3PSLA

Fine-tuning the stimulation of mll1 methyltransferase activity by a histone h3 based peptide mimetic
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
303
structure length
298
Chain Sequence
b'KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Fine-tuning the stimulation of MLL1 methyltransferase activity by a histone H3-based peptide mimetic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 98
structure length 298
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3pslA00
2I0SA 4FA5D 4JXMA 4OZUA 3IJCA 3SXTD 3EWEA 3MXXA 2EBSA 4CZYA 1OLZA 4CY5A 3SWSD 4A2LA 3DM0A 2HESX 3OKYA 3I7PA 1S4UX 2CN2A 2PM9A 3SMRA 3MMYA 1VYHC 1K8KC 2OIZA 5HYNB 2OJYA 4MK0B 3OKYB 2CO0A 5AJAA 5C2WB 2AGYA 2W18A 3IJ0A 4Y7RA 2PM9B 4J0XA 5TEEA 4J79A 3MZLA 5IJ8E 4E54A 5HE2B 2OK6A 3EI3A 3VGZA 2Q7QA 1P22A 2OVRB 4XYIA 4CI1A 2IURA 2IUPA 5HE1B 4E54B 3EI3B 4CY2A 1TBGA 5FA5B 4GQBB 4GMBA 5FXYA 2B5MA 3F3PA 4I79A 1N6FA 2H6NA 2IAAA 1XHMA 3BWSA 4YVDA 1MDAH 2I3SA 3SFZA 2CO0C 1B9YA 2P9KC 5C9ZB 3BG0A 5IJ7E 4L3HD 2AH1A 3IJ1A 3MKQA 3AH8B 2CNXA 4ZOVA 2H6QA 3JAMg 2P9UC 2OK4A 3PXWD 4QQEA 1NR0A 4JT5C 3EU7A 5SXMA 4FB1D 2P9SC 4GGAA 2J55H 4BL0A 2Z2NA 5K1CC 5FKQA 1Q47A 4E5ZA 3DXKC 3HFQA 3UVKA 5GSAA 4J81A 4D6VA 4O45A 3I7LA 3OKTA 4O9DA 3A0FA 3UVOA 4N14A 4E5ZB 4QL1A 3C5MA 2HXCA 3EI1A 1N6EA 1YFQA 2B5LA 3OKWA 4A0AA 5IGQA 5TDHB 4NSXA 3F3GA 5H1MA 4QT8A 5FKTA 2H9PA 5EMMB 4LGNA 1R5MA 1SHYB 3EI1B 3RN0D 1NEXB 4PC0A 4A0AB 4FHLA 1PEVA 3I8EA 2YNOA 3I7OA 5HE3B 3I89A 1K32A 3SCYA 2QXVA 2H6KA 3GFCA 4K3JB 5EM2A 3K27A 4AOWA 2J57G 2YNNA 4X63B 2P9NC 3PVUB 3DXMC 5CXBA 3CFVA 3SVWD 4J82A 4JSVC 3BG1A 5IGOA 5EM2B 1JOFA 4J87A 1GOTB 3NVQA 5CXBB 3RFGA 1PGUA 4JD2C 4G56B 1L0QA 4IA9A 4L3GD 2P9LC 4J8BA 4GM8A 3IKOA 2P9IC 5CYKA 2BBKH 3JZGA 3N0EA 1XKSA 4ERYA 2HYEA 4CZVA 2OVPB 3VA6A 2PBIB 4X60B 5I5MA 3RLMD 5CYKB 5TF2A 1GG2B 3U4YA 3NVXA 3E0CA 5CXCA 3MZKA 3DSMA 1N6DA 1JJUB 5K19A 1JMZB 3SHFA 4PXWA 4LG8A 2PM6B 2H3XA 2XU7A 5CXCB 5IC7A 2IWKA 5FKSA 3UVMA 4A08A 3C75H 4GGDA 2I3TA 4FA4D 1GP2B 3ZWLB 1QNIA 2YNPA 3I7HA 3UVLA 2XYIA 3B7FA 4A08B 3PXSD 5TEFA 4OWRA 2Z2PA 4U7AA 4J73A 1JMXB 4R7AB 3EI4A 3CIKB 3ULEC 3F3FA 4HDJA 3IIYA 3V7DB 2OVQB 2IUVA 3PVWB 5IT9g 3FGBA 4ZOYA 3NVNA 3EI4B 3L4OD 3OL2B 4CY1A 2H9NA 3N0DA 4JSPC 3AL8A 4PSXB 5KDOB 1PI6A 3I2NA 3JRPA 2GC7A 4PNKB 5I5IA 3AL8B 2YMUA 1GXRA 3KRXB 4H5IA 2G99A 3UKRC 3J81g 3OTTA 3ODTA 4J78A 4O1QD 4X3EA 2H9LA 4JSNC 1U4CA 3I7NA 3SBQA 3PE7A 5JWZA 3PSLA 3EG6A 4A7JA 2IUQA 4BUJC 4A2MA 3EMHA 3MKSB 3V5WB 4ERZA 4PSWB 3OW8A 3FM0A 1B9XA 3UKUC 3JB9L 1U2VC 3P4FA 3L4MD 3AL9A 4GQ2P 1SQ9A 3SLED 5H14A 2PM7B 2AGWA 3J80g 4A09A 3DWLC 4IMMA 4ERQA 2J56H 4QRJA 1OMWB 2CE8A 2Z2OA 3SJLD 2HJBA 4ESGA 3UVNA 2IWFA 4A09B 5A2Qg 4A0BA 5EARA 4CC9A 3PSCB 4GQ1A 2GC4A 1ERJA 3W15A 5GMKn 4BH6A 3AFCA 1TYQC 2AH0A 5HE0B 2H9MA 2XL2A 2YBAA 4ZOZA 1MG3A 2YB8B 3C99A 4Z8LA 4A0BB 3SN6B 5C2VB 4L9OA 2B5NA 3FRXA 5GXIA 3KRWB 2AGLA 5GXHA 2O9KA 4AEZA 4ZN4A 5B4WA 5EMJB 4K3ID 3I8CA 2HKMA 3V9FA 2BCJB 1XIPA 4UI9R 5HQGA 4ES0A 3RSEC 2H14A 4Y5RD 4TZ4A 5AMSA 4CI2A 4PBYA 4D0KA 3OL2A 3EI2A 5FQDA 2AGXA 4EWRA 2HJ4A 4XEIC 3UR4A 5THAA 3K26A 2I0RA 5FLXg 4CY3A 4O3TB 3EI2B 4J0WA 4X61B 2B4EA 3RMZD 2QC5A 4CZXA 2CE9A 3JROA 3GREA 3I7KA 2H47A 3PXTD 5EAMA 4J8GA 4CI8A 3JZHA 1SQJA 3SBPA 4GM9A 3ORVD 5EMLB 4J86A 4JSXC 3RN1D 4PBZA 4GM3A 4H5JA 4U1EI 2P9PC 5EAPA 2MTAH 2GNQA 4KFMB 4GZ8A 1PBYB 2TRCB 4J77A 3JPXA 4LG9A 3C9CA 3SBRA 4XYHA 4J84A 1A0RB 1RI6A 2G9AA 4GGCA 3VH0A 1FWXA 2UZYB 3IIWA 5AFU3 2H68A 4FA9D 2XL3A 4L1QD 5EALA 2UZXB 5EMKB 5FKRA 4CI3A 2HKRA 4FAND 4ZOXA 2AQ5A 2CN3A 5I5JA 3RRMC 4A11A 1MG2A 2I0TA 4FA1D 2H13A 4O3UB 3RFHA 3CFSB 4JT6C 4FWWA 3JZNA 5H17A 4FAVD 2AGZA 4A11B
