3PSLA

Fine-tuning the stimulation of mll1 methyltransferase activity by a histone h3 based peptide mimetic
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
303
structure length
298
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fine-tuning the stimulation of MLL1 methyltransferase activity by a histone H3-based peptide mimetic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
total genus 98
structure length 298
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3pslA00
2H14A 4ERZA 3PVUB 1S4UX 2YBAA 1OLZA 4GGDA 3B7FA 4TZ4A 4JT6C 2AGLA 4L1QD 4NSXA 4CZVA 3ODTA 4BUJC 5A2Qg 5TEFA 2YB8B 1XKSA 3UVOA 4ZOZA 5EARA 3OTTA 4I79A 4FAND 4QRJA 1MDAH 5EM2A 3EMHA 4LG9A 3EI4A 2HJ4A 1B9XA 3OL2B 1OMWB 3IKOA 2UZXB 3EU7A 1NR0A 3MZKA 2HKRA 5K1CC 3JPXA 3EI1A 5FKTA 2PM9A 4U1EI 4FA4D 5AJAA 2H13A 2MTAH 4CY5A 2W18A 5IGQA 4XYHA 5IGOA 5IJ7E 3A0FA 3IJ0A 2BCJB 3JROA 1XIPA 5H1MA 1PGUA 4A08B 2H3XA 2HKMA 3PSLA 2AH1A 1K8KC 4CY3A 3C75H 1U2VC 4FA5D 3PXTD 2H47A 4E5ZB 5HE1B 2AH0A 4ZN4A 4GGCA 3UR4A 2J55H 1B9YA 3RN0D 4HDJA 4A0AB 3NVXA 3IJCA 2AGZA 4BH6A 4A2LA 5I5MA 4Y7RA 1MG3A 4ZOVA 4JT5C 4J8BA 4D0KA 3MXXA 2I3TA 3CIKB 1GG2B 1A0RB 1TYQC 2AGXA 4IA9A 4ZOXA 4J79A 3JZHA 3KRXB 3JAMg 5H17A 4XYIA 3C99A 3FGBA 5GXHA 2PM7B 3F3PA 3IIWA 3CFVA 4H5IA 2CN2A 4N14A 2IWKA 4FB1D 3OKWA 4J82A 4QQEA 5TF2A 4A11A 2Z2NA 1NEXB 3BWSA 1YFQA 3IJ1A 4J77A 3SBQA 4E5ZA 1N6FA 3SJLD 3OKYB 5CYKB 4ESGA 3I8CA 3DXMC 3GFCA 4L3GD 4JXMA 5KDOB 4UI9R 3VA6A 4J8GA 2H9NA 3SN6B 4GM8A 4AEZA 5FXYA 3I7LA 4ERQA 3ULEC 4FWWA 2H6KA 3IIYA 3PXSD 2H9PA 5FA5B 4FA9D 3L4MD 3UVKA 2IAAA 3K27A 3SMRA 2YNOA 4U7AA 5HE0B 2B5NA 4GM9A 4CI2A 4J73A 2J56H 3U4YA 2IWFA 3AL8A 3F3FA 4PSXB 1JMZB 3L4OD 3SXTD 4BL0A 4A11B 2G99A 3MZLA 5B4WA 3JB9L 3UVNA 3JRPA 3UVMA 1TBGA 4GM3A 2P9NC 4JSNC 3V9FA 3RSEC 2Z2PA 4X63B 4J84A 4YVDA 3V5WB 2H6NA 3BG0A 4OWRA 5EMLB 3OKYA 5CYKA 3C5MA 3AFCA 2B5MA 5SXMA 4O1QD 3AL9A 1P22A 2HXCA 2XYIA 1PI6A 1VYHC 4PXWA 4ZOYA 5H14A 1XHMA 3J81g 3K26A 3E0CA 3SLED 5IJ8E 5HE3B 1ERJA 3GREA 3MKQA 4J78A 3OW8A 2I0TA 2G9AA 5GMKn 4GMBA 5CXBA 5CXBB 3FM0A 2YNPA 3AL8B 1GXRA 2AQ5A 5THAA 4CY2A 3RFGA 2H6QA 2P9IC 4JSXC 3PE7A 4A0AA 3MKSB 2B4EA 3KRWB 5FQDA 4CZXA 4L9OA 3EI2B 4K3ID 5EM2B 1GOTB 3RN1D 3EG6A 4JSPC 4A09A 1SQJA 4GQBB 4Y5RD 3SBPA 2OVRB 5AMSA 5C2WB 2P9UC 4A08A 3I7OA 2XL3A 1N6DA 3HFQA 4X60B 5I5IA 2OK4A 1SHYB 2P9PC 1JJUB 4ES0A 5HYNB 3EI1B 1PEVA 5TDHB 4J87A 3UVLA 5FKQA 1PBYB 2XL2A 2P9SC 2GC4A 4R7AB 3CFSB 4GQ2P 4LG8A 3PXWD 2P9KC 3I8EA 2QXVA 4A7JA 2CO0A 3RMZD 3VGZA 5K19A 5IT9g 4QT8A 3VH0A 3EI3A 4XEIC 3SBRA 3I7PA 4PC0A 4G56B 2PM9B 4CI8A 5GXIA 3ORVD 2OVQB 2AGYA 3SCYA 4L3HD 3SFZA 5I5JA 3I7KA 4LGNA 2OK6A 3N0EA 2OVPB 4PNKB 2BBKH 3FRXA 4GZ8A 2IUPA 4E54A 4FHLA 4J86A 4CZYA 4IMMA 4Z8LA 3C9CA 5HE2B 3OKTA 5FKRA 4A0BA 2HESX 3P4FA 3SVWD 2I0SA 2AGWA 2O9KA 4GQ1A 2QC5A 3UKRC 4GGAA 3I89A 5AFU3 2J57G 2YMUA 5CXCA 2CE9A 4KFMB 4JD2C 3EI4B 3N0DA 4A2MA 3ZWLB 1Q47A 2TRCB 3RRMC 3BG1A 2H68A 4JSVC 4CY1A 3RLMD 3V7DB 2GC7A 3NVQA 2H9LA 5JWZA 5C9ZB 5EMMB 4O3TB 3DM0A 3RFHA 4QL1A 3I7NA 5EAPA 4CC9A 3SWSD 3AH8B 1RI6A 2HYEA 4PSWB 2EBSA 5EALA 4J0WA 2GNQA 2YNNA 3DSMA 4X61B 3OL2A 3I2NA 4K3JB 4O45A 3EI2A 3UKUC 4H5JA 2IUQA 2HJBA 2IUVA 2CNXA 5EAMA 3J80g 2I0RA 1L0QA 2OIZA 4PBZA 5TEEA 4E54B 3PVWB 4J0XA 4MK0B 4CI1A 2PM6B 2XU7A 1JOFA 1U4CA 5IC7A 3DXKC 4A0BB 4OZUA 4O9DA 3NVNA 2PBIB 2OJYA 1JMXB 3I7HA 4PBYA 2UZYB 3F3GA 3MMYA 2P9LC 3DWLC 3EWEA 2H9MA 4J81A 5FLXg 3JZGA 2IURA 5HQGA 2I3SA 2CO0C 2CN3A 2Q7QA 4AOWA 4CI3A 4O3UB 5GSAA 1MG2A 4X3EA 3PSCB 4D6VA 1N6EA 5C2VB 5FKSA 3EI3B 3JZNA 1SQ9A 1FWXA 5EMJB 4EWRA 5CXCB 4ERYA 2Z2OA 4FA1D 1GP2B 2CE8A 4FAVD 1R5MA 3SHFA 3W15A 1QNIA 4A09B 2B5LA 1K32A 5EMKB
