5AI9A 4K05A 1SCKA 1CUDA 1TPYA 4B4KA 1GV1A 3QU5A 4V39A 4YQFA 2J9FB 3IPXA 1T4CB 3WKEA 1S2NA 3LQFA 2ZI4A 3JSAA 2O7SA 3RVDA 1GGEA 3ZHYA 4C88A 5KHOC 5DNAA 3UXEA 1E5VA 4ZXFA 4CM3A 3V4OA 5T8KA 1OFGA 3FUWA 5GM1A 4ARCA 2HBRA 2HGSA 3L04A 1U7PA 4KXMA 5E38A 1MHPA 3L6EA 4I2VA 4HLQB 3AVYA 1CEEA 4HWTA 4KR9A 2HJ9A 1W93A 2Z0MA 1U1GA 2YY6A 4GYJA 4OYHA 4XCXA 1BVHA 2QRKA 4S1VA 1EWKA 4MWBA 7AT1A 2A1TR 3S2UA 4OIMA 5ALKA 2ZB2A 3FRJA 3QKTA 3E2PA 5IUKC 2RGNA 1U2GC 3GVHA 1IOLA 1MAWA 1XCMA 3NM5A 1W0KD 2RH5A 3DMFA 3NX4A 3WIEA 4E70A 4PRZA 4BE7B 1J0CA 1JKJA 5TE9A 3HK2A 3KZCA 4IJKA 3TF5A 3RADC 4KX5A 2FZLA 4M99A 2C1XA 4JHLA 3DF9A 3TR5A 3EPHA 5KYWB 1NAIA 2ZTHA 4KBFA 1VPEA 1DAFA 1Z2PX 2HCRA 2X1MA 2X7JA 3ICPA 2H31A 1X9HA 1G64A 3C3XA 4NBWA 4Q1CA 5FEUA 3EWIA 3BTSA 3O8QA 5C5CA 1YQQA 4JBWA 4I19A 1SPBS 2AVDA 1XHFA 2PEZA 1G1MA 1NMSA 1KDTA 2JASA 2QD5A 2FA9A 1T3GA 3GNTA 3NTVA 4UPDA 3QU2A 5JNWA 2FP4B 3WJ2A 4AF7A 1NSTA 3QM1A 4OLFA 3C1AA 2NSHA 3B6ZA 4J3JA 2R8EA 5CNMA 3V8MA 3FSRA 1YVUA 2PUFA 4D26A 1PV4A 4C14A 3JVUA 4MW1A 3F5DA 5KX5B 4YJFA 5EUBA 1Z4QA 4HWRA 5JCJA 4A26A 3QOFA 2WTXA 1X13A 2A9OA 3GP5A 3S5UA 3SIWA 4JLUA 1RKQA 3LBAA 4WBNA 3U9LA 3GARA 4YQEA 4MICA 4TTIA 4AI6A 1NVBA 3FOEC 2OHOA 3HVUA 5FWYA 2OAP1 1NSFA 2IPNA 2I1VB 1GG2A 5ESDA 4GKKB 5KOJA 1Z18A 1E98A 1LPBB 2Y4OA 1BE6A 3I58A 2Q21A 2YWBA 3G2NA 1CUWA 2AQKA 3EGWA 4NBUA 1ZJZA 2FETA 3LVQE 4O4LF 1OTXA 3AIMA 2PGXA 3KEQA 4IYRA 3TIVA 4GSLA 3ZDXB 4R9NA 3TINA 1A7JA 1J0XO 1XT6A 3DYVA 3H16A 3I2FA 2D1SA 4HXYA 4HLDA 4TWBA 1NQUA 3IAM1 3EXFB 3CPJB 3AXTA 5A7GA 4MULA 1Y8RA 1E2DA 3PUKA 4JQCA 5JSUA 1P4SA 3TAUA 1TAGA 2DFNA 2GPYA 1RAEA 2IDJA 3A6LA 3KOOA 3QTLA 3A2NA 1CETA 3EAQA 4EKDA 3H5LA 5A4DA 1I80A 2I80A 1Z8DA 3IHWA 4HYTA 3UENA 4EFMA 1QF9A 2WF7A 1QQAA 2QMYA 1FP4B 4Q4LA 2JH3A 4X0EA 2FPXA 1B7GO 2IU6A 2BR5A 1G8AA 1MIOA 1L5YA 1H2XA 1L4MA 2CUZA 3E1GA 5DGHA 3I5YA 1WNTA 5JNLA 5F3WB 3EVDA 4LXXA 4D9MA 1KORA 1IU9A 1WF3A 2FJUA 2WYOA 4JEHA 3FR7A 5BYJA 4BLUA 2C7PA 4ZCLA 1IIRA 3SKVA 4CLOA 3JD3A 1NNSA 2JFFA 4FIZA 3ZV5A 4AAYA 5DM1A 3ED5A 1M73E 1F14A 1QV7A 1W1WA 4LMAA 4U02A 2Q41A 4PCVA 4ZFNA 1IIBA 3E3LA 4H1HA 5G41A 3LX6A 1T1EA 3UFXA 3F9CA 2IW1A 3K4PA 2SBTA 2C07A 2CL0X 4F4IA 1IZ7A 1N2SA 3P0EA 1U0EA 4E5DA 2H11A 1DIGA 3UKOA 2HNBA 2RGAA 2VYFA 3UW3A 4QTUB 1Y9EA 2OAGA 1HE4A 1C4OA 2YOGA 1YS9A 1Z8FA 3AWDA 5LQRA 3CC8A 3WLMA 1TCAA 2R11A 4CKEB 5KJCA 2PR7A 2ZIWB 1IOZA 3UUFA 1RMYA 2GDZA 5HKOA 5AXBA 2W2LA 2ZR0A 3WB2A 1GSOA 1W88B 3KQVA 4H4DA 2EG9A 4IIDA 4RESA 4YCJA 3NIDB 3H86A 5H59A 4XB1A 4P0QB 4Q4DA 3LPCA 3TIIA 2PRZA 4DUZB 3NH9A 4NU0A 2PE5A 5GOZA 3TLEA 4ZHQF 4KQHA 3HEBA 3QLEA 1PEYA 1UPBA 2N75A 3PB3A 2VDMB 1OBHA 5LP1A 1K4MA 1SHLA 1SVLA 2WTEA 4G4SP 2VVTA 1OAOA 1T1SA 5A4JA 4YIHA 2CXPA 4GW3A 4KVFA 3RNOA 4NNPA 3D3KA 4BO1A 5AICA 2N1MA 1R27A 3D1VA 5IK2D 3PCXA 2ZRBA 1S8NA 1KEZA 2FWIA 3F8TA 2EEZA 3NYQA 4C6TA 3B51X 1JDNA 2IODA 3VHXB 5AW7A 5EJ9A 2VH1A 1CJCA 4AY4A 4UUOA 3SXUB 3SVLA 5D2CA 1AB6A 3QE0A 1ZM3A 2YW2A 2HU5A 2ZP1A 4RKWA 4E7OA 2D7DA 4JODA 2MTBA 4PIPA 5KCZA 3BXHA 9LDTA 2CFCA 2HZBA 3R7BA 1U5BB 1L8OA 3HXKA 3L84A 2B4RO 1NIJA 1JSXA 4H77A 2Q6TA 1JEYA 1H94A 5KOHA 2WWRA 2F2TA 3F4BA 1B73A 2P9JA 1E2GA 4MCIA 1FUUA 2MIIA 4NYMR 3CNBA 1S3SA 4TMKA 4MVXA 4X9XA 3S1AA 1NXSA 5GADl 1PHPA 2XNDD 5J63A 3WOHA 2YJGA 3L2OB 4YJDA 2BGNA 1ZIDA 3ONVA 1BCSB 3G0OA 3X2SA 4ZV4A 4GMDA 2CJWA 3U3JA 3Q6MA 4BKMA 2Y9MB 1PR1A 3ZE2B 2XA9A 4CKBB 4XCVA 1HYQA 1AMOA 4DN6A 2IHTA 4Z3KA 5DCYA 5EPUA 1GKKA 1H2ZA 1WQ1R 4KOEC 2VSXA 4C0HA 4DV3B 3N2NA 3GPCA 5HMMA 3NUZA 1XRJA 1JNYA 1Z0FA 3KAPA 1DO0A 5CX4A 1G8PA 3ABQB 3H8WA 1BNCA 1RE0A 4YCAA 4WA7A 4MVJA 3WADA 4A4DA 2C7QA 3RYFB 1IZ9A 1PJQA 1PKXA 4PLFA 3UK0A 4RWEA 3KVRA 1RMQA 1KMMA 1M5UA 3CVJA 5CVUA 3WK6A 2MYNA 4X1IA 5A9TA 3WMGA 5LP6F 4EYOA 1F8GA 2ZI7A 4HN2A 3R3ZA 3GL9A 4LW8A 1HL7A 4L8GA 5E4JA 5SYAA 1GO2A 1ADBA 1UDRA 2GRUA 3D6HA 5AI0A 4E5YA 4G0WA 3AVVA 4DM4A 2YXBA 4MVJI 2NO4A 2BV3A 1MQAA 1M0WA 4IZOA 1NNLA 1L5FA 2EZ9A 4JQOA 4R1QA 5TV2A 3SG0A 3GFVA 1DAKA 2GAOA 3HN6A 2K2QB 1GPUA 4G36A 4GBGA 4IJ5A 4J43A 4EB6B 5BWBA 1ZGZA 4TKUA 4COKA 4DNPA 1HBJA 3FNBA 5L6MB 2PGJA 3M6VA 3KBBA 4MWDA 5KCMA 1L7OA 3N5CA 4A15A 2VKQA 3O3CA 3L05A 2BE7A 4FYPA 2FYTA 1AZSC 5EIBC 2PA3A 2R6HA 1SUSA 5DISB 3GBSA 4BWYA 3QJYA 2BGKA 1GSHA 3NV9A 5ITVA 3A9SA 1E1CB 3FG9A 3E53A 4RHUA 2F64A 1D2HA 1GRNA 3DPSA 2H9IA 1SKAA 3VPSA 1DHTA 3ZHSA 1GRVA 2GBFA 4UM5A 1OX4A 1BD3A 1K8XB 1R16A 6NULA 3TX2A 1HORA 3IESA 1ZBQA 1S2LA 2DH6A 2O7NA 5G3YA 3C3YA 1VSUA 3H13A 1R3UA 2KX7A 4R2LA 4ZVTA 3FGNA 