3PSLA

Fine-tuning the stimulation of mll1 methyltransferase activity by a histone h3 based peptide mimetic
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
303
structure length
298
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Fine-tuning the stimulation of MLL1 methyltransferase activity by a histone H3-based peptide mimetic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 98
structure length 298
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3pslA00
5FA5B 4NSXA 4BL0A 4PSWB 1P22A 3SBRA 4J77A 4JSVC 3C75H 5EAPA 3F3PA 1GOTB 1SHYB 2O9KA 2UZYB 2J57G 4XEIC 3PVUB 4BUJC 2XYIA 4JT6C 2IUQA 5GMKn 5H17A 5I5MA 4H5IA 4GM8A 4OWRA 4ESGA 4IA9A 3OKTA 1ERJA 2YNPA 2H9NA 3PSCB 4FHLA 4JXMA 4CY3A 5HE2B 2PBIB 3I8CA 4ZOZA 2HJ4A 5IJ7E 4O45A 3DXMC 4A7JA 4CZVA 2H9LA 3SLED 2P9KC 4QRJA 5IJ8E 5IGQA 4A09B 4J79A 3IJ0A 3N0DA 1XKSA 3JZNA 5FLXg 2PM9B 4CY1A 4LG8A 3A0FA 3U4YA 2G99A 4E5ZB 4G56B 3ORVD 5FXYA 4H5JA 3MZKA 3AFCA 3MZLA 5IC7A 1QNIA 3JPXA 2OVPB 2I3TA 5EMJB 2CN2A 2YMUA 2Z2NA 4A09A 1K8KC 4IMMA 3L4MD 3SN6B 5GSAA 2TRCB 4ZOVA 3N0EA 4A2LA 5HE1B 1GG2B 2YBAA 4CI1A 2IUPA 3I2NA 4X60B 4O9DA 3CFSB 5AFU3 4X63B 5AJAA 3UVMA 4FWWA 4E5ZA 1U4CA 3OL2B 4QQEA 4D0KA 3RRMC 1GP2B 4CZXA 2AGLA 3UVOA 4J8BA 5HE3B 2BBKH 4PXWA 4CI3A 3SWSD 3V9FA 3F3GA 1JMZB 3KRXB 3F3FA 2B4EA 3FGBA 4JD2C 3KRWB 5C9ZB 2IAAA 4EWRA 3MMYA 4HDJA 1U2VC 4BH6A 4FAND 2H47A 3OKWA 4U1EI 5TDHB 1MG3A 2XU7A 4KFMB 1A0RB 1XHMA 3ODTA 2P9IC 2P9SC 4N14A 3OTTA 4J8GA 3I89A 3UVNA 3EMHA 1XIPA 3CFVA 2I3SA 3RSEC 2I0RA 2I0SA 3ZWLB 3OKYB 2H6QA 3RLMD 3FRXA 2HKMA 2OVQB 5K19A 4E54B 3NVQA 3SFZA 5TF2A 4ERQA 4PBZA 3SCYA 2H9PA 5EMLB 3IIYA 2HJBA 3C99A 3EI4B 1Q47A 1B9YA 4L3GD 4J81A 4PC0A 3ULEC 3GREA 3OKYA 3UKRC 4ZOYA 2G9AA 4E54A 5B4WA 3B7FA 4FA1D 3JZGA 2H3XA 4TZ4A 3EI4A 3EWEA 2YNOA 4A0BB 2H6NA 2J55H 2P9UC 1JOFA 4FA9D 4ES0A 4L1QD 4OZUA 5FKTA 3RFGA 3BG1A 4O3TB 4J0WA 2CE9A 2OIZA 2BCJB 2IWFA 2CN3A 3CIKB 4A0BA 3IJ1A 4J87A 2W18A 5HE0B 1PBYB 5TEFA 1R5MA 3IJCA 4GM3A 2H68A 3V5WB 3SMRA 2IUVA 5SXMA 4UI9R 3UVLA 3V7DB 3PE7A 4JSPC 3MKSB 2OJYA 3E0CA 1L0QA 5C2VB 2H13A 4XYHA 3SBPA 4FB1D 5JWZA 2AGYA 4QL1A 4GGAA 4CI8A 3NVNA 3SBQA 4A11B 4O3UB 2YB8B 4PNKB 3RFHA 2AGZA 4MK0B 4ERZA 4A08A 3I8EA 2YNNA 3BWSA 4A0AB 4K3ID 5FQDA 3AL9A 4X61B 5FKQA 3L4OD 1MG2A 1VYHC 2AGXA 4D6VA 4PBYA 4ZOXA 4A11A 1B9XA 4JT5C 4O1QD 5CYKB 1PI6A 4CI2A 2I0TA 3P4FA 4FAVD 4I79A 5HYNB 4A0AA 4ZN4A 3I7PA 2AQ5A 4LGNA 5AMSA 4GQ1A 2J56H 3MKQA 4GMBA 5EMKB 2MTAH 2XL2A 1TYQC 2P9NC 5CYKA 3JZHA 2CO0A 1SQJA 4FA5D 4GQ2P 1GXRA 1OLZA 5EAMA 2HXCA 2UZXB 5CXCA 2OK6A 3C5MA 3I7NA 5GXIA 3BG0A 5EMMB 5FKRA 3RMZD 4FA4D 4QT8A 2GC4A 2GNQA 2OVRB 2B5NA 4XYIA 3RN1D 3J81g 5H14A 2B5LA 1N6DA 3DSMA 4J82A 1OMWB 3UVKA 4Y7RA 3JROA 4R7AB 3VGZA 2IWKA 4GZ8A 4A2MA 1SQ9A 5THAA 3NVXA 3AH8B 3K27A 5K1CC 5EM2B 1NEXB 4Z8LA 4U7AA 2QC5A 3PVWB 2EBSA 2QXVA 3PXSD 4X3EA 3DXKC 5HQGA 4CY2A 4GGCA 3SJLD 3EI2B 2IURA 5GXHA 3JB9L 2AGWA 4PSXB 3EG6A 3PXTD 4CC9A 5A2Qg 4A08B 3I7HA 5EM2A 5EALA 3SXTD 3AL8B 3UKUC 4Y5RD 1JJUB 1S4UX 5C2WB 2CNXA 1PEVA 1FWXA 3C9CA 2XL3A 3IIWA 4GGDA 4LG9A 3W15A 4AOWA 3GFCA 2Q7QA 3EI3B 3EI2A 3I7KA 5H1MA 3EU7A 3PSLA 5KDOB 3I7LA 1K32A 3IKOA 3AL8A 3OW8A 3VH0A 1PGUA 1YFQA 2PM9A 3SVWD 1JMXB 1MDAH 4ERYA 2H9MA 1NR0A 3DWLC 2AH0A 2OK4A 2P9PC 4CY5A 3EI3A 3HFQA 4L9OA 5I5IA 5I5JA 3EI1B 4J78A 1N6FA 3SHFA 4GM9A 4AEZA 2CO0C 2GC7A 3JRPA 3JAMg 2Z2PA 2Z2OA 3K26A 3PXWD 5CXCB 5CXBB 5TEEA 4GQBB 2AH1A 2HYEA 2PM6B 4J73A 3OL2A 5FKSA 4L3HD 2HKRA 4YVDA 3EI1A 5EARA 3J80g 4J0XA 4JSXC 3FM0A 4CZYA 1N6EA 3MXXA 3I7OA 5IGOA 2P9LC 3DM0A 2CE8A 1TBGA 2B5MA 4JSNC 5CXBA 3VA6A 4J86A 1RI6A 5IT9g 2H6KA 3UR4A 2PM7B 2H14A 2HESX 3RN0D 4K3JB 4J84A
