3PSWA

Structure of e97q mutant of tim from plasmodium falciparum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
246
structure length
246
Chain Sequence
b'RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFQRRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
molecule tags Isomerase
source organism Plasmodium falciparum
publication title Revisiting the mechanism of the triosephosphate isomerase reaction: the role of the fully conserved glutamic acid 97 residue
pubmed doi rcsb
total genus 96
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pswA00
4FNSA 5DBTA 4UC5A 3L67A 1ZAJA 3P81A 1AW1A 1OJXA 3O16A 1TJPA 4GNJA 4PODA 2YX0A 3B04A 5BMXA 2B7QA 4O0ZA 3VNDA 1W1ZA 3NXFA 4O57A 3W72A 5D02A 4MJMA 1CI1A 2CLLA 4UTMA 1FDZA 4OHQA 4Y6GA 1FWRA 4NJHA 3NDOA 4Z1CA 1VJIA 1LBLA 5E1QA 4QQ3A 3W86A 2RDUA 5DCDA 4DPPA 2FB2A 3UPBA 1ZFJA 2W79A 4JTKA 4IGHA 4N4PA 4DPQA 3W71A 2KZHA 5CZSA 4P61A 2CLHA 1K3UA 3G0UA 3QW4B 5D38A 2FPYA 1WYIA 5CSRA 5A5WA 3G1HA 2JK2A 2NUXA 3W2LA 4O54A 1JRBA 3N9SA 2DZVA 3MUXA 3HG2A 5FF4A 4MYAA 1W3IA 4HNNA 3G24A 4K38A 1H5YA 3PBVA 5LSMA 3M6YA 3EWYA 1ALDA 3TU9A 2UV8G 4FO4A 2YYTA 4AMAA 1SQ7A 2Y88A 5CPOA 2ZBTA 3LX9A 4MZ1A 1EWDA 1TPVA 3WFAA 2NUWA 1IF2A 1LRTA 3LHVA 3T40A 4RJEA 4TMCA 1MEHA 2E68A 2V2HA 3QM3A 3T78A 2GQ9A 1LZOA 1IIHA 3LXCA 1K7XA 3W1QA 1CX9A 4DBEA 5CZJA 2EAWA 2CLKA 1EEPA 5C2XA 3W7PA 4WY0F 2R94A 2CFFA 4CCEA 2ZRWA 4OE7A 4E0CA 5D2WA 2I14A 1GEQA 2B7PA 5F4XA 1ZAHA 3SECA 1Q6QA 1OK4A 2Y70A 2ISWA 5KINA 1GJPA 5BOOA 4NX5A 1KLYA 3C52A 4UFHA 4FNTA 1XBVA 1LLZA 3W3OA 4A2RA 3L5LA 2FTPA 4U28A 1OK6A 5F2GA 4LUIA 3NPWA 3QC3A 3UZJA 1BEUA 4KFOA 3G22A 1UB3A 4JY8A 3T7VA 1XXXA 3LB0A 2CLMA 4HKPA 4O1BA 1FY6A 1RZMA 1ME9A 1HO4A 3H53A 4WX2A 4CNNA 1TV7A 5ABTA 3W1XA 2ZZ4A 3HGSA 1SZEA 4RZ6A 4RKAA 4S1FA 2GVLA 4Z1AA 1QWGA 3ELFA 1LOQA 4I9AA 4IXHA 3GDKA 1WAUA 3QRHA 4M5PA 1LOSA 1M5WA 3PC0A 5LKYA 2WNNA 4PEKA 4FIQA 1QFEA 4TMBA 1EPXA 1CW2A 1K8YA 4GUJA 2W0UA 1QPOA 4JN6A 4GBUA 5L9FA 3L21A 3BGGA 2C1HA 2X1RA 8TIMA 3JR2A 1VCFA 3FEMA 3LCWA 1ZJIA 3TQVA 1OFAA 2WKJA 2DZWA 3DBPA 3PG9A 4LVGA 2HS8A 3W1UA 1XL9A 2ZZ7A 4HHPA 1FDJA 