chains in the Genus database with same CATH superfamily
2H14A 4ERZA 3PVUB 1S4UX 2EIDA 2YBAA 1OLZA 4GGDA 3B7FA 4TZ4A 4JT6C 2AGLA 4L1QD 2VZ3A 4NSXA 4CZVA 3ODTA 1UOOA 4BUJC 5A2Qg 5TEFA 2YB8B 1XKSA 1E8MA 3UVOA 4ZOZA 5EARA 3OTTA 4I79A 4FAND 4QRJA 1MDAH 1VE7A 5EM2A 3EMHA 4LG9A 3EI4A 1JTDB 2HJ4A 2VC2A 1B9XA 3V4VA 3OL2B 1OMWB 3IKOA 2UZXB 3EU7A 1NR0A 3MZKA 2HKRA 4NBMA 5K1CC 3JPXA 3EI1A 5FKTA 2PM9A 4U1EI 4FA4D 4BCCA 5AJAA 2H13A 2MTAH 1H2WA 4CY5A 2W18A 4JHNA 4NENA 5IGQA 4XYHA 5IGOA 1UOPA 5IJ7E 3A0FA 3IJ0A 2BCJB 3JROA 1XIPA 5H1MA 1PGUA 4A08B 2H3XA 2HKMA 2BKLA 3PSLA 2AH1A 2VDKA 5M61A 1K8KC 2XZGA 4CY3A 3C75H 1U2VC 4FA5D 3PXTD 2H47A 4E5ZB 4UM9A 1E5TA 5HE1B 5M5UA 2AH0A 4ZN4A 4GGCA 3UR4A 2J55H 1B9YA 3RN0D 4HDJA 4L1MA 4A0AB 3NVXA 3IJCA 2AGZA 4BH6A 1K3IA 1GOHA 4A2LA 5FFOA 5I5MA 4BCBA 4Y7RA 1MG3A 4ZOVA 2EIBA 4JT5C 4J8BA 3KCIA 4D0KA 1H2ZA 3MXXA 2I3TA 3CIKB 1GG2B 1A0RB 1TYQC 3MUOA 2AGXA 4IA9A 4ZOXA 4J79A 3JZHA 3KRXB 3JAMg 4RE5A 5H17A 4XYIA 3C99A 3FGBA 5GXHA 3ZE1A 2PM7B 3F3PA 3IIWA 3CFVA 4H5IA 2CN2A 4N14A 2IWKA 4FB1D 3OKWA 4J82A 1JV2A 1A12A 4QQEA 5TF2A 4A11A 2Z2NA 1GOGA 1NEXB 3BWSA 1YFQA 4AN1A 4Z7OA 3IJ1A 4J77A 3SBQA 3ZDXA 3K6SA 4E5ZA 1N6FA 4DNUA 3SJLD 3OKYB 5CYKB 4ESGA 3I8CA 3DXMC 4D9SA 5HDBA 3GFCA 4L3GD 4JXMA 5KDOB 3K72A 4UI9R 4J8GA 3VA6A 2H9NA 3SN6B 4GM8A 4AEZA 5FXYA 3I7LA 2VDQA 4ERQA 3ULEC 4FWWA 4BP9A 2H6KA 1BPOA 3GD1I 3IIYA 5M5TA 3PXSD 2H9PA 5FA5B 4FA9D 3L4MD 3UVKA 2IAAA 3K27A 3SMRA 4O02A 3O4GA 2QZPA 2YNOA 3IUNA 4U7AA 5HE0B 2B5NA 4GM9A 1O6FA 4CI2A 4DNVA 4J73A 2J56H 3U4YA 2XDWA 2IWFA 3AL8A 3F3FA 4PSXB 3IUJA 3L4OD 3SXTD 4JHPC 4BL0A 4A11B 2G99A 3MZLA 5FFGA 5B4WA 3JB9L 3UVNA 3JRPA 3UVMA 1TBGA 4MMYA 4GM3A 2P9NC 4JSNC 5M5VA 2WQ8A 3V9FA 3RSEC 2Z2PA 3IURA 4X63B 4J84A 4YVDA 3V5WB 2H6NA 3BG0A 4OWRA 5EMLB 3OKYA 5CYKA 3C5MA 3AFCA 3T3PA 2B5MA 5SXMA 2VDPA 4O1QD 3AL9A 1P22A 2HXCA 2XYIA 1PI6A 1UOQA 1VYHC 4PXWA 4ZOYA 5H14A 1XHMA 3OF7A 3J81g 3K26A 3O4JA 3E0CA 3SLED 5IJ8E 5HE3B 1QFMA 4QAMA 1ERJA 2XE4A 3VI3A 3GREA 3MKQA 4J78A 3OW8A 1YR2A 1TYEA 2I0TA 4WK0A 2G9AA 5GMKn 4GMBA 5CXBA 5CXBB 3FM0A 2YNPA 3AL8B 1GXRA 2AQ5A 5THAA 3O4IA 4CY2A 3RFGA 2H6QA 1E8NA 2P9IC 5M5SA 4JSXC 3PE7A 4A0AA 3MKSB 2VZ1A 2B4EA 3KRWB 4G55A 5FQDA 4CZXA 4L9OA 3EI2B 4K3ID 5EM2B 1GOTB 3RN1D 3EG6A 4JSPC 3IVMA 4A09A 1SQJA 4GQBB 4Y5RD 3SBPA 2OVRB 5AMSA 5C2WB 5E6SA 2P9UC 4A08A 3I7OA 2XL3A 1N6DA 3HFQA 4X60B 1QFSA 5I5IA 2OK4A 3IUMA 3ZDZA 4IRZA 1SHYB 2P9PC 1JJUB 3IJEA 4ES0A 5HYNB 1I2MB 2HU7A 1L5GA 3EI1B 1PEVA 4G1MA 5TDHB 4J87A 3UVLA 4WK2A 5FKQA 3ZE0A 4WK4A 1PBYB 4WJKA 2XL2A 3MVDK 2P9SC 2GC4A 4R7AB 3CFSB 1T2XA 4GQ2P 4LG8A 5M5RA 3PXWD 2P9KC 3EQ8A 3I8EA 2QXVA 4A7JA 2CO0A 3RMZD 3VGZA 1H2XA 5K19A 4Z7NA 5IT9g 4QT8A 2HU8A 3VH0A 1VZ2A 3EI3A 4XEIC 3DDUA 3SBRA 3I7PA 4PC0A 5E6UA 4G1EA 4AMYA 4G56B 4AX4A 1GOFA 2PM9B 4CI8A 5GXIA 3ORVD 2OVQB 2AGYA 3SCYA 3V4PA 4L3HD 3SFZA 5I5JA 3I7KA 4LGNA 2OK6A 3N0EA 2OVPB 4PNKB 3QI0A 2BBKH 3FRXA 4GZ8A 2IUPA 5C86A 4E54A 4FHLA 4J86A 4NAAA 4CZYA 4IMMA 4Z8LA 3C9CA 5HE2B 3OKTA 5FKRA 4A0BA 2HESX 4O2WA 3P4FA 4Z7QA 3SVWD 2I0SA 2AGWA 2O9KA 4GQ1A 2QC5A 3NIFA 3UKRC 3VI4A 