chains in the Genus database with same CATH superfamily
1O6GA 2XE4A 5FA5B 4NSXA 4BL0A 4PSWB 1P22A 3SBRA 4J77A 4JSVC 5M5RA 3C75H 5C86A 5EAPA 3F3PA 2XZGA 1GOTB 1SHYB 2O9KA 2UZYB 4AN1A 1UOQA 2J57G 3ZE0A 4XEIC 3PVUB 4BCCA 1C9IA 4BUJC 2XYIA 4JT6C 2IUQA 5GMKn 5H17A 5I5MA 4H5IA 4GM8A 4OWRA 4ESGA 4IA9A 3OKTA 1ERJA 2YNPA 2H9NA 4BP8A 5FFOA 3PSCB 2HU7A 1U8CA 4FHLA 4JXMA 1A12A 2VZ3A 4CY3A 5HE2B 2PBIB 3I8CA 4ZOZA 2HJ4A 5IJ7E 1E5TA 4O45A 3DXMC 4A7JA 4CZVA 2H9LA 3SLED 2P9KC 4QRJA 1T2XA 5IJ8E 5IGQA 4A09B 1JV2A 1H2XA 4J79A 1I2MB 3IJ0A 3N0DA 1XKSA 3JZNA 5FLXg 2PM9B 4CY1A 4LG8A 4MMYA 3A0FA 3U4YA 2G99A 4E5ZB 4G56B 3ORVD 5FXYA 4H5JA 1QFSA 3MZKA 3AFCA 3MZLA 5IC7A 1QNIA 3JPXA 3EQ9A 3IVMA 2OVPB 2I3TA 5EMJB 2CN2A 2YMUA 2Z2NA 4A09A 1K8KC 1E8NA 3L4MD 4IMMA 3SN6B 5GSAA 2TRCB 4ZOVA 2VDNA 3N0EA 4A2LA 5HE1B 1GG2B 2YBAA 4CI1A 2IUPA 3I2NA 4X60B 4O9DA 3CFSB 3IUNA 5E6SA 5AFU3 4X63B 5AJAA 3UVMA 4FWWA 4E5ZA 2VDQA 1U4CA 3OL2B 4QQEA 4L1MA 4D0KA 3V4VA 4AMZA 4DNVA 3RRMC 1GP2B 4CZXA 2AGLA 3UVOA 4J8BA 5HE3B 2BBKH 4PXWA 2XDWA 3SWSD 4CI3A 3V9FA 4MMZA 3F3GA 1GOHA 1JMZB 3KRXB 3F3FA 2B4EA 3FGBA 4JD2C 3KRWB 5C9ZB 2IAAA 4EWRA 3MMYA 4HDJA 1U2VC 4BH6A 3VI3A 4FAND 2H47A 3OKWA 4U1EI 5E6RA 3GC3B 4NAAA 5TDHB 1MG3A 3T3PA 4AMYA 2VZ1A 1UOOA 2XU7A 3O4IA 4KFMB 1A0RB 1XHMA 3ODTA 2P9IC 1O6FA 2P9SC 4N14A 3K6SA 3OTTA 4J8GA 3I89A 2VDPA 3UVNA 3EMHA 1XIPA 3CFVA 2I3SA 3RSEC 2I0RA 2I0SA 3ZWLB 1H2YA 3OKYB 2H6QA 3RLMD 3FRXA 2HKMA 2OVQB 5K19A 4E54B 3NVQA 3SFZA 5TF2A 4ERQA 4PBZA 4JHNA 3SCYA 2H9PA 2VDMA 4IRZA 5EMLB 3IIYA 1GOFA 2HJBA 3C99A 3EI4B 1Q47A 1B9YA 2HU5A 2BKLA 4L3GD 4J81A 4PC0A 3ULEC 3GREA 3OKYA 1L5GA 4AN0A 4D9SA 4G1EA 3UKRC 4ZOYA 1VZ2A 2G9AA 4E54A 3IULA 5B4WA 1VE6A 3B7FA 4FA1D 3JZGA 1VZ3A 2H3XA 4TZ4A 3EI4A 3O4HA 3EWEA 2YNOA 3O4JA 4A0BB 2H6NA 2J55H 4UM9A 2P9UC 1JOFA 4FA9D 3IURA 4L1QD 4OZUA 5FKTA 4ES0A 3NIFA 3FCUA 3BG1A 4O3TB 3RFGA 4J0WA 3ZE1A 2CE9A 2EICA 2OIZA 4Z7NA 5M5SA 3T3MA 2BCJB 2IWFA 3ZDXA 2CN3A 3CIKB 4A0BA 3IJ1A 4J87A 2W18A 5HE0B 1PBYB 3IUJA 5TEFA 1R5MA 3IJCA 4GM3A 2H68A 5M61A 3V5WB 3SMRA 2IUVA 5SXMA 4UI9R 3UVLA 3V7DB 3PE7A 1GOGA 3MKSB 2OJYA 4JSPC 3E0CA 1L0QA 3QI0A 2HU8A 5M5UA 5C2VB 3IJEA 2H13A 4XYHA 3SBPA 4FB1D 5JWZA 2AGYA 4QL1A 4NC4A 4GGAA 4CI8A 3NVNA 3SBQA 4A11B 4O3UB 2YB8B 4PNKB 3RFHA 2AGZA 4WK4A 3K71A 4MK0B 4ERZA 4NENA 4A08A 3I8EA 3IUQA 2YNNA 2QZPA 3BWSA 4A0AB 4K3ID 3ZE2A 5FQDA 3AL9A 4X61B 5FKQA 3L4OD 1MG2A 1VYHC 4WJKA 2AGXA 4D6VA 4PBYA 4ZOXA 4WK0A 4A11A 1B9XA 4JT5C 4O1QD 3EQ8A 5CYKB 4MMXA 2VDOA 5HDBA 1BPOA 1PI6A 4RE5A 4CI2A 2I0TA 3P4FA 2JKXA 1M1XA 1VE7A 4FAVD 2EIBA 4I79A 5HYNB 4A0AA 1C9LA 3MUOA 3QHYB 4ZN4A 2EIDA 3I7PA 3IUMA 2AQ5A 4LGNA 5AMSA 1H2WA 4GQ1A 2J56H 2VDKA 3DDUA 3MKQA 4GMBA 4QAMA 1QFMA 1JTDB 5EMKB 2MTAH 2XL2A 1TYQC 2P9NC 5CYKA 3JZHA 2CO0A 1UOPA 1SQJA 4FA5D 4GQ2P 1GXRA 1OLZA 5EAMA 4WK2A 2HXCA 2UZXB 5CXCA 4DNWA 2OK6A 3C5MA 3I7NA 2VDLA 5GXIA 3BG0A 5EMMB 4RE6A 5FKRA 3RMZD 4FA4D 4QT8A 2GC4A 3NIDA 3FCSA 4DNUA 2GNQA 2OVRB 2B5NA 4XYIA 4Z7QA 3RN1D 3J81g 5H14A 4BCBA 2B5LA 1N6DA 1E8MA 3DSMA 1YR2A 4J82A 1OMWB 3UVKA 4Y7RA 3JROA 4R7AB 3VGZA 2IWKA 4NBMA 4GZ8A 4A2MA 