chains in the Genus database with same CATH superfamily
2I0SA 4NC4A 4FA5D 4JXMA 3NIGA 4OZUA 3FCUA 4BCDA 4RE5A 3IJCA 3SXTD 3EWEA 3MUOA 3MXXA 2EBSA 4BP9A 4CZYA 3IUJA 1OLZA 4CY5A 3IVMA 2EIBA 3SWSD 4A2LA 3DM0A 2HESX 3OKYA 3I7PA 1S4UX 2CN2A 4MMYA 2PM9A 1U8CA 3MMYA 3SMRA 1VYHC 1K8KC 2OIZA 5HYNB 1UOOA 2OJYA 4MK0B 3OKYB 4MMZA 2CO0A 5AJAA 4AN1A 5C2WB 2AGYA 2W18A 3IJ0A 4Y7RA 2PM9B 2VDMA 4J0XA 5TEEA 4J79A 1E5TA 3MZLA 5IJ8E 4E54A 5HE2B 2OK6A 3EI3A 1QFSA 3VGZA 2Q7QA 1P22A 3O4IA 2OVRB 4XYIA 4CI1A 2IURA 2IUPA 5HE1B 3IUQA 4E54B 4AMYA 3ZDXA 3EI3B 4CY2A 1TBGA 2VDOA 3O4GA 5FA5B 3IJEA 4GQBB 1L5GA 4JHPC 4G55A 4GMBA 5FXYA 2B5MA 3F3PA 4I79A 1N6FA 2H6NA 3VI4A 2IAAA 1XHMA 3BWSA 4YVDA 3ZE0A 1MDAH 4D9SA 2I3SA 3SFZA 2CO0C 1B9YA 2P9KC 4G1EA 5C9ZB 4AN0A 3GC3B 3BG0A 5IJ7E 4L3HD 2AH1A 3IJ1A 3MKQA 3AH8B 2CNXA 2HU8A 4ZOVA 5FFOA 2H6QA 5C92A 2P9UC 2OK4A 3PXWD 3JAMg 4QQEA 1NR0A 4JT5C 3EU7A 5SXMA 1TYEA 4FB1D 3K72A 1VE7A 2P9SC 4GGAA 2J55H 3EQ7A 1UOQA 4BL0A 2Z2NA 5K1CC 4DNUA 5FKQA 1Q47A 3ZE1A 5E6UA 3DXKC 3HFQA 3UVKA 2JKXA 5GSAA 4E5ZA 4J81A 4D6VA 4O45A 3I7LA 3OKTA 4O9DA 3A0FA 3UVOA 4N14A 4E5ZB 4QL1A 3C5MA 3T3MA 2HXCA 4O02A 3EI1A 1N6EA 1YFQA 2B5LA 1VZ2A 3OKWA 2VDKA 5IGQA 4A0AA 2BKLA 5TDHB 4NSXA 3F3GA 5H1MA 4QT8A 5FKTA 4RE6A 2H9PA 2XZGA 5EMMB 4Z7OA 4LGNA 1R5MA 1SHYB 3EI1B 3RN0D 1NEXB 4PC0A 4A0AB 3IULA 1PEVA 3I8EA 4FHLA 2YNOA 3I7OA 5HE3B 3I89A 1K32A 3SCYA 2QXVA 2H6KA 3GFCA 4K3JB 4UM8A 3K27A 5EM2A 3T3PA 4AOWA 2J57G 2YNNA 4DNVA 4X63B 2P9NC 4O2WA 2VC2A 3PVUB 3DXMC 5CXBA 3CFVA 3SVWD 4J82A 4JSVC 3BG1A 4WK0A 5IGOA 5EM2B 1JOFA 4J87A 1GOTB 3NVQA 4Z7NA 5CXBB 3RFGA 1PGUA 4BCCA 2VZ3A 4JD2C 4G56B 1L0QA 3O4HA 4IA9A 2P9LC 4L3GD 4J8BA 1I2MB 4GM8A 2VDLA 3IKOA 2P9IC 5CYKA 3QI0A 2BBKH 3JZGA 1UTCA 3N0EA 1XKSA 4ERYA 5C86A 1GOHA 2HYEA 4CZVA 2OVPB 1E8NA 3VA6A 2PBIB 4X60B 4AX4A 5I5MA 3RLMD 5CYKB 1GOFA 5TF2A 1GG2B 1K3IA 3U4YA 3NVXA 3E0CA 5CXCA 3ZDYA 3MZKA 1H2WA 3DSMA 1N6DA 1JJUB 5K19A 1JMZB 3SHFA 4PXWA 2PM6B 4LG8A 1H2ZA 2H3XA 2XU7A 5CXCB 5IC7A 3VI3A 2HU5A 2IWKA 5FKSA 3UVMA 5M5TA 4A08A 1JV2A 3C75H 4GGDA 1UOPA 2XDWA 2I3TA 4FA4D 1GP2B 3ZWLB 1QNIA 2YNPA 3I7HA 3UVLA 2XE4A 2XYIA 3B7FA 4A08B 3PXSD 5TEFA 4OWRA 4G1MA 2Z2PA 4U7AA 4J73A 3KCIA 1JMXB 4R7AB 1VZ3A 3EI4A 3CIKB 3ULEC 3F3FA 4HDJA 3IIYA 3V7DB 3QHYB 2OVQB 2IUVA 3PVWB 5IT9g 3FGBA 4ZOYA 3NVNA 3EI4B 4DNWA 1QFMA 3L4OD 3OL2B 4CY1A 5E6RA 2H9NA 3N0DA 4NAAA 4JSPC 3AL8A 4L1MA 4PSXB 5KDOB 1PI6A 3I2NA 3JRPA 5M5UA 2GC7A 4PNKB 3ZE2A 5I5IA 3AL8B 2YMUA 1GXRA 3KRXB 4H5IA 2G99A 3UKRC 4IRZA 3J81g 3OTTA 3ODTA 4J78A 4O1QD 4X3EA 2VDPA 2H9LA 4JSNC 1U4CA 3K6SA 3I7NA 3SBQA 2EIEA 3PE7A 4Z7QA 5JWZA 3PSLA 3EG6A 4A7JA 2IUQA 4BUJC 4A2MA 3EMHA 3MKSB 2EICA 3V5WB 4ERZA 5M61A 4PSWB 3OW8A 3FM0A 1B9XA 2VDRA 3IUMA 1O6FA 3UKUC 3JB9L 1U2VC 3P4FA 3L4MD 3AL9A 4GQ2P 1SQ9A 3SLED 5H14A 2PM7B 2AGWA 3J80g 4A09A 3DWLC 4IMMA 4ERQA 2J56H 4QRJA 1OMWB 2CE8A 2Z2OA 2WQ8A 3SJLD 4WK2A 2HJBA 4ESGA 3ZDZA 3UVNA 3NIFA 2IWFA 3OF7A 4JHNA 4A09B 2EIDA 5A2Qg 3MVDK 4A0BA 5EARA 4CC9A 3PSCB 2QR5A 4GQ1A 2GC4A 1ERJA 3W15A 5GMKn 4BH6A 3AFCA 1TYQC 2AH0A 5HE0B 2H9MA 2XL2A 2YBAA 4ZOZA 