4GGAA 3I89A 4DNWA 3IUQA 5AFU3 2VDOA 2J57G 2YMUA 5CXCA 4UM8A 2CE9A 4KFMB 4JD2C 3EI4B 1UTCA 3N0DA 4A2MA 3ZWLB 4BCDA 1Q47A 2TRCB 3RRMC 2EIEA 3NIDA 3IULA 3BG1A 1O6GA 2H68A 4JSVC 4CY1A 2VDLA 3RLMD 3V7DB 2VDRA 2GC7A 3NVQA 2H9LA 5JWZA 3FCSA 5C9ZB 5EMMB 4O3TB 3DM0A 3RFHA 4QL1A 3I7NA 5EAPA 4CC9A 3SWSD 3AH8B 1RI6A 2HYEA 4PSWB 1VZ3A 1H2YA 4AN0A 2EBSA 5EALA 4J0WA 2GNQA 2YNNA 3DSMA 4X61B 3OL2A 3I2NA 4K3JB 2JKXA 4O45A 3EQ9A 1C9LA 1M1XA 2VDNA 3EI2A 3UKUC 4H5JA 2IUQA 1K32A 2HJBA 2IUVA 2CNXA 3GC3B 3MUNA 5EAMA 2I0RA 1L0QA 2OIZA 4PBZA 3T3MA 3J80g 5TEEA 4E54B 3PVWB 2QR5A 4J0XA 4MK0B 4CI1A 4MMXA 3ZE2A 2PM6B 4BP8A 2XU7A 1JOFA 1U4CA 5IC7A 3DXKC 4A0BB 4OZUA 4O9DA 3NVNA 2PBIB 2OJYA 1JMXB 3I7HA 4PBYA 2UZYB 1VE6A 3F3GA 3MMYA 2EICA 2P9LC 3DWLC 3EWEA 2H9MA 4J81A 4AMZA 5FLXg 3O4HA 3JZGA 1C9IA 2IURA 3K71A 5HQGA 4RE6A 2VDMA 2I3SA 2CO0C 2CN3A 2Q7QA 4AOWA 4MMZA 4CI3A 4O3UB 5E6RA 3FCUA 5C92A 5GSAA 1MG2A 4X3EA 2HU5A 3PSCB 4D6VA 1N6EA 5C2VB 5FKSA 3EI3B 3JZNA 3QHYB 1SQ9A 1FWXA 3ZDYA 3EQ7A 5EMJB 4EWRA 5CXCB 4ERYA 2Z2OA 1U8CA 4FA1D 4NC4A 1GP2B 2CE8A 4FAVD 3NIGA 1R5MA 3SHFA 3W15A 1QNIA 4A09B 2B5LA 1JMZB 5EMKB
chains in the Genus database with same CATH topology
2H14A 4ERZA 3PVUB 1S4UX 2YBAA 1OLZA 4GGDA 3B7FA 4TZ4A 4JT6C 2AGLA 4L1QD 4NSXA 4CZVA 3ODTA 4BUJC 5A2Qg 5TEFA 2YB8B 1XKSA 3UVOA 4ZOZA 5EARA 3OTTA 4I79A 4FAND 4QRJA 1MDAH 5EM2A 3EMHA 4LG9A 3EI4A 2HJ4A 1B9XA 3OL2B 1OMWB 3IKOA 2UZXB 3EU7A 1NR0A 3MZKA 2HKRA 5K1CC 3JPXA 3EI1A 5FKTA 2PM9A 4U1EI 4FA4D 5AJAA 2H13A 2MTAH 4CY5A 2W18A 5IGQA 4XYHA 5IGOA 5IJ7E 3A0FA 3IJ0A 2BCJB 3JROA 1XIPA 5H1MA 1PGUA 4A08B 2H3XA 2HKMA 3PSLA 2AH1A 1K8KC 4CY3A 3C75H 1U2VC 4FA5D 3PXTD 2H47A 4E5ZB 5HE1B 2AH0A 4ZN4A 4GGCA 3UR4A 2J55H 1B9YA 3RN0D 4HDJA 4A0AB 3NVXA 3IJCA 2AGZA 4BH6A 4A2LA 5I5MA 4Y7RA 1MG3A 4ZOVA 4JT5C 4J8BA 4D0KA 3MXXA 2I3TA 3CIKB 1GG2B 1A0RB 1TYQC 2AGXA 4IA9A 4ZOXA 4J79A 3JZHA 3KRXB 3JAMg 5H17A 4XYIA 3C99A 3FGBA 5GXHA 2PM7B 3F3PA 3IIWA 3CFVA 4H5IA 2CN2A 4N14A 2IWKA 4FB1D 3OKWA 4J82A 4QQEA 5TF2A 4A11A 2Z2NA 1NEXB 3BWSA 1YFQA 3IJ1A 4J77A 3SBQA 4E5ZA 1N6FA 3SJLD 3OKYB 5CYKB 4ESGA 3I8CA 3DXMC 3GFCA 4L3GD 4JXMA 5KDOB 4UI9R 3VA6A 4J8GA 2H9NA 3SN6B 4GM8A 4AEZA 5FXYA 3I7LA 4ERQA 3ULEC 4FWWA 2H6KA 3IIYA 3PXSD 2H9PA 5FA5B 4FA9D 3L4MD 3UVKA 2IAAA 3K27A 3SMRA 2YNOA 4U7AA 5HE0B 2B5NA 4GM9A 4CI2A 4J73A 2J56H 3U4YA 2IWFA 3AL8A 3F3FA 4PSXB 1JMZB 3L4OD 3SXTD 4BL0A 4A11B 2G99A 3MZLA 5B4WA 3JB9L 3UVNA 3JRPA 3UVMA 1TBGA 4GM3A 2P9NC 4JSNC 3V9FA 3RSEC 2Z2PA 4X63B 4J84A 4YVDA 3V5WB 2H6NA 3BG0A 4OWRA 5EMLB 3OKYA 5CYKA 3C5MA 3AFCA 2B5MA 5SXMA 4O1QD 3AL9A 1P22A 2HXCA 2XYIA 1PI6A 1VYHC 4PXWA 4ZOYA 5H14A 1XHMA 3J81g 3K26A 3E0CA 3SLED 5IJ8E 5HE3B 1ERJA 3GREA 3MKQA 4J78A 3OW8A 2I0TA 2G9AA 5GMKn 4GMBA 5CXBA 5CXBB 3FM0A 2YNPA 3AL8B 1GXRA 2AQ5A 5THAA 4CY2A 3RFGA 2H6QA 2P9IC 4JSXC 3PE7A 4A0AA 3MKSB 2B4EA 3KRWB 5FQDA 4CZXA 4L9OA 3EI2B 4K3ID 5EM2B 1GOTB 3RN1D 3EG6A 4JSPC 4A09A 1SQJA 4GQBB 4Y5RD 3SBPA 2OVRB 5AMSA 5C2WB 2P9UC 4A08A 3I7OA 2XL3A 1N6DA 3HFQA 4X60B 5I5IA 2OK4A 1SHYB 2P9PC 1JJUB 4ES0A 5HYNB 3EI1B 1PEVA 5TDHB 4J87A 3UVLA 5FKQA 1PBYB 2XL2A 2P9SC 2GC4A 4R7AB 3CFSB 4GQ2P 4LG8A 3PXWD 2P9KC 3I8EA 2QXVA 4A7JA 2CO0A 3RMZD 3VGZA 5K19A 5IT9g 4QT8A 3VH0A 3EI3A 4XEIC 3SBRA 3I7PA 4PC0A 4G56B 2PM9B 4CI8A 5GXIA 3ORVD 2OVQB 2AGYA 3SCYA 4L3HD 3SFZA 5I5JA 3I7KA 4LGNA 2OK6A 3N0EA 2OVPB 4PNKB 2BBKH 3FRXA 4GZ8A 2IUPA 