2WQPA 1J2WA 3N2XA 2QCEA 5F2MA 5KITA 3DFOA 5HMSA 1WDWA 1V7YA 5DCBA 2OT1A 3NQGA 2RH9A 1VQTA 2TPSA 3BPWA 3O15A 1YXDA 4X2RA 2A5HA 2GQ8A 4JEQA 3LERA 2QKFA 1GYLA 5DELA 1OYAA 4JTSA 4GWEA 1H60A 3KFTA 4UNLA 4O4WA 3GAKA 2CZDA 4JXCA 4N4QA 2ATSA 5CZ0A 5K9XA 5E0KA 4LV9A 3C8FA 4TR9A 4NXKA 3K30A 2A7PA 4A29A 1VGAA 3U8GA 3BG3A 2BX7A 2J88A 1RQBA 3UPWA 2XFWA 3JS3A 4MY1A 2Z1BA 4NJJA 4IJBA 1LLWA 1YDOA 3FYOA 5HINA 4IMDA 1RVGA 4AF0A 4HNTA 1B4EA 2E5DA 4H6KA 5C54A 2X2GA 1LBMA 3NQVA 4LRTA 2X1UA 4FF7A 3IIOA 4LRSA 3C2EA 3C61A 3MHUA 3MI3A 4JYEA 4KFNA 4FX8A 3S6DA 5CPNA 3PVFA 2ISSA 3PAJA 4GUHA 1ADOA 3N9RA 2YFNA 1G67A 3S0CA 4MVAA 1GVSA 3LI1A 3W7MA 1HG3A 2NXIA 1QPRA 5TBOA 2VXNA 4R7JA 1H1YA 3QJAA 2C6QA 3NAVA 3EWZA 4LVFA 3HQ1A 2HTMA 2FB3A 2TRSA 4GUGA 1TPUA 2C14A 3P5YA 4YMZA 3T44A 2RDTA 4D2JA 1PCKA 1XBYA 4FIRA 3NQAA 2OMAA 3W6YA 1JQXA 2GOUA 1AW2A 1F7BA 1VYPX 5T26A 1M6JA 3EWUA 1VYRA 3DHDA 3R8RA 3STCA 4Z0SA 2BZNA 4ZQOA 3PWAA 1QO5A 1KTNA 5D32A 1GVOA 2VFGA 5AHEA 1OF6A 4LVDA 5EA9A 5HWJA 1QCWA 3TC7A 3STGA 3G8EA 4OGZA 2VEKA 3NM1A 3LV5A 3S9YA 2ZRZA 2YPIA 4RX0A 2J27A 1IXNA 3M0ZA 2VELA 2Y7GA 3W2JA 4IPIA 3IIPA 5CPLA 1W3NA 1U5JA 4WQ6A 1F2JA 3SGUA 3GVGA 3KVLA 2DZXA 1MO0A 3KRSA 3TW6A 5D09A 3DFTA 4EVZA 3DFQA 3E02A 2X16A 4DF2A 4JTGA 3L5MA 1SPQA 4JTJA 3W2UA 3TKFA 1GPWA 1BWKA 3NPUA 1LBFA 2PURA 3CWOX 3W7KA 1QPNA 2PCQA 2V2DA 3T4CA 3LLFA 3GDTA 4EWND 1SZFA 3G1YA 4QNEA 5EL1A 1XDLA 4LUJA 3OVRA 3W1AA 1WBHA 1JCLA 1ZALA 4JTLA 1EP3A 3LHZA 3NL3A 4HT3A 1LTDA 4O28A 3S8HA 2NXHA 2E6YA 2E6FA 4MY8A 3P8JA 3PY2A 2ZZ5A 4FB7A 2EF9A 5F4WA 5FF0A 4LY8A 1KV5A 5AYXA 3NQ8A 4UR8A 1WQ5A 4DXVA 5HR7A 3HGJA 1VZWA 3QSTA 3TMQA 4K7YA 4BK9A 4WXZA 2QDHA 1YDNA 2VC6A 4O50A 3M5XA 4IMFA 1XBZA 1R2TA 4UTIA 3NQCA 2ISVA 2YW3A 4OWGA 3SGZA 1EP1A 4Q32A 4UIOA 4MJZA 3W7CA 1OFRA 1S5WA 3UWVA 3GX9A 4JTFA 1L6YA 2JGQA 3LCFA 1NFBA 3DKJA 5D37A 3LLDA 3MYPA 1SW0A 5CGQA 3PBYA 1ICPA 2RDWA 5I3IA 2QEZA 5CKSA 1VH7A 4Y8FA 3W1MA 2WSYA 3P8IA 2QCHA 3SR7A 4BI7A 3S42A 3P74A 2G95A 3DENA 3PR2A 2C15A 4Y96A 3BW4A 5D2YA 4JNMA 4O14A 3LXAA 1DQXA 3MMTA 3EKZA 1KM5A 1SO3A 1TPEA 3PS7A 3TJLA 2A0NA 4OBTA 4JTTA 1YTEA 3LV6A 