1ZLXA 4L5AA 1JLLB 4MV4A 5G0VA 3GOHA 3BE6A 2TMGA 3V2GA 3EIOA 2P4UA 5LXTA 2V0GA 3WO0A 1PQPA 3DV2A 3FKJA 1I2MA 4HG2A 4N03A 4OSEA 2HSEA 4JUCA 1TYDE 1XZCA 1UWLA 2AYZA 2OV2A 1T8UA 1QPGA 3NKFA 3PVSA 4FMDB 4Q4AA 1T1RA 2NU9B 1O08A 4CPDA 3LL4A 3SOPA 4L8LA 4MWZA 4YCCA 4OI1A 3CZ9A 3LK6A 4EVSA 4RD6A 3NBZC 3NGLA 4AP6A 5IU6A 2NM0A 4FLFA 1UKEA 2P4QA 1E60A 3K6KA 4IMRA 2DF8A 2JKVA 1SD2A 1Z6PA 1BX1A 2VCHA 4ZHSA 3DZDA 4R5HA 1JJAA 3E15A 4C2UA 2W2VA 1ZFNA 4L8FA 1ODLA 1X80B 1PAUA 2QRLA 3HKBB 3VBEA 1OR8A 2NO7A 2PLAA 3KHSA 1C1DB 4FLEA 3PC7A 4XOUA 4CL2A 3MWGA 3FFBA 4WBNF 1UDWA 5IM4A 1DX9A 4L9RA 4R2JA 3EC7A 1N2ZA 1Z0ZA 2XAAA 4IWXA 1M67A 3NMUF 1XWWA 1N7JA 1M5RA 4GS5A 1XALA 2ZBDA 2C2BA 4HSGA 3NDBB 5FA8A 1D5CA 3UZUA 3ZH9B 5BSWA 4QICA 4RKEA 1Y3BE 3R6WA 4EG1A 4ENQA 5K0CA 1DG3A 4RNDB 3WICA 1RC1A 3A6JA 4UMEA 4X8OA 4A36A 4BMYA 5JAUA 1DUSA 3REFA 1U8AA 4ALLA 1RT9A 3ZCTA 1JNXX 1QE3A 1MA3A 4RDHA 3VX3A 5I01A 5JCJD 1C0EA 3CEJA 5TQ2A 4ARZA 2IHNA 2OMKA 2ZREA 4UHCA 4AL4A 6REQB 3Q8WA 2H92A 2HUPA 2P2GA 4WY2A 4AWAA 5THXA 5I9BA 1IONA 1TMGE 2RAUA 4RF3A 1JIXA 3VI3B 5JISA 5KWSA 1THGA 2AWOA 1NHWA 3JWHA 2W8BA 4WL0A 3ZI0A 3ZLJA 3QLVA 1Y82A 1UJBA 4ZMSA 2M6RA 3LC0A 2AFIE 2J0UA 1ADJA 5LMZA 5IBRA 3U56A 1JA9A 1KJWA 4ARIA 4M1EA 3VDXA 3H6GA 1TLLA 1VMIA 3KYDB 4S05A 3UJNA 4LYAA 4XYMA 4CV0A 1KI7A 1EB8A 4BQFA 1U6KA 1LWOA 2B20A 2BKXA 3WGLA 1FS4A 1N6RA 3BVPA 4RK6A 1LZLA 1Q14A 2WNIA 3FH0A 1T26A 5DO9A 1GAWA 2PTGA 3QVKA 4P92A 1YA4A 3RR2A 2X7HA 1A4XA 2R8PA 3A04A 1D2NA 3X44A 3ZLBA 1N5MA 1C3XA 5E7JA 1OYVA 4Q34A 3GB9A 4BOYA 2P8JA 2XNCA 4RQBA 5JW6A 3R1IA 3QX3A 4MGKR 3GDFA 1YOBA 4IFEA 2DQZA 1ZW1A 4NCIA 3IDQA 3JARB 3VC2A 1XTZA 1WPGA 1UDAA 2YIMA 4WUVA 5KTKA 4YBRA 3H4VA 1Q0QA 5CLLA 4X7MA 2EZ4A 2C2OA 3DOEA 3MWDA 4UAUA 1M2GA 3OEWA 1INLA 1JHAA 5FWNA 1IJBA 3Q7RA 4RH0A 1FS5A 3TQFA 5EIOA 2CNWA 1XZGA 4KQ2A 1OIWA 1ZUD1 2XMGA 2M6SA 5IRCD 1PT7A 1ORVA 3VR4D 4RTRA 3G5AA 1VG0B 2CLMB 3HKEA 4ZMRA 1FF9A 1R9NA 2BCGY 4TOIA 1BOFA 1QPBA 3W79A 3CLKA 3I05A 4MWEA 5JT1A 2QTAA 2I7XA 1NI4A 2EBHX 1EJ2A 2OV3A 3GHHA 5A3JA 2WOOA 1XLWA 1QQBA 4AJ9A 3CB4A 1SU4A 5A3VA 3P2JA 4F5EA 1XYYA 2JGDA 4ZZ2A 3TR0A 3BCUA 2QLBA 2VATA 1KJZA 4Q19A 4S1PA 3O82A 5FUVA 4B6EA 4DTIA 2GBCA 4IY1A 1P0QA 3NIBA 5FYDA 2X0NA 2HSDA 3PKZA 3S28A 1W0JD 3UJAA 1SQ5A 3OPMA 2ZIZA 1FMTA 3MRXA 3PSHA 4C0QC 5HVNA 2LDBA 1GNVA 4YMTA 4FE7A 3GVCA 4K2AA 2I7DA 5C7LO 1XF1A 1IAVA 1M10A 2QD1A 4DV7B 4HDQB 4LJLA 4JP3A 4Y0VA 2G0AA 1X1EA 3GQVA 4FKMA 3GCDA 5JROA 4IRUB 4N40A 5DRTA 5F64A 3CVUA 3WLSA 4FYIA 4JB2A 5TMBA 3ROFA 5L51A 4HRYA 3ZCSA 3UFXB 3TOVA 2ZVJA 4DMKA 2FWJA 3K5IA 3OM1A 1WUIS 4XASA 2F55A 3LW7A 3T3IA 3DE0X 3OTWA 2CVQA 4XUEA 3GROA 1UWKA 1OKKA 221PA 2WZBA 4KQCA 4II3A 1ZOLA 3OESA 4MV8A 2OD9A 4X8HA 4DSZA 2D1QA 5AK0A 2XODA 2HAEA 2HTFA 4XAQA 5JDIC 4QBFA 1U0NA 1SUBA 2A35A 4HFNA 2PWYA 1E7QA 1NYRA 1SIUA 3PHJA 4MYUA 2ZQZA 4HTAA 2ZITA 3GRKA 4I3FA 4B09A 1YA6A 2H1LA 1NVWQ 2IHYA 3VVCA 4BZXA 5HTKA 3LFUA 1V1JA 4MQMA 5F7JA 1I8TA 1H6AA 1SUDA 2OGZA 4IDCA 3D59A 4EG7A 3NVKI 2B2XA 1E9EA 1EWYA 5C81A 5J5VA 5IUNC 1G18A 1UZAA 2QQGA 3FRIA 4HRVA 3ECAA 3F8SA 2GA9A 2QG9A 2Z30A 3AFIA 3LT5A 4CE6A 4EO9A 5L95A 2H29A 1B23P 4BQRA 3VAZA 1T8RA 4ND6A 1O57A 3LLMA 5C4MA 1ZP6A 3VU0A 4ZA2A 3A6DA 2Y1GA 2BGGA 3JQCA 3OM8A 3V1KA 1W5FA 4QARA 3VHXA 4Q7QA 3OZDA 3V2IA 4TV9F 4J4HA 4BMDA 1ESZA 2OXEA 3DV0A 4E13A 1KI1A 5BQ5A 3UJ9A 2YXNA 3UJ8A 1L4UA 2VSYA 1KTIA 1YR3A 4G67A 4JYZA 3OZGA 1YOVA 1QGOA 2H1FA 3E5RA 1GAQA 4P6VF 1YQ9A 4DCOA 1N0IA 2HWYA 2R3SA 4J90A 4DDTA 1PJ4A 2EJCA 1T35A 4XOIA 3GO4A 4E46A 2QN2A 4H16A 3SY8A 1SUEA 1Q20A 3QXHA 2ZRJA 3E35A 3TL6A 4DNXA 3GVIA 1OV4A 3A6PC 4LZOA 3C6KA 4HNVA 3MOIA 4XXHA 1ND6A 4K9LA 4RTLA 4N41A 4CXMA 1M2NA 4A3SA 1I7QB 4YP7A 3WXMA 1JEOA 2O59A 1IY1A 1VPWA 4RPIA 3WYGA 3EZNA 5C52B 3OTGA 2WYUA 4GI2A 3SYLA 3CT4A 1TIPA 4FDUA 4OM7A 3T95A 5GVSA 2Q5QA 5CFNA 1TQDA 2H3EA 3HJBA 4YP1A 1J70A 3SHVA 1CLUA 3VPCA 1S2OA 3FOCA 4BMCA 2O9JA 5CA1B 1Z17A 1X7XA 1PJBA 1RM0A 4MI9A 4IHJB 1T0HB 1OH7A 1ONPA 3QXSA 4JYBA 4G9GA 4OG2A 4EEZA 1JN0A 4JCOA 4U5XA 1CKEA 1Z12A 4PO1A 4B83A 3D43A 4WH0A 2BFBB 1LCIA 4M0EA 4P3KA 5A5DA 1NN3A 1QM5A 1TA9A 1T29A 2LWIA 4HEA6 1RIFA 3AUYA 3NFRA 4BCCA 4M21A 5HZHA 2ZSDA 1D7OA 3WNZA 3PVZA 4ZC8A 5ELLA 1LPMA 3NHBA 4MGZR 2EW1A 1JR3E 1KS2A 3IQEA 3LQ2A 2ID9A 1KI8A 5IARA 1NNI1 3G2HA 1C14A 3L02A 4BVBA 1KAMA 2P1RA 3M70A 3ZIUA 3N2EA 4M0DA 3OD5A 2HJVA 1IHOA 3DMTC 3B36A 5LNK6 2RBKA 5CVVA 2ZBUA 5CP8A 1R5OA 2GDJA 5TSDA 3WRVA 4M9UA 2PZLA 5HCUA 1IMJA 1RHJA 5G1NA 1PWHA 4FQ5A 4F1KA 