4E54A 4FHLA 4J86A 4CZYA 4IMMA 4Z8LA 3C9CA 5HE2B 3OKTA 5FKRA 4A0BA 2HESX 3P4FA 3SVWD 2I0SA 2AGWA 2O9KA 4GQ1A 2QC5A 3UKRC 4GGAA 3I89A 5AFU3 2J57G 2YMUA 5CXCA 2CE9A 4KFMB 4JD2C 3EI4B 3N0DA 4A2MA 3ZWLB 1Q47A 2TRCB 3RRMC 3BG1A 2H68A 4JSVC 4CY1A 3RLMD 3V7DB 2GC7A 3NVQA 2H9LA 5JWZA 5C9ZB 5EMMB 4O3TB 3DM0A 3RFHA 4QL1A 3I7NA 5EAPA 4CC9A 3SWSD 3AH8B 1RI6A 2HYEA 4PSWB 2EBSA 5EALA 4J0WA 2GNQA 2YNNA 3DSMA 4X61B 3OL2A 3I2NA 4K3JB 4O45A 3EI2A 3UKUC 4H5JA 2IUQA 2HJBA 2IUVA 2CNXA 5EAMA 3J80g 2I0RA 1L0QA 2OIZA 4PBZA 5TEEA 4E54B 3PVWB 4J0XA 4MK0B 4CI1A 2PM6B 2XU7A 1JOFA 1U4CA 5IC7A 3DXKC 4A0BB 4OZUA 4O9DA 3NVNA 2PBIB 2OJYA 1JMXB 3I7HA 4PBYA 2UZYB 3F3GA 3MMYA 2P9LC 3DWLC 3EWEA 2H9MA 4J81A 5FLXg 3JZGA 2IURA 5HQGA 2I3SA 2CO0C 2CN3A 2Q7QA 4AOWA 4CI3A 4O3UB 5GSAA 1MG2A 4X3EA 3PSCB 4D6VA 1N6EA 5C2VB 5FKSA 3EI3B 3JZNA 1SQ9A 1FWXA 5EMJB 4EWRA 5CXCB 4ERYA 2Z2OA 4FA1D 1GP2B 2CE8A 4FAVD 1R5MA 3SHFA 3W15A 1QNIA 4A09B 2B5LA 1K32A 5EMKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H14 A;  4ERZ A;  3PVU B;  1S4U X;  2YBA A;  1OLZ A;  4GGD A;  3B7F A;  4TZ4 A;  4JT6 C;  2AGL A;  4L1Q D;  4NSX A;  4CZV A;  3ODT A;  4BUJ C;  5A2Q g;  5TEF A;  2YB8 B;  1XKS A;  3UVO A;  4ZOZ A;  5EAR A;  3OTT A;  4I79 A;  4FAN D;  4QRJ A;  1MDA H;  5EM2 A;  3EMH A;  4LG9 A;  3EI4 A;  2HJ4 A;  1B9X A;  3OL2 B;  1OMW B;  3IKO A;  2UZX B;  3EU7 A;  1NR0 A;  3MZK A;  2HKR A;  5K1C C;  3JPX A;  3EI1 A;  5FKT A;  2PM9 A;  4U1E I;  4FA4 D;  5AJA A;  2H13 A;  2MTA H;  4CY5 A;  2W18 A;  5IGQ A;  4XYH A;  5IGO A;  5IJ7 E;  3A0F A;  3IJ0 A;  2BCJ B;  3JRO A;  1XIP A;  5H1M A;  1PGU A;  4A08 B;  2H3X A;  2HKM A;  3PSL A;  2AH1 A;  1K8K C;  4CY3 A;  3C75 H;  1U2V C;  4FA5 D;  3PXT D;  2H47 A;  4E5Z B;  5HE1 B;  2AH0 A;  4ZN4 A;  4GGC A;  3UR4 A;  2J55 H;  1B9Y A;  3RN0 D;  4HDJ A;  4A0A B;  3NVX A;  3IJC A;  2AGZ A;  4BH6 A;  4A2L A;  5I5M A;  4Y7R A;  1MG3 A;  4ZOV A;  4JT5 C;  4J8B A;  4D0K A;  3MXX A;  2I3T A;  3CIK B;  1GG2 B;  1A0R B;  1TYQ C;  2AGX A;  4IA9 A;  4ZOX A;  4J79 A;  3JZH A;  3KRX B;  3JAM g;  5H17 A;  4XYI A;  3C99 A;  3FGB A;  5GXH A;  2PM7 B;  3F3P A;  3IIW A;  3CFV A;  4H5I A;  2CN2 A;  4N14 A;  2IWK A;  4FB1 D;  3OKW A;  4J82 A;  4QQE A;  5TF2 A;  4A11 A;  2Z2N A;  1NEX B;  3BWS A;  1YFQ A;  3IJ1 A;  4J77 A;  3SBQ A;  4E5Z A;  1N6F A;  3SJL D;  3OKY B;  5CYK B;  4ESG A;  3I8C A;  3DXM C;  3GFC A;  4L3G D;  4JXM A;  5KDO B;  4UI9 R;  3VA6 A;  4J8G A;  2H9N A;  3SN6 B;  4GM8 A;  4AEZ A;  5FXY A;  3I7L A;  4ERQ A;  3ULE C;  4FWW A;  2H6K A;  3IIY A;  3PXS D;  2H9P A;  5FA5 B;  4FA9 D;  3L4M D;  3UVK A;  2IAA A;  3K27 A;  3SMR A;  2YNO A;  4U7A A;  5HE0 B;  2B5N A;  4GM9 A;  4CI2 A;  4J73 A;  2J56 H;  3U4Y A;  2IWF A;  3AL8 A;  3F3F A;  4PSX B;  1JMZ B;  3L4O D;  3SXT D;  4BL0 A;  4A11 B;  2G99 A;  3MZL A;  5B4W A;  3JB9 L;  3UVN A;  3JRP A;  3UVM A;  1TBG A;  4GM3 A;  2P9N C;  4JSN C;  3V9F A;  3RSE C;  2Z2P A;  4X63 B;  4J84 A;  4YVD A;  3V5W B;  2H6N A;  3BG0 A;  4OWR A;  5EML B;  3OKY A;  5CYK A;  3C5M A;  3AFC A;  2B5M A;  5SXM A;  4O1Q D;  3AL9 A;  1P22 A;  2HXC A;  2XYI A;  1PI6 A;  1VYH C;  4PXW A;  4ZOY A;  5H14 A;  1XHM A;  3J81 g;  3K26 A;  3E0C A;  3SLE D;  5IJ8 E;  5HE3 B;  1ERJ A;  3GRE A;  3MKQ A;  4J78 A;  3OW8 A;  2I0T A;  2G9A A;  5GMK n;  4GMB A;  5CXB A;  5CXB B;  3FM0 A;  2YNP A;  3AL8 