1C9DA 2YW4A 2GQAA 2NX1A 4N02A 5DXYA 3G8RA 3P5ZA 1G6CA 1ZAIA 3GKFA 3TH6A 3W7GA 5SWUA 1JUEA 4ZQPA 4PFMA 4MZ8A 3F4WA 1JCYA 2CLFA 1Z42A 3KRZA 2V81A 1ICQA 1XUZA 4LC8A 1PHWA 5C5YA 2QJIA 4O1DA 3WK2A 5U7SA 3NL6A 4HSOA 2CW6A 4GE8A 4AWTA 3A9IA 1ZHAA 3ZWSA 3GAYA 1GT8A 2ZA2A 2HS6A 4TO8A 2A85A 1I45A 2C13A 5TQLA 3TE9A 3LBMA 2EHHA 4NJIA 4I7VA 2XN0A 2QUTA 2ZZ6A 1DJNA 3W9ZA 1FWNA 2Q3RA 5DLCA 3LCHA 4Q4KA 1EUNA 1RD5A 2Y62A 4MYXA 2QCDB 1QOPA 2H8XA 3QEZA 4HPXA 1O5XA 4MZYA 3SJ3A 2DZPA 1A5CA 2ZFAA 4RK8A 1IGSA 2D73A 5EMUA 4XTDA 1HO1A 2B7OA 3QZEA 2V9DA 4UFLA 3EXRA 2HSAA 2J6XA 4UCGA 4EOUA 4O16A 3IIXA 1O5KA 1P4CA 3M16A 3B03A 4H3DA 3GXPA 3HO8A 3MP4A 3WK3A 1MSSA 3WK1A 1TQXA 4S2CA 4O52A 5H2ZA 1V5XA 3NYZA 4LTSA 3IRDA 4NJGA 1VC4A 5AC7A 3IV3A 3U6WA 4FX6M 1G4PA 1K03A 1VLWA 4O11A 1E51A 3BG9A 3EWBX 4CQ8A 4GUIA 1IIGA 3GDMA 3O8AA 4UNKA 5HNRA 3DI0A 3ABOA 3W85A 3QMTA 3A5FA 3NNTA 3QF0A 3M1ZA 2Q8ZA 3Q58A 5IBXA 1OFOA 2DZUA 2CLIA 4LS0A 1HUVA 1JCMP 2VEIA 3CEUA 3GLCA 1LRNA 3NEVA 3M41A 4ML9A 3ZS4A 3DHFA 1FWTA 1LOLA 5DY2A 3CQ0A 3G1AA 4TIMA 2JGYA 4R53A 5AC8A 4UTTC 3LDVA 1AL7A 3P67A 3WJZA 4KFPA 3RFAA 1PL9A 4KWWA 4XUGA 3FJ6A 4FNPA 2H3BA 1YXCA 5D2TA 3LCLA 1PCWA 2QR6A 3DI1A 3UWWA 1KM4A 2OX1A 3G1SA 4ZZ9A 3THQA 3YPIA 4RZ5A 4LNYA 2F84A 5AHNA 2NWSA 3IIVA 5FI8A 5A8GA 1ME7A 1J5TA 1JJKA 1TTJA 2DP3A 2Y85A 3QYQA 1LDCA 3C56A 1M7PA 2Z6JA 3QPYA 1TREA 1PHQA 3I7SA 1YPIA 2Y7EA 3F1QA 4POCA 1KM2A 4JDBA 4ZQMA 4ZVJA 5K4ZA 3F4NA 4QSHA 1BWLA 3W22A 5KSWA 4NT0A 5AB3A 5I3GA 2R14A 3B4UA 3W1NA 2QCNA 1DBTA 3P80A 4O0KA 5CPMA 3W1PA 5BW6A 5D2XA 3M7WA 2RHGA 4UTKA 4JICA 1SSGA 1EWEA 2ZA3A 3HBLA 3PUDA 4JIPA 1LP6A 2ZTKA 5HR6A 2Y89A 3RU6A 1W5NA 2QF7A 1FXPA 1N55A 2AQWA 5FEZA 2A7NA 1J4EA 1B3OA 3TQ0A 3GR7A 4N9DA 2BSLA 2C3ZA 3M9YA 3NOEA 4XQ6A 1SFJA 2AGKA 4NUWA 2YZRA 1EX5A 5IM51 4JGDA 2CZFA 3PBUA 3IVTA 3C2RA 1LRQA 2VFEA 1B9BA 3NQ7A 4HPJA 5LHEA 2EPHA 1ME8A 2NX3A 1LYXA 3IVUA 3B0VC 4MKNA 4YXGA 3A22A 3W7EA 1JCNA 4N9CA 1RQEA 1HL2A 5HUOA 2H6RA 4YCOA 1HFBA 2CZEA 4N2YA 4UMCA 2YDAA 4MLJA 3TC6A 3TUUA 3E0IA 2Y6ZA 1OYCA 3DFNA 1KLZA 4TX9A 2ZRXA 2BWGA 4HSNA 1OX4A 1G69A 5F2LA 1ICSA 4BR1A 1OHLA 5G2WA 