1SQ9A 5THAA 3NVXA 3AH8B 3K27A 5K1CC 5EM2B 1NEXB 4Z8LA 3O4GA 4U7AA 2QC5A 3PVWB 2EBSA 2QXVA 1UTCA 3PXSD 1K3IA 3GD1I 4X3EA 4JHPC 3EQ7A 3DXKC 3K72A 5HQGA 4Z7OA 4CY2A 2WQ8A 4GGCA 3SJLD 3EI2B 2IURA 5GXHA 3JB9L 2AGWA 4PSXB 3ZDYA 3EG6A 3PXTD 4CC9A 5A2Qg 4A08B 3I7HA 5EM2A 5EALA 3SXTD 2QR5A 3OF7A 3AL8B 3UKUC 4Y5RD 1JJUB 5C92A 1S4UX 5C2WB 5FFGA 2CNXA 1PEVA 1FWXA 3C9CA 4BP9A 2VC2A 2XL3A 3IIWA 4GGDA 4LG9A 3W15A 3VI4A 4AOWA 3GFCA 3KCIA 3MUNA 2Q7QA 3EI3B 3EI2A 3I7KA 5H1MA 3EU7A 3PSLA 5KDOB 3I7LA 1K32A 3IKOA 3AL8A 3OW8A 3VH0A 3ZDZA 1PGUA 1TYEA 1YFQA 2PM9A 3SVWD 1JMXB 1MDAH 3MVDK 4ERYA 2H9MA 1NR0A 3DWLC 1H2ZA 2AH0A 2OK4A 2P9PC 4CY5A 3EI3A 2VDRA 3HFQA 4L9OA 5I5IA 5I5JA 3EI1B 4J78A 1N6FA 4G1MA 3SHFA 4GM9A 4AEZA 2CO0C 2GC7A 3JRPA 3JAMg 2Z2PA 2Z2OA 4O02A 3K26A 3PXWD 5CXCB 5CXBB 5TEEA 4GQBB 2AH1A 2HYEA 2PM6B 4J73A 3OL2A 5FKSA 4L3HD 2HKRA 4YVDA 4O2WA 3EI1A 5EARA 3J80g 4J0XA 4G55A 4JSXC 3FM0A 4CZYA 3V4PA 1N6EA 3MXXA 3I7OA 5IGOA 2P9LC 3DM0A 4UM8A 2CE8A 1TBGA 2B5MA 4JSNC 4AX4A 5E6UA 2EIEA 5CXBA 3VA6A 4J86A 1RI6A 4BCDA 5IT9g 2H6KA 3UR4A 5M5TA 2PM7B 2H14A 2HESX 3NIGA 3RN0D 4K3JB 5M5VA 4J84A
chains in the Genus database with same CATH topology
5FA5B 4NSXA 4BL0A 4PSWB 1P22A 3SBRA 4J77A 4JSVC 3C75H 5EAPA 3F3PA 1GOTB 1SHYB 2O9KA 2UZYB 2J57G 4XEIC 3PVUB 4BUJC 2XYIA 4JT6C 2IUQA 5GMKn 5H17A 5I5MA 4H5IA 4GM8A 4OWRA 4ESGA 4IA9A 3OKTA 1ERJA 2YNPA 2H9NA 3PSCB 4FHLA 4JXMA 4CY3A 5HE2B 2PBIB 3I8CA 4ZOZA 2HJ4A 5IJ7E 4O45A 3DXMC 4A7JA 4CZVA 2H9LA 3SLED 2P9KC 4QRJA 5IJ8E 5IGQA 4A09B 4J79A 3IJ0A 3N0DA 1XKSA 3JZNA 5FLXg 2PM9B 4CY1A 4LG8A 3A0FA 3U4YA 2G99A 4E5ZB 4G56B 3ORVD 5FXYA 4H5JA 3MZKA 3AFCA 3MZLA 5IC7A 1QNIA 3JPXA 2OVPB 2I3TA 5EMJB 2CN2A 2YMUA 2Z2NA 4A09A 1K8KC 4IMMA 3L4MD 3SN6B 5GSAA 2TRCB 4ZOVA 3N0EA 4A2LA 5HE1B 1GG2B 2YBAA 4CI1A 2IUPA 3I2NA 4X60B 4O9DA 3CFSB 5AFU3 4X63B 5AJAA 3UVMA 4FWWA 4E5ZA 1U4CA 3OL2B 4QQEA 4D0KA 3RRMC 1GP2B 4CZXA 2AGLA 3UVOA 4J8BA 5HE3B 2BBKH 4PXWA 4CI3A 3SWSD 3V9FA 3F3GA 1JMZB 3KRXB 3F3FA 2B4EA 3FGBA 4JD2C 3KRWB 5C9ZB 2IAAA 4EWRA 3MMYA 4HDJA 1U2VC 4BH6A 4FAND 2H47A 3OKWA 4U1EI 5TDHB 1MG3A 2XU7A 4KFMB 1A0RB 1XHMA 3ODTA 2P9IC 2P9SC 4N14A 3OTTA 4J8GA 3I89A 3UVNA 3EMHA 1XIPA 3CFVA 2I3SA 3RSEC 2I0RA 2I0SA 3ZWLB 3OKYB 2H6QA 3RLMD 3FRXA 2HKMA 2OVQB 5K19A 4E54B 3NVQA 3SFZA 5TF2A 4ERQA 4PBZA 3SCYA 2H9PA 5EMLB 3IIYA 2HJBA 3C99A 3EI4B 1Q47A 1B9YA 4L3GD 4J81A 4PC0A 3ULEC 3GREA 3OKYA 3UKRC 4ZOYA 2G9AA 4E54A 5B4WA 3B7FA 4FA1D 3JZGA 2H3XA 4TZ4A 3EI4A 3EWEA 2YNOA 4A0BB 2H6NA 2J55H 2P9UC 1JOFA 4FA9D 4ES0A 4L1QD 4OZUA 5FKTA 3RFGA 3BG1A 4O3TB 4J0WA 2CE9A 2OIZA 2BCJB 2IWFA 2CN3A 3CIKB 4A0BA 3IJ1A 4J87A 2W18A 5HE0B 1PBYB 5TEFA 1R5MA 3IJCA 4GM3A 2H68A 3V5WB 3SMRA 2IUVA 5SXMA 4UI9R 3UVLA 3V7DB 3PE7A 4JSPC 3MKSB 2OJYA 3E0CA 1L0QA 5C2VB 2H13A 4XYHA 3SBPA 4FB1D 5JWZA 2AGYA 4QL1A 4GGAA 4CI8A 3NVNA 3SBQA 4A11B 4O3UB 2YB8B 4PNKB 3RFHA 2AGZA 4MK0B 4ERZA 4A08A 3I8EA 2YNNA 3BWSA 4A0AB 4K3ID 5FQDA 3AL9A 4X61B 5FKQA 3L4OD 1MG2A 1VYHC 2AGXA 4D6VA 4PBYA 4ZOXA 4A11A 1B9XA 4JT5C 4O1QD 5CYKB 1PI6A 4CI2A 2I0TA 3P4FA 4FAVD 4I79A 5HYNB 4A0AA 4ZN4A 3I7PA 2AQ5A 4LGNA 5AMSA 4GQ1A 2J56H 3MKQA 4GMBA 5EMKB 2MTAH 2XL2A 1TYQC 2P9NC 5CYKA 3JZHA 2CO0A 1SQJA 4FA5D 4GQ2P 1GXRA 1OLZA 5EAMA 2HXCA 2UZXB 5CXCA 2OK6A 3C5MA 3I7NA 5GXIA 3BG0A 5EMMB 5FKRA 3RMZD 4FA4D 4QT8A 2GC4A 2GNQA 2OVRB 2B5NA 4XYIA 3RN1D 3J81g 5H14A 2B5LA 1N6DA 3DSMA 4J82A 