3PSLA

Fine-tuning the stimulation of mll1 methyltransferase activity by a histone h3 based peptide mimetic
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
303
structure length
298
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Fine-tuning the stimulation of MLL1 methyltransferase activity by a histone H3-based peptide mimetic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 98
structure length 298
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3pslA00
2B5MA 4J78A 1JMXB 4U1EI 3JB9L 3FRXA 4A11A 3DM0A 4A2LA 4OWRA 2AGYA 2PM7B 3RSEC 2H9NA 2Z2OA 4A0AA 2AH0A 4E5ZA 3JROA 2QXVA 4CZXA 3F3GA 2MTAH 4A0BA 2IUPA 4LGNA 4FA5D 2J56H 1K8KC 3EI3A 3PSLA 3BG1A 1QNIA 4JSVC 4ZOYA 1OMWB 2G9AA 4J0XA 2HKRA 3IJCA 5EM2A 4JSNC 3IJ1A 5CXBB 2P9NC 5HQGA 4D6VA 3VA6A 4XYIA 4GQ2P 5A2Qg 2OVQB 3AL8A 5HE1B 4ERQA 3PSCB 4CZVA 3SLED 5C2VB 5AMSA 4Z8LA 4L9OA 1L0QA 3C9CA 4CY1A 1ERJA 2Q7QA 4ZN4A 3AH8B 3OKYA 3IIWA 4ERYA 4CZYA 3J81g 4ESGA 2IUQA 2G99A 2OVPB 4PBZA 4PSXB 3I89A 4MK0B 1NEXB 2YBAA 1GG2B 5HYNB 5GMKn 5IGOA 2P9LC 4GQ1A 2CE8A 2UZXB 4CY3A 3DSMA 4CI3A 2PM6B 3JRPA 4J0WA 4AEZA 2H3XA 1P22A 4UI9R 1A0RB 2AH1A 2HJBA 3SBPA 3U4YA 3FGBA 5CXCB 4O1QD 2CO0A 4I79A 1XIPA 4FWWA 3EI2B 2BBKH 3SHFA 4CC9A 4ZOXA 2HXCA 4JD2C 1R5MA 2HESX 5FXYA 5CYKB 1B9XA 5K1CC 1RI6A 2AGLA 3UVNA 4FA4D 4TZ4A 3EI1B 3E0CA 2IUVA 1MDAH 2HKMA 4O3TB 4A7JA 1K32A 4FHLA 2H68A 2XL3A 2PBIB 3BG0A 3EI4A 5FA5B 4N14A 5IJ7E 5C2WB 3RMZD 2J55H 2P9PC 3I7NA 1SQJA 2PM9B 5CXBA 1SHYB 3UKUC 3V9FA 4GGCA 4O9DA 3DXMC 3SJLD 5I5MA 2P9SC 3SBQA 2P9UC 4A08A 4HDJA 3RFGA 3UVOA 4BH6A 4PXWA 1TBGA 4A09B 4L3GD 4X61B 3C99A 3OTTA 3RRMC 2IWKA 3C5MA 5H14A 5IT9g 2IAAA 3L4OD 2OJYA 3OL2A 4X60B 4GM3A 4D0KA 2HJ4A 3PXWD 1GOTB 3P4FA 5EMJB 4JSPC 1JJUB 2GC7A 4FAVD 3OKTA 1N6DA 5JWZA 4PC0A 5TDHB 3A0FA 3I7HA 2YNPA 5B4WA 5HE0B 4E54B 2W18A 3N0EA 2IURA 2YMUA 3ORVD 1PGUA 4J73A 3ODTA 3I8CA 5I5IA 3UKRC 3I7KA 4GGDA 5GSAA 4J86A 3SFZA 3EMHA 4PNKB 3AL9A 5FLXg 4CY2A 4PBYA 5IGQA 3IKOA 3I2NA 5CYKA 2O9KA 1YFQA 3DWLC 3J80g 3EI1A 4H5IA 3HFQA 5HE2B 4JT6C 3UR4A 1MG2A 2CN3A 2UZYB 1PEVA 3MZKA 4GQBB 5GXIA 2I0TA 4A11B 2P9IC 4R7AB 3MZLA 5KDOB 4K3ID 3CFSB 3BWSA 2PM9A 3KRXB 3JZNA 3ZWLB 5TEEA 4NSXA 5IJ8E 4A0AB 5IC7A 3NVQA 4U7AA 5EAPA 4EWRA 3EI3B 3IJ0A 4J8BA 3SXTD 3RN1D 1U4CA 3AFCA 3EU7A 2CE9A 2IWFA 3PVUB 2YNNA 3ULEC 2H13A 1SQ9A 4O45A 3GREA 4ZOZA 2I0SA 2H9LA 4PSWB 3RFHA 2GNQA 2XL2A 3RLMD 3N0DA 1MG3A 3EWEA 3PXSD 5K19A 1Q47A 2XU7A 3UVKA 4E54A 2AGZA 4QRJA 4YVDA 4ZOVA 3PXTD 4K3JB 2J57G 3I8EA 3NVNA 4LG9A 2H9MA 3DXKC 2CO0C 2Z2NA 4ES0A 3GFCA 4GM9A 3FM0A 5EAMA 5EMKB 3JZGA 5FKTA 5AFU3 2AGWA 2QC5A 1JMZB 1PI6A 3UVMA 3I7LA 4OZUA 4QT8A 5FKRA 5EALA 2OK4A 5FQDA 2I0RA 2H6KA 2HYEA 4O3UB 4CI8A 4GGAA 2YNOA 3K26A 3CFVA 3V7DB 4A2MA 3PVWB 4J82A 5CXCA 2XYIA 4JSXC 2BCJB 3EI4B 3UVLA 4JXMA 3SCYA 2GC4A 3CIKB 3EI2A 1XHMA 4IMMA 4XEIC 3V5WB 2P9KC 1JOFA 1N6EA 3SWSD 4J79A 5EMMB 3VH0A 3F3PA 3I7PA 4CI1A 1GXRA 4GM8A 4A08B 3F3FA 3B7FA 2YB8B 5TEFA 5EMLB 5H1MA 4J84A 4J87A 2OK6A 2H9PA 3MKSB 4L3HD 4KFMB 4X3EA 4Y5RD 3W15A 3OW8A 3OL2B 1U2VC 4CI2A 4FA9D 3C75H 3JPXA 5C9ZB 4Y7RA 3SVWD 1S4UX 5TF2A 4E5ZB 4QQEA 1FWXA 2I3TA 4A0BB 3SBRA 4A09A 5FKSA 2B5LA 2CN2A 2TRCB 5EM2B 4J77A 4J8GA 4L1QD 5EARA 5AJAA 3L4MD 3EG6A 5FKQA 3SN6B 4ERZA 2EBSA 4GZ8A 2H6QA 3SMRA 4FAND 3AL8B 3MXXA 2B4EA 4XYHA 1B9YA 3K27A 1TYQC 4G56B 4X63B 5H17A 3OKYB 2AQ5A 4H5JA 4BL0A 3PE7A 4QL1A 3OKWA 3KRWB 4FB1D 2Z2PA 5THAA 1NR0A 3JZHA 1XKSA 4AOWA 1GP2B 1OLZA 3JAMg 1PBYB 1N6FA 1VYHC 3RN0D 3IIYA 4J81A 2OIZA 2I3SA 4CY5A 4IA9A 4BUJC 2H47A 3MMYA 3I7OA 3NVXA 2AGXA 2B5NA 2H6NA 5I5JA 3VGZA 5GXHA 5HE3B 2OVRB 2CNXA 4GMBA 4FA1D 4JT5C 3MKQA 2H14A 4LG8A 5SXMA