B;  1GXR A;  2AQ5 A;  5THA A;  4CY2 A;  3RFG A;  2H6Q A;  2P9I C;  4JSX C;  3PE7 A;  4A0A A;  3MKS B;  2B4E A;  3KRW B;  5FQD A;  4CZX A;  4L9O A;  3EI2 B;  4K3I D;  5EM2 B;  1GOT B;  3RN1 D;  3EG6 A;  4JSP C;  4A09 A;  1SQJ A;  4GQB B;  4Y5R D;  3SBP A;  2OVR B;  5AMS A;  5C2W B;  2P9U C;  4A08 A;  3I7O A;  2XL3 A;  1N6D A;  3HFQ A;  4X60 B;  5I5I A;  2OK4 A;  1SHY B;  2P9P C;  1JJU B;  4ES0 A;  5HYN B;  3EI1 B;  1PEV A;  5TDH B;  4J87 A;  3UVL A;  5FKQ A;  1PBY B;  2XL2 A;  2P9S C;  2GC4 A;  4R7A B;  3CFS B;  4GQ2 P;  4LG8 A;  3PXW D;  2P9K C;  3I8E A;  2QXV A;  4A7J A;  2CO0 A;  3RMZ D;  3VGZ A;  5K19 A;  5IT9 g;  4QT8 A;  3VH0 A;  3EI3 A;  4XEI C;  3SBR A;  3I7P A;  4PC0 A;  4G56 B;  2PM9 B;  4CI8 A;  5GXI A;  3ORV D;  2OVQ B;  2AGY A;  3SCY A;  4L3H D;  3SFZ A;  5I5J A;  3I7K A;  4LGN A;  2OK6 A;  3N0E A;  2OVP B;  4PNK B;  2BBK H;  3FRX A;  4GZ8 A;  2IUP A;  4E54 A;  4FHL A;  4J86 A;  4CZY A;  4IMM A;  4Z8L A;  3C9C A;  5HE2 B;  3OKT A;  5FKR A;  4A0B A;  2HES X;  3P4F A;  3SVW D;  2I0S A;  2AGW A;  2O9K A;  4GQ1 A;  2QC5 A;  3UKR C;  4GGA A;  3I89 A;  5AFU 3;  2J57 G;  2YMU A;  5CXC A;  2CE9 A;  4KFM B;  4JD2 C;  3EI4 B;  3N0D A;  4A2M A;  3ZWL B;  1Q47 A;  2TRC B;  3RRM C;  3BG1 A;  2H68 A;  4JSV C;  4CY1 A;  3RLM D;  3V7D B;  2GC7 A;  3NVQ A;  2H9L A;  5JWZ A;  5C9Z B;  5EMM B;  4O3T B;  3DM0 A;  3RFH A;  4QL1 A;  3I7N A;  5EAP A;  4CC9 A;  3SWS D;  3AH8 B;  1RI6 A;  2HYE A;  4PSW B;  2EBS A;  5EAL A;  4J0W A;  2GNQ A;  2YNN A;  3DSM A;  4X61 B;  3OL2 A;  3I2N A;  4K3J B;  4O45 A;  3EI2 A;  3UKU C;  4H5J A;  2IUQ A;  2HJB A;  2IUV A;  2CNX A;  5EAM A;  3J80 g;  2I0R A;  1L0Q A;  2OIZ A;  4PBZ A;  5TEE A;  4E54 B;  3PVW B;  4J0X A;  4MK0 B;  4CI1 A;  2PM6 B;  2XU7 A;  1JOF A;  1U4C A;  5IC7 A;  3DXK C;  4A0B B;  4OZU A;  4O9D A;  3NVN A;  2PBI B;  2OJY A;  1JMX B;  3I7H A;  4PBY A;  2UZY B;  3F3G A;  3MMY A;  2P9L C;  3DWL C;  3EWE A;  2H9M A;  4J81 A;  5FLX g;  3JZG A;  2IUR A;  5HQG A;  2I3S A;  2CO0 C;  2CN3 A;  2Q7Q A;  4AOW A;  4CI3 A;  4O3U B;  5GSA A;  1MG2 A;  4X3E A;  3PSC B;  4D6V A;  1N6E A;  5C2V B;  5FKS A;  3EI3 B;  3JZN A;  1SQ9 A;  1FWX A;  5EMJ B;  4EWR A;  5CXC B;  4ERY A;  2Z2O A;  4FA1 D;  1GP2 B;  2CE8 A;  4FAV D;  1R5M A;  3SHF A;  3W15 A;  1QNI A;  4A09 B;  2B5L A;  1K32 A;  5EMK B; 
#chains in the Genus database with same CATH topology
 2H14 A;  4ERZ A;  3PVU B;  1S4U X;  2EID A;  2YBA A;  1OLZ A;  4GGD A;  3B7F A;  4TZ4 A;  4JT6 C;  2AGL A;  4L1Q D;  2VZ3 A;  4NSX A;  4CZV A;  3ODT A;  1UOO A;  4BUJ C;  5A2Q g;  5TEF A;  2YB8 B;  1XKS A;  1E8M A;  3UVO A;  4ZOZ A;  5EAR A;  3OTT A;  4I79 A;  4FAN D;  4QRJ A;  1MDA H;  1VE7 A;  5EM2 A;  3EMH A;  4LG9 A;  3EI4 A;  1JTD B;  2HJ4 A;  2VC2 A;  1B9X A;  3V4V A;  3OL2 B;  1OMW B;  3IKO A;  2UZX B;  3EU7 A;  1NR0 A;  3MZK A;  2HKR A;  4NBM A;  5K1C C;  3JPX A;  3EI1 A;  5FKT A;  2PM9 A;  4U1E I;  4FA4 D;  4BCC A;  5AJA A;  2H13 A;  2MTA H;  1H2W A;  4CY5 A;  2W18 A;  4JHN A;  4NEN A;  5IGQ A;  4XYH A;  5IGO A;  1UOP A;  5IJ7 E;  3A0F A;  3IJ0 A;  2BCJ B;  3JRO A;  1XIP A;  5H1M A;  1PGU A;  4A08 B;  2H3X A;  2HKM A;  2BKL A;  3PSL A;  2AH1 A;  2VDK A;  5M61 A;  1K8K C;  2XZG A;  4CY3 A;  3C75 H;  1U2V C;  4FA5 D;  3PXT D;  2H47 A;  4E5Z B;  4UM9 A;  1E5T A;  5HE1 B;  5M5U A;  2AH0 A;  4ZN4 