1OMWB 3UVKA 4Y7RA 3JROA 4R7AB 3VGZA 2IWKA 4GZ8A 4A2MA 1SQ9A 5THAA 3NVXA 3AH8B 3K27A 5K1CC 5EM2B 1NEXB 4Z8LA 4U7AA 2QC5A 3PVWB 2EBSA 2QXVA 3PXSD 4X3EA 3DXKC 5HQGA 4CY2A 4GGCA 3SJLD 3EI2B 2IURA 5GXHA 3JB9L 2AGWA 4PSXB 3EG6A 3PXTD 4CC9A 5A2Qg 4A08B 3I7HA 5EM2A 5EALA 3SXTD 3AL8B 3UKUC 4Y5RD 1JJUB 1S4UX 5C2WB 2CNXA 1PEVA 1FWXA 3C9CA 2XL3A 3IIWA 4GGDA 4LG9A 3W15A 4AOWA 3GFCA 2Q7QA 3EI3B 3EI2A 3I7KA 5H1MA 3EU7A 3PSLA 5KDOB 3I7LA 1K32A 3IKOA 3AL8A 3OW8A 3VH0A 1PGUA 1YFQA 2PM9A 3SVWD 1JMXB 1MDAH 4ERYA 2H9MA 1NR0A 3DWLC 2AH0A 2OK4A 2P9PC 4CY5A 3EI3A 3HFQA 4L9OA 5I5IA 5I5JA 3EI1B 4J78A 1N6FA 3SHFA 4GM9A 4AEZA 2CO0C 2GC7A 3JRPA 3JAMg 2Z2PA 2Z2OA 3K26A 3PXWD 5CXCB 5CXBB 5TEEA 4GQBB 2AH1A 2HYEA 2PM6B 4J73A 3OL2A 5FKSA 4L3HD 2HKRA 4YVDA 3EI1A 5EARA 3J80g 4J0XA 4JSXC 3FM0A 4CZYA 1N6EA 3MXXA 3I7OA 5IGOA 2P9LC 3DM0A 2CE8A 1TBGA 2B5MA 4JSNC 5CXBA 3VA6A 4J86A 1RI6A 5IT9g 2H6KA 3UR4A 2PM7B 2H14A 2HESX 3RN0D 4K3JB 4J84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FA5 B;  4NSX A;  4BL0 A;  4PSW B;  1P22 A;  3SBR A;  4J77 A;  4JSV C;  3C75 H;  5EAP A;  3F3P A;  1GOT B;  1SHY B;  2O9K A;  2UZY B;  2J57 G;  4XEI C;  3PVU B;  4BUJ C;  2XYI A;  4JT6 C;  2IUQ A;  5GMK n;  5H17 A;  5I5M A;  4H5I A;  4GM8 A;  4OWR A;  4ESG A;  4IA9 A;  3OKT A;  1ERJ A;  2YNP A;  2H9N A;  3PSC B;  4FHL A;  4JXM A;  4CY3 A;  5HE2 B;  2PBI B;  3I8C A;  4ZOZ A;  2HJ4 A;  5IJ7 E;  4O45 A;  3DXM C;  4A7J A;  4CZV A;  2H9L A;  3SLE D;  2P9K C;  4QRJ A;  5IJ8 E;  5IGQ A;  4A09 B;  4J79 A;  3IJ0 A;  3N0D A;  1XKS A;  3JZN A;  5FLX g;  2PM9 B;  4CY1 A;  4LG8 A;  3A0F A;  3U4Y A;  2G99 A;  4E5Z B;  4G56 B;  3ORV D;  5FXY A;  4H5J A;  3MZK A;  3AFC A;  3MZL A;  5IC7 A;  1QNI A;  3JPX A;  2OVP B;  2I3T A;  5EMJ B;  2CN2 A;  2YMU A;  2Z2N A;  4A09 A;  1K8K C;  4IMM A;  3L4M D;  3SN6 B;  5GSA A;  2TRC B;  4ZOV A;  3N0E A;  4A2L A;  5HE1 B;  1GG2 B;  2YBA A;  4CI1 A;  2IUP A;  3I2N A;  4X60 B;  4O9D A;  3CFS B;  5AFU 3;  4X63 B;  5AJA A;  3UVM A;  4FWW A;  4E5Z A;  1U4C A;  3OL2 B;  4QQE A;  4D0K A;  3RRM C;  1GP2 B;  4CZX A;  2AGL A;  3UVO A;  4J8B A;  5HE3 B;  2BBK H;  4PXW A;  4CI3 A;  3SWS D;  3V9F A;  3F3G A;  1JMZ B;  3KRX B;  3F3F A;  2B4E A;  3FGB A;  4JD2 C;  3KRW B;  5C9Z B;  2IAA A;  4EWR A;  3MMY A;  4HDJ A;  1U2V C;  4BH6 A;  4FAN D;  2H47 A;  3OKW A;  4U1E I;  5TDH B;  1MG3 A;  2XU7 A;  4KFM B;  1A0R B;  1XHM A;  3ODT A;  2P9I C;  2P9S C;  4N14 A;  3OTT A;  4J8G A;  3I89 A;  3UVN A;  3EMH A;  1XIP A;  3CFV A;  2I3S A;  3RSE C;  2I0R A;  2I0S A;  3ZWL B;  3OKY B;  2H6Q A;  3RLM D;  3FRX A;  2HKM A;  2OVQ B;  5K19 A;  4E54 B;  3NVQ A;  3SFZ A;  5TF2 A;  4ERQ A;  4PBZ A;  3SCY A;  2H9P A;  5EML B;  3IIY A;  2HJB A;  3C99 A;  3EI4 B;  1Q47 A;  1B9Y A;  4L3G D;  4J81 A;  4PC0 A;  3ULE C;  3GRE A;  3OKY A;  3UKR C;  4ZOY A;  2G9A A;  4E54 A;  5B4W A;  3B7F A;  4FA1 D;  3JZG A;  2H3X A;  4TZ4 A;  3EI4 A;  3EWE A;  2YNO A;  4A0B B;  2H6N A;  2J55 H;  2P9U C;  1JOF A;  4FA9 D;  4ES0 A;  4L1Q D;  4OZU A;  5FKT A;  3RFG A;  3BG1 A;  4O3T B;  4J0W A;  2CE9 A;  2OIZ A;  2BCJ B;  2IWF A;  2CN3 A;  3CIK B;  4A0B A;  3IJ1 A;  4J87 A;  2W18 A;  5HE0 B;  1PBY B;  5TEF A;  1R5M A;  3IJC A;  4GM3 A;  2H68 A;  3V5W B;  3SMR A;  2IUV A;  5SXM A;  4UI9 R;  3UVL A;  3V7D B;  3PE7 A;  4JSP C;  3MKS B;  2OJY A;  3E0C A;  1L0Q A;  