5HDBA 1MG3A 2YB8B 3C99A 4Z8LA 4A0BB 1VE6A 3SN6B 5C2VB 3O4JA 4L9OA 2B5NA 3NIDA 3FRXA 5GXIA 3KRWB 2AGLA 5GXHA 2O9KA 4AEZA 4ZN4A 1GOGA 5B4WA 5EMJB 3FCSA 4K3ID 3I8CA 2HKMA 3V9FA 2BCJB 2VDQA 1XIPA 3K71A 4UI9R 4QAMA 5HQGA 4AMZA 4ES0A 3RSEC 5M5VA 2H14A 1M1XA 4Y5RD 4TZ4A 4WJKA 3IUNA 5AMSA 2VDNA 2HU7A 4CI2A 4PBYA 4D0KA 4UM9A 3OL2A 3DDUA 3EI2A 5FQDA 2AGXA 4EWRA 1O6GA 3IURA 2HJ4A 4XEIC 3UR4A 5THAA 3K26A 2I0RA 5FLXg 4CY3A 4O3TB 1H2YA 3EI2B 4J0WA 4X61B 2B4EA 3RMZD 2QC5A 4WK4A 4CZXA 2CE9A 3JROA 3GREA 3I7KA 2H47A 5M5SA 3PXTD 5EAMA 3EQ9A 4J8GA 4CI8A 3JZHA 1SQJA 3SBPA 4GM9A 3ORVD 5EMLB 4J86A 4JSXC 3RN1D 4BP8A 4PBZA 4GM3A 4H5JA 4U1EI 2P9PC 3EQ8A 4NBMA 2MTAH 5EAPA 2GNQA 1JTDB 4KFMB 3V4PA 4GZ8A 1E8MA 5E6SA 1PBYB 1C9IA 2TRCB 3JPXA 3C9CA 4J77A 4LG9A 3SBRA 4XYHA 4J84A 1A0RB 1RI6A 2G9AA 5FFGA 4GGCA 3VH0A 1BPOA 1FWXA 1A12A 2UZYB 3IIWA 3GD1I 2H68A 1T2XA 4FA9D 5AFU3 4BCBA 2XL3A 4L1QD 5EALA 1YR2A 2UZXB 5EMKB 5M5RA 5FKRA 3V4VA 4CI3A 2HKRA 4FAND 3MUNA 4ZOXA 2AQ5A 2VZ1A 2CN3A 5I5JA 3RRMC 1H2XA 4A11A 1MG2A 2I0TA 4FA1D 2H13A 4O3UB 2QZPA 3RFHA 3CFSB 4JT6C 4FWWA 4MMXA 3JZNA 5H17A 4FAVD 2AGZA 4A11B 1C9LA 4NENA
chains in the Genus database with same CATH topology
2I0SA 4FA5D 4JXMA 4OZUA 3IJCA 3SXTD 3EWEA 3MXXA 2EBSA 4CZYA 1OLZA 4CY5A 3SWSD 4A2LA 3DM0A 2HESX 3OKYA 3I7PA 1S4UX 2CN2A 2PM9A 3SMRA 3MMYA 1VYHC 1K8KC 2OIZA 5HYNB 2OJYA 4MK0B 3OKYB 2CO0A 5AJAA 5C2WB 2AGYA 2W18A 3IJ0A 4Y7RA 2PM9B 4J0XA 5TEEA 4J79A 3MZLA 5IJ8E 4E54A 5HE2B 2OK6A 3EI3A 3VGZA 2Q7QA 1P22A 2OVRB 4XYIA 4CI1A 2IURA 2IUPA 5HE1B 4E54B 3EI3B 4CY2A 1TBGA 5FA5B 4GQBB 4GMBA 5FXYA 2B5MA 3F3PA 4I79A 1N6FA 2H6NA 2IAAA 1XHMA 3BWSA 4YVDA 1MDAH 2I3SA 3SFZA 2CO0C 1B9YA 2P9KC 5C9ZB 3BG0A 5IJ7E 4L3HD 2AH1A 3IJ1A 3MKQA 3AH8B 2CNXA 4ZOVA 2H6QA 3JAMg 2P9UC 2OK4A 3PXWD 4QQEA 1NR0A 4JT5C 3EU7A 5SXMA 4FB1D 2P9SC 4GGAA 2J55H 4BL0A 2Z2NA 5K1CC 5FKQA 1Q47A 4E5ZA 3DXKC 3HFQA 3UVKA 5GSAA 4J81A 4D6VA 4O45A 3I7LA 3OKTA 4O9DA 3A0FA 3UVOA 4N14A 4E5ZB 4QL1A 3C5MA 2HXCA 3EI1A 1N6EA 1YFQA 2B5LA 3OKWA 4A0AA 5IGQA 5TDHB 4NSXA 3F3GA 5H1MA 4QT8A 5FKTA 2H9PA 5EMMB 4LGNA 1R5MA 1SHYB 3EI1B 3RN0D 1NEXB 4PC0A 4A0AB 4FHLA 1PEVA 3I8EA 2YNOA 3I7OA 5HE3B 3I89A 1K32A 3SCYA 2QXVA 2H6KA 3GFCA 4K3JB 5EM2A 3K27A 4AOWA 2J57G 2YNNA 4X63B 2P9NC 3PVUB 3DXMC 5CXBA 3CFVA 3SVWD 4J82A 4JSVC 3BG1A 5IGOA 5EM2B 1JOFA 4J87A 1GOTB 3NVQA 5CXBB 3RFGA 1PGUA 4JD2C 4G56B 1L0QA 4IA9A 4L3GD 2P9LC 4J8BA 4GM8A 3IKOA 2P9IC 5CYKA 2BBKH 3JZGA 3N0EA 1XKSA 4ERYA 2HYEA 4CZVA 2OVPB 3VA6A 2PBIB 4X60B 5I5MA 3RLMD 5CYKB 5TF2A 1GG2B 3U4YA 3NVXA 3E0CA 5CXCA 3MZKA 3DSMA 1N6DA 1JJUB 5K19A 1JMZB 3SHFA 4PXWA 4LG8A 2PM6B 2H3XA 2XU7A 5CXCB 5IC7A 2IWKA 5FKSA 3UVMA 4A08A 3C75H 4GGDA 2I3TA 4FA4D 1GP2B 3ZWLB 1QNIA 2YNPA 3I7HA 3UVLA 2XYIA 3B7FA 4A08B 3PXSD 5TEFA 4OWRA 2Z2PA 4U7AA 4J73A 1JMXB 4R7AB 3EI4A 3CIKB 3ULEC 3F3FA 4HDJA 3IIYA 3V7DB 2OVQB 2IUVA 3PVWB 5IT9g 3FGBA 4ZOYA 3NVNA 3EI4B 3L4OD 3OL2B 4CY1A 2H9NA 3N0DA 4JSPC 3AL8A 4PSXB 5KDOB 1PI6A 3I2NA 3JRPA 2GC7A 4PNKB 5I5IA 3AL8B 2YMUA 1GXRA 3KRXB 4H5IA 2G99A 3UKRC 3J81g 3OTTA 3ODTA 4J78A 4O1QD 4X3EA 2H9LA 4JSNC 1U4CA 3I7NA 3SBQA 3PE7A 5JWZA 3PSLA 3EG6A 4A7JA 2IUQA 4BUJC 4A2MA 3EMHA 3MKSB 3V5WB 4ERZA 4PSWB 3OW8A 3FM0A 1B9XA 3UKUC 3JB9L 1U2VC 3P4FA 3L4MD 3AL9A 4GQ2P 1SQ9A 3SLED 5H14A 2PM7B 2AGWA 3J80g 4A09A 3DWLC 4IMMA 4ERQA 2J56H 4QRJA 1OMWB 2CE8A 2Z2OA 3SJLD 2HJBA 4ESGA 3UVNA 2IWFA 