chains in the Genus database with same CATH superfamily
2B5MA 4J78A 1JMXB 4U1EI 3JB9L 3FRXA 4A11A 5M5VA 3DM0A 4A2LA 4OWRA 1U8CA 1C9IA 2AGYA 5M5SA 1A12A 2PM7B 3RSEC 2H9NA 1O6GA 2Z2OA 4A0AA 2AH0A 4E5ZA 3JROA 2QXVA 4CZXA 3F3GA 2MTAH 4A0BA 2IUPA 4LGNA 4FA5D 2J56H 1K8KC 2VZ1A 3EI3A 3PSLA 3BG1A 1QNIA 3KCIA 4L1MA 4JSVC 4ZOYA 1OMWB 2G9AA 4J0XA 2HKRA 3IJCA 5EM2A 4JSNC 3IJ1A 5CXBB 2P9NC 1E5TA 5HQGA 4UM9A 2JKXA 4D6VA 3VA6A 3NIDA 4XYIA 4GQ2P 5A2Qg 2OVQB 1C9LA 1GOGA 3AL8A 1VE6A 5HE1B 1E8MA 1UTCA 3PSCB 4ERQA 4CZVA 3SLED 5C2VB 5AMSA 4Z8LA 4L9OA 1L0QA 3C9CA 3IJEA 3IURA 4CY1A 1ERJA 2Q7QA 2XE4A 4BP8A 4ZN4A 3AH8B 3OKYA 3IIWA 2VDNA 4ERYA 4CZYA 3J81g 4ESGA 2IUQA 2G99A 2OVPB 5E6SA 3IUQA 4PBZA 4PSXB 4Z7QA 3I89A 4MK0B 2HU7A 4MMYA 4Z7NA 1NEXB 2YBAA 3T3MA 1GG2B 5HYNB 5GMKn 5IGOA 4WJKA 2P9LC 4GQ1A 2CE8A 2UZXB 4CY3A 3DSMA 4CI3A 2PM6B 3JRPA 4J0WA 4AEZA 2H3XA 1P22A 4UI9R 1A0RB 2AH1A 2HJBA 3SBPA 3U4YA 1VZ2A 3FGBA 5CXCB 3ZE2A 4AX4A 4O1QD 2CO0A 4I79A 1K3IA 1XIPA 4FWWA 3EI2B 2BBKH 3SHFA 4AMYA 4CC9A 1UOOA 4ZOXA 4D9SA 2HXCA 1H2ZA 4JD2C 1R5MA 2HESX 5FXYA 5CYKB 1B9XA 5K1CC 1RI6A 2AGLA 1O6FA 3UVNA 4TZ4A 4NAAA 2VDMA 3E0CA 2IUVA 1MDAH 4FA4D 2HKMA 3ZDYA 4O3TB 4QAMA 4A7JA 1K32A 4FHLA 2H68A 2XL3A 2PBIB 1VZ3A 3BG0A 3EQ7A 3EI4A 5FA5B 4N14A 5IJ7E 5C2WB 3RMZD 2J55H 2P9PC 3I7NA 1SQJA 2PM9B 4G55A 1SHYB 5CXBA 3UKUC 3V9FA 4GGCA 3DXMC 4O9DA 3SJLD 5I5MA 2P9SC 3SBQA 2P9UC 4A08A 4IRZA 4HDJA 3RFGA 4RE6A 3FCSA 3UVOA 4BH6A 4PXWA 4MMXA 1H2YA 1TBGA 4A09B 4L3GD 4X61B 3C99A 3OTTA 3RRMC 2IWKA 3C5MA 5H14A 3MVDK 4O02A 5IT9g 4G1MA 2IAAA 3L4OD 2OJYA 3OL2A 4X60B 4G1EA 4GM3A 5M61A 4D0KA 3O4HA 2HJ4A 3PXWD 4AN1A 1GOTB 3P4FA 3QHYB 5EMJB 4JSPC 4AN0A 1JJUB 2GC7A 4DNVA 1UOPA 4FAVD 3OKTA 1N6DA 5JWZA 1QFMA 4PC0A 5TDHB 3A0FA 3I7HA 2YNPA 5B4WA 5HE0B 4E54B 2W18A 3N0EA 2IURA 3GD1I 2YMUA 3ORVD 1PGUA 4J73A 3ODTA 3I8CA 5I5IA 3UKRC 3I7KA 4GGDA 5GSAA 4J86A 5E6UA 2HU8A 3SFZA 3EMHA 4PNKB 3AL9A 4MMZA 5FLXg 4CY2A 4PBYA 5IGQA 3IKOA 3I2NA 5CYKA 2QZPA 3K6SA 2O9KA 3T3PA 1YFQA 3DWLC 3J80g 3EI1A 3IUJA 4H5IA 3HFQA 5HE2B 4JT6C 3UR4A 1MG2A 2CN3A 2UZYB 1PEVA 3MZKA 4GQBB 5GXIA 4BP9A 1GOFA 3IUMA 2I0TA 4A11B 2P9IC 4R7AB 3MZLA 5KDOB 4K3ID 4BCDA 3CFSB 3BWSA 2PM9A 3KRXB 3JZNA 3ZDXA 3ZWLB 1H2WA 5TEEA 4NSXA 5IJ8E 1L5GA 3DDUA 4A0AB 5IC7A 2VDPA 3NVQA 4U7AA 5EAPA 3NIGA 4EWRA 4Z7OA 3EI3B 3IJ0A 2VDRA 5M5RA 4J8BA 1H2XA 1YR2A 4O2WA 3SXTD 3RN1D 1U4CA 2EIBA 2VDLA 3AFCA 3EU7A 2CE9A 3FCUA 2IWFA 3PVUB 4RE5A 4DNWA 3QI0A 2YNNA 3ULEC 4NC4A 2H13A 1SQ9A 4NBMA 4O45A 3EI1B 3GREA 4ZOZA 2I0SA 2H9LA 4PSWB 3RFHA 2GNQA 5FFOA 5C92A 2XL2A 3RLMD 1E8NA 3N0DA 1MG3A 2WQ8A 3EWEA 3PXSD 3ZDZA 5M5TA 5K19A 4JHNA 1Q47A 5FFGA 2XU7A 3UVKA 3ZE0A 3O4IA 2BKLA 4E54A 2AGZA 3EQ9A 3V4PA 1TYEA 3MUOA 4QRJA 4YVDA 4ZOVA 3PXTD 2XDWA 4K3JB 2J57G 3I8EA 3NVNA 4LG9A 2H9MA 3NIFA 3DXKC 2CO0C 2Z2NA 4ES0A 4BCBA 3GFCA 4GM9A 3FM0A 5EAMA 5EMKB 1BPOA 3JZGA 5FKTA 5AFU3 2AGWA 2QC5A 4WK0A 1JMZB 1PI6A 1JTDB 3UVMA 3I7LA 1UOQA 1QFSA 4OZUA 4QT8A 5FKRA 3K71A 5EALA 2OK4A 5FQDA 3MUNA 3OF7A 2I0RA 3VI3A 2H6KA 3V4VA 3EQ8A 2HYEA 4O3UB 4CI8A 4GGAA 2EIDA 2YNOA 3K26A 3CFVA 3V7DB 4A2MA 3PVWB 