2VSQA 3I9OA 2JK0A 4DR2B 1DHRA 2DFDA 3VDNB 2EQBA 2BP7A 3R77A 4MP3A 4J3FA 2UYYA 1VE1A 1UZUA 1K6XA 1M66A 1K5DA 4IP0A 4N5LA 1UFOA 3CF6R 1ARZA 2X0FA 4K6HA 5LZ2A 2HL6A 4TMWA 3TNDA 2B30A 3EEYA 4MAFA 1S2GA 3M5DA 3UOWA 3IA7A 4E3ZA 2Y1OA 4G2NA 3S2FA 3K9LA 4KOAA 3TW6A 4RPGA 2WIBA 3OCXA 3UEOA 1R6DA 2WKQA 2XB2A 2HX1A 1G3QA 2ZKLA 2ODEA 1U8UA 1Y7IA 2W6OA 2BFMA 2IX9A 1NJSA 1SUCA 2AC4A 4N82A 4A0QA 5L4LA 1HDZA 4R41A 3PF9A 1L3IA 3K9BA 2XMQA 2EL7A 4AMVA 3E58A 1X1SA 4QNNA 2GZHA 3MSXA 3O75A 5AFSA 3K6RA 2F3TA 9ATCA 3TAXA 4O0LA 4GOND 4Q1BA 4Z4GA 3KVYA 1FSZA 1T2VA 1NKVA 1RAGA 1TE2A 3IR7A 4TMVA 3OAAA 1B6GA 1YZGA 1J2JA 5DM4A 1I0LA 4RLQA 4Z99A 5J9FA 3ETHA 3HC7A 2ZYWX 5DM60 1GG8A 1IN8A 1Q3TA 1AQLA 2G6TA 2XKJE 2Z2ZA 1S9HA 3DOHA 4L73A 4W5HA 4QYIB 4AWXA 2WQ6A 1WBBA 3MLBA 2YWHA 2O8BB 2X9GA 4JX8A 4YC7A 2Q5FA 2GCPA 3KZMA 1FX0A 4OI2A 4LSWA 4CEHA 1Z2OX 3BYZA 1KSGA 4F3YA 2VP9A 2UXBB 3BIFA 2C7RA 4GR9A 2O8EA 2VXYA 3TECE 3LYUA 3TYXA 3ZU6A 1MOPA 4ZOAA 1JZQA 3TUJC 3LCRA 4B17A 2A78A 3EA5A 3JZFA 5JZBA 2PUEA 2WHPB 1DKPA 1QG2A 1X7ZB 4DR5B 1KY3A 1ZH8A 2EWVA 4AU1A 1OUMA 1YQWA 1I0IA 4P58A 3L7IA 1VMDA 1BVRA 2VJPA 4Y1GA 1UKVY 1N34B 4PW0A 5DIFA 1NAHA 1GG5A 5J23A 1PL6A 4LJRA 3CBGA 2WYWA 4OXYA 4J8PA 2IUUA 4X7RA 4DLKA 5EWMA 3CR7A 1EQAA 1F3LA 4RVDA 4MS1B 4YRRA 4ZJPA 1XZEA 3ZZMA 1B8VA 3EZYA 3FYHA 4FDMA 1JP7A 3HKEB 4E5MA 2CVHA 2GN1A 4O4IB 1ZK0A 4DAEA 1CBUA 4UNNA 1GAXA 1C3OB 3N76A 5I7AA 4MPDA 1K2VN 1ISFA 3ETJA 1U4NA 3D0QA 4IHQA 1NJ6A 3K94A 3VOTA 3I4FA 1RM5A 3MSCA 4AX4A 5DI3A 5BN3B 4F7WA 1P1RA 1QDEA 4NCNA 3LZCA 3DUFA 4JVNA 3PNVA 5LJIA 1MV8A 1PUIA 1NR7A 3IOBA 4PY2A 4DBLC 3GCWA 4CV2A 2R62A 3NBKA 3IP5A 3L7BA 1UOEA 1U04A 1S8OA 2NSDA 4I1YA 4JDPA 4JJEA 3ST7A 1W5BA 1JQJC 2A6PA 3RLFA 4DR4B 3KLNA 1JHQA 3EBLA 2OL4A 4UTNA 4F60A 5A0VA 4JLVA 2DR2A 2F1KA 1B14A 4WIAA 1JHPA 2DTEA 1MIOB 1DB3A 3WL8A 3EEOA 3W0LB 1TGVA 2C57A 1OROA 4X61A 4MTLA 5KNDA 3KQLA 4E09A 3BTOA 4GI3A 3H83A 5GM2A 4E5SA 2XXAA 2Q0QA 4GX0A 2WJAA 5B3JC 4L78A 4RTMA 1G63A 2JI7A 3K70D 1VCOA 3FTDA 4JP8A 5FNZA 3VYWA 2HU7A 3SZLA 1TKAA 1PZMA 2MMCA 4NG4A 3H9GA 5JWHA 1LLFA 1RRVA 2JIPA 3M6WA 3DAHA 3G0IA 4AJPA 4HX9A 3GJ8A 2VXBA 4DUPA 1QB7A 3EIEA 1DT5A 3VGPA 4PZZA 2FW7A 3JZIA 3PX3A 2RHDA 3OG9A 3A9VA 3QPWA 3S4YA 4CM8B 1K7CA 2WOJA 1PIWA 2ZE6A 4NMXB 4A8HA 1OLXA 1Y5RA 1I10A 3WSTA 2GZMA 1P2DA 1K08A 2QE6A 4N48A 1M2FA 5EN4A 4AXXA 1F9AA 3W5DA 3RS4A 1ZU4A 2HADA 1I01A 3QLJA 1WQ3A 3DKKA 4FMCF 2WDZA 3WAJA 2ZBVA 2ZU0C 2O20A 1J8QA 3H1FA 1CVRA 1G5RA 3G85A 1WVGA 2WAXA 1XOIA 1N75A 2BOVA 2QR3A 1FZQA 2Z9CA 5K3EA 1GL9B 2ZIXA 4L4ZA 1TJPB 3QKSA 1MW9X 2CKDA 3LXXA 3Q0EA 4EW6A 3LTNC 1FFSA 3THSA 4NHEA 1SM4A 1ZJ4A 3IALA 2P6NA 3HGTA 1H2FA 1RADA 2PBFA 2QTWB 3C4JA 3DE3X 1ZKDA 1ZIYA 1JPVA 2OO5A 2QJTA 3VC1A 5K45A 1NR5A 2GJSA 2Q5IA 1NF9A 1USVA 1QFYA 4MAAA 1RZVA 4OHMA 1YB1A 4C4OA 5A4KA 3E03A 3IEPA 1QHYA 1XVVA 2FEKA 1JIKA 2YVAA 5L3RA 4L07A 1UWVA 3ZCUA 1NW4A 2FEMA 3H11A 4PCLA 1U0HC 1GM5A 3S6JA 5EFZA 2O6LA 4A2PA 3TQCA 1ODFA 3HU1A 4KN9S 4Z53A 4PPQA 3NBXX 4O02B 5BUSA 5L7WA 4LOKA 3STUA 3PJEA 3N6XA 2X19A 4GF5A 5YASA 3NIFB 2XR1A 1NI4B 3M1AA 1Z2CA 2BM0A 2O07A 1GADO 1U2QA 3H2JA 1UDXA 1OJ7A 4FFNA 1RFGE 2ZTUA 2OC4A 5DM0A 2Y1KA 4AZSA 4QJ4A 5FUMA 5KYNA 4XFJA 1BSVA 2EWMA 3T35A 2UYCA 4Y2RA 1JG3A 1QNFA 3Q7QA 3QVTA 5HGXA 1QDLB 1RXEA 5IJZA 5JWOA 3P9QA 1T2DA 3AEQB 1OTHA 5ILGA 5BPHA 4OHBA 6PFKA 4NMHA 3GUYA 4EHFA 1PL7A 1A9ZA 1SEVA 1U1DA 1WZ2A 2E9SA 3EK2A 1QOQB 3AOEC 4XD2A 4RU1A 1EX6A 2H57A 3ADKA 3U7RA 1JHUA 1OFHA 4BKUA 1CRPA 4QELA 3K35A 2O5CA 1FRFS 4ALIA 2G88A 3HPRA 2I33A 3NNSA 4LXGA 3UMJA 2DE0X 5E6SA 5KBYA 4DIFA 4TN5A 3ETLA 3DEIA 4LN1A 4GR4A 2ZKIA 4WBSA 1ISMA 3O91A 2Y92A 3STHA 3LHKA 3DMGA 3NXKA 5H83A 2RAFA 2KJQA 2FOLA 3CUSA 5JY6A 3BKXA 4I3GA 2LZ0A 4CL8A 2PXCA 2O2JA 3GH1A 4TUYB 5CT6A 4B2LA 1MOSA 2JW5A 4YPFA 3BG5A 5F51A 2G9QA 1U9IA 5K05A 3C6BA 1ECLA 3DNMA 2JFGA 4H7FA 3PJDA 1P62B 1JKFA 5I7SA 4KIJA 3BZWA 5CCXA 3F74A 4IIFA 2LKCA 1QIFA 1RM4A 3PHCA 4EK9A 2VDWB 1GLNA 3L43A 1EGMB 1WTCA 3Q9UA 1BFUA 2D7JA 2X0IA 1EKXA 2O1WA 1ES9A 1B6TA 3IAS1 4DCTA 3HP1A 1K8QA 4G2TA 4MHSA 4UCXA 1QB8A 1V16B 2GFHA 4NYMQ 5CITA 4LRWA 5EIAA 5I7FA 1KOJA 1JEYB 3I2HA 1TB4A 3I9JA 5E2AA 5AW2A 2PYDA 5FPQA 5BORA 1A50B 3D6JA 2K87A 2DKFA 1YKFA 3MWYW 4UHBA 3HJFA 1Y63A 4CHGA 1KDVA 3OX4A 4FBMA 1V0JA 2ORED 4R71A 5BRNA 1Q1GA 3RSQA 2P90A 5EWJA 1E0DA 3KDAA 1UKBA 2HHJA 2WMDA 2QL7A 3CX8A 4B3SB 2VA9A 3MYRA 2JJ2A 3RBZA 4B32A 5AVSA 4JQSA 3SM9A 3EH1A 3H1EA 2PFSA 4GP7A 4X91A 1ZJYA 2ILTA 4IZ6A 4K40A 4Q4JA 3CHYA 4C5CA 