4A09B 5A2Qg 4A0BA 5EARA 4CC9A 3PSCB 4GQ1A 2GC4A 1ERJA 3W15A 5GMKn 4BH6A 3AFCA 1TYQC 2AH0A 5HE0B 2H9MA 2XL2A 2YBAA 4ZOZA 1MG3A 2YB8B 3C99A 4Z8LA 4A0BB 3SN6B 5C2VB 4L9OA 2B5NA 3FRXA 5GXIA 3KRWB 2AGLA 5GXHA 2O9KA 4AEZA 4ZN4A 5B4WA 5EMJB 4K3ID 3I8CA 2HKMA 3V9FA 2BCJB 1XIPA 4UI9R 5HQGA 4ES0A 3RSEC 2H14A 4Y5RD 4TZ4A 5AMSA 4CI2A 4PBYA 4D0KA 3OL2A 3EI2A 5FQDA 2AGXA 4EWRA 2HJ4A 4XEIC 3UR4A 5THAA 3K26A 2I0RA 5FLXg 4CY3A 4O3TB 3EI2B 4J0WA 4X61B 2B4EA 3RMZD 2QC5A 4CZXA 2CE9A 3JROA 3GREA 3I7KA 2H47A 3PXTD 5EAMA 4J8GA 4CI8A 3JZHA 1SQJA 3SBPA 4GM9A 3ORVD 5EMLB 4J86A 4JSXC 3RN1D 4PBZA 4GM3A 4H5JA 4U1EI 2P9PC 5EAPA 2MTAH 2GNQA 4KFMB 4GZ8A 1PBYB 2TRCB 4J77A 3JPXA 4LG9A 3C9CA 3SBRA 4XYHA 4J84A 1A0RB 1RI6A 2G9AA 4GGCA 3VH0A 1FWXA 2UZYB 3IIWA 5AFU3 2H68A 4FA9D 2XL3A 4L1QD 5EALA 2UZXB 5EMKB 5FKRA 4CI3A 2HKRA 4FAND 4ZOXA 2AQ5A 2CN3A 5I5JA 3RRMC 4A11A 1MG2A 2I0TA 4FA1D 2H13A 4O3UB 3RFHA 3CFSB 4JT6C 4FWWA 3JZNA 5H17A 4FAVD 2AGZA 4A11B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0S A;  4FA5 D;  4JXM A;  4OZU A;  3IJC A;  3SXT D;  3EWE A;  3MXX A;  2EBS A;  4CZY A;  1OLZ A;  4CY5 A;  3SWS D;  4A2L A;  3DM0 A;  2HES X;  3OKY A;  3I7P A;  1S4U X;  2CN2 A;  2PM9 A;  3SMR A;  3MMY A;  1VYH C;  1K8K C;  2OIZ A;  5HYN B;  2OJY A;  4MK0 B;  3OKY B;  2CO0 A;  5AJA A;  5C2W B;  2AGY A;  2W18 A;  3IJ0 A;  4Y7R A;  2PM9 B;  4J0X A;  5TEE A;  4J79 A;  3MZL A;  5IJ8 E;  4E54 A;  5HE2 B;  2OK6 A;  3EI3 A;  3VGZ A;  2Q7Q A;  1P22 A;  2OVR B;  4XYI A;  4CI1 A;  2IUR A;  2IUP A;  5HE1 B;  4E54 B;  3EI3 B;  4CY2 A;  1TBG A;  5FA5 B;  4GQB B;  4GMB A;  5FXY A;  2B5M A;  3F3P A;  4I79 A;  1N6F A;  2H6N A;  2IAA A;  1XHM A;  3BWS A;  4YVD A;  1MDA H;  2I3S A;  3SFZ A;  2CO0 C;  1B9Y A;  2P9K C;  5C9Z B;  3BG0 A;  5IJ7 E;  4L3H D;  2AH1 A;  3IJ1 A;  3MKQ A;  3AH8 B;  2CNX A;  4ZOV A;  2H6Q A;  3JAM g;  2P9U C;  2OK4 A;  3PXW D;  4QQE A;  1NR0 A;  4JT5 C;  3EU7 A;  5SXM A;  4FB1 D;  2P9S C;  4GGA A;  2J55 H;  4BL0 A;  2Z2N A;  5K1C C;  5FKQ A;  1Q47 A;  4E5Z A;  3DXK C;  3HFQ A;  3UVK A;  5GSA A;  4J81 A;  4D6V A;  4O45 A;  3I7L A;  3OKT A;  4O9D A;  3A0F A;  3UVO A;  4N14 A;  4E5Z B;  4QL1 A;  3C5M A;  2HXC A;  3EI1 A;  1N6E A;  1YFQ A;  2B5L A;  3OKW A;  4A0A A;  5IGQ A;  5TDH B;  4NSX A;  3F3G A;  5H1M A;  4QT8 A;  5FKT A;  2H9P A;  5EMM B;  4LGN A;  1R5M A;  1SHY B;  3EI1 B;  3RN0 D;  1NEX B;  4PC0 A;  4A0A B;  4FHL A;  1PEV A;  3I8E A;  2YNO A;  3I7O A;  5HE3 B;  3I89 A;  1K32 A;  3SCY A;  2QXV A;  2H6K A;  3GFC A;  4K3J B;  5EM2 A;  3K27 A;  4AOW A;  2J57 G;  2YNN A;  4X63 B;  2P9N C;  3PVU B;  3DXM C;  5CXB A;  3CFV A;  3SVW D;  4J82 A;  4JSV C;  3BG1 A;  5IGO A;  5EM2 B;  1JOF A;  4J87 A;  1GOT B;  3NVQ A;  5CXB B;  3RFG A;  1PGU A;  4JD2 C;  4G56 B;  1L0Q A;  4IA9 A;  4L3G D;  2P9L C;  4J8B A;  4GM8 A;  3IKO A;  2P9I C;  5CYK A;  2BBK H;  3JZG A;  3N0E A;  1XKS A;  4ERY A;  2HYE A;  4CZV A;  2OVP B;  3VA6 A;  2PBI B;  4X60 B;  5I5M A;  3RLM D;  5CYK B;  5TF2 A;  1GG2 B;  3U4Y A;  3NVX A;  3E0C A;  5CXC A;  3MZK A;  3DSM A;  1N6D A;  1JJU B;  5K19 A;  1JMZ B;  3SHF A;  4PXW A;  4LG8 A;  2PM6 B;  2H3X A;  2XU7 A;  5CXC B;  5IC7 A;  2IWK A;  5FKS A;  3UVM A;  4A08 A;  3C75 H;  4GGD A;  2I3T A;  4FA4 D;  1GP2 B;  3ZWL B;  1QNI A;  2YNP A;  3I7H A;  3UVL A;  2XYI A;  3B7F A;  4A08 B;  3PXS D;  5TEF A;  