5C2V B;  2H13 A;  4XYH A;  3SBP A;  4FB1 D;  5JWZ A;  2AGY A;  4QL1 A;  4GGA A;  4CI8 A;  3NVN A;  3SBQ A;  4A11 B;  4O3U B;  2YB8 B;  4PNK B;  3RFH A;  2AGZ A;  4MK0 B;  4ERZ A;  4A08 A;  3I8E A;  2YNN A;  3BWS A;  4A0A B;  4K3I D;  5FQD A;  3AL9 A;  4X61 B;  5FKQ A;  3L4O D;  1MG2 A;  1VYH C;  2AGX A;  4D6V A;  4PBY A;  4ZOX A;  4A11 A;  1B9X A;  4JT5 C;  4O1Q D;  5CYK B;  1PI6 A;  4CI2 A;  2I0T A;  3P4F A;  4FAV D;  4I79 A;  5HYN B;  4A0A A;  4ZN4 A;  3I7P A;  2AQ5 A;  4LGN A;  5AMS A;  4GQ1 A;  2J56 H;  3MKQ A;  4GMB A;  5EMK B;  2MTA H;  2XL2 A;  1TYQ C;  2P9N C;  5CYK A;  3JZH A;  2CO0 A;  1SQJ A;  4FA5 D;  4GQ2 P;  1GXR A;  1OLZ A;  5EAM A;  2HXC A;  2UZX B;  5CXC A;  2OK6 A;  3C5M A;  3I7N A;  5GXI A;  3BG0 A;  5EMM B;  5FKR A;  3RMZ D;  4FA4 D;  4QT8 A;  2GC4 A;  2GNQ A;  2OVR B;  2B5N A;  4XYI A;  3RN1 D;  3J81 g;  5H14 A;  2B5L A;  1N6D A;  3DSM A;  4J82 A;  1OMW B;  3UVK A;  4Y7R A;  3JRO A;  4R7A B;  3VGZ A;  2IWK A;  4GZ8 A;  4A2M A;  1SQ9 A;  5THA A;  3NVX A;  3AH8 B;  3K27 A;  5K1C C;  5EM2 B;  1NEX B;  4Z8L A;  4U7A A;  2QC5 A;  3PVW B;  2EBS A;  2QXV A;  3PXS D;  4X3E A;  3DXK C;  5HQG A;  4CY2 A;  4GGC A;  3SJL D;  3EI2 B;  2IUR A;  5GXH A;  3JB9 L;  2AGW A;  4PSX B;  3EG6 A;  3PXT D;  4CC9 A;  5A2Q g;  4A08 B;  3I7H A;  5EM2 A;  5EAL A;  3SXT D;  3AL8 B;  3UKU C;  4Y5R D;  1JJU B;  1S4U X;  5C2W B;  2CNX A;  1PEV A;  1FWX A;  3C9C A;  2XL3 A;  3IIW A;  4GGD A;  4LG9 A;  3W15 A;  4AOW A;  3GFC A;  2Q7Q A;  3EI3 B;  3EI2 A;  3I7K A;  5H1M A;  3EU7 A;  3PSL A;  5KDO B;  3I7L A;  1K32 A;  3IKO A;  3AL8 A;  3OW8 A;  3VH0 A;  1PGU A;  1YFQ A;  2PM9 A;  3SVW D;  1JMX B;  1MDA H;  4ERY A;  2H9M A;  1NR0 A;  3DWL C;  2AH0 A;  2OK4 A;  2P9P C;  4CY5 A;  3EI3 A;  3HFQ A;  4L9O A;  5I5I A;  5I5J A;  3EI1 B;  4J78 A;  1N6F A;  3SHF A;  4GM9 A;  4AEZ A;  2CO0 C;  2GC7 A;  3JRP A;  3JAM g;  2Z2P A;  2Z2O A;  3K26 A;  3PXW D;  5CXC B;  5CXB B;  5TEE A;  4GQB B;  2AH1 A;  2HYE A;  2PM6 B;  4J73 A;  3OL2 A;  5FKS A;  4L3H D;  2HKR A;  4YVD A;  3EI1 A;  5EAR A;  3J80 g;  4J0X A;  4JSX C;  3FM0 A;  4CZY A;  1N6E A;  3MXX A;  3I7O A;  5IGO A;  2P9L C;  3DM0 A;  2CE8 A;  1TBG A;  2B5M A;  4JSN C;  5CXB A;  3VA6 A;  4J86 A;  1RI6 A;  5IT9 g;  2H6K A;  3UR4 A;  2PM7 B;  2H14 A;  2HES X;  3RN0 D;  4K3J B;  4J84 A; 
#chains in the Genus database with same CATH topology
 1O6G A;  2XE4 A;  5FA5 B;  4NSX A;  4BL0 A;  4PSW B;  1P22 A;  3SBR A;  4J77 A;  4JSV C;  5M5R A;  3C75 H;  5C86 A;  5EAP A;  3F3P A;  2XZG A;  1GOT B;  1SHY B;  2O9K A;  2UZY B;  4AN1 A;  1UOQ A;  2J57 G;  3ZE0 A;  4XEI C;  3PVU B;  4BCC A;  1C9I A;  4BUJ C;  2XYI A;  4JT6 C;  2IUQ A;  5GMK n;  5H17 A;  5I5M A;  4H5I A;  4GM8 A;  4OWR A;  4ESG A;  4IA9 A;  3OKT A;  1ERJ A;  2YNP A;  2H9N A;  4BP8 A;  5FFO A;  3PSC B;  2HU7 A;  1U8C A;  4FHL A;  4JXM A;  1A12 A;  2VZ3 A;  4CY3 A;  5HE2 B;  2PBI B;  3I8C A;  4ZOZ A;  2HJ4 A;  5IJ7 E;  1E5T A;  4O45 A;  3DXM C;  4A7J A;  4CZV A;  2H9L A;  3SLE D;  2P9K C;  4QRJ A;  1T2X A;  5IJ8 E;  5IGQ A;  4A09 B;  1JV2 A;  1H2X A;  4J79 A;  1I2M B;  3IJ0 A;  3N0D A;  1XKS A;  3JZN A;  5FLX g;  2PM9 B;  4CY1 A;  4LG8 A;  4MMY A;  3A0F A;  3U4Y A;  2G99 A;  4E5Z B;  4G56 B;  3ORV D;  5FXY A;  4H5J A;  1QFS A;  3MZK A;  3AFC A;  3MZL A;  5IC7 A;  1QNI A;  3JPX A;  3EQ9 A;  