3GC6A 4GL2A 2FSFA 2YV2A 4MRAA 1JSZA 1TD9A 2QRZA 4CF7A 1QLWA 1J56A 3P9SA 3CPHA 5C0OE 2I6GA 1TM1E 1P77A 1P0PA 3HJTA 4JOSA 4DQDA 1NV8A 2AKEA 3GMSA 1OTYA 3WLIA 5CLIA 3EPRA 2V6GA 3EMBA 3UCXA 3U0VA 5L40A 5HUQA 5BMVF 3JYQA 2W2OA 4YLEA 2W6MA 4IS2A 3NDJA 1N33B 1JG7A 3AP2A 4LHVA 4MUGA 1PUJA 1I6MA 3FLAA 2PUTA 3SE7A 4EYSA 1T8SA 3TSYA 2JAQA 1UQUA 1I2AA 4HDSB 3O4VA 4IIXA 1I24A 3PITA 5DT2A 5TT1A 1SBHA 3F71A 2R4UA 2YH2A 4IEEA 5HNKA 5JQGB 4QOHA 3QVUA 2CXHA 4RGBA 2RB5A 4TVKA 3UO8B 1PD0A 3PNYA 1O95A 5HIIA 1CDOA 2PMKA 5C3MA 3TKYA 1QANA 1IAQA 4PGAA 3GJ6A 3MWEA 5K3CA 1U2RA 4B48A 1V7PC 5DWQA 2C54A 5GV8A 1T36A 1ZUNA 3BXPA 2CEAA 3D8NA 1O96B 4I14A 1AX9A 1L5ZA 3E9DA 4GWKA 4J7AA 5LZ8A 4QJ3A 4GUDA 4LF8B 1JQ5A 1GWNA 4FK8A 1RZRD 5I7OA 3KJGA 4J0KA 2XF8A 1XTSA 3KJQA 4QXAA 2I62A 3LLVA 4EG4A 4HVTA 1BW9A 2ZVPX 4FCCA 4QDTA 3K9NA 1RXCA 4ZTUB 2XCIA 3VC3A 1QUFA 5AUQA 2C96A 4EATA 3AR2A 2LUOA 5FI3A 4I66A 3QUQA 4AJNA 1EVYA 2Q2QA 3AR8A 1V9LA 2FZWA 1PP4A 4AFNA 3WRXC 3MJTA 3FROA 5ILQA 5BSMA 2V45A 4R8RA 4E15A 4A0GA 3A14A 3C8ZA 3KALA 4BVHA 5FI1B 2CFSA 3B1KA 1K97A 4CM9D 3L7LA 3TDMA 1ZL0A 2JFQA 5DEIA 2GN9A 1A5AB 1V45E 4GOMD 5K3BA 2HRRA 3B6MA 3PK0A 5B37A 1SU8A 1B2RA 3CF0A 4D4JA 3WWCA 2CHGA 3KB1A 3RC8A 4MGEA 3K16A 5EZYB 2O8FA 3QITA 3RRNA 5FULA 1CE8B 1QO0D 2TMYA 4L6AA 1Y34E 4K5QA 1M0EA 3WLRA 1Z2EA 1UZNA 1XIVA 1MJFA 1OC2A 3TPCA 4B45A 1CHNA 1QYIA 3MS2A 3ZHRA 1R37A 2IYRA 1B42A 4HGYA 4FFBB 1L7AA 3FTPA 3GA7A 1OLOA 3CUTA 3F98A 5DMXA 4FZRA 5ICEA 3JQFA 3PDUA 4MP6A 4Y2UA 3GD7A 1OXKB 1N1GA 1MZVA 3AIOA 3ENKA 4BQSA 1T4CA 5DKFA 1HY3A 1H85A 4OYLA 1DKQA 5CDSA 1ICIA 3K8OE 1TQ4A 3AI1A 3HN7A 5KYYB 3VBCA 4P4NA 3WGTA 1YJXA 2VI5A 1M1YE 3WV5A 4A73A 1GV0A 1SXJC 4HFJA 2H1OA 1NW7A 4BBZA 4QUGA 2YFHA 5FF9A 3IRVA 3QBTA 1LVHA 2Y8EA 2P3SA 1O94C 3FNQA 4OVKA 3S2IA 2W8ZA 1AJEA 4JEUA 1YVEI 3STTA 3BOSA 3W8EA 3HG7A 4B31A 4Z9BA 4PG7A 5JS7A 1W46A 3T1VA 1EZZA 1CJVC 3HDHA 1FY2A 5K6TA 1YNSA 2BC9A 3TL2A 3KJIA 5DNWA 2BW0A 3BD7A 1AUXA 2X7XA 2H4XA 1DWUA 2Q3LA 3DAPA 4HS4A 4PNHA 4ZQFA 5JC8A 2VZLA 1SGWA 3V8QA 1E2UA 4JBYA 1G8KA 3JRNA 4HDNB 2DOKA 4HXFB 4N7BA 1UBTS 3Q6IA 5FADA 2WICA 2OO7A 3EG9A 3U4AA 3WJ1A 3ZNNA 3M6IA 1VXRA 3GFOA 4LMBA 4WGGA 1VJTA 1BX0A 1V2GA 2AN1A 2WFMA 4I6GA 1BGXT 4KC0A 1AGXA 5G1PA 2YFYA 2FNAA 3NHUA 1OLXB 3I6IA 1FCJA 3OJFA 4PRYA 1P3DA 4FN4A 4PLVA 5KO2A 1RU3A 3TTWA 2X8JB 4ZICA 4FT2A 2GZ2A 2SICE 1V11A 5AIAA 2QR2A 3JYHA 1E5DA 4OREX 1M2JA 4M38A 5JHHB 4KO4S 4MCHA 4RYDA 5F35A 1ST2A 2D4AA 4YRLA 4MR9B 4XB2A 3FMFA 4O4IA 4BV2A 2ID7A 5JBQA 1TO1E 3KPUA 3GPIA 3D7NA 1I4EB 1DEOA 3KP1A 3WHKA 4HUTA 2JFYA 3OPVA 2P2SA 3IT3A 4NC9A 2AOTA 3BJRA 1RP1A 4OGLA 4RTOA 4ABTA 3K8YA 1G6Q1 4OXIA 1DIBA 3C4QA 2HW8A 1L7RA 5AW4A 3NOQA 2PJRA 3DZ8A 4WLFA 2I3AA 3NIWA 1SKYB 1JIQA 1CY8A 2OFXA 1QZTA 1NVXQ 3U3KA 1M1YB 2IGTA 4Q16A 1CQIB 5DBIA 1MF7A 2WYIA 3UWMA 2E7ZA 3BMCB 3ZD6A 2HO4A 1W4ZA 3GBPA 3PICA 4WN9A 4BO9A 3ADPA 2VDQB 4DDKA 3H11B 1K5GA 4UBMA 3RVOA 2X5NA 3FLMA 1U9CA 1XMXA 2G70A 1CQIA 1CY0A 4JB3A 2YV3A 2A0XA 4QQKA 1XDDA 2WMOB 4F86A 1VJGA 1N6NA 1E6CA 3FVVA 2PFGA 2LCQA 4ZO7A 4EYQA 1NQVA 2YX1A 5C5IA 1SVUA 4ALMA 4PLPA 2WAMA 3A9WA 3MNFA 2FB9A 1I9CA 4W82A 1KRXA 2WHQA 6LDHA 4QXPA 3AZQA 2CW5A 1F60A 1NVMB 3REQA 2XYRA 3IJPA 1B8PA 5AXCA 2GVDC 3OQIA 5DGXA 4YYEA 2CHEA 5JFGA 4GPEA 3MA0A 3JVVA 3QRWA 3GLVA 5E9JA 3X1YA 3O6VA 5K3OA 1DRJA 3W90A 3KOUA 2BD0A 3MT8A 4ENRA 2RMKA 4Z3OA 4KDEA 2ZI6A 1FK8A 2H7YA 3K5PA 2IS6A 2J6CA 3QHAA 4NBRA 4DB2A 3OEEA 2AYXA 2VP2A 1GDHA 3HO1A 2QUJA 2XNSA 3DBVO 4WJZA 5E2IA 3VPDA 1DRKA 5BT9A 3LP5A 2Z2IA 3NOXA 2PZEA 1AN9A 2GUGA 1C4WA 1GNQA 2HLPA 3C98A 4P9NA 5GGYA 2A14A 3D4PA 1HM5A 4ZEXA 3OC0A 5IM4F 1QP8A 2I67A 1NMZA 2ZUSA 4PLZA 1Q7RA 3MCAA 4BV8A 4XYLA 3OY2A 1VIAA 1Q5PA 2CD7A 3SR0A 1Y4DE 3TLCA 3QVSA 3ZWDA 2CDCA 2EJVA 5KNBD 5C7OO 4RIHA 2ACWA 3CZCA 4XA8A 1GR1A 1JIJA 1P4JA 3D0RA 3VKWA 3ADCA 4NZNA 4EYGA 5B3AA 2KHZA 2D8AA 4GXRA 3JV7A 4BWFB 1ZVJA 2IELA 2XVAA 4JKOA 1TCBA 3EGCA 3LS2A 4UEKA 1WNFA 2R4QA 5ADWA 1NVKA 4D7AA 5TEWA 3MJVA 5F4BA 2M1ZA 2JI4A 1EFHA 2ATVA 4RTNA 2YDYA 3PPVA 1EWRA 1T9CA 3QBVA 4S2EA 5D7BA 3UB2A 1Y8AA 1K8RA 1WW8A 3IDSA 3ORQA 4X97A 1TKBA 3WQBA 2XRYA 2V5UA 4I4TF 1ZH6A 2EIXA 3ZWMA 3P9PA 4RYLA 3P9RA 2JB9A 3F6SA 2PZMA 3GU3A 3PT5A 1Y6RA 3N2ZB 5DCLA 3KXLA 4MVWA 2WU1A 1I3MA 1BCRA 2EC5A 3A7DA 4INPA 2GAJA 2QPTA 1YFLA 4I55B 3LPLA 3LY8A 3DQQA 3KJXA 2AR0A 5G4KB 3WTBA 5K09A 2QT9A 2Q3HA 3VPFA 2KBEA 1WDWB 4L74A 2WUFA 4WKNA 4BC0A 1H1LB 2ILVA 2P6OA 3ANTA 3SDSA 3W3AA 4IHAA 1AT1A 4WMLA 4HATA 1KJNA 5L7TA 