4OWR A;  2Z2P A;  4U7A A;  4J73 A;  1JMX B;  4R7A B;  3EI4 A;  3CIK B;  3ULE C;  3F3F A;  4HDJ A;  3IIY A;  3V7D B;  2OVQ B;  2IUV A;  3PVW B;  5IT9 g;  3FGB A;  4ZOY A;  3NVN A;  3EI4 B;  3L4O D;  3OL2 B;  4CY1 A;  2H9N A;  3N0D A;  4JSP C;  3AL8 A;  4PSX B;  5KDO B;  1PI6 A;  3I2N A;  3JRP A;  2GC7 A;  4PNK B;  5I5I A;  3AL8 B;  2YMU A;  1GXR A;  3KRX B;  4H5I A;  2G99 A;  3UKR C;  3J81 g;  3OTT A;  3ODT A;  4J78 A;  4O1Q D;  4X3E A;  2H9L A;  4JSN C;  1U4C A;  3I7N A;  3SBQ A;  3PE7 A;  5JWZ A;  3PSL A;  3EG6 A;  4A7J A;  2IUQ A;  4BUJ C;  4A2M A;  3EMH A;  3MKS B;  3V5W B;  4ERZ A;  4PSW B;  3OW8 A;  3FM0 A;  1B9X A;  3UKU C;  3JB9 L;  1U2V C;  3P4F A;  3L4M D;  3AL9 A;  4GQ2 P;  1SQ9 A;  3SLE D;  5H14 A;  2PM7 B;  2AGW A;  3J80 g;  4A09 A;  3DWL C;  4IMM A;  4ERQ A;  2J56 H;  4QRJ A;  1OMW B;  2CE8 A;  2Z2O A;  3SJL D;  2HJB A;  4ESG A;  3UVN A;  2IWF A;  4A09 B;  5A2Q g;  4A0B A;  5EAR A;  4CC9 A;  3PSC B;  4GQ1 A;  2GC4 A;  1ERJ A;  3W15 A;  5GMK n;  4BH6 A;  3AFC A;  1TYQ C;  2AH0 A;  5HE0 B;  2H9M A;  2XL2 A;  2YBA A;  4ZOZ A;  1MG3 A;  2YB8 B;  3C99 A;  4Z8L A;  4A0B B;  3SN6 B;  5C2V B;  4L9O A;  2B5N A;  3FRX A;  5GXI A;  3KRW B;  2AGL A;  5GXH A;  2O9K A;  4AEZ A;  4ZN4 A;  5B4W A;  5EMJ B;  4K3I D;  3I8C A;  2HKM A;  3V9F A;  2BCJ B;  1XIP A;  4UI9 R;  5HQG A;  4ES0 A;  3RSE C;  2H14 A;  4Y5R D;  4TZ4 A;  5AMS A;  4CI2 A;  4PBY A;  4D0K A;  3OL2 A;  3EI2 A;  5FQD A;  2AGX A;  4EWR A;  2HJ4 A;  4XEI C;  3UR4 A;  5THA A;  3K26 A;  2I0R A;  5FLX g;  4CY3 A;  4O3T B;  3EI2 B;  4J0W A;  4X61 B;  2B4E A;  3RMZ D;  2QC5 A;  4CZX A;  2CE9 A;  3JRO A;  3GRE A;  3I7K A;  2H47 A;  3PXT D;  5EAM A;  4J8G A;  4CI8 A;  3JZH A;  1SQJ A;  3SBP A;  4GM9 A;  3ORV D;  5EML B;  4J86 A;  4JSX C;  3RN1 D;  4PBZ A;  4GM3 A;  4H5J A;  4U1E I;  2P9P C;  5EAP A;  2MTA H;  2GNQ A;  4KFM B;  4GZ8 A;  1PBY B;  2TRC B;  4J77 A;  3JPX A;  4LG9 A;  3C9C A;  3SBR A;  4XYH A;  4J84 A;  1A0R B;  1RI6 A;  2G9A A;  4GGC A;  3VH0 A;  1FWX A;  2UZY B;  3IIW A;  5AFU 3;  2H68 A;  4FA9 D;  2XL3 A;  4L1Q D;  5EAL A;  2UZX B;  5EMK B;  5FKR A;  4CI3 A;  2HKR A;  4FAN D;  4ZOX A;  2AQ5 A;  2CN3 A;  5I5J A;  3RRM C;  4A11 A;  1MG2 A;  2I0T A;  4FA1 D;  2H13 A;  4O3U B;  3RFH A;  3CFS B;  4JT6 C;  4FWW A;  3JZN A;  5H17 A;  4FAV D;  2AGZ A;  4A11 B; 
#chains in the Genus database with same CATH topology
 2I0S A;  4NC4 A;  4FA5 D;  4JXM A;  3NIG A;  4OZU A;  3FCU A;  4BCD A;  4RE5 A;  3IJC A;  3SXT D;  3EWE A;  3MUO A;  3MXX A;  2EBS A;  4BP9 A;  4CZY A;  3IUJ A;  1OLZ A;  4CY5 A;  3IVM A;  2EIB A;  3SWS D;  4A2L A;  3DM0 A;  2HES X;  3OKY A;  3I7P A;  1S4U X;  2CN2 A;  4MMY A;  2PM9 A;  1U8C A;  3MMY A;  3SMR A;  1VYH C;  1K8K C;  2OIZ A;  5HYN B;  1UOO A;  2OJY A;  4MK0 B;  3OKY B;  4MMZ A;  2CO0 A;  5AJA A;  4AN1 A;  5C2W B;  2AGY A;  2W18 A;  3IJ0 A;  4Y7R A;  2PM9 B;  2VDM A;  4J0X A;  5TEE A;  4J79 A;  1E5T A;  3MZL A;  5IJ8 E;  4E54 A;  5HE2 B;  2OK6 A;  3EI3 A;  1QFS A;  3VGZ A;  2Q7Q A;  1P22 A;  3O4I A;  2OVR B;  4XYI A;  4CI1 A;  2IUR A;  2IUP A;  5HE1 B;  3IUQ A;  4E54 B;  4AMY A;  3ZDX A;  3EI3 B;  4CY2 A;  1TBG A;  2VDO A;  3O4G A;  5FA5 B;  3IJE A;  4GQB B;  1L5G A;  4JHP C;  4G55 A;  4GMB A;  5FXY A;  2B5M A;  3F3P A;  4I79 A;  1N6F A;  2H6N A;  3VI4 A;  2IAA A;  1XHM A;  3BWS A;  4YVD