A;  4GGC A;  3UR4 A;  2J55 H;  1B9Y A;  3RN0 D;  4HDJ A;  4L1M A;  4A0A B;  3NVX A;  3IJC A;  2AGZ A;  4BH6 A;  1K3I A;  1GOH A;  4A2L A;  5FFO A;  5I5M A;  4BCB A;  4Y7R A;  1MG3 A;  4ZOV A;  2EIB A;  4JT5 C;  4J8B A;  3KCI A;  4D0K A;  1H2Z A;  3MXX A;  2I3T A;  3CIK B;  1GG2 B;  1A0R B;  1TYQ C;  3MUO A;  2AGX A;  4IA9 A;  4ZOX A;  4J79 A;  3JZH A;  3KRX B;  3JAM g;  4RE5 A;  5H17 A;  4XYI A;  3C99 A;  3FGB A;  5GXH A;  3ZE1 A;  2PM7 B;  3F3P A;  3IIW A;  3CFV A;  4H5I A;  2CN2 A;  4N14 A;  2IWK A;  4FB1 D;  3OKW A;  4J82 A;  1JV2 A;  1A12 A;  4QQE A;  5TF2 A;  4A11 A;  2Z2N A;  1GOG A;  1NEX B;  3BWS A;  1YFQ A;  4AN1 A;  4Z7O A;  3IJ1 A;  4J77 A;  3SBQ A;  3ZDX A;  3K6S A;  4E5Z A;  1N6F A;  4DNU A;  3SJL D;  3OKY B;  5CYK B;  4ESG A;  3I8C A;  3DXM C;  4D9S A;  5HDB A;  3GFC A;  4L3G D;  4JXM A;  5KDO B;  3K72 A;  4UI9 R;  4J8G A;  3VA6 A;  2H9N A;  3SN6 B;  4GM8 A;  4AEZ A;  5FXY A;  3I7L A;  2VDQ A;  4ERQ A;  3ULE C;  4FWW A;  4BP9 A;  2H6K A;  1BPO A;  3GD1 I;  3IIY A;  5M5T A;  3PXS D;  2H9P A;  5FA5 B;  4FA9 D;  3L4M D;  3UVK A;  2IAA A;  3K27 A;  3SMR A;  4O02 A;  3O4G A;  2QZP A;  2YNO A;  3IUN A;  4U7A A;  5HE0 B;  2B5N A;  4GM9 A;  1O6F A;  4CI2 A;  4DNV A;  4J73 A;  2J56 H;  3U4Y A;  2XDW A;  2IWF A;  3AL8 A;  3F3F A;  4PSX B;  3IUJ A;  3L4O D;  3SXT D;  4JHP C;  4BL0 A;  4A11 B;  2G99 A;  3MZL A;  5FFG A;  5B4W A;  3JB9 L;  3UVN A;  3JRP A;  3UVM A;  1TBG A;  4MMY A;  4GM3 A;  2P9N C;  4JSN C;  5M5V A;  2WQ8 A;  3V9F A;  3RSE C;  2Z2P A;  3IUR A;  4X63 B;  4J84 A;  4YVD A;  3V5W B;  2H6N A;  3BG0 A;  4OWR A;  5EML B;  3OKY A;  5CYK A;  3C5M A;  3AFC A;  3T3P A;  2B5M A;  5SXM A;  2VDP A;  4O1Q D;  3AL9 A;  1P22 A;  2HXC A;  2XYI A;  1PI6 A;  1UOQ A;  1VYH C;  4PXW A;  4ZOY A;  5H14 A;  1XHM A;  3OF7 A;  3J81 g;  3K26 A;  3O4J A;  3E0C A;  3SLE D;  5IJ8 E;  5HE3 B;  1QFM A;  4QAM A;  1ERJ A;  2XE4 A;  3VI3 A;  3GRE A;  3MKQ A;  4J78 A;  3OW8 A;  1YR2 A;  1TYE A;  2I0T A;  4WK0 A;  2G9A A;  5GMK n;  4GMB A;  5CXB A;  5CXB B;  3FM0 A;  2YNP A;  3AL8 B;  1GXR A;  2AQ5 A;  5THA A;  3O4I A;  4CY2 A;  3RFG A;  2H6Q A;  1E8N A;  2P9I C;  5M5S A;  4JSX C;  3PE7 A;  4A0A A;  3MKS B;  2VZ1 A;  2B4E A;  3KRW B;  4G55 A;  5FQD A;  4CZX A;  4L9O A;  3EI2 B;  4K3I D;  5EM2 B;  1GOT B;  3RN1 D;  3EG6 A;  4JSP C;  3IVM A;  4A09 A;  1SQJ A;  4GQB B;  4Y5R D;  3SBP A;  2OVR B;  5AMS A;  5C2W B;  5E6S A;  2P9U C;  4A08 A;  3I7O A;  2XL3 A;  1N6D A;  3HFQ A;  4X60 B;  1QFS A;  5I5I A;  2OK4 A;  3IUM A;  3ZDZ A;  4IRZ A;  1SHY B;  2P9P C;  1JJU B;  3IJE A;  4ES0 A;  5HYN B;  1I2M B;  2HU7 A;  1L5G A;  3EI1 B;  1PEV A;  4G1M A;  5TDH B;  4J87 A;  3UVL A;  4WK2 A;  5FKQ A;  3ZE0 A;  4WK4 A;  1PBY B;  4WJK A;  2XL2 A;  3MVD K;  2P9S C;  2GC4 A;  4R7A B;  3CFS B;  1T2X A;  4GQ2 P;  4LG8 A;  5M5R A;  3PXW D;  2P9K C;  3EQ8 A;  3I8E A;  2QXV A;  4A7J A;  2CO0 A;  3RMZ D;  3VGZ A;  1H2X A;  5K19 A;  4Z7N A;  5IT9 g;  4QT8 A;  2HU8 A;  3VH0 A;  1VZ2 A;  3EI3 A;  4XEI C;  3DDU A;  3SBR A;  3I7P A;  4PC0 A;  5E6U A;  4G1E A;  4AMY A;  4G56 B;  4AX4 A;  1GOF A;  2PM9 B;  4CI8 A;  5GXI A;  3ORV D;  2OVQ B;  2AGY A;  3SCY A;  3V4P A;  4L3H D;  3SFZ A;  5I5J A;  3I7K A;  4LGN A;  2OK6 A;  3N0E A;  2OVP B;  4PNK B;  3QI0 A;  2BBK H;  3FRX A;  4GZ8 A;  2IUP A;  5C86 A;  4E54 A;  4FHL A;  