4J82A 5CXCA 2XYIA 4JSXC 2BCJB 2QR5A 3EI4B 4WK4A 3UVLA 4JXMA 3SCYA 2GC4A 1JV2A 3CIKB 2EIEA 3EI2A 1XHMA 4IMMA 4XEIC 3V5WB 1GOHA 2P9KC 1JOFA 1N6EA 3SWSD 4J79A 4DNUA 5EMMB 3VH0A 3F3PA 3I7PA 3GC3B 4CI1A 1GXRA 2XZGA 4GM8A 3K72A 4A08B 3F3FA 2VDOA 3B7FA 4UM8A 2YB8B 5TEFA 5EMLB 5H1MA 2VDQA 4J84A 4J87A 2VC2A 2OK6A 1T2XA 5HDBA 2H9PA 3MKSB 4L3HD 4KFMB 3O4GA 4AMZA 4X3EA 4Y5RD 3W15A 3OW8A 3OL2B 1U2VC 4CI2A 4FA9D 3C75H 3JPXA 3IUNA 5C9ZB 4Y7RA 3SVWD 3IULA 2EICA 1S4UX 5TF2A 4E5ZB 4QQEA 1FWXA 2I3TA 4A0BB 3SBRA 4A09A 5FKSA 2B5LA 2CN2A 2TRCB 5EM2B 4J77A 4J8GA 4L1QD 5EARA 5AJAA 3L4MD 3EG6A 5FKQA 3VI4A 2VZ3A 3SN6B 4ERZA 2EBSA 4GZ8A 2H6QA 5E6RA 3SMRA 4BCCA 4FAND 3AL8B 3MXXA 2B4EA 4XYHA 1B9YA 3K27A 1TYQC 4G56B 4X63B 3ZE1A 1I2MB 5H17A 3OKYB 2AQ5A 4H5JA 4BL0A 3PE7A 4QL1A 3OKWA 3KRWB 4JHPC 4FB1D 2Z2PA 5THAA 1NR0A 5M5UA 3JZHA 1XKSA 4AOWA 1GP2B 1OLZA 3JAMg 2HU5A 1PBYB 1N6FA 1VYHC 3RN0D 3IIYA 4J81A 2OIZA 2I3SA 1VE7A 4CY5A 4IA9A 3O4JA 4BUJC 3IVMA 2H47A 5C86A 3MMYA 3I7OA 3NVXA 4WK2A 2AGXA 2B5NA 2H6NA 5I5JA 3VGZA 5GXHA 5HE3B 2OVRB 2CNXA 4GMBA 1M1XA 4NENA 4FA1D 4JT5C 3MKQA 2H14A 4LG8A 5SXMA 2VDKA
chains in the Genus database with same CATH topology
2B5MA 4J78A 1JMXB 4U1EI 3JB9L 3FRXA 4A11A 3DM0A 4A2LA 4OWRA 2AGYA 2PM7B 3RSEC 2H9NA 2Z2OA 4A0AA 2AH0A 4E5ZA 3JROA 2QXVA 4CZXA 3F3GA 2MTAH 4A0BA 2IUPA 4LGNA 4FA5D 2J56H 1K8KC 3EI3A 3PSLA 3BG1A 1QNIA 4JSVC 4ZOYA 1OMWB 2G9AA 4J0XA 2HKRA 3IJCA 5EM2A 4JSNC 3IJ1A 5CXBB 2P9NC 5HQGA 4D6VA 3VA6A 4XYIA 4GQ2P 5A2Qg 2OVQB 3AL8A 5HE1B 4ERQA 3PSCB 4CZVA 3SLED 5C2VB 5AMSA 4Z8LA 4L9OA 1L0QA 3C9CA 4CY1A 1ERJA 2Q7QA 4ZN4A 3AH8B 3OKYA 3IIWA 4ERYA 4CZYA 3J81g 4ESGA 2IUQA 2G99A 2OVPB 4PBZA 4PSXB 3I89A 4MK0B 1NEXB 2YBAA 1GG2B 5HYNB 5GMKn 5IGOA 2P9LC 4GQ1A 2CE8A 2UZXB 4CY3A 3DSMA 4CI3A 2PM6B 3JRPA 4J0WA 4AEZA 2H3XA 1P22A 4UI9R 1A0RB 2AH1A 2HJBA 3SBPA 3U4YA 3FGBA 5CXCB 4O1QD 2CO0A 4I79A 1XIPA 4FWWA 3EI2B 2BBKH 3SHFA 4CC9A 4ZOXA 2HXCA 4JD2C 1R5MA 2HESX 5FXYA 5CYKB 1B9XA 5K1CC 1RI6A 2AGLA 3UVNA 4FA4D 4TZ4A 3EI1B 3E0CA 2IUVA 1MDAH 2HKMA 4O3TB 4A7JA 1K32A 4FHLA 2H68A 2XL3A 2PBIB 3BG0A 3EI4A 5FA5B 4N14A 5IJ7E 5C2WB 3RMZD 2J55H 2P9PC 3I7NA 1SQJA 2PM9B 5CXBA 1SHYB 3UKUC 3V9FA 4GGCA 4O9DA 3DXMC 3SJLD 5I5MA 2P9SC 3SBQA 2P9UC 4A08A 4HDJA 3RFGA 3UVOA 4BH6A 4PXWA 1TBGA 4A09B 4L3GD 4X61B 3C99A 3OTTA 3RRMC 2IWKA 3C5MA 5H14A 5IT9g 2IAAA 3L4OD 2OJYA 3OL2A 4X60B 4GM3A 4D0KA 2HJ4A 3PXWD 1GOTB 3P4FA 5EMJB 4JSPC 1JJUB 2GC7A 4FAVD 3OKTA 1N6DA 5JWZA 4PC0A 5TDHB 3A0FA 3I7HA 2YNPA 5B4WA 5HE0B 4E54B 2W18A 3N0EA 2IURA 2YMUA 3ORVD 1PGUA 4J73A 3ODTA 3I8CA 5I5IA 3UKRC 3I7KA 4GGDA 5GSAA 4J86A 3SFZA 3EMHA 4PNKB 3AL9A 5FLXg 4CY2A 4PBYA 5IGQA 3IKOA 3I2NA 5CYKA 2O9KA 1YFQA 3DWLC 3J80g 3EI1A 4H5IA 3HFQA 5HE2B 4JT6C 3UR4A 1MG2A 2CN3A 2UZYB 1PEVA 3MZKA 4GQBB 5GXIA 2I0TA 4A11B 2P9IC 4R7AB 3MZLA 5KDOB 4K3ID 3CFSB 3BWSA 2PM9A 3KRXB 3JZNA 3ZWLB 5TEEA 4NSXA 5IJ8E 4A0AB 5IC7A 3NVQA 4U7AA 5EAPA 4EWRA 3EI3B 3IJ0A 4J8BA 3SXTD 3RN1D 1U4CA 3AFCA 3EU7A 2CE9A 2IWFA 3PVUB 2YNNA 3ULEC 2H13A 1SQ9A 4O45A 3GREA 4ZOZA 2I0SA 2H9LA 4PSWB 3RFHA 2GNQA 2XL2A 3RLMD 3N0DA 1MG3A 3EWEA 3PXSD 5K19A 1Q47A 2XU7A 3UVKA 4E54A 2AGZA 4QRJA 4YVDA 4ZOVA 3PXTD 4K3JB 2J57G 3I8EA 3NVNA 4LG9A 2H9MA 3DXKC 2CO0C 2Z2NA 4ES0A 3GFCA 4GM9A 3FM0A 5EAMA 5EMKB 3JZGA 5FKTA 5AFU3 2AGWA 2QC5A 1JMZB 1PI6A 3UVMA 3I7LA 4OZUA 4QT8A 5FKRA 5EALA 2OK4A 5FQDA 2I0RA 2H6KA 2HYEA 