A;  3ZE0 A;  1MDA H;  4D9S A;  2I3S A;  3SFZ A;  2CO0 C;  1B9Y A;  2P9K C;  4G1E A;  5C9Z B;  4AN0 A;  3GC3 B;  3BG0 A;  5IJ7 E;  4L3H D;  2AH1 A;  3IJ1 A;  3MKQ A;  3AH8 B;  2CNX A;  2HU8 A;  4ZOV A;  5FFO A;  2H6Q A;  5C92 A;  2P9U C;  2OK4 A;  3PXW D;  3JAM g;  4QQE A;  1NR0 A;  4JT5 C;  3EU7 A;  5SXM A;  1TYE A;  4FB1 D;  3K72 A;  1VE7 A;  2P9S C;  4GGA A;  2J55 H;  3EQ7 A;  1UOQ A;  4BL0 A;  2Z2N A;  5K1C C;  4DNU A;  5FKQ A;  1Q47 A;  3ZE1 A;  5E6U A;  3DXK C;  3HFQ A;  3UVK A;  2JKX A;  5GSA A;  4E5Z A;  4J81 A;  4D6V A;  4O45 A;  3I7L A;  3OKT A;  4O9D A;  3A0F A;  3UVO A;  4N14 A;  4E5Z B;  4QL1 A;  3C5M A;  3T3M A;  2HXC A;  4O02 A;  3EI1 A;  1N6E A;  1YFQ A;  2B5L A;  1VZ2 A;  3OKW A;  2VDK A;  5IGQ A;  4A0A A;  2BKL A;  5TDH B;  4NSX A;  3F3G A;  5H1M A;  4QT8 A;  5FKT A;  4RE6 A;  2H9P A;  2XZG A;  5EMM B;  4Z7O A;  4LGN A;  1R5M A;  1SHY B;  3EI1 B;  3RN0 D;  1NEX B;  4PC0 A;  4A0A B;  3IUL A;  1PEV A;  3I8E A;  4FHL A;  2YNO A;  3I7O A;  5HE3 B;  3I89 A;  1K32 A;  3SCY A;  2QXV A;  2H6K A;  3GFC A;  4K3J B;  4UM8 A;  3K27 A;  5EM2 A;  3T3P A;  4AOW A;  2J57 G;  2YNN A;  4DNV A;  4X63 B;  2P9N C;  4O2W A;  2VC2 A;  3PVU B;  3DXM C;  5CXB A;  3CFV A;  3SVW D;  4J82 A;  4JSV C;  3BG1 A;  4WK0 A;  5IGO A;  5EM2 B;  1JOF A;  4J87 A;  1GOT B;  3NVQ A;  4Z7N A;  5CXB B;  3RFG A;  1PGU A;  4BCC A;  2VZ3 A;  4JD2 C;  4G56 B;  1L0Q A;  3O4H A;  4IA9 A;  2P9L C;  4L3G D;  4J8B A;  1I2M B;  4GM8 A;  2VDL A;  3IKO A;  2P9I C;  5CYK A;  3QI0 A;  2BBK H;  3JZG A;  1UTC A;  3N0E A;  1XKS A;  4ERY A;  5C86 A;  1GOH A;  2HYE A;  4CZV A;  2OVP B;  1E8N A;  3VA6 A;  2PBI B;  4X60 B;  4AX4 A;  5I5M A;  3RLM D;  5CYK B;  1GOF A;  5TF2 A;  1GG2 B;  1K3I A;  3U4Y A;  3NVX A;  3E0C A;  5CXC A;  3ZDY A;  3MZK A;  1H2W A;  3DSM A;  1N6D A;  1JJU B;  5K19 A;  1JMZ B;  3SHF A;  4PXW A;  2PM6 B;  4LG8 A;  1H2Z A;  2H3X A;  2XU7 A;  5CXC B;  5IC7 A;  3VI3 A;  2HU5 A;  2IWK A;  5FKS A;  3UVM A;  5M5T A;  4A08 A;  1JV2 A;  3C75 H;  4GGD A;  1UOP A;  2XDW A;  2I3T A;  4FA4 D;  1GP2 B;  3ZWL B;  1QNI A;  2YNP A;  3I7H A;  3UVL A;  2XE4 A;  2XYI A;  3B7F A;  4A08 B;  3PXS D;  5TEF A;  4OWR A;  4G1M A;  2Z2P A;  4U7A A;  4J73 A;  3KCI A;  1JMX B;  4R7A B;  1VZ3 A;  3EI4 A;  3CIK B;  3ULE C;  3F3F A;  4HDJ A;  3IIY A;  3V7D B;  3QHY B;  2OVQ B;  2IUV A;  3PVW B;  5IT9 g;  3FGB A;  4ZOY A;  3NVN A;  3EI4 B;  4DNW A;  1QFM A;  3L4O D;  3OL2 B;  4CY1 A;  5E6R A;  2H9N A;  3N0D A;  4NAA A;  4JSP C;  3AL8 A;  4L1M A;  4PSX B;  5KDO B;  1PI6 A;  3I2N A;  3JRP A;  5M5U A;  2GC7 A;  4PNK B;  3ZE2 A;  5I5I A;  3AL8 B;  2YMU A;  1GXR A;  3KRX B;  4H5I A;  2G99 A;  3UKR C;  4IRZ A;  3J81 g;  3OTT A;  3ODT A;  4J78 A;  4O1Q D;  4X3E A;  2VDP A;  2H9L A;  4JSN C;  1U4C A;  3K6S A;  3I7N A;  3SBQ A;  2EIE A;  3PE7 A;  4Z7Q A;  5JWZ A;  3PSL A;  3EG6 A;  4A7J A;  2IUQ A;  4BUJ C;  4A2M A;  3EMH A;  3MKS B;  2EIC A;  3V5W B;  4ERZ A;  5M61 A;  4PSW B;  3OW8 A;  3FM0 A;  1B9X A;  2VDR A;  3IUM A;  1O6F A;  3UKU C;  3JB9 L;  1U2V C;  3P4F A;  3L4M D;  3AL9 A;  4GQ2 P;  1SQ9 A;  3SLE D;  5H14 A;  2PM7 B;  2AGW A;  3J80 g;  4A09 A;  3DWL C;  4IMM A;  4ERQ A;  2J56 H;  4QRJ A;  1OMW B;  2CE8 A;  2Z2O A;  2WQ8 A;  3SJL D;  4WK2 A;  2HJB A;  4ESG A;  3ZDZ A;  3UVN A;  3NIF A;  2IWF A;  3OF7 A;  4JHN A;  4A09 B;  