1FQKA 3MG9A 4PIVA 3GW8A 1RNLA 1HDOA 4BO7A 3STYA 1AVTA 1IHUA 3PS9A 4LWOA 1HZZC 3DD1A 2HMUA 4CL3A 5D6NA 3HTXA 3EDYA 5LM3A 3R23A 1Q1EA 3TN7A 1Q21A 2PLFA 4L95C 3D81A 1H1TA 3AESB 4MQEB 2NV6A 4L02A 4P3OA 3BWEA 1XN1A 3LKVA 2BH2A 4UUBA 4X8MA 2C7OA 3W5UA 2VH5R 3EVFA 3BGDA 2ZI5A 2V58A 3CF2A 5IZCA 1NQWA 3IOEA 3DF7A 2DHDA 4BNXA 1C2TA 1V8FA 1Q7BA 4GO1A 1AKVA 2Z4TA 1PR6A 3JR3A 4CIVA 3TXXA 4EMSA 2FJ0A 2QPAA 5ALZA 2VZ0A 4Y6OA 3LRPA 3GLFB 1ZXXA 5EERA 5KB3A 3H1PA 3IQIX 3D8UA 4G5RA 4H4EA 3Q88A 1TU3A 3TE7A 3BWDD 3G2QA 3STXA 3LIIA 2VDKB 4KZKA 3NW9A 3PQFA 1TO2E 4TXNA 2QVYX 3ORSA 4FT4A 3UAWA 3EEFA 3EZ9A 3ZUGA 1ZGCA 4GIBA 1RLUA 2JIMA 1QMPA 3TMAA 1V3QE 2W6IA 2Q5HA 4OFZA 1M6YA 4UZSA 3VKFA 1TW3A 2BBSA 4N0QA 3AQIA 4H9GA 4RFSB 4ZD6A 2ZAOA 4AG6A 4FDVA 2B21A 1JHDA 1TI7A 2KPOA 5KQLA 1OI3A 1UBNA 1WV0A 4C43A 1VG9B 4UMFA 4MYDA 1POXA 1OXXK 1J99A 3HSSA 2FPGA 1F0KA 1BHSA 4RZQA 2W4QA 4F2PA 3AONB 2PMDA 3KXDA 3L4BC 1YVDA 4N47A 2G4LA 4DR6B 5EWJB 4XWAA 5ABPA 1Z36A 3DPUA 4CLRB 2FPGB 1UBSB 4Q4AB 5HKLA 1FMJA 4CDGA 3ICOA 4AYWA 3QMMA 1PJ3A 3OE7A 5DSZA 4D3SA 4YV1A 5E7MA 5LWHA 5AJHA 5MFPA 1H2RS 5K2OA 3G0BA 3U7JA 2HK8A 4KBYA 1YVPA 1HH4A 3Q12A 2RHLA 1P7ZA 1TEVA 4CTJA 1JX6A 1KAHA 1T3HA 3KTFA 3GZNA 3GOQA 3K05A 4C6SA 2Q4RA 4IO1A 1TK2A 3N6RA 4E1BA 5B7PA 3BIXA 3MILA 2FFBA 1U1FA 4MVJM 4Z3DA 4BB6A 3NJRA 3CE6A 5GQSA 1RWPA 1SUAA 1VECA 2R1UA 4CBVA 1Q0UA 5COBA 4DSOA 5K6RA 2A9JA 2O8EB 5H3CA 4HWKA 4X66B 3I9LA 3U5ZB 4E2WA 3U60B 2DULA 1O54A 3GMDA 5HIKA 1SVOA 1D1TA 2QWXA 3KZNA 5AKEA 1DRVA 3I4LA 3PYXA 5DX0A 4YDRA 4F5DA 1O94A 3CPSA 3PF8A 5BSVA 2N42A 3R0ZA 1VDZA 2WP8J 3AKCA 3U4GA 4YASA 3UB4A 2PS1A 3WBBA 4AJOA 4CGYA 3MMPA 3WWDA 1ZXBA 2O8CA 2YHBA 3TTXA 5ARCA 2Q5LA 1X1DA 2WSIA 3BCSA 3DYBA 1VLJA 4F6RB 3PL5A 5KDDA 4R1SA 5ALSA 5SYNA 3QXXA 2J48A 4JMPA 5DLYA 1VSBA 1CQJB 4O59O 3FWPA 2PNJA 2D5AA 3G1WA 3V7YA 3B38A 3VYTB 3DMHA 1QXSA 1J7KA 2VA8A 4MS1A 2IS2A 2QZZA 2Z3WA 3H5TA 3JWIA 3T1QA 1IJFA 1CHDA 1A27A 1XTQA 3N0WA 3O9MA 4FS8A 3QHQA 4TXMA 5AVQA 1CT9A 1DZIA 5FD8A 1D6MA 2YWEA 2CMHA 1ZH0A 3DSRA 2VUHB 2OZKA 2X8AA 5EHXA 1NQ5A 1LH0A 1LS6A 1PFGA 2AQHA 3IJRA 3KLPX 5EFOA 2ZBPA 1QUEA 2WYHA 3I2KA 2QP3A 1MAUA 3DP9A 4UNIA 4CJXA 4DMFA 2DBQA 5BSGA 2DQKA 2OV6A 3RVRA 5KWEA 2B7BA 2VTBB 1DQPA 1PJZA 2GCGA 3GNQA 3P97A 4TL7A 1YUMA 3R3VA 4UPEA 4DQXA 1I2BA 2C77A 1WX1A 1DEXA 3KE8A 4ZOBA 3QLVC 3H1GA 2J6BA 4NV3A 3IMKA 3LYHA 3RTEA 3QEJA 5JG7A 3ISVA 2C2YA 4LJ9A 3A31A 2X8WA 3HKCB 1OBVA 4QGAA 1KMCA 3UHJA 2NOAA 2WT4A 1E89A 1EGVB 3OTIA 5IXSA 4BGEA 1ZR4A 3Q2OA 4REMA 3GLQA 2EATA 3R5TA 1R4MA 1JFTA 3ETNA 2ODAA 4OLHA 4Z8YA 1ML4A 1Q11A 4R9SA 5DWVA 3BUSA 3BWMA 3HJHA 4FVTA 4PX5A 3RO7A 4BX8A 4YV7A 2I4TA 1HEUA 2C5AA 1K66A 2PSHA 3ER8A 5LZ7A 4EW3A 1JI0A 5MGBA 5M34A 2ZDHA 5AVWA 2IUTA 2IXTA 3BE5A 3LVBA 4GI1A 3FNGA 2UDPA 1NONA 1A7AA 1NLUA 4JLPA 1W87A 3QY9A 1LS1A 4LV8B 2VYVA 2G9RA 1E63A 3AK4A 1AM4D 1XELA 4HDCA 2XZLA 4RZ3A 4QHTA 4MCJA 3RUAA 2AC2A 2JAHA 3V7WA 2HRCA 5KC8A 3PVCA 5C53B 4F2DA 3EOAI 4OLBA 2ZS7A 4MV9A 3VVMA 4F96A 3A6FA 2FX3A 1Q7CA 2V55B 4PC6A 4C7KA 5B7NA 2OBBA 2I3BA 4HTFA 1MABA 2OAQ1 3STVA 5KWJA 2WC1A 4WA8A 4CMIA 3MJHA 2RI1A 1F12A 5LMCA 1DXHA 1JPNA 1KRWA 1LJ8A 4FE4A 4CV1A 4AN1A 3NEPX 2WA2A 4E88A 2FK7A 1USKA 3IP1A 1A1VA 4ZP1A 3PPWA 5CH8A 4B73A 4Y7CA 3VJKA 2DG2A 2HOQA 4NF2A 3W4JA 1D07A 1JQEA 2JVKA 1Y9DA 4QYWA 2H5LA 1QFJA 1COWA 1IY0A 3O3OB 4BDSA 1KFEB 2HDNB 4G0QA 1W52X 5CRIA 3Q8KA 1WKCA 1Q7GA 4GOJA 4QBTA 1ZI8A 2XXJA 1J09A 1W35A 5TJHA 1V9CA 1UBCA 3F1KA 3M89A 1MOZA 2C84A 2XZDA 3MJ4A 1FP4A 2Y0EA 4AO7A 2BHRA 1H8HA 4IX9A 4OGWA 4KREA 1CNFA 2QAIA 2PGOA 2QSUA 5TMPA 3RFCA 1DDOA 4Z4FA 1P5RA 1KJYA 2CF6A 4IJ6A 5F7ZA 3BFKA 3VZPA 4CWAA 5FQOA 4LQCA 1QH1A 1R66A 4ZYYA 3IV9A 1QBKC 5IHPA 4MUKA 1STOA 3DOOA 2IP4A 4NZYA 4OQ4A 1P7CA 4CVNA 2I3GA 5JCZA 5KJ1A 4NAUA 1RXUA 1WVMA 3MJFA 4F1WA 4YPOA 3K6SB 1U0BB 1TLFA 3OIDA 1JL3A 2R5FA 2JAXA 1JDJA 4H7JA 1YBMA 1YBFA 2OENG 2FKNA 1Z5UA 1FFXB 2K2WA 3G0GA 2I9PA 4GR5A 3PTZA 2WVAA 3R3SA 4IMIB 4MKXA 4Y3UA 4ZZ0A 4XJSA 1PZHA 3M82A 3RJTA 3G49A 1WL8A 4Z4QA 3CLRD 3L0YA 1Y3CE 4UNRA 3NFYA 3FYCA 1F0PA 3UV7A 5KMGA 1N7HA 2HPVA 4X5OA 2PAFA 3HV2A 4MEJA 5D8DA 1NW6A 4OXKA 3H04A 4Q1DA 4DYHA 1JEEA 4MWSA 1NG1A 2MDTA 2PX0A 3O84A 1KU0A 4Y9TA 1FRZA 2HHAA 1J0EA 5HS4A 1C3EA 3ZDEA 1KMIY 1HLDA 4R2XA 3RHFA 2GCOA 3U44A 1BGVA 4RFLA 3I9V1 1U0OC 3G17A 3FTFA 3IIMA 1RHKA 4IAOA 1VXOA 2IEDA 3LQRA 3PCTA 1Y1PA 3V1LA 2GLXA 5F5LA 1HTBA 4AF6A 4R2WA 4JDUA 4AJHA 1VE3A 3P32A 4WJKB 4BO0A 2ERXA 2PAAA 5LA6B 3A7EA 4ZCTA 3Q2KA 4TKUB 2X0DA 