4O3UB 4CI8A 4GGAA 2YNOA 3K26A 3CFVA 3V7DB 4A2MA 3PVWB 4J82A 5CXCA 2XYIA 4JSXC 2BCJB 3EI4B 3UVLA 4JXMA 3SCYA 2GC4A 3CIKB 3EI2A 1XHMA 4IMMA 4XEIC 3V5WB 2P9KC 1JOFA 1N6EA 3SWSD 4J79A 5EMMB 3VH0A 3F3PA 3I7PA 4CI1A 1GXRA 4GM8A 4A08B 3F3FA 3B7FA 2YB8B 5TEFA 5EMLB 5H1MA 4J84A 4J87A 2OK6A 2H9PA 3MKSB 4L3HD 4KFMB 4X3EA 4Y5RD 3W15A 3OW8A 3OL2B 1U2VC 4CI2A 4FA9D 3C75H 3JPXA 5C9ZB 4Y7RA 3SVWD 1S4UX 5TF2A 4E5ZB 4QQEA 1FWXA 2I3TA 4A0BB 3SBRA 4A09A 5FKSA 2B5LA 2CN2A 2TRCB 5EM2B 4J77A 4J8GA 4L1QD 5EARA 5AJAA 3L4MD 3EG6A 5FKQA 3SN6B 4ERZA 2EBSA 4GZ8A 2H6QA 3SMRA 4FAND 3AL8B 3MXXA 2B4EA 4XYHA 1B9YA 3K27A 1TYQC 4G56B 4X63B 5H17A 3OKYB 2AQ5A 4H5JA 4BL0A 3PE7A 4QL1A 3OKWA 3KRWB 4FB1D 2Z2PA 5THAA 1NR0A 3JZHA 1XKSA 4AOWA 1GP2B 1OLZA 3JAMg 1PBYB 1N6FA 1VYHC 3RN0D 3IIYA 4J81A 2OIZA 2I3SA 4CY5A 4IA9A 4BUJC 2H47A 3MMYA 3I7OA 3NVXA 2AGXA 2B5NA 2H6NA 5I5JA 3VGZA 5GXHA 5HE3B 2OVRB 2CNXA 4GMBA 4FA1D 4JT5C 3MKQA 2H14A 4LG8A 5SXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5M A;  4J78 A;  1JMX B;  4U1E I;  3JB9 L;  3FRX A;  4A11 A;  3DM0 A;  4A2L A;  4OWR A;  2AGY A;  2PM7 B;  3RSE C;  2H9N A;  2Z2O A;  4A0A A;  2AH0 A;  4E5Z A;  3JRO A;  2QXV A;  4CZX A;  3F3G A;  2MTA H;  4A0B A;  2IUP A;  4LGN A;  4FA5 D;  2J56 H;  1K8K C;  3EI3 A;  3PSL A;  3BG1 A;  1QNI A;  4JSV C;  4ZOY A;  1OMW B;  2G9A A;  4J0X A;  2HKR A;  3IJC A;  5EM2 A;  4JSN C;  3IJ1 A;  5CXB B;  2P9N C;  5HQG A;  4D6V A;  3VA6 A;  4XYI A;  4GQ2 P;  5A2Q g;  2OVQ B;  3AL8 A;  5HE1 B;  4ERQ A;  3PSC B;  4CZV A;  3SLE D;  5C2V B;  5AMS A;  4Z8L A;  4L9O A;  1L0Q A;  3C9C A;  4CY1 A;  1ERJ A;  2Q7Q A;  4ZN4 A;  3AH8 B;  3OKY A;  3IIW A;  4ERY A;  4CZY A;  3J81 g;  4ESG A;  2IUQ A;  2G99 A;  2OVP B;  4PBZ A;  4PSX B;  3I89 A;  4MK0 B;  1NEX B;  2YBA A;  1GG2 B;  5HYN B;  5GMK n;  5IGO A;  2P9L C;  4GQ1 A;  2CE8 A;  2UZX B;  4CY3 A;  3DSM A;  4CI3 A;  2PM6 B;  3JRP A;  4J0W A;  4AEZ A;  2H3X A;  1P22 A;  4UI9 R;  1A0R B;  2AH1 A;  2HJB A;  3SBP A;  3U4Y A;  3FGB A;  5CXC B;  4O1Q D;  2CO0 A;  4I79 A;  1XIP A;  4FWW A;  3EI2 B;  2BBK H;  3SHF A;  4CC9 A;  4ZOX A;  2HXC A;  4JD2 C;  1R5M A;  2HES X;  5FXY A;  5CYK B;  1B9X A;  5K1C C;  1RI6 A;  2AGL A;  3UVN A;  4FA4 D;  4TZ4 A;  3EI1 B;  3E0C A;  2IUV A;  1MDA H;  2HKM A;  4O3T B;  4A7J A;  1K32 A;  4FHL A;  2H68 A;  2XL3 A;  2PBI B;  3BG0 A;  3EI4 A;  5FA5 B;  4N14 A;  5IJ7 E;  5C2W B;  3RMZ D;  2J55 H;  2P9P C;  3I7N A;  1SQJ A;  2PM9 B;  5CXB A;  1SHY B;  3UKU C;  3V9F A;  4GGC A;  4O9D A;  3DXM C;  3SJL D;  5I5M A;  2P9S C;  3SBQ A;  2P9U C;  4A08 A;  4HDJ A;  3RFG A;  3UVO A;  4BH6 A;  4PXW A;  1TBG A;  4A09 B;  4L3G D;  4X61 B;  3C99 A;  3OTT A;  3RRM C;  2IWK A;  3C5M A;  5H14 A;  5IT9 g;  2IAA A;  3L4O D;  2OJY A;  3OL2 A;  4X60 B;  4GM3 A;  4D0K A;  2HJ4 A;  3PXW D;  1GOT B;  3P4F A;  5EMJ B;  4JSP C;  1JJU B;  2GC7 A;  4FAV D;  3OKT A;  1N6D A;  5JWZ A;  4PC0 A;  5TDH B;  3A0F A;  3I7H A;  2YNP A;  5B4W A;  5HE0 B;  4E54 B;  2W18 A;  3N0E A;  2IUR A;  2YMU A;  3ORV D;  1PGU A;  4J73 A;  3ODT A;  3I8C A;  5I5I A;  3UKR C;  3I7K A;  4GGD A;  5GSA A;  4J86 A;  3SFZ A;  3EMH A;  4PNK B;  3AL9 A;  5FLX g;  4CY2 A;  4PBY A;  5IGQ A;  3IKO A;  3I2N A;  5CYK A;  2O9K A;  1YFQ A;  3DWL C;  3J80 g;  3EI1 A;  4H5I A;  3HFQ A;  5HE2 B;  4JT6 C;  3UR4 A;  1MG2 A;  2CN3 A;  2UZY B;  