2EID A;  5A2Q g;  3MVD K;  4A0B A;  5EAR A;  4CC9 A;  3PSC B;  2QR5 A;  4GQ1 A;  2GC4 A;  1ERJ A;  3W15 A;  5GMK n;  4BH6 A;  3AFC A;  1TYQ C;  2AH0 A;  5HE0 B;  2H9M A;  2XL2 A;  2YBA A;  4ZOZ A;  5HDB A;  1MG3 A;  2YB8 B;  3C99 A;  4Z8L A;  4A0B B;  1VE6 A;  3SN6 B;  5C2V B;  3O4J A;  4L9O A;  2B5N A;  3NID A;  3FRX A;  5GXI A;  3KRW B;  2AGL A;  5GXH A;  2O9K A;  4AEZ A;  4ZN4 A;  1GOG A;  5B4W A;  5EMJ B;  3FCS A;  4K3I D;  3I8C A;  2HKM A;  3V9F A;  2BCJ B;  2VDQ A;  1XIP A;  3K71 A;  4UI9 R;  4QAM A;  5HQG A;  4AMZ A;  4ES0 A;  3RSE C;  5M5V A;  2H14 A;  1M1X A;  4Y5R D;  4TZ4 A;  4WJK A;  3IUN A;  5AMS A;  2VDN A;  2HU7 A;  4CI2 A;  4PBY A;  4D0K A;  4UM9 A;  3OL2 A;  3DDU A;  3EI2 A;  5FQD A;  2AGX A;  4EWR A;  1O6G A;  3IUR A;  2HJ4 A;  4XEI C;  3UR4 A;  5THA A;  3K26 A;  2I0R A;  5FLX g;  4CY3 A;  4O3T B;  1H2Y A;  3EI2 B;  4J0W A;  4X61 B;  2B4E A;  3RMZ D;  2QC5 A;  4WK4 A;  4CZX A;  2CE9 A;  3JRO A;  3GRE A;  3I7K A;  2H47 A;  5M5S A;  3PXT D;  5EAM A;  3EQ9 A;  4J8G A;  4CI8 A;  3JZH A;  1SQJ A;  3SBP A;  4GM9 A;  3ORV D;  5EML B;  4J86 A;  4JSX C;  3RN1 D;  4BP8 A;  4PBZ A;  4GM3 A;  4H5J A;  4U1E I;  2P9P C;  3EQ8 A;  4NBM A;  2MTA H;  5EAP A;  2GNQ A;  1JTD B;  4KFM B;  3V4P A;  4GZ8 A;  1E8M A;  5E6S A;  1PBY B;  1C9I A;  2TRC B;  3JPX A;  3C9C A;  4J77 A;  4LG9 A;  3SBR A;  4XYH A;  4J84 A;  1A0R B;  1RI6 A;  2G9A A;  5FFG A;  4GGC A;  3VH0 A;  1BPO A;  1FWX A;  1A12 A;  2UZY B;  3IIW A;  3GD1 I;  2H68 A;  1T2X A;  4FA9 D;  5AFU 3;  4BCB A;  2XL3 A;  4L1Q D;  5EAL A;  1YR2 A;  2UZX B;  5EMK B;  5M5R A;  5FKR A;  3V4V A;  4CI3 A;  2HKR A;  4FAN D;  3MUN A;  4ZOX A;  2AQ5 A;  2VZ1 A;  2CN3 A;  5I5J A;  3RRM C;  1H2X A;  4A11 A;  1MG2 A;  2I0T A;  4FA1 D;  2H13 A;  4O3U B;  2QZP A;  3RFH A;  3CFS B;  4JT6 C;  4FWW A;  4MMX A;  3JZN A;  5H17 A;  4FAV D;  2AGZ A;  4A11 B;  1C9L A;  4NEN A; 
#chains in the Genus database with same CATH homology
 2I0S A;  4FA5 D;  4JXM A;  4OZU A;  3IJC A;  3SXT D;  3EWE A;  3MXX A;  2EBS A;  4CZY A;  1OLZ A;  4CY5 A;  3SWS D;  4A2L A;  3DM0 A;  2HES X;  3OKY A;  3I7P A;  1S4U X;  2CN2 A;  2PM9 A;  3SMR A;  3MMY A;  1VYH C;  1K8K C;  2OIZ A;  5HYN B;  2OJY A;  4MK0 B;  3OKY B;  2CO0 A;  5AJA A;  5C2W B;  2AGY A;  2W18 A;  3IJ0 A;  4Y7R A;  2PM9 B;  4J0X A;  5TEE A;  4J79 A;  3MZL A;  5IJ8 E;  4E54 A;  5HE2 B;  2OK6 A;  3EI3 A;  3VGZ A;  2Q7Q A;  1P22 A;  2OVR B;  4XYI A;  4CI1 A;  2IUR A;  2IUP A;  5HE1 B;  4E54 B;  3EI3 B;  4CY2 A;  1TBG A;  5FA5 B;  4GQB B;  4GMB A;  5FXY A;  2B5M A;  3F3P A;  4I79 A;  1N6F A;  2H6N A;  2IAA A;  1XHM A;  3BWS A;  4YVD A;  1MDA H;  2I3S A;  3SFZ A;  2CO0 C;  1B9Y A;  2P9K C;  5C9Z B;  3BG0 A;  5IJ7 E;  4L3H D;  2AH1 A;  3IJ1 A;  3MKQ A;  3AH8 B;  2CNX A;  4ZOV A;  2H6Q A;  3JAM g;  2P9U C;  2OK4 A;  3PXW D;  4QQE A;  1NR0 A;  4JT5 C;  3EU7 A;  5SXM A;  4FB1 D;  2P9S C;  4GGA A;  2J55 H;  4BL0 A;  2Z2N A;  5K1C C;  5FKQ A;  1Q47 A;  4E5Z A;  3DXK C;  3HFQ A;  3UVK A;  5GSA A;  4J81 A;  4D6V A;  4O45 A;  3I7L A;  3OKT A;  4O9D A;  3A0F A;  3UVO A;  4N14 A;  4E5Z B;  4QL1 A;  3C5M A;  2HXC A;  3EI1 A;  1N6E A;  1YFQ A;  2B5L A;  3OKW A;  4A0A A;  5IGQ A;  5TDH B;  4NSX A;  3F3G A;  5H1M A;  4QT8 A;  5FKT A;  2H9P A;  5EMM B;  4LGN A;  1R5M A;  1SHY B;  3EI1 B;  3RN0 D;  1NEX B;  4PC0 A;  4A0A