4HDRB 1EQUA 2C3OA 3CNQS 4O4LA 4NDZA 1C9KA 4GEGA 5K0NA 4BNLA 5AESA 1EB9A 1WZIA 1ZQ1A 3DXZA 3FCYA 4FBLA 4PPFA 1ILEA 2GPBA 3LK7A 2ONJA 3ZGNA 4UVDA 3W78A 4J7XA 4ME6A 2OQIA 5L8VA 3S2SA 1R0CA 2JKZA 4JYMA 3OTOB 1PGPA 1PLKA 1R8XA 4JC5A 3TFQA 1G38A 1FNSA 3LY9A 1UPCA 3BT7A 3HA3A 2C0CA 1ZYUA 4G1BA 1JQ3A 2I0FA 4HS9A 2D59A 3KT8A 3R0XA 3TMKA 4FGKA 1K1EA 1ZCFA 4G86A 3RT9A 1PGOA 1FDWA 1L7MA 5EE3A 2BN4A 1KY2A 5FFNA 4J16A 1JT9A 2IPAB 4X85A 3WGHA 2VPIA 4N9WA 4Q1VA 5FOVA 3TGPA 1YZNA 2NMVA 2PGLA 1TM3E 1HT2E 4MB2A 1VJ5A 4UXIA 3UA4A 4NCAA 3I45A 5EJ5A 4IIJA 3T34A 4MDFA 3AF6A 1BWQA 1Q2UA 2D8MA 3G2PA 1FOEB 2X77A 4GKVA 1FNCA 2P0EA 3H5NA 2JCXA 4HUQB 2DWUA 1EH5A 3SYMA 2AH5A 1SWVA 4ER7A 2HU2A 5JXIA 3HU5A 4J4BA 4MUIA 3O8OA 4RORA 3QKUA 1C7EA 1XU7A 3BRWD 2FG5A 1Y5MA 1LK0A 1X7WB 2BBWA 3LDFA 3AHDA 2NU6B 2WT9A 2AOVA 4I5DA 4TLMB 5ELMA 4BO8A 5E9AA 4DQ0A 2WSSD 3Q9NA 1V4BA 1W30A 2NZYA 4TLEA 3HCRA 4CF5A 3BAZA 1HFKA 10MHA 5REQB 1DKNA 1WR8A 1UKYA 3BGSA 2VCYA 4JBXA 4QRDA 4CCYA 2VJDA 1DTEA 5BR4A 1UPTA 3D3QA 4FCWA 2FTKE 4UBKA 1DC8A 1OT3A 1XRNA 4ND2A 2OHFA 2K7FA 1XE3A 4PYOA 1FYEA 3WV4A 1DX4A 1Y3IA 4RPCA 4CM8A 3T7SA 1FYVA 2HV8A 4MRSA 5AKZA 2ZETA 3ASZA 4Q03A 1ZGAA 2W2KB 1FW8A 5DI9A 1GQFA 1SUWA 5EKXA 1N4AA 4C07A 2WWYA 1ZDMA 4NONA 3NHKA 4KITB 3TO5A 3ZWQA 5K6AA 1SBCA 1ECGA 1HGXA 2P69A 2W58A 4G5SA 4RE6A 3TIFA 1JHYA 3DYIA 2I6SA 4L3WA 3TFWA 4XPIA 1F7VA 1J8VA 1VLVA 3FHTA 4DM3A 3JY6A 1B16A 4EHLA 3CIFA 1OH6A 3TLJA 2ZR9A 4MV1A 4TLBA 3GJSA 3TG2A 4W5TA 1DADA 3GLUA 2IS1A 1MVNA 2VZ8A 2RGBA 3OEHD 1RLJA 4FFLA 5DVZA 5HX7A 3WQQA 3Q7PA 1YRQA 5JVDB 4B6JA 2PSDA 3VR6A 4PO8A 1CERA 2WWFA 4CV3A 4EGCB 5AKYA 3TWOA 3VNVA 3L6DA 1ONSA 1JTFA 2VAVA 4FOSA 1G3RA 2XV1A 3HNPA 1UMCB 3EDMA 3L1JA 1JVSA 4K9PA 3J7AC 3IJ5A 3AV3A 1E92A 2MWMA 2Z6VA 1K06A 3W5VA 4YUVA 1QHIA 3L6OO 3EIUA 2VJCA 2V97A 2JK1A 1FRNA 4GHWA 1U7ZA 4CMAA 2O2SA 2D7CA 2OLJA 1QAQA 2P2CA 3ES9A 4D0NA 1S1MA 4DBLE 4KLCA 4XGQA 5PGMA 4MR9A 2R96A 2R0QC 1Z6QA 3HHPA 4YAGA 1P7YA 2Y0DA 3ZK8A 5JZOA 2H51A 2XGOA 3K9HA 2VDJA 3SZGA 1HPLA 2C5GA 2AUMA 1QVZA 1SD5A 1T5DX 2ZJ5A 3EAFA 4ZHQA 1WOYA 4LBYA 1XZ8A 3Q11A 5K3FB 1R6BX 1PR3A 3WGMA 1VI5A 3A58B 2IX3A 1BE0A 1YI0A 2L2QA 2ZE5A 1YMQA 3AR9A 3KFXA 4RMGA 4UEJA 5I8PA 3ON5A 1Q7TA 3NEAA 1UT5A 5CFLA 2WQ7A 2IT1A 1R0KA 3F78A 2I6XA 3TMYA 3AERB 3I32A 5B4TA 5KEIA 4TV9B 1JQBA 5EJFA 1LPSA 1W8DA 4OHZA 4Z1OA 4Y1RA 2R1VB 3GRUA 1YONA 1TAQA 1YS1X 3EVEA 4R3WA 4F5ZA 4EMUA 1FNMA 2P62A 2O8DB 3OI7A 4ENSA 4GE3A 4KXLA 3WNQA 1W36D 5CLGA 1WE2A 5JD5A 3ASVA 4CT4B 5C80A 3H1AA 1N6KA 3M3HA 3F4KA 3FOBA 2GYYA 4LZLA 3EUEA 1ST3A 3IHLA 4OUDA 4XDGA 4YRNA 3GUCA 1YE8A 1IDN1 2FFHA 3BL6A 3EZ7A 5AW0A 3FAKA 1PFKA 5IC4A 5KTSA 1MIHA 1U8TA 3HZRA 3RWMB 1EFRA 4K9SA 1M75A 4URYR 5IDXA 4HAYA 4FTWA 1EG7A 5HW0A 1KEUA 1WXWA 1QWOA 4HCJA 5AQ1A 1E6MA 5EE5B 1JYEA 4IZHA 4OKIA 1QTQA 3IV7A 5J40A 3PNOA 4DIKA 3K31A 2H54A 3BM5A 5CK5A 2CDNA 1YB6A 2WMYA 4BNWA 4RXMA 1URPA 4G1CA 2WUEA 4X8LA 4UU1A 3RU3A 5C32A 2RHCA 2PUAA 2H52A 3LT1A 1XDUA 5I9MA 1A9PA 4YCSA 1V5EA 1DSSG 2XYHA 3TLXA 1VJCA 1XCJA 4NOJA 1G20B 3NWPA 5JRDS 5BVGA 4ZOLA 4KPUA 1HF3A 2V7BA 2GPNA 4DL9A 1CUVA 3GJ3A 3TAHA 3OFVA 1E9RA 4UOZA 3TBFA 3O2QB 5A3RA 1QCZA 3ROTA 4CTMA 5AW6A 4ATNA 5I4KA 3NHAA 4V0QA 3CX4A 3RYHA 1XNQB 1HQKA 2NV2B 3BXZA 3R6LA 1I4DD 4L3VA 2N46A 1C7RA 3SWWA 3UBMA 1HKUA 3RS2A 2HSZA 2IZOA 4MRVA 2BH9A 4BFLA 3GGJA 2BFDB 3A9TA 5DJ5A 4EBBA 3E9ZA 4F93B 1MO2A 1PR5A 1O6GA 3PHIA 4ZANA 2OHGA 2J0QA 2J41A 4IM7A 1K5HA 4KQIA 1T91A 1AS3A 1M34A 2WIDA 3KKPA 4C4TA 4YMVA 3ZPXA 3FLEA 3IAM6 4LRQA 1JDSA 4LXIA 2J7PA 1IEVA 2WBLC 1B2LA 1YZFA 1AZLA 3K15A 4DVJA 2NQTA 4ZJYA 2JIRA 1BRTA 1L1QA 1JG1A 2MSEB 3EMKA 4M6WA 1VBNA 5THKA 2I2XB 1MPTA 4KU4A 4MXDA 4MVJE 4PFQA 4RS3A 4YACA 1QJCA 2GTIA 5ARDA 5FUBA 3SC2A 3VOAA 5H0IA 1NXWA 4I81A 1U8EA 2V6MA 4BQIA 1Z29A 2ZJ6A 4HEHA 3LBYA 4IGEA 1CY1A 4NU6A 4U2CA 5TS3A 4FEYA 2B8NA 2QS9A 2AIRA 2C0PA 2GJ4A 3RW9A 2ASVA 2Q3BA 1TW2A 2IYTA 5F1OA 1XYVA 5IJ0B 1YZ3A 1NKSA 2FN4A 3PSAA 2Q7DA 3GLGE 4HXEB 5CW1A 3RC9A 3T3NA 5GPBA 5F98A 2D0IA 5KVAA 2AF4C 4HNHA 1N1MA 2JG3A 4W9NA 5FWDA 4XFDA 1A4RA 2BTQA 1TDJA 2F1JA 3I5MA 1GEGA 3HFSA 3LRXA 5DCUA 1WXXA 2Q7OE 5K7SA 3DDOA 1G7RA 3C14C 2Y6UA 2SKDA 4YROA 3L49A 4Q9IA 4HJRA 4UBJA 4YLGA 1TIBA 1O87A 2OSVA 1MABB 2BMWA 4DQUA 4YGYA 3BFVA 1N2CE 4MZXA 3JVIA 3H19A 3T15A 4YWJA 1R0SA 3KOYA 2J5RA 3ANXA 1W2GA 1W96A 2PFKA 2I76A 4MNTA 2BGIA 4G0OA 5F76A 2VF8A 5IW8A 1XQYA 1JPUA 2ZBFA 2R8BA 2XF2A 1ZUIA 2J8ZA 4FFVA 5JNUA 2C9OA 3KKZA 4QUBA 3JQDA 1ULTA 2B9EA 4RK5A 5AK6A 