1PEV A;  3MZK A;  4GQB B;  5GXI A;  2I0T A;  4A11 B;  2P9I C;  4R7A B;  3MZL A;  5KDO B;  4K3I D;  3CFS B;  3BWS A;  2PM9 A;  3KRX B;  3JZN A;  3ZWL B;  5TEE A;  4NSX A;  5IJ8 E;  4A0A B;  5IC7 A;  3NVQ A;  4U7A A;  5EAP A;  4EWR A;  3EI3 B;  3IJ0 A;  4J8B A;  3SXT D;  3RN1 D;  1U4C A;  3AFC A;  3EU7 A;  2CE9 A;  2IWF A;  3PVU B;  2YNN A;  3ULE C;  2H13 A;  1SQ9 A;  4O45 A;  3GRE A;  4ZOZ A;  2I0S A;  2H9L A;  4PSW B;  3RFH A;  2GNQ A;  2XL2 A;  3RLM D;  3N0D A;  1MG3 A;  3EWE A;  3PXS D;  5K19 A;  1Q47 A;  2XU7 A;  3UVK A;  4E54 A;  2AGZ A;  4QRJ A;  4YVD A;  4ZOV A;  3PXT D;  4K3J B;  2J57 G;  3I8E A;  3NVN A;  4LG9 A;  2H9M A;  3DXK C;  2CO0 C;  2Z2N A;  4ES0 A;  3GFC A;  4GM9 A;  3FM0 A;  5EAM A;  5EMK B;  3JZG A;  5FKT A;  5AFU 3;  2AGW A;  2QC5 A;  1JMZ B;  1PI6 A;  3UVM A;  3I7L A;  4OZU A;  4QT8 A;  5FKR A;  5EAL A;  2OK4 A;  5FQD A;  2I0R A;  2H6K A;  2HYE A;  4O3U B;  4CI8 A;  4GGA A;  2YNO A;  3K26 A;  3CFV A;  3V7D B;  4A2M A;  3PVW B;  4J82 A;  5CXC A;  2XYI A;  4JSX C;  2BCJ B;  3EI4 B;  3UVL A;  4JXM A;  3SCY A;  2GC4 A;  3CIK B;  3EI2 A;  1XHM A;  4IMM A;  4XEI C;  3V5W B;  2P9K C;  1JOF A;  1N6E A;  3SWS D;  4J79 A;  5EMM B;  3VH0 A;  3F3P A;  3I7P A;  4CI1 A;  1GXR A;  4GM8 A;  4A08 B;  3F3F A;  3B7F A;  2YB8 B;  5TEF A;  5EML B;  5H1M A;  4J84 A;  4J87 A;  2OK6 A;  2H9P A;  3MKS B;  4L3H D;  4KFM B;  4X3E A;  4Y5R D;  3W15 A;  3OW8 A;  3OL2 B;  1U2V C;  4CI2 A;  4FA9 D;  3C75 H;  3JPX A;  5C9Z B;  4Y7R A;  3SVW D;  1S4U X;  5TF2 A;  4E5Z B;  4QQE A;  1FWX A;  2I3T A;  4A0B B;  3SBR A;  4A09 A;  5FKS A;  2B5L A;  2CN2 A;  2TRC B;  5EM2 B;  4J77 A;  4J8G A;  4L1Q D;  5EAR A;  5AJA A;  3L4M D;  3EG6 A;  5FKQ A;  3SN6 B;  4ERZ A;  2EBS A;  4GZ8 A;  2H6Q A;  3SMR A;  4FAN D;  3AL8 B;  3MXX A;  2B4E A;  4XYH A;  1B9Y A;  3K27 A;  1TYQ C;  4G56 B;  4X63 B;  5H17 A;  3OKY B;  2AQ5 A;  4H5J A;  4BL0 A;  3PE7 A;  4QL1 A;  3OKW A;  3KRW B;  4FB1 D;  2Z2P A;  5THA A;  1NR0 A;  3JZH A;  1XKS A;  4AOW A;  1GP2 B;  1OLZ A;  3JAM g;  1PBY B;  1N6F A;  1VYH C;  3RN0 D;  3IIY A;  4J81 A;  2OIZ A;  2I3S A;  4CY5 A;  4IA9 A;  4BUJ C;  2H47 A;  3MMY A;  3I7O A;  3NVX A;  2AGX A;  2B5N A;  2H6N A;  5I5J A;  3VGZ A;  5GXH A;  5HE3 B;  2OVR B;  2CNX A;  4GMB A;  4FA1 D;  4JT5 C;  3MKQ A;  2H14 A;  4LG8 A;  5SXM A; 
#chains in the Genus database with same CATH topology
 2B5M A;  4J78 A;  1JMX B;  4U1E I;  3JB9 L;  3FRX A;  4A11 A;  5M5V A;  3DM0 A;  4A2L A;  4OWR A;  1U8C A;  1C9I A;  2AGY A;  5M5S A;  1A12 A;  2PM7 B;  3RSE C;  2H9N A;  1O6G A;  2Z2O A;  4A0A A;  2AH0 A;  4E5Z A;  3JRO A;  2QXV A;  4CZX A;  3F3G A;  2MTA H;  4A0B A;  2IUP A;  4LGN A;  4FA5 D;  2J56 H;  1K8K C;  2VZ1 A;  3EI3 A;  3PSL A;  3BG1 A;  1QNI A;  3KCI A;  4L1M A;  4JSV C;  4ZOY A;  1OMW B;  2G9A A;  4J0X A;  2HKR A;  3IJC A;  5EM2 A;  4JSN C;  3IJ1 A;  5CXB B;  2P9N C;  1E5T A;  5HQG A;  4UM9 A;  2JKX A;  4D6V A;  3VA6 A;  3NID A;  4XYI A;  4GQ2 P;  5A2Q g;  2OVQ B;  1C9L A;  1GOG A;  3AL8 A;  1VE6 A;  5HE1 B;  1E8M A;  1UTC A;  3PSC B;  4ERQ A;  4CZV A;  3SLE D;  5C2V B;  5AMS A;  4Z8L A;  4L9O A;  1L0Q A;  3C9C A;  3IJE A;  3IUR A;  4CY1 A;  1ERJ A;  2Q7Q A;  2XE4 A;  4BP8 A;  4ZN4 A;  3AH8 B;  3OKY A;  3IIW A;  2VDN A;  4ERY A;  4CZY A;  3J81 g;  4ESG A;  2IUQ A;  2G99 A;  2OVP B;  5E6S A;  