3IVM A;  2OVP B;  2I3T A;  5EMJ B;  2CN2 A;  2YMU A;  2Z2N A;  4A09 A;  1K8K C;  1E8N A;  3L4M D;  4IMM A;  3SN6 B;  5GSA A;  2TRC B;  4ZOV A;  2VDN A;  3N0E A;  4A2L A;  5HE1 B;  1GG2 B;  2YBA A;  4CI1 A;  2IUP A;  3I2N A;  4X60 B;  4O9D A;  3CFS B;  3IUN A;  5E6S A;  5AFU 3;  4X63 B;  5AJA A;  3UVM A;  4FWW A;  4E5Z A;  2VDQ A;  1U4C A;  3OL2 B;  4QQE A;  4L1M A;  4D0K A;  3V4V A;  4AMZ A;  4DNV A;  3RRM C;  1GP2 B;  4CZX A;  2AGL A;  3UVO A;  4J8B A;  5HE3 B;  2BBK H;  4PXW A;  2XDW A;  3SWS D;  4CI3 A;  3V9F A;  4MMZ A;  3F3G A;  1GOH A;  1JMZ B;  3KRX B;  3F3F A;  2B4E A;  3FGB A;  4JD2 C;  3KRW B;  5C9Z B;  2IAA A;  4EWR A;  3MMY A;  4HDJ A;  1U2V C;  4BH6 A;  3VI3 A;  4FAN D;  2H47 A;  3OKW A;  4U1E I;  5E6R A;  3GC3 B;  4NAA A;  5TDH B;  1MG3 A;  3T3P A;  4AMY A;  2VZ1 A;  1UOO A;  2XU7 A;  3O4I A;  4KFM B;  1A0R B;  1XHM A;  3ODT A;  2P9I C;  1O6F A;  2P9S C;  4N14 A;  3K6S A;  3OTT A;  4J8G A;  3I89 A;  2VDP A;  3UVN A;  3EMH A;  1XIP A;  3CFV A;  2I3S A;  3RSE C;  2I0R A;  2I0S A;  3ZWL B;  1H2Y A;  3OKY B;  2H6Q A;  3RLM D;  3FRX A;  2HKM A;  2OVQ B;  5K19 A;  4E54 B;  3NVQ A;  3SFZ A;  5TF2 A;  4ERQ A;  4PBZ A;  4JHN A;  3SCY A;  2H9P A;  2VDM A;  4IRZ A;  5EML B;  3IIY A;  1GOF A;  2HJB A;  3C99 A;  3EI4 B;  1Q47 A;  1B9Y A;  2HU5 A;  2BKL A;  4L3G D;  4J81 A;  4PC0 A;  3ULE C;  3GRE A;  3OKY A;  1L5G A;  4AN0 A;  4D9S A;  4G1E A;  3UKR C;  4ZOY A;  1VZ2 A;  2G9A A;  4E54 A;  3IUL A;  5B4W A;  1VE6 A;  3B7F A;  4FA1 D;  3JZG A;  1VZ3 A;  2H3X A;  4TZ4 A;  3EI4 A;  3O4H A;  3EWE A;  2YNO A;  3O4J A;  4A0B B;  2H6N A;  2J55 H;  4UM9 A;  2P9U C;  1JOF A;  4FA9 D;  3IUR A;  4L1Q D;  4OZU A;  5FKT A;  4ES0 A;  3NIF A;  3FCU A;  3BG1 A;  4O3T B;  3RFG A;  4J0W A;  3ZE1 A;  2CE9 A;  2EIC A;  2OIZ A;  4Z7N A;  5M5S A;  3T3M A;  2BCJ B;  2IWF A;  3ZDX A;  2CN3 A;  3CIK B;  4A0B A;  3IJ1 A;  4J87 A;  2W18 A;  5HE0 B;  1PBY B;  3IUJ A;  5TEF A;  1R5M A;  3IJC A;  4GM3 A;  2H68 A;  5M61 A;  3V5W B;  3SMR A;  2IUV A;  5SXM A;  4UI9 R;  3UVL A;  3V7D B;  3PE7 A;  1GOG A;  3MKS B;  2OJY A;  4JSP C;  3E0C A;  1L0Q A;  3QI0 A;  2HU8 A;  5M5U A;  5C2V B;  3IJE A;  2H13 A;  4XYH A;  3SBP A;  4FB1 D;  5JWZ A;  2AGY A;  4QL1 A;  4NC4 A;  4GGA A;  4CI8 A;  3NVN A;  3SBQ A;  4A11 B;  4O3U B;  2YB8 B;  4PNK B;  3RFH A;  2AGZ A;  4WK4 A;  3K71 A;  4MK0 B;  4ERZ A;  4NEN A;  4A08 A;  3I8E A;  3IUQ A;  2YNN A;  2QZP A;  3BWS A;  4A0A B;  4K3I D;  3ZE2 A;  5FQD A;  3AL9 A;  4X61 B;  5FKQ A;  3L4O D;  1MG2 A;  1VYH C;  4WJK A;  2AGX A;  4D6V A;  4PBY A;  4ZOX A;  4WK0 A;  4A11 A;  1B9X A;  4JT5 C;  4O1Q D;  3EQ8 A;  5CYK B;  4MMX A;  2VDO A;  5HDB A;  1BPO A;  1PI6 A;  4RE5 A;  4CI2 A;  2I0T A;  3P4F A;  2JKX A;  1M1X A;  1VE7 A;  4FAV D;  2EIB A;  4I79 A;  5HYN B;  4A0A A;  1C9L A;  3MUO A;  3QHY B;  4ZN4 A;  2EID A;  3I7P A;  3IUM A;  2AQ5 A;  4LGN A;  5AMS A;  1H2W A;  4GQ1 A;  2J56 H;  2VDK A;  3DDU A;  3MKQ A;  4GMB A;  4QAM A;  1QFM A;  1JTD B;  5EMK B;  2MTA H;  2XL2 A;  1TYQ C;  2P9N C;  5CYK A;  3JZH A;  2CO0 A;  1UOP A;  1SQJ A;  4FA5 D;  4GQ2 P;  1GXR A;  1OLZ A;  5EAM A;  4WK2 A;  2HXC A;  2UZX B;  5CXC A;  4DNW A;  2OK6 A;  3C5M A;  3I7N A;  2VDL A;  5GXI A;  3BG0 A;  5EMM B;  4RE6 A;  5FKR A;  3RMZ D;  4FA4 D;  4QT8 A;  2GC4 A;  3NID A;  3FCS A;  4DNU A;  2GNQ A;  2OVR