3ROXA 3T99A 3TRDA 2I87A 3NKVA 4UAVA 3CLVA 5JXWA 4W5OA 3PX7A 2O14A 3P0JA 1PNVA 3GPDG 5BMOA 5JZVA 2H1WA 3S70A 2C5BA 4E5PA 1AMNA 3V00A 1DIAA 2I71A 3MB5A 3Q15C 3T7RA 3OZVA 5BSHA 3T6KA 3A05A 5KX5F 4D43A 3EEQA 4C3VA 2C9CA 1LDGA 1IULA 4Q7KA 5HK8A 5KVQA 5FORA 2P5TB 3FDXA 4P38A 2EFYA 2QTHA 3ILYA 4PO3X 2XTJA 1IYZA 1DAOA 1AGRA 1Y6ZA 1ZG3A 1S4MA 2F00A 1VFPA 2DAPA 2QM7A 3AH8A 3DZKA 1X80A 3H2ZA 4EHAA 5C46F 4BXOB 3IS3A 2OPBA 3MINB 3A11A 4R98A 3VH3A 4F8EA 1TRHA 1DO2A 1OVMA 1VGQA 4X1KB 3U4CA 4EI7A 1TJYA 2NSJA 4QU8A 3P2IA 3GJQA 1E9CA 1L3CA 1D9ZA 3O4RA 5G0TA 3RM3A 4QZVA 1IVYA 1J00A 4GXQA 4H31A 4D3XA 5LMNB 3WA7A 2PV0A 2GX6A 1NVVR 3MCVA 4JB8A 4K6OA 4BP3A 2A5LA 3D8BA 1S01A 2G1PA 4K6CA 4DIBA 2EJTA 2Z56A 2M2IA 2QG6A 5JQGA 1Y4SA 1I2CA 3T5CA 4QC2A 1PDWA 1IUNA 4KX3A 1ZIOA 3ZZUA 1P39A 3G7UA 3CUWA 3IVGA 3ZE8A 5TLSA 2CVOA 1VJ1A 5IKOA 3V1UA 4Z86A 2OGSA 4E21A 3QXCA 3QYPA 4ZK2A 1U0JA 3WRXA 4C4XA 4YRZA 1SVMA 4EKGA 1H8EA 3H5WA 4LHYA 1DE0A 3VZRA 2WUDA 4PGHA 1EFRD 3JATB 1YDWA 3HCWA 1HTWA 3V48A 5KNCA 3HCBA 4R9VA 4TYQA 5ECWA 4N65A 4V0ME 3QVGA 4KQGA 4QX6A 4TM8A 4D5EA 4EBFA 1Z07A 2XWPA 3EDCA 4UASA 8ADHA 2C97A 2WYVA 1DLIA 1I6WA 1U0LA 1TQHA 1NBHA 3E3MA 2I1WA 1C2YA 2J0UB 2V96A 3LFHA 2PD3A 3F9IA 3F90A 1Y4UA 4B7CA 1BS9A 5IYZB 3WKAA 3QVVA 4JI8B 3CCFA 4NP6A 4RXTA 3W3AD 3FNEA 1JBKA 2FR8A 2H63A 2JBAA 1MD9A 4GICA 4LTNA 1T5BA 4E33A 4F5WA 4K0KB 1G6OA 2C8LA 4JJGA 3D2LA 1D4FA 4RGQA 5GAJA 1I6LA 2CSUA 4BKQA 1V8OA 1DAEA 3H18A 4JLMA 3WIVA 2EX4A 3U1VA 1COWD 3G2OA 2PUVA 4X1OA 4AKSA 2PKWA 1I1OA 4MGYR 4RHFA 1WU8A 2QVCA 1ZZGA 4TRRA 1TADA 5J4LA 3GGDA 1I9GA 4TYYA 1MC8A 2PJDA 1LX6A 1Z3CA 1CCWA 1XVTA 1BE1A 1YAHA 2NADA 1N1EA 4A5OA 1TKCA 4RV4A 4Q6WA 2J6HA 1GUAA 2G06A 4MB6A 5ELXA 4IVRA 2AX4A 5B12A 4BRSA 3ZE7A 5DNUA 4TRJA 2QVXX 1Z62A 3T9BA 1GUBA 2GH1A 2CSXA 3RV4A 5CFMA 5HIMA 3ZY5A 1KI2A 3Q3HA 3LKBA 3ZDCA 3OECA 4Q3DA 1HXHA 3DVLA 1LLCA 5JTUA 3G1TA 4IDOA 2QJWA 5BQPA 4B85A 3GG9A 1Z5WA 2VQ6A 1T3ZA 2ZSKA 3B1ZA 3F6PA 4W7IA 2X6TA 4LI0A 3S2ZA 2GEVA 3V6LA 5CDFE 2YWGA 2EERA 3DUFB 2YHSA 3RIYA 1L5NA 1EXWA 1MOQA 3CSDA 1SBYA 4KL8S 4KKXB 2BT4A 3FJ1A 3G7SA 4QUHA 3SQMA 3TZ6A 2IOYA 3NVDA 1RJFA 2VWQA 4NBNA 1PDVA 2FWNA 4HH4A 4AO8A 2VT3A 3WYBA 3O8NA 3QPAA 4RGVA 4G63A 4ZOQI 4PS1A 2C9ZA 3UTDA 4HGOA 2I4IA 3SQNA 1K6MA 4KDCA 3T0FA 1SXJD 3PXXA 2XE7A 4WK2B 4HDKB 2FVXA 1R4MB 1RCFA 1PK7A 4MQLA 4MW7A 2G36A 3EEBA 4WBXC 1GSIA 5BSEA 2A3RA 2BZ1A 5D6OA 3ZU3A 3MELA 5EZ6B 5FPKA 2HLDA 2KE5A 3HJNA 5JSHA 1YQDA 2E0IA 1YH3A 5DK4A 1VCHA 1LWNA 2YOFA 1PJTA 2XZTA 5EJIA 3V55A 3Q40A 4B3XA 1K9SA 2D1YA 1FU8A 3IFSA 3AFNA 3CNEA 3SFVA 2G4CA 1NDHA 3NTRA 3AHCA 4EA8A 1VCNA 4AIIA 1Z16A 4BMSA 3OM9A 2XLBA 2YVUA 2PKRA 5D85A 5BSRA 1UMBA 4BWGA 4DT1A 2JJ8A 5JS8A 5BURA 2CJYA 4GX1A 4QDJA 1P7PA 1G3UA 3Q87B 5K8LA 1WLYA 3SDBA 1SXQA 3WMFA 4YCBA 1EGQA 1HL3A 4F5YA 2NZJA 1O0CA 4L3OA 4LSMA 2JGEA 4BLTA 1X19A 3W2GA 3W04A 3PR2B 2WZQA 4RE5A 4INOA 1XTIA 4YCDA 4C06A 2E18A 3EG9B 1KPHA 1GFZA 3G89A 2NXJA 4JYPA 2GF2A 3W5BA 1PVVA 2W83A 2G04A 4V2IA 3IDZA 3TZEA 2OQ2A 4HEQA 3C8HA 3HP4A 4IV8A 4M54A 5BW6B 1E3IA 3TKLA 1VYUA 4AD8A 2OCKA 4Y6GB 3OO0A 1ZGHA 3AUSA 1JSLA 2CLCX 2Z9BA 3BD6A 3E7DA 1V11B 4ARBA 1JDPA 3C1OA 1DCMA 2YYSA 1KMNA 5C7YA 2G25A 3KTAB 4CKWA 3PHBE 4AY6A 2ERYA 3PNPA 4TMFA 4FHGA 4X1YA 1H6BA 2DBRA 4WT7A 5HK9A 3FSGA 5FNVB 1AA6A 2FN7A 1F4VA 4RVOA 3V42A 3BMQB 1OXSC 4B81A 1SVKA 5K3FA 1TTHA 5IH7A 4BTLA 2YS7A 3BD9A 2YYAA 3WB1A 4QSMA 2P4SA 3C6YA 3JYLA 1K7XB 1Z7GA 4V0LA 2KW5A 5J43A 3GLRA 3H9BA 2Z3ZA 2E4ZA 3OQIB 4N0EA 1RI3A 1KSHA 2AD1A 4UDYX 2C4HA 1P31A 3OLYA 3R4VA 3ONEA 1J1IA 2NUAB 3VPGA 4B1FA 2IYPA 1Z39A 3FAZA 3DOJA 3HY6A 4I9FA 3I28A 4YDHB 5CFRA 3FW1A 1CF4A 2Y2VA 3BA6A 3AP1A 1KYQA 4FDAA 5KMGB 1UR5A 2XWJI 3DVAB 1LTQA 2QMZA 2H59A 5T4BA 3DD5A 1EU1A 1FS6A 3M2TA 1P0MA 5AKLA 1HE3A 4GLJA 5IVHA 1WPRA 2VAPA 1XR3A 2JJMA 1FVOA 4HTFB 1G291 1C1YA 1CB7A 4HNRA 3I39X 1GPBA 3FWHA 4YRCA 1K8ZB 2BEUB 4MWTA 3EFHA 7ADHA 1IFXA 2PLWA 1T3TA 3HVRA 4J0CA 5E8JA 1YV9A 2E89A 4EW2A 5EG5A 3O7MA 4U2BA 1R4ZA 3P45A 3ZYZA 1QC5B 4X20B 4Y2QA 2IE8A 5CMLA 1H5QA 3BGVA 3PE6A 1FFYA 1QFZA 1QTIA 4B0PA 4L2IA 5JQGF 4QUEA 3INRA 4F3RA 2X0RA 3FPFA 4X24A 4CUJA 4Q9HA 1SBIA 1FQWA 1C9EA 1WMDA 1NBMD 2ZUWA 4BEJA 1WMEA 2NW6A 3HN2A 3SZ3A 2IRWA 5A6SB 5BN1A 3Q98A 3P5SA 3QUSA 4ZOLB 5DYGA 1DG1G 1WCYA 3SJBA 4X90A 4BYGA 4TL6A 3R76A 2AGVA 2YWDA 1KZ7B 1M3SA 3DO8A 4EQZA 4L8YA 5AHRA 3SPXA 2GAFA 3F3YA 1EE9A 1PNOA 4LE1A 4NIMA 4P53A 3OEYA 1N6LA 2J85A 5BW8A 1OFVA 3KQHA 2GGSA 2O2IA 1YB4A 3EWAA 1RI5A 1D5WA 3GV0A 