4J86 A;  4NAA A;  4CZY A;  4IMM A;  4Z8L A;  3C9C A;  5HE2 B;  3OKT A;  5FKR A;  4A0B A;  2HES X;  4O2W A;  3P4F A;  4Z7Q A;  3SVW D;  2I0S A;  2AGW A;  2O9K A;  4GQ1 A;  2QC5 A;  3NIF A;  3UKR C;  3VI4 A;  4GGA A;  3I89 A;  4DNW A;  3IUQ A;  5AFU 3;  2VDO A;  2J57 G;  2YMU A;  5CXC A;  4UM8 A;  2CE9 A;  4KFM B;  4JD2 C;  3EI4 B;  1UTC A;  3N0D A;  4A2M A;  3ZWL B;  4BCD A;  1Q47 A;  2TRC B;  3RRM C;  2EIE A;  3NID A;  3IUL A;  3BG1 A;  1O6G A;  2H68 A;  4JSV C;  4CY1 A;  2VDL A;  3RLM D;  3V7D B;  2VDR A;  2GC7 A;  3NVQ A;  2H9L A;  5JWZ A;  3FCS A;  5C9Z B;  5EMM B;  4O3T B;  3DM0 A;  3RFH A;  4QL1 A;  3I7N A;  5EAP A;  4CC9 A;  3SWS D;  3AH8 B;  1RI6 A;  2HYE A;  4PSW B;  1VZ3 A;  1H2Y A;  4AN0 A;  2EBS A;  5EAL A;  4J0W A;  2GNQ A;  2YNN A;  3DSM A;  4X61 B;  3OL2 A;  3I2N A;  4K3J B;  2JKX A;  4O45 A;  3EQ9 A;  1C9L A;  1M1X A;  2VDN A;  3EI2 A;  3UKU C;  4H5J A;  2IUQ A;  1K32 A;  2HJB A;  2IUV A;  2CNX A;  3GC3 B;  3MUN A;  5EAM A;  2I0R A;  1L0Q A;  2OIZ A;  4PBZ A;  3T3M A;  3J80 g;  5TEE A;  4E54 B;  3PVW B;  2QR5 A;  4J0X A;  4MK0 B;  4CI1 A;  4MMX A;  3ZE2 A;  2PM6 B;  4BP8 A;  2XU7 A;  1JOF A;  1U4C A;  5IC7 A;  3DXK C;  4A0B B;  4OZU A;  4O9D A;  3NVN A;  2PBI B;  2OJY A;  1JMX B;  3I7H A;  4PBY A;  2UZY B;  1VE6 A;  3F3G A;  3MMY A;  2EIC A;  2P9L C;  3DWL C;  3EWE A;  2H9M A;  4J81 A;  4AMZ A;  5FLX g;  3O4H A;  3JZG A;  1C9I A;  2IUR A;  3K71 A;  5HQG A;  4RE6 A;  2VDM A;  2I3S A;  2CO0 C;  2CN3 A;  2Q7Q A;  4AOW A;  4MMZ A;  4CI3 A;  4O3U B;  5E6R A;  3FCU A;  5C92 A;  5GSA A;  1MG2 A;  4X3E A;  2HU5 A;  3PSC B;  4D6V A;  1N6E A;  5C2V B;  5FKS A;  3EI3 B;  3JZN A;  3QHY B;  1SQ9 A;  1FWX A;  3ZDY A;  3EQ7 A;  5EMJ B;  4EWR A;  5CXC B;  4ERY A;  2Z2O A;  1U8C A;  4FA1 D;  4NC4 A;  1GP2 B;  2CE8 A;  4FAV D;  3NIG A;  1R5M A;  3SHF A;  3W15 A;  1QNI A;  4A09 B;  2B5L A;  1JMZ B;  5EMK B; 
#chains in the Genus database with same CATH homology
 2H14 A;  4ERZ A;  3PVU B;  1S4U X;  2YBA A;  1OLZ A;  4GGD A;  3B7F A;  4TZ4 A;  4JT6 C;  2AGL A;  4L1Q D;  4NSX A;  4CZV A;  3ODT A;  4BUJ C;  5A2Q g;  5TEF A;  2YB8 B;  1XKS A;  3UVO A;  4ZOZ A;  5EAR A;  3OTT A;  4I79 A;  4FAN D;  4QRJ A;  1MDA H;  5EM2 A;  3EMH A;  4LG9 A;  3EI4 A;  2HJ4 A;  1B9X A;  3OL2 B;  1OMW B;  3IKO A;  2UZX B;  3EU7 A;  1NR0 A;  3MZK A;  2HKR A;  5K1C C;  3JPX A;  3EI1 A;  5FKT A;  2PM9 A;  4U1E I;  4FA4 D;  5AJA A;  2H13 A;  2MTA H;  4CY5 A;  2W18 A;  5IGQ A;  4XYH A;  5IGO A;  5IJ7 E;  3A0F A;  3IJ0 A;  2BCJ B;  3JRO A;  1XIP A;  5H1M A;  1PGU A;  4A08 B;  2H3X A;  2HKM A;  3PSL A;  2AH1 A;  1K8K C;  4CY3 A;  3C75 H;  1U2V C;  4FA5 D;  3PXT D;  2H47 A;  4E5Z B;  5HE1 B;  2AH0 A;  4ZN4 A;  4GGC A;  3UR4 A;  2J55 H;  1B9Y A;  3RN0 D;  4HDJ A;  4A0A B;  3NVX A;  3IJC A;  2AGZ A;  4BH6 A;  4A2L A;  5I5M A;  4Y7R A;  1MG3 A;  4ZOV A;  4JT5 C;  4J8B A;  4D0K A;  3MXX A;  2I3T A;  3CIK B;  1GG2 B;  1A0R B;  1TYQ C;  2AGX A;  4IA9 A;  4ZOX A;  4J79 A;  3JZH A;  3KRX B;  3JAM g;  5H17 A;  4XYI A;  3C99 A;  3FGB A;  5GXH A;  2PM7 B;  3F3P A;  3IIW A;  3CFV A;  4H5I A;  2CN2 A;  4N14 A;  2IWK A;  4FB1 D;  3OKW A;  4J82 A;  4QQE A;  5TF2 A;  4A11 A;  2Z2N A;  1NEX B;  3BWS A;  1YFQ A;  3IJ1 A;  4J77 A;  3SBQ A;  4E5Z A;  1N6F A;  3SJL D;  3OKY B;  5CYK B;  4ESG A;  3I8C A;  3DXM C;  3GFC A;  4L3G