B;  2B5N A;  4XYI A;  4Z7Q A;  3RN1 D;  3J81 g;  5H14 A;  4BCB A;  2B5L A;  1N6D A;  1E8M A;  3DSM A;  1YR2 A;  4J82 A;  1OMW B;  3UVK A;  4Y7R A;  3JRO A;  4R7A B;  3VGZ A;  2IWK A;  4NBM A;  4GZ8 A;  4A2M A;  1SQ9 A;  5THA A;  3NVX A;  3AH8 B;  3K27 A;  5K1C C;  5EM2 B;  1NEX B;  4Z8L A;  3O4G A;  4U7A A;  2QC5 A;  3PVW B;  2EBS A;  2QXV A;  1UTC A;  3PXS D;  1K3I A;  3GD1 I;  4X3E A;  4JHP C;  3EQ7 A;  3DXK C;  3K72 A;  5HQG A;  4Z7O A;  4CY2 A;  2WQ8 A;  4GGC A;  3SJL D;  3EI2 B;  2IUR A;  5GXH A;  3JB9 L;  2AGW A;  4PSX B;  3ZDY A;  3EG6 A;  3PXT D;  4CC9 A;  5A2Q g;  4A08 B;  3I7H A;  5EM2 A;  5EAL A;  3SXT D;  2QR5 A;  3OF7 A;  3AL8 B;  3UKU C;  4Y5R D;  1JJU B;  5C92 A;  1S4U X;  5C2W B;  5FFG A;  2CNX A;  1PEV A;  1FWX A;  3C9C A;  4BP9 A;  2VC2 A;  2XL3 A;  3IIW A;  4GGD A;  4LG9 A;  3W15 A;  3VI4 A;  4AOW A;  3GFC A;  3KCI A;  3MUN A;  2Q7Q A;  3EI3 B;  3EI2 A;  3I7K A;  5H1M A;  3EU7 A;  3PSL A;  5KDO B;  3I7L A;  1K32 A;  3IKO A;  3AL8 A;  3OW8 A;  3VH0 A;  3ZDZ A;  1PGU A;  1TYE A;  1YFQ A;  2PM9 A;  3SVW D;  1JMX B;  1MDA H;  3MVD K;  4ERY A;  2H9M A;  1NR0 A;  3DWL C;  1H2Z A;  2AH0 A;  2OK4 A;  2P9P C;  4CY5 A;  3EI3 A;  2VDR A;  3HFQ A;  4L9O A;  5I5I A;  5I5J A;  3EI1 B;  4J78 A;  1N6F A;  4G1M A;  3SHF A;  4GM9 A;  4AEZ A;  2CO0 C;  2GC7 A;  3JRP A;  3JAM g;  2Z2P A;  2Z2O A;  4O02 A;  3K26 A;  3PXW D;  5CXC B;  5CXB B;  5TEE A;  4GQB B;  2AH1 A;  2HYE A;  2PM6 B;  4J73 A;  3OL2 A;  5FKS A;  4L3H D;  2HKR A;  4YVD A;  4O2W A;  3EI1 A;  5EAR A;  3J80 g;  4J0X A;  4G55 A;  4JSX C;  3FM0 A;  4CZY A;  3V4P A;  1N6E A;  3MXX A;  3I7O A;  5IGO A;  2P9L C;  3DM0 A;  4UM8 A;  2CE8 A;  1TBG A;  2B5M A;  4JSN C;  4AX4 A;  5E6U A;  2EIE A;  5CXB A;  3VA6 A;  4J86 A;  1RI6 A;  4BCD A;  5IT9 g;  2H6K A;  3UR4 A;  5M5T A;  2PM7 B;  2H14 A;  2HES X;  3NIG A;  3RN0 D;  4K3J B;  5M5V A;  4J84 A; 
#chains in the Genus database with same CATH homology
 5FA5 B;  4NSX A;  4BL0 A;  4PSW B;  1P22 A;  3SBR A;  4J77 A;  4JSV C;  3C75 H;  5EAP A;  3F3P A;  1GOT B;  1SHY B;  2O9K A;  2UZY B;  2J57 G;  4XEI C;  3PVU B;  4BUJ C;  2XYI A;  4JT6 C;  2IUQ A;  5GMK n;  5H17 A;  5I5M A;  4H5I A;  4GM8 A;  4OWR A;  4ESG A;  4IA9 A;  3OKT A;  1ERJ A;  2YNP A;  2H9N A;  3PSC B;  4FHL A;  4JXM A;  4CY3 A;  5HE2 B;  2PBI B;  3I8C A;  4ZOZ A;  2HJ4 A;  5IJ7 E;  4O45 A;  3DXM C;  4A7J A;  4CZV A;  2H9L A;  3SLE D;  2P9K C;  4QRJ A;  5IJ8 E;  5IGQ A;  4A09 B;  4J79 A;  3IJ0 A;  3N0D A;  1XKS A;  3JZN A;  5FLX g;  2PM9 B;  4CY1 A;  4LG8 A;  3A0F A;  3U4Y A;  2G99 A;  4E5Z B;  4G56 B;  3ORV D;  5FXY A;  4H5J A;  3MZK A;  3AFC A;  3MZL A;  5IC7 A;  1QNI A;  3JPX A;  2OVP B;  2I3T A;  5EMJ B;  2CN2 A;  2YMU A;  2Z2N A;  4A09 A;  1K8K C;  4IMM A;  3L4M D;  3SN6 B;  5GSA A;  2TRC B;  4ZOV A;  3N0E A;  4A2L A;  5HE1 B;  1GG2 B;  2YBA A;  4CI1 A;  2IUP A;  3I2N A;  4X60 B;  4O9D A;  3CFS B;  5AFU 3;  4X63 B;  5AJA A;  3UVM A;  4FWW A;  4E5Z A;  1U4C A;  3OL2 B;  4QQE A;  4D0K A;  3RRM C;  1GP2 B;  4CZX A;  2AGL A;  3UVO A;  4J8B A;  5HE3 B;  2BBK H;  4PXW A;  4CI3 A;  3SWS D;  3V9F A;  3F3G A;  1JMZ B;  3KRX B;  3F3F A;  2B4E A;  3FGB A;  4JD2 C;  3KRW B;  5C9Z B;  2IAA A;  4EWR A;  3MMY A;  4HDJ A;  1U2V C;  4BH6 A;  4FAN D;  2H47 A;  3OKW A;  4U1E I;  5TDH B;  1MG3 A;  2XU7 A;  4KFM B;  1A0R