3EXG2 5MGNA 3UGJA 4TZKA 1CUHA 4LF4B 3O8DA 1T5HX 1UBRS 1V26A 1V7QA 2NVBA 2O19A 1KI6B 3P9ZA 2X6RA 1EK0A 1L5SA 4GOKA 4I8IA 4BFSA 2Z43A 4AVYA 4R0NA 4R6WA 1L5MA 4IDBA 4EG5A 5BV8A 3USZA 3OUUA 2X2PA 3GDGA 4EI8A 2PWAA 4H7KA 4LDJA 1A98A 1FUKA 2VF2A 2HRQA 4TXJA 1TT7A 4TMYA 2VRCA 3KSDO 1C1DA 5AK3A 3RYFA 3VYVA 3OMLA 1PZGA 3FHCB 1ANKA 2PO7A 2Q4BA 4TSKA 5JH7A 2VBGA 3H2YA 4UM9D 3UOGA 1W6RA 2B7LA 1V37A 3GJYA 3NALA 4J1NA 3DBRA 1B26A 3I5AA 5DSTA 3JQAB 5FO0A 3S44A 4IKEA 2JLYA 3K9QO 1DT3A 3MD0A 2Q6VA 4D9HA 1XP5A 1N57A 2MYPA 1EBFA 2WG2A 3IEXA 5FRDA 4PRLA 1ZLYA 3DPIA 4LXTA 5HBGA 1DKMA 1OX6A 3LF2A 3RRBA 5A2GA 2YZGA 2BRUA 3TKAA 2HK7A 2VTVA 3WL6A 5FEMA 3BMNA 3E70C 4MITA 4F85A 2IBMA 1XU4A 2P91A 3G23A 4XLZA 1CVIA 1VL6A 1OZFA 2E55A 3ZY4A 1A3CA 2J4FA 1DEHA 3V4FA 3RFFA 3CZ4A 4A1FA 4ENVA 2G08A 3DHWC 3V4VB 2NYRA 3NHSA 4YJ3A 2UVDA 4IJWA 2E4YA 3WLJA 5IN4A 3PFGA 3QU7A 3I8SA 2ZT7A 1E6WA 3EUFA 3FOZA 1AKRA 3NIGB 1DJOA 3GP3A 4NAHA 5KU1A 4FWIB 1J1UA 1KXZA 1G3IA 5MFZA 1XD9A 1RZUA 3MBOA 3O9ZA 1GGMA 5DDIP 1X38A 5EUQB 5K2MA 1R64A 3H4IA 4DA9A 5AMXA 5BUZA 3L6CA 1U8ZA 3Q3VA 4B2IA 4YMWA 2PNFA 4F04A 3RS8A 3UKDA 3GMIA 1LPAB 3JD1A 3KV1A 3O1IC 4Q24A 3E4CA 4RV9A 3RNLA 1EWQA 4QFCA 2XBUA 3IV6A 3URMA 4KMRA 2HN9A 3V34A 3OIYA 4HNAA 2MJLA 1PJCA 2QV0A 2XT0A 1R0LA 3BRSA 3THRA 3A4TA 4WW0A 4ZI7B 4AKTA 2R68A 3PQDA 2RJ3A 3EAGA 1X8JA 3G8YA 3ZNPA 3USCS 3DV9A 1G8GA 3JALA 5JZ9A 1KMHA 1OFUX 2QN9A 5ALIA 2ZJZA 4EECA 1XFDA 1XC7A 2QQFA 4UHHA 2ZYRA 3A4NA 3O1HB 3DT6A 1LQTA 3SXJA 3LAWA 3B13B 3T9FA 3P9IA 4EARA 1GT91 2FWBA 5IDYA 3DUWA 2I7TA 4QU0A 5CYFA 2RSLA 4A8JA 4AQDA 2FPPA 2A1UB 3BBLA 4F06A 3OWXA 4INJA 4OQQA 3U7QB 1E4EB 3EYWA 1FE8A 2QL9A 3FTNA 4G97A 3P0FA 4H7DA 4PX3A 3RYIB 1QIDA 1EGAA 1WUHS 2FW9A 4WZAE 4TQ9A 5ALXA 4E4RA 3PNKA 5M29A 2G67A 1JDVA 1YUBA 5ERYA 2NUTB 3WJ7A 5I6DA 4OHYA 3IUNA 3WI7A 4CQMA 4P36A 4QDXA 2FUG1 3I01M 1BROA 1Q92A 4KYVA 3W06A 2GXSA 3UMBA 3KHUA 1PS9A 4LOIA 4KG7A 3K71B 5EQJB 2AJTA 4CI0B 4M0MA 1ACMA 3F3MA 4JKIA 4ZV7A 4AJ2A 1ATZA 1WZNA 4KJXA 4Y1RB 1RRKA 1X8XA 3K2IA 3RGWS 4G4JA 1FFCA 1ENYA 2R1TA 3M4JA 1C1XA 4EI2A 3ZDQA 3UPDA 1E5QA 3GRFA 4R0MA 2FX5A 2ZCJA 3RG2A 3RKUA 1U2DA 5H68A 4B2YA 5D01A 1IPFA 1UT8A 1E4OA 4D4GA 3CH4B 3UK1A 1CIJA 4I5IA 4IDDA 1DAPA 4Q6BA 2FOXA 2CXNA 3NT5A 3TLKA 1QAMA 1QO7A 2VRBA 1JLMA 1QGZA 1T6NA 3ONNA 4PG6A 5D3ZA 2VC2B 4BP1A 4BVEA 1AUOA 5GZ3A 1GCOA 4GPAA 1N5OX 5ALGA 5DNDA 5EMHA 3ZZ0A 4Q3BA 2R47A 4QPZA 1ZC3A 4J0HA 3GFSA 3ETGA 4YMHA 4QEZA 5IAOA 1AV6A 1KRHA 2H2HA 3Q5DA 2VTBA 3ZVRA 3HRHA 1KMQA 2DP4E 2X42A 2PWBA 3K9CA 4JLDA 3LE8A 2CXOA 4W6ZA 1CIPA 4IOLA 2A0KA 1PHRA 5C34B 5CA1F 5I4BA 3RTAA 2CJFA 3IBFA 2QE7A 3M1YA 7ABPA 5K4GA 4HGPA 5A04A 2OOKA 4DGSA 3AM3A 3HB0A 5LXTF 1XTPA 2B0CA 2C78A 1QPZA 2ATIA 2GNAA 3G8CA 3WWEA 4HDMA 2LIPA 4ARUA 2O3UA 2HMVA 5CG1A 2WJ6A 1WPQA 3SX0A 2NO5A 1XVIA 1L4KA 2VJKA 2IHJA 3LMKA 3VFDA 4DIEA 2V4MA 4KO8A 3ZR4B 2JJ2D 4AN4A 2WIJA 4NG5A 3PDWA 4LISA 5T3UA 3IPLA 3SS7X 4CM9A 4ECEA 4RWZA 4DCSA 2D2VA 3HRIA 4E2ZA 2OFOA 5LVAA 1RWNA 3ICVA 2QNIA 3K1AA 2XKBA 4B3CA 3ESDA 1YZLA 1HQCA 4MMZB 1SY7A 1T9GR 3ID6C 3I04M 3TRFA 5EZQA 3ABOB 1IBSA 3WLLA 1NBIA 3U2QA 3URKA 2ES4A 5CAEA 3V9AA 2IYQA 1B0ZA 2Z8YM 4R40A 3LLCA 2F4VB 1PVOA 2OAEA 4BFUA 3D02A 4KKVA 4Y7DA 1PU2A 1DC7A 3I8OA 1E4YA 1R15A 2XDQA 2HA5A 4ETMA 3TQQA 2YXEA 4Z7NB 3IGFA 3A70A 3AQ4A 3OLZA 3OKCA 3TUZC 1EA5A 1NUUA 1XJ5A 2NVWA 5TVKA 3DG9A 5TPZD 3UCFA 1TVMA 2EYQA 3JPWA 3EVZA 4MLPA 2ZIAA 3TBKA 3VTAA 4ZIRB 4Z9XA 4LBWA 2JGJA 4GAEA 4XSVA 3U7IA 1IMOA 4UTOA 5GTDA 1CJSA 1CRLA 2QTCA 2NACA 3FZNA 2Q29A 4YWHA 4LUCA 3W1EA 3FPHA 3MCTA 1J2EA 1C9MA 1U4OA 1QYDA 1ULHA 1VBKA 1KKLA 1EEXB 3PL1A 3R8FA 1XZAA 4BL5A 3CH7A 2BM9A 2HUNA 3LP6A 4L76A 1OC4A 1JSCA 1WCXA 3S7TA 4ZN6A 1AKEA 3NBMA 1OVGA 3DFFA 1GNPA 4ZREA 3CU5A 2FPMA 4Z4EA 1QF7A 3TEFA 1C1HA 2YHIB 2F67A 3OIVA 1KI6A 4FW8A 3DL7A 3WGVA 3PA8A 2XE6A 5I4IA 2Z83A 3BILA 3E5HA 4HQRA 4KDRA 3DBLB 4V0MA 4TLAA 4TKMA 4Y0NA 3B78A 2RK4A 4WVFA 1D2EA 4KEAA 4KV7A 4TSFD 1U2DC 1LD3A 3S99A 1ZICA 5F3RA 4X00A 3UAZA 3SI7A 3QLUA 3SR4A 3W5IA 5TDHA 2ZU6A 3G2IA 4R3UC 4EDHA 1SKUA 2O7RA 1G0NA 1S3FA 1SC4A 2VQSA 2HF2A 3E7FA 3BB4A 5TGTA 2FQ1A 2ZTMA 1JZTA 3NCHA 1BYIA 1XDGA 1SFRA 2DWQA 1HQDA 3KWMA 3SNHA 2WFZA 1NE7A 2JLRA 2ZR7A 1Z25A 3UQZA 4DWJA 1ZN7A 2JDID 1MGPA 1Z4JA 1R0BA 1I94B 1MC5A 3PEVA 4O4IF 1SRQA 2AD5A 3REOA 3T3EA 1GKUB 1GNTA 2J9ZB 2Z2XA 3HL0A 1EFPB 3H0EA 4UARA 4IFIA 3AJRA 4AYXA 1G9XA 2J3IA 1QGYA 4JIGA 3R44A 1Y7PA 5K3AA 1GLGA 1L5RA 2HM7A 3B2NA 3EGIA 4WFQA 4YAIA 3DZFA 3P94A 3BHIA