B;  4FHL A;  1PEV A;  3I8E A;  2YNO A;  3I7O A;  5HE3 B;  3I89 A;  1K32 A;  3SCY A;  2QXV A;  2H6K A;  3GFC A;  4K3J B;  5EM2 A;  3K27 A;  4AOW A;  2J57 G;  2YNN A;  4X63 B;  2P9N C;  3PVU B;  3DXM C;  5CXB A;  3CFV A;  3SVW D;  4J82 A;  4JSV C;  3BG1 A;  5IGO A;  5EM2 B;  1JOF A;  4J87 A;  1GOT B;  3NVQ A;  5CXB B;  3RFG A;  1PGU A;  4JD2 C;  4G56 B;  1L0Q A;  4IA9 A;  4L3G D;  2P9L C;  4J8B A;  4GM8 A;  3IKO A;  2P9I C;  5CYK A;  2BBK H;  3JZG A;  3N0E A;  1XKS A;  4ERY A;  2HYE A;  4CZV A;  2OVP B;  3VA6 A;  2PBI B;  4X60 B;  5I5M A;  3RLM D;  5CYK B;  5TF2 A;  1GG2 B;  3U4Y A;  3NVX A;  3E0C A;  5CXC A;  3MZK A;  3DSM A;  1N6D A;  1JJU B;  5K19 A;  1JMZ B;  3SHF A;  4PXW A;  4LG8 A;  2PM6 B;  2H3X A;  2XU7 A;  5CXC B;  5IC7 A;  2IWK A;  5FKS A;  3UVM A;  4A08 A;  3C75 H;  4GGD A;  2I3T A;  4FA4 D;  1GP2 B;  3ZWL B;  1QNI A;  2YNP A;  3I7H A;  3UVL A;  2XYI A;  3B7F A;  4A08 B;  3PXS D;  5TEF A;  4OWR A;  2Z2P A;  4U7A A;  4J73 A;  1JMX B;  4R7A B;  3EI4 A;  3CIK B;  3ULE C;  3F3F A;  4HDJ A;  3IIY A;  3V7D B;  2OVQ B;  2IUV A;  3PVW B;  5IT9 g;  3FGB A;  4ZOY A;  3NVN A;  3EI4 B;  3L4O D;  3OL2 B;  4CY1 A;  2H9N A;  3N0D A;  4JSP C;  3AL8 A;  4PSX B;  5KDO B;  1PI6 A;  3I2N A;  3JRP A;  2GC7 A;  4PNK B;  5I5I A;  3AL8 B;  2YMU A;  1GXR A;  3KRX B;  4H5I A;  2G99 A;  3UKR C;  3J81 g;  3OTT A;  3ODT A;  4J78 A;  4O1Q D;  4X3E A;  2H9L A;  4JSN C;  1U4C A;  3I7N A;  3SBQ A;  3PE7 A;  5JWZ A;  3PSL A;  3EG6 A;  4A7J A;  2IUQ A;  4BUJ C;  4A2M A;  3EMH A;  3MKS B;  3V5W B;  4ERZ A;  4PSW B;  3OW8 A;  3FM0 A;  1B9X A;  3UKU C;  3JB9 L;  1U2V C;  3P4F A;  3L4M D;  3AL9 A;  4GQ2 P;  1SQ9 A;  3SLE D;  5H14 A;  2PM7 B;  2AGW A;  3J80 g;  4A09 A;  3DWL C;  4IMM A;  4ERQ A;  2J56 H;  4QRJ A;  1OMW B;  2CE8 A;  2Z2O A;  3SJL D;  2HJB A;  4ESG A;  3UVN A;  2IWF A;  4A09 B;  5A2Q g;  4A0B A;  5EAR A;  4CC9 A;  3PSC B;  4GQ1 A;  2GC4 A;  1ERJ A;  3W15 A;  5GMK n;  4BH6 A;  3AFC A;  1TYQ C;  2AH0 A;  5HE0 B;  2H9M A;  2XL2 A;  2YBA A;  4ZOZ A;  1MG3 A;  2YB8 B;  3C99 A;  4Z8L A;  4A0B B;  3SN6 B;  5C2V B;  4L9O A;  2B5N A;  3FRX A;  5GXI A;  3KRW B;  2AGL A;  5GXH A;  2O9K A;  4AEZ A;  4ZN4 A;  5B4W A;  5EMJ B;  4K3I D;  3I8C A;  2HKM A;  3V9F A;  2BCJ B;  1XIP A;  4UI9 R;  5HQG A;  4ES0 A;  3RSE C;  2H14 A;  4Y5R D;  4TZ4 A;  5AMS A;  4CI2 A;  4PBY A;  4D0K A;  3OL2 A;  3EI2 A;  5FQD A;  2AGX A;  4EWR A;  2HJ4 A;  4XEI C;  3UR4 A;  5THA A;  3K26 A;  2I0R A;  5FLX g;  4CY3 A;  4O3T B;  3EI2 B;  4J0W A;  4X61 B;  2B4E A;  3RMZ D;  2QC5 A;  4CZX A;  2CE9 A;  3JRO A;  3GRE A;  3I7K A;  2H47 A;  3PXT D;  5EAM A;  4J8G A;  4CI8 A;  3JZH A;  1SQJ A;  3SBP A;  4GM9 A;  3ORV D;  5EML B;  4J86 A;  4JSX C;  3RN1 D;  4PBZ A;  4GM3 A;  4H5J A;  4U1E I;  2P9P C;  5EAP A;  2MTA H;  2GNQ A;  4KFM B;  4GZ8 A;  1PBY B;  2TRC B;  4J77 A;  3JPX A;  4LG9 A;  3C9C A;  3SBR A;  4XYH A;  4J84 A;  1A0R B;  1RI6 A;  2G9A A;  4GGC A;  3VH0 A;  1FWX A;  2UZY B;  3IIW A;  5AFU 3;  2H68 A;  4FA9 D;  2XL3 A;  4L1Q D;  5EAL A;  2UZX B;  5EMK B;  5FKR A;  4CI3 A;  2HKR A;  4FAN D;  4ZOX A;  2AQ5 A;  2CN3 A;  5I5J A;  3RRM C;  4A11 A;  1MG2 A;  2I0T A;  4FA1 D;  2H13 A;  4O3U B;  3RFH A;  3CFS B;  4JT6 C;  4FWW A;  3JZN A;  5H17 A;  4FAV D;  2AGZ A;  4A11 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...