D;  4JXM A;  5KDO B;  4UI9 R;  3VA6 A;  4J8G A;  2H9N A;  3SN6 B;  4GM8 A;  4AEZ A;  5FXY A;  3I7L A;  4ERQ A;  3ULE C;  4FWW A;  2H6K A;  3IIY A;  3PXS D;  2H9P A;  5FA5 B;  4FA9 D;  3L4M D;  3UVK A;  2IAA A;  3K27 A;  3SMR A;  2YNO A;  4U7A A;  5HE0 B;  2B5N A;  4GM9 A;  4CI2 A;  4J73 A;  2J56 H;  3U4Y A;  2IWF A;  3AL8 A;  3F3F A;  4PSX B;  1JMZ B;  3L4O D;  3SXT D;  4BL0 A;  4A11 B;  2G99 A;  3MZL A;  5B4W A;  3JB9 L;  3UVN A;  3JRP A;  3UVM A;  1TBG A;  4GM3 A;  2P9N C;  4JSN C;  3V9F A;  3RSE C;  2Z2P A;  4X63 B;  4J84 A;  4YVD A;  3V5W B;  2H6N A;  3BG0 A;  4OWR A;  5EML B;  3OKY A;  5CYK A;  3C5M A;  3AFC A;  2B5M A;  5SXM A;  4O1Q D;  3AL9 A;  1P22 A;  2HXC A;  2XYI A;  1PI6 A;  1VYH C;  4PXW A;  4ZOY A;  5H14 A;  1XHM A;  3J81 g;  3K26 A;  3E0C A;  3SLE D;  5IJ8 E;  5HE3 B;  1ERJ A;  3GRE A;  3MKQ A;  4J78 A;  3OW8 A;  2I0T A;  2G9A A;  5GMK n;  4GMB A;  5CXB A;  5CXB B;  3FM0 A;  2YNP A;  3AL8 B;  1GXR A;  2AQ5 A;  5THA A;  4CY2 A;  3RFG A;  2H6Q A;  2P9I C;  4JSX C;  3PE7 A;  4A0A A;  3MKS B;  2B4E A;  3KRW B;  5FQD A;  4CZX A;  4L9O A;  3EI2 B;  4K3I D;  5EM2 B;  1GOT B;  3RN1 D;  3EG6 A;  4JSP C;  4A09 A;  1SQJ A;  4GQB B;  4Y5R D;  3SBP A;  2OVR B;  5AMS A;  5C2W B;  2P9U C;  4A08 A;  3I7O A;  2XL3 A;  1N6D A;  3HFQ A;  4X60 B;  5I5I A;  2OK4 A;  1SHY B;  2P9P C;  1JJU B;  4ES0 A;  5HYN B;  3EI1 B;  1PEV A;  5TDH B;  4J87 A;  3UVL A;  5FKQ A;  1PBY B;  2XL2 A;  2P9S C;  2GC4 A;  4R7A B;  3CFS B;  4GQ2 P;  4LG8 A;  3PXW D;  2P9K C;  3I8E A;  2QXV A;  4A7J A;  2CO0 A;  3RMZ D;  3VGZ A;  5K19 A;  5IT9 g;  4QT8 A;  3VH0 A;  3EI3 A;  4XEI C;  3SBR A;  3I7P A;  4PC0 A;  4G56 B;  2PM9 B;  4CI8 A;  5GXI A;  3ORV D;  2OVQ B;  2AGY A;  3SCY A;  4L3H D;  3SFZ A;  5I5J A;  3I7K A;  4LGN A;  2OK6 A;  3N0E A;  2OVP B;  4PNK B;  2BBK H;  3FRX A;  4GZ8 A;  2IUP A;  4E54 A;  4FHL A;  4J86 A;  4CZY A;  4IMM A;  4Z8L A;  3C9C A;  5HE2 B;  3OKT A;  5FKR A;  4A0B A;  2HES X;  3P4F A;  3SVW D;  2I0S A;  2AGW A;  2O9K A;  4GQ1 A;  2QC5 A;  3UKR C;  4GGA A;  3I89 A;  5AFU 3;  2J57 G;  2YMU A;  5CXC A;  2CE9 A;  4KFM B;  4JD2 C;  3EI4 B;  3N0D A;  4A2M A;  3ZWL B;  1Q47 A;  2TRC B;  3RRM C;  3BG1 A;  2H68 A;  4JSV C;  4CY1 A;  3RLM D;  3V7D B;  2GC7 A;  3NVQ A;  2H9L A;  5JWZ A;  5C9Z B;  5EMM B;  4O3T B;  3DM0 A;  3RFH A;  4QL1 A;  3I7N A;  5EAP A;  4CC9 A;  3SWS D;  3AH8 B;  1RI6 A;  2HYE A;  4PSW B;  2EBS A;  5EAL A;  4J0W A;  2GNQ A;  2YNN A;  3DSM A;  4X61 B;  3OL2 A;  3I2N A;  4K3J B;  4O45 A;  3EI2 A;  3UKU C;  4H5J A;  2IUQ A;  2HJB A;  2IUV A;  2CNX A;  5EAM A;  3J80 g;  2I0R A;  1L0Q A;  2OIZ A;  4PBZ A;  5TEE A;  4E54 B;  3PVW B;  4J0X A;  4MK0 B;  4CI1 A;  2PM6 B;  2XU7 A;  1JOF A;  1U4C A;  5IC7 A;  3DXK C;  4A0B B;  4OZU A;  4O9D A;  3NVN A;  2PBI B;  2OJY A;  1JMX B;  3I7H A;  4PBY A;  2UZY B;  3F3G A;  3MMY A;  2P9L C;  3DWL C;  3EWE A;  2H9M A;  4J81 A;  5FLX g;  3JZG A;  2IUR A;  5HQG A;  2I3S A;  2CO0 C;  2CN3 A;  2Q7Q A;  4AOW A;  4CI3 A;  4O3U B;  5GSA A;  1MG2 A;  4X3E A;  3PSC B;  4D6V A;  1N6E A;  5C2V B;  5FKS A;  3EI3 B;  3JZN A;  1SQ9 A;  1FWX A;  5EMJ B;  4EWR A;  5CXC B;  4ERY A;  2Z2O A;  4FA1 D;  1GP2 B;  2CE8 A;  4FAV D;  1R5M A;  3SHF A;  3W15 A;  1QNI A;  4A09 B;  2B5L A;  1K32 A;  5EMK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...