3IUQ A;  4PBZ A;  4PSX B;  4Z7Q A;  3I89 A;  4MK0 B;  2HU7 A;  4MMY A;  4Z7N A;  1NEX B;  2YBA A;  3T3M A;  1GG2 B;  5HYN B;  5GMK n;  5IGO A;  4WJK A;  2P9L C;  4GQ1 A;  2CE8 A;  2UZX B;  4CY3 A;  3DSM A;  4CI3 A;  2PM6 B;  3JRP A;  4J0W A;  4AEZ A;  2H3X A;  1P22 A;  4UI9 R;  1A0R B;  2AH1 A;  2HJB A;  3SBP A;  3U4Y A;  1VZ2 A;  3FGB A;  5CXC B;  3ZE2 A;  4AX4 A;  4O1Q D;  2CO0 A;  4I79 A;  1K3I A;  1XIP A;  4FWW A;  3EI2 B;  2BBK H;  3SHF A;  4AMY A;  4CC9 A;  1UOO A;  4ZOX A;  4D9S A;  2HXC A;  1H2Z A;  4JD2 C;  1R5M A;  2HES X;  5FXY A;  5CYK B;  1B9X A;  5K1C C;  1RI6 A;  2AGL A;  1O6F A;  3UVN A;  4TZ4 A;  4NAA A;  2VDM A;  3E0C A;  2IUV A;  1MDA H;  4FA4 D;  2HKM A;  3ZDY A;  4O3T B;  4QAM A;  4A7J A;  1K32 A;  4FHL A;  2H68 A;  2XL3 A;  2PBI B;  1VZ3 A;  3BG0 A;  3EQ7 A;  3EI4 A;  5FA5 B;  4N14 A;  5IJ7 E;  5C2W B;  3RMZ D;  2J55 H;  2P9P C;  3I7N A;  1SQJ A;  2PM9 B;  4G55 A;  1SHY B;  5CXB A;  3UKU C;  3V9F A;  4GGC A;  3DXM C;  4O9D A;  3SJL D;  5I5M A;  2P9S C;  3SBQ A;  2P9U C;  4A08 A;  4IRZ A;  4HDJ A;  3RFG A;  4RE6 A;  3FCS A;  3UVO A;  4BH6 A;  4PXW A;  4MMX A;  1H2Y A;  1TBG A;  4A09 B;  4L3G D;  4X61 B;  3C99 A;  3OTT A;  3RRM C;  2IWK A;  3C5M A;  5H14 A;  3MVD K;  4O02 A;  5IT9 g;  4G1M A;  2IAA A;  3L4O D;  2OJY A;  3OL2 A;  4X60 B;  4G1E A;  4GM3 A;  5M61 A;  4D0K A;  3O4H A;  2HJ4 A;  3PXW D;  4AN1 A;  1GOT B;  3P4F A;  3QHY B;  5EMJ B;  4JSP C;  4AN0 A;  1JJU B;  2GC7 A;  4DNV A;  1UOP A;  4FAV D;  3OKT A;  1N6D A;  5JWZ A;  1QFM A;  4PC0 A;  5TDH B;  3A0F A;  3I7H A;  2YNP A;  5B4W A;  5HE0 B;  4E54 B;  2W18 A;  3N0E A;  2IUR A;  3GD1 I;  2YMU A;  3ORV D;  1PGU A;  4J73 A;  3ODT A;  3I8C A;  5I5I A;  3UKR C;  3I7K A;  4GGD A;  5GSA A;  4J86 A;  5E6U A;  2HU8 A;  3SFZ A;  3EMH A;  4PNK B;  3AL9 A;  4MMZ A;  5FLX g;  4CY2 A;  4PBY A;  5IGQ A;  3IKO A;  3I2N A;  5CYK A;  2QZP A;  3K6S A;  2O9K A;  3T3P A;  1YFQ A;  3DWL C;  3J80 g;  3EI1 A;  3IUJ A;  4H5I A;  3HFQ A;  5HE2 B;  4JT6 C;  3UR4 A;  1MG2 A;  2CN3 A;  2UZY B;  1PEV A;  3MZK A;  4GQB B;  5GXI A;  4BP9 A;  1GOF A;  3IUM A;  2I0T A;  4A11 B;  2P9I C;  4R7A B;  3MZL A;  5KDO B;  4K3I D;  4BCD A;  3CFS B;  3BWS A;  2PM9 A;  3KRX B;  3JZN A;  3ZDX A;  3ZWL B;  1H2W A;  5TEE A;  4NSX A;  5IJ8 E;  1L5G A;  3DDU A;  4A0A B;  5IC7 A;  2VDP A;  3NVQ A;  4U7A A;  5EAP A;  3NIG A;  4EWR A;  4Z7O A;  3EI3 B;  3IJ0 A;  2VDR A;  5M5R A;  4J8B A;  1H2X A;  1YR2 A;  4O2W A;  3SXT D;  3RN1 D;  1U4C A;  2EIB A;  2VDL A;  3AFC A;  3EU7 A;  2CE9 A;  3FCU A;  2IWF A;  3PVU B;  4RE5 A;  4DNW A;  3QI0 A;  2YNN A;  3ULE C;  4NC4 A;  2H13 A;  1SQ9 A;  4NBM A;  4O45 A;  3EI1 B;  3GRE A;  4ZOZ A;  2I0S A;  2H9L A;  4PSW B;  3RFH A;  2GNQ A;  5FFO A;  5C92 A;  2XL2 A;  3RLM D;  1E8N A;  3N0D A;  1MG3 A;  2WQ8 A;  3EWE A;  3PXS D;  3ZDZ A;  5M5T A;  5K19 A;  4JHN A;  1Q47 A;  5FFG A;  2XU7 A;  3UVK A;  3ZE0 A;  3O4I A;  2BKL A;  4E54 A;  2AGZ A;  3EQ9 A;  3V4P A;  1TYE A;  3MUO A;  4QRJ A;  4YVD A;  4ZOV A;  3PXT D;  2XDW A;  4K3J B;  2J57 G;  3I8E A;  3NVN A;  4LG9 A;  2H9M A;  3NIF A;  3DXK C;  2CO0 C;  2Z2N A;  4ES0 A;  4BCB A;  3GFC A;  4GM9 A;  3FM0 A;  5EAM A;  5EMK B;  1BPO A;  3JZG A;  5FKT A;  5AFU 3;  2AGW A;  2QC5 A;  4WK0 A;  1JMZ B;  1PI6 A;  1JTD B;  3UVM A;  3I7L A;  1UOQ A;  1QFS A;  4OZU A;  4QT8 