B;  1XHM A;  3ODT A;  2P9I C;  2P9S C;  4N14 A;  3OTT A;  4J8G A;  3I89 A;  3UVN A;  3EMH A;  1XIP A;  3CFV A;  2I3S A;  3RSE C;  2I0R A;  2I0S A;  3ZWL B;  3OKY B;  2H6Q A;  3RLM D;  3FRX A;  2HKM A;  2OVQ B;  5K19 A;  4E54 B;  3NVQ A;  3SFZ A;  5TF2 A;  4ERQ A;  4PBZ A;  3SCY A;  2H9P A;  5EML B;  3IIY A;  2HJB A;  3C99 A;  3EI4 B;  1Q47 A;  1B9Y A;  4L3G D;  4J81 A;  4PC0 A;  3ULE C;  3GRE A;  3OKY A;  3UKR C;  4ZOY A;  2G9A A;  4E54 A;  5B4W A;  3B7F A;  4FA1 D;  3JZG A;  2H3X A;  4TZ4 A;  3EI4 A;  3EWE A;  2YNO A;  4A0B B;  2H6N A;  2J55 H;  2P9U C;  1JOF A;  4FA9 D;  4ES0 A;  4L1Q D;  4OZU A;  5FKT A;  3RFG A;  3BG1 A;  4O3T B;  4J0W A;  2CE9 A;  2OIZ A;  2BCJ B;  2IWF A;  2CN3 A;  3CIK B;  4A0B A;  3IJ1 A;  4J87 A;  2W18 A;  5HE0 B;  1PBY B;  5TEF A;  1R5M A;  3IJC A;  4GM3 A;  2H68 A;  3V5W B;  3SMR A;  2IUV A;  5SXM A;  4UI9 R;  3UVL A;  3V7D B;  3PE7 A;  4JSP C;  3MKS B;  2OJY A;  3E0C A;  1L0Q A;  5C2V B;  2H13 A;  4XYH A;  3SBP A;  4FB1 D;  5JWZ A;  2AGY A;  4QL1 A;  4GGA A;  4CI8 A;  3NVN A;  3SBQ A;  4A11 B;  4O3U B;  2YB8 B;  4PNK B;  3RFH A;  2AGZ A;  4MK0 B;  4ERZ A;  4A08 A;  3I8E A;  2YNN A;  3BWS A;  4A0A B;  4K3I D;  5FQD A;  3AL9 A;  4X61 B;  5FKQ A;  3L4O D;  1MG2 A;  1VYH C;  2AGX A;  4D6V A;  4PBY A;  4ZOX A;  4A11 A;  1B9X A;  4JT5 C;  4O1Q D;  5CYK B;  1PI6 A;  4CI2 A;  2I0T A;  3P4F A;  4FAV D;  4I79 A;  5HYN B;  4A0A A;  4ZN4 A;  3I7P A;  2AQ5 A;  4LGN A;  5AMS A;  4GQ1 A;  2J56 H;  3MKQ A;  4GMB A;  5EMK B;  2MTA H;  2XL2 A;  1TYQ C;  2P9N C;  5CYK A;  3JZH A;  2CO0 A;  1SQJ A;  4FA5 D;  4GQ2 P;  1GXR A;  1OLZ A;  5EAM A;  2HXC A;  2UZX B;  5CXC A;  2OK6 A;  3C5M A;  3I7N A;  5GXI A;  3BG0 A;  5EMM B;  5FKR A;  3RMZ D;  4FA4 D;  4QT8 A;  2GC4 A;  2GNQ A;  2OVR B;  2B5N A;  4XYI A;  3RN1 D;  3J81 g;  5H14 A;  2B5L A;  1N6D A;  3DSM A;  4J82 A;  1OMW B;  3UVK A;  4Y7R A;  3JRO A;  4R7A B;  3VGZ A;  2IWK A;  4GZ8 A;  4A2M A;  1SQ9 A;  5THA A;  3NVX A;  3AH8 B;  3K27 A;  5K1C C;  5EM2 B;  1NEX B;  4Z8L A;  4U7A A;  2QC5 A;  3PVW B;  2EBS A;  2QXV A;  3PXS D;  4X3E A;  3DXK C;  5HQG A;  4CY2 A;  4GGC A;  3SJL D;  3EI2 B;  2IUR A;  5GXH A;  3JB9 L;  2AGW A;  4PSX B;  3EG6 A;  3PXT D;  4CC9 A;  5A2Q g;  4A08 B;  3I7H A;  5EM2 A;  5EAL A;  3SXT D;  3AL8 B;  3UKU C;  4Y5R D;  1JJU B;  1S4U X;  5C2W B;  2CNX A;  1PEV A;  1FWX A;  3C9C A;  2XL3 A;  3IIW A;  4GGD A;  4LG9 A;  3W15 A;  4AOW A;  3GFC A;  2Q7Q A;  3EI3 B;  3EI2 A;  3I7K A;  5H1M A;  3EU7 A;  3PSL A;  5KDO B;  3I7L A;  1K32 A;  3IKO A;  3AL8 A;  3OW8 A;  3VH0 A;  1PGU A;  1YFQ A;  2PM9 A;  3SVW D;  1JMX B;  1MDA H;  4ERY A;  2H9M A;  1NR0 A;  3DWL C;  2AH0 A;  2OK4 A;  2P9P C;  4CY5 A;  3EI3 A;  3HFQ A;  4L9O A;  5I5I A;  5I5J A;  3EI1 B;  4J78 A;  1N6F A;  3SHF A;  4GM9 A;  4AEZ A;  2CO0 C;  2GC7 A;  3JRP A;  3JAM g;  2Z2P A;  2Z2O A;  3K26 A;  3PXW D;  5CXC B;  5CXB B;  5TEE A;  4GQB B;  2AH1 A;  2HYE A;  2PM6 B;  4J73 A;  3OL2 A;  5FKS A;  4L3H D;  2HKR A;  4YVD A;  3EI1 A;  5EAR A;  3J80 g;  4J0X A;  4JSX C;  3FM0 A;  4CZY A;  1N6E A;  3MXX A;  3I7O A;  5IGO A;  2P9L C;  3DM0 A;  2CE8 A;  1TBG A;  2B5M A;  4JSN C;  5CXB A;  3VA6 A;  4J86 A;  1RI6 A;  5IT9 g;  2H6K A;  3UR4 A;  2PM7 B;  2H14 A;  2HES X;  3RN0 D;  4K3J B;  4J84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...