A;  5FKR A;  3K71 A;  5EAL A;  2OK4 A;  5FQD A;  3MUN A;  3OF7 A;  2I0R A;  3VI3 A;  2H6K A;  3V4V A;  3EQ8 A;  2HYE A;  4O3U B;  4CI8 A;  4GGA A;  2EID A;  2YNO A;  3K26 A;  3CFV A;  3V7D B;  4A2M A;  3PVW B;  4J82 A;  5CXC A;  2XYI A;  4JSX C;  2BCJ B;  2QR5 A;  3EI4 B;  4WK4 A;  3UVL A;  4JXM A;  3SCY A;  2GC4 A;  1JV2 A;  3CIK B;  2EIE A;  3EI2 A;  1XHM A;  4IMM A;  4XEI C;  3V5W B;  1GOH A;  2P9K C;  1JOF A;  1N6E A;  3SWS D;  4J79 A;  4DNU A;  5EMM B;  3VH0 A;  3F3P A;  3I7P A;  3GC3 B;  4CI1 A;  1GXR A;  2XZG A;  4GM8 A;  3K72 A;  4A08 B;  3F3F A;  2VDO A;  3B7F A;  4UM8 A;  2YB8 B;  5TEF A;  5EML B;  5H1M A;  2VDQ A;  4J84 A;  4J87 A;  2VC2 A;  2OK6 A;  1T2X A;  5HDB A;  2H9P A;  3MKS B;  4L3H D;  4KFM B;  3O4G A;  4AMZ A;  4X3E A;  4Y5R D;  3W15 A;  3OW8 A;  3OL2 B;  1U2V C;  4CI2 A;  4FA9 D;  3C75 H;  3JPX A;  3IUN A;  5C9Z B;  4Y7R A;  3SVW D;  3IUL A;  2EIC A;  1S4U X;  5TF2 A;  4E5Z B;  4QQE A;  1FWX A;  2I3T A;  4A0B B;  3SBR A;  4A09 A;  5FKS A;  2B5L A;  2CN2 A;  2TRC B;  5EM2 B;  4J77 A;  4J8G A;  4L1Q D;  5EAR A;  5AJA A;  3L4M D;  3EG6 A;  5FKQ A;  3VI4 A;  2VZ3 A;  3SN6 B;  4ERZ A;  2EBS A;  4GZ8 A;  2H6Q A;  5E6R A;  3SMR A;  4BCC A;  4FAN D;  3AL8 B;  3MXX A;  2B4E A;  4XYH A;  1B9Y A;  3K27 A;  1TYQ C;  4G56 B;  4X63 B;  3ZE1 A;  1I2M B;  5H17 A;  3OKY B;  2AQ5 A;  4H5J A;  4BL0 A;  3PE7 A;  4QL1 A;  3OKW A;  3KRW B;  4JHP C;  4FB1 D;  2Z2P A;  5THA A;  1NR0 A;  5M5U A;  3JZH A;  1XKS A;  4AOW A;  1GP2 B;  1OLZ A;  3JAM g;  2HU5 A;  1PBY B;  1N6F A;  1VYH C;  3RN0 D;  3IIY A;  4J81 A;  2OIZ A;  2I3S A;  1VE7 A;  4CY5 A;  4IA9 A;  3O4J A;  4BUJ C;  3IVM A;  2H47 A;  5C86 A;  3MMY A;  3I7O A;  3NVX A;  4WK2 A;  2AGX A;  2B5N A;  2H6N A;  5I5J A;  3VGZ A;  5GXH A;  5HE3 B;  2OVR B;  2CNX A;  4GMB A;  1M1X A;  4NEN A;  4FA1 D;  4JT5 C;  3MKQ A;  2H14 A;  4LG8 A;  5SXM A;  2VDK A; 
#chains in the Genus database with same CATH homology
 2B5M A;  4J78 A;  1JMX B;  4U1E I;  3JB9 L;  3FRX A;  4A11 A;  3DM0 A;  4A2L A;  4OWR A;  2AGY A;  2PM7 B;  3RSE C;  2H9N A;  2Z2O A;  4A0A A;  2AH0 A;  4E5Z A;  3JRO A;  2QXV A;  4CZX A;  3F3G A;  2MTA H;  4A0B A;  2IUP A;  4LGN A;  4FA5 D;  2J56 H;  1K8K C;  3EI3 A;  3PSL A;  3BG1 A;  1QNI A;  4JSV C;  4ZOY A;  1OMW B;  2G9A A;  4J0X A;  2HKR A;  3IJC A;  5EM2 A;  4JSN C;  3IJ1 A;  5CXB B;  2P9N C;  5HQG A;  4D6V A;  3VA6 A;  4XYI A;  4GQ2 P;  5A2Q g;  2OVQ B;  3AL8 A;  5HE1 B;  4ERQ A;  3PSC B;  4CZV A;  3SLE D;  5C2V B;  5AMS A;  4Z8L A;  4L9O A;  1L0Q A;  3C9C A;  4CY1 A;  1ERJ A;  2Q7Q A;  4ZN4 A;  3AH8 B;  3OKY A;  3IIW A;  4ERY A;  4CZY A;  3J81 g;  4ESG A;  2IUQ A;  2G99 A;  2OVP B;  4PBZ A;  4PSX B;  3I89 A;  4MK0 B;  1NEX B;  2YBA A;  1GG2 B;  5HYN B;  5GMK n;  5IGO A;  2P9L C;  4GQ1 A;  2CE8 A;  2UZX B;  4CY3 A;  3DSM A;  4CI3 A;  2PM6 B;  3JRP A;  4J0W A;  4AEZ A;  2H3X A;  1P22 A;  4UI9 R;  1A0R B;  2AH1 A;  2HJB A;  3SBP A;  3U4Y A;  3FGB A;  5CXC B;  4O1Q D;  2CO0 A;  4I79 A;  1XIP A;  4FWW A;  3EI2 B;  2BBK H;  3SHF A;  4CC9 A;  4ZOX A;  2HXC A;  4JD2 C;  1R5M A;  2HES X;  5FXY A;  5CYK B;  1B9X A;  5K1C C;  1RI6 A;  2AGL A;  3UVN A;  4FA4 D;  4TZ4 A;  3EI1 B;  3E0C A;  2IUV A;  1MDA H;  2HKM A;  4O3T B;  4A7J A;  1K32 A;  4FHL A;  2H68 A;  2XL3 A;  2PBI B;  3BG0 A;  3EI4 A;  5FA5 B;  4N14 A;  5IJ7 E;  5C2W B;  3RMZ D;  2J55 H;  2P9P C;  3I7N A;  1SQJ A;  2PM9 B;  5CXB A;  1SHY B;  3UKU C;  3V9F A;  4GGC A;  4O9D A;  3DXM C;  3SJL D;  5I5M A;  2P9S C;  3SBQ A;  2P9U C;  4A08 A;  4HDJ A;  3RFG A;  3UVO A;  4BH6 A;  4PXW A;  1TBG A;  4A09 B;  4L3G D;  4X61 B;  3C99 A;  3OTT A;  3RRM C;  2IWK A;  3C5M A;  5H14 A;  5IT9 g;  2IAA A;  3L4O D;  2OJY A;  3OL2 A;  4X60 B;  4GM3 A;  4D0K A;  2HJ4 A;  3PXW D;  1GOT B;  3P4F A;  5EMJ B;  4JSP C;  1JJU B;  2GC7 A;  4FAV D;  3OKT A;  1N6D A;  5JWZ A;  4PC0 A;  5TDH B;  3A0F A;  3I7H A;  2YNP A;  5B4W A;  5HE0 B;  4E54 B;  2W18 A;  3N0E A;  2IUR A;  2YMU A;  3ORV D;  1PGU A;  4J73 A;  3ODT A;  3I8C A;  5I5I A;  3UKR C;  3I7K A;  4GGD A;  5GSA A;  4J86 A;  3SFZ A;  3EMH A;  4PNK B;  3AL9 A;  5FLX g;  4CY2 A;  4PBY A;  5IGQ A;  3IKO A;  3I2N A;  5CYK A;  2O9K A;  1YFQ A;  3DWL C;  3J80 g;  3EI1 A;  4H5I A;  3HFQ A;  5HE2 B;  4JT6 C;  3UR4 A;  1MG2 A;  2CN3 A;  2UZY B;  1PEV A;  3MZK A;  4GQB B;  5GXI A;  2I0T A;  4A11 B;  2P9I C;  4R7A B;  3MZL A;  5KDO B;  4K3I D;  3CFS B;  3BWS A;  2PM9 A;  3KRX B;  3JZN A;  3ZWL B;  5TEE A;  4NSX A;  5IJ8 E;  4A0A B;  5IC7 A;  3NVQ A;  4U7A A;  5EAP A;  4EWR A;  3EI3 B;  3IJ0 A;  4J8B A;  3SXT D;  3RN1 D;  1U4C A;  3AFC A;  3EU7 A;  2CE9 A;  2IWF A;  3PVU B;  2YNN A;  3ULE C;  2H13 A;  1SQ9 A;  4O45 A;  3GRE A;  4ZOZ A;  2I0S A;  2H9L A;  4PSW B;  3RFH A;  2GNQ A;  2XL2 A;  3RLM D;  3N0D A;  1MG3 A;  3EWE A;  3PXS D;  5K19 A;  1Q47 A;  2XU7 A;  3UVK A;  4E54 A;  2AGZ A;  4QRJ A;  4YVD A;  4ZOV A;  3PXT D;  4K3J B;  2J57 G;  3I8E A;  3NVN A;  4LG9 A;  2H9M A;  3DXK C;  2CO0 C;  2Z2N A;  4ES0 A;  3GFC A;  4GM9 A;  3FM0 A;  5EAM A;  5EMK B;  3JZG A;  5FKT A;  5AFU 3;  2AGW A;  2QC5 A;  1JMZ B;  1PI6 A;  3UVM A;  3I7L A;  4OZU A;  4QT8 A;  5FKR A;  5EAL A;  2OK4 A;  5FQD A;  2I0R A;  2H6K A;  2HYE A;  4O3U B;  4CI8 A;  4GGA A;  2YNO A;  3K26 A;  3CFV A;  3V7D B;  4A2M A;  3PVW B;  4J82 A;  5CXC A;  2XYI A;  4JSX C;  2BCJ B;  3EI4 B;  3UVL A;  4JXM A;  3SCY A;  2GC4 A;  3CIK B;  3EI2 A;  1XHM A;  4IMM A;  4XEI C;  3V5W B;  2P9K C;  1JOF A;  1N6E A;  3SWS D;  4J79 A;  5EMM B;  3VH0 A;  3F3P A;  3I7P A;  4CI1 A;  1GXR A;  4GM8 A;  4A08 B;  3F3F A;  3B7F A;  2YB8 B;  5TEF A;  5EML B;  5H1M A;  4J84 A;  4J87 A;  2OK6 A;  2H9P A;  3MKS B;  4L3H D;  4KFM B;  4X3E A;  4Y5R D;  3W15 A;  3OW8 A;  3OL2 B;  1U2V C;  4CI2 A;  4FA9 D;  3C75 H;  3JPX A;  5C9Z B;  4Y7R A;  3SVW D;  1S4U X;  5TF2 A;  4E5Z B;  4QQE A;  1FWX A;  2I3T A;  4A0B B;  3SBR A;  4A09 A;  5FKS A;  2B5L A;  2CN2 A;  2TRC B;  5EM2 B;  4J77 A;  4J8G A;  4L1Q D;  5EAR A;  5AJA A;  3L4M D;  3EG6 A;  5FKQ A;  3SN6 B;  4ERZ A;  2EBS A;  4GZ8 A;  2H6Q A;  3SMR A;  4FAN D;  3AL8 B;  3MXX A;  2B4E A;  4XYH A;  1B9Y A;  3K27 A;  1TYQ C;  4G56 B;  4X63 B;  5H17 A;  3OKY B;  2AQ5 A;  4H5J A;  4BL0 A;  3PE7 A;  4QL1 A;  3OKW A;  3KRW B;  4FB1 D;  2Z2P A;  5THA A;  1NR0 A;  3JZH A;  1XKS A;  4AOW A;  1GP2 B;  1OLZ A;  3JAM g;  1PBY B;  1N6F A;  1VYH C;  3RN0 D;  3IIY A;  4J81 A;  2OIZ A;  2I3S A;  4CY5 A;  4IA9 A;  4BUJ C;  2H47 A;  3MMY A;  3I7O A;  3NVX A;  2AGX A;  2B5N A;  2H6N A;  5I5J A;  3VGZ A;  5GXH A;  5HE3 B;  2OVR B;  2CNX A;  4GMB A;  4FA1 D;  4JT5 C;  3MKQ A;  2H14 A;  4LG8 A;  5SXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...