3SY5A 3PB0A 4E2BA 1DV7A 1B4KA 1KFCA 3S1UA 3O6YX 2DZTA 1GYNA 3CPRA 3W73A 4LC6A 5I3FA 1KW1A 5KZDA 2RKXA 3INPA 1SO6A 2C0AA 3CWNA 4AXKA 1OG0A 1P5BA 3MJYA 1R47A 4FEZA 4YWIA 3W7IA 4IQLA 4HIBA 4N9EA 3UWQA 3HIJA 2FJKA 3LRLA 4WY0B 3G0SA 1XKYA 3DXIA 1FCVA 3GXTA 1DL3A 2JKAA 5H91A 1HTIA 3H55A 3UWYA 1QAPA 2NLIA 5LNSA 5G2IA 4OU1A 4JR5A 5LNWA 3WK0A 1D3GA 3G1DA 4LV4A 2ZRUA 3ATYA 4HNVA 1OF8A 3NVTA 2WNZA 2ZDRA 1F6PA 3STEA 1H7OA 4ADTA 2ZYFA 3TQKA 3WJXA 2O7QA 2WJZA 4XKYA 5FEXA 5LNUA 3MP5A 5KZMA 3V1PA 2PE4A 1GVQA 1FWWA 3L65A 5FF3A 1M7OA 1K8ZA 2Y61A 2YGYA 3GZ3A 5KMYA 3LOTA 4J9JA 4IPJA 4FXRA 1OFQA 5U4NA 5AHFA 2VKZG 2JKEA 4UR7A 3DFSA 3SSJA 4KKXA 3BVJA 4JX5A 4DO5A 2V82A 2NV1A 4O10A 3TNOA 5TIMA 1TPH1 4NU7A 3LCIA 5AYYA 1NSJA 2WPBA 2E6DA 3KXQA 2W6RA 3A23A 4M6QA 1JUBA 2E77A 3DKLA 4DO6A 3HG4A 3FS2A 3UD6A 2I9EA 3SIZA 1KTBA 4ZQCA 1K8XA 2NZLA 2ALDA 2YCEA 3R2GA 5EYWA 4PL2A 4UFIA 4AHOA 3LGEA 3HMJG 1EUAA 4NX0A 1P0NA 4K37A 4PL1A 1XC4A 3MWAA 4UTJA 5HUPA 2PRHA 1DORA 4WY0A 4ORMA 3ANYA 4QISA 4LWWA 3AJXA 4BFAA 4GXMA 1WOAA 5FF7A 1W37A 1F05A 2BTMA 2J9YA 3NGJA 1UASA 3E96A 4I7UA 4MY9A 4XBSA 2TMDA 3E49A 1ZNNA 1KM6A 1MEIA 2FQIA 2PC4A 3UZ5A 2Y7FA 3M43A 1XM3A 3W7HA 1K7FA 4LW7A 4Z0JA 4FNUA 5EY5A 4UFKA 1JCXA 3W7LA 5HWNA 1RQHA 1QOQA 2WSRA 4M6VA 5D2VA 3D0CA 4PC8A 3CM4A 4O53A 3EX4A 2FIQA 1T0OA 5KZEA 4ALDA 2WNQA 3E9AA 3TSMA 1W5OA 2TYSA 4NJKA 2BXVA 3QQ1A 1TTIA 3QMRA 4Z1DA 1SW7A 2G5WA 1SW3A 1ONRA 4U4MA 2QCFA 4N9BA 4IXXA 2ZRYA 2GJNA 3PB2A 4WZHA 4NZJA 3VCRA 2DU2A 4AWSA 5K3VA 3NPXA 4AB4A 3FJLA 1EP2A 2A4AA 4DF0A 3MYOA 1PIIA 4NXSA 3TAOA 1GVRA 3KHJA 3TFXA 4K8EA 2JBMA 2FLIA 4CNOA 5DCEA 2ZQ0A 4JTUA 1UJPA 5HULA 2Z2UA 3KAOA 1H7XA 3NQ6A 4NNAA 3CEPA 5I3HA 3H54A 4UMAA 4X22A 4IX0A 3NPVA 3LHYA 4O18A 2X1TA 4NNBA 7TIMA 1WX0A 3N3MA 4BWLA 3MI2A 4JTEA 1GWJA 4QITA 4CQ9A 2VEPA 4IMCA 3W1TA 5G1TA 1VCGA 1SUXA 3DH7A 2Q8LA 3W74A 4JYFA 4AWUA 5CG7A 1Q6RA 1GZGA 3TDFA 5DXXA 1ML1A 2NX9A 1OFEA 1TB3A 4WJEA 1Q3NA 3TFCA 1TPDA 3EB2A 2YFOA 1H7NA 2CLOA 1NVMA 1F76A 4O15A 5EBUA 1R2RA 1SO4A 3TROA 3W2NA 4DQWA 3N19B 4XBKA 1TPC1 3EXTA 3HPSA 5E93A 4B5NA 1L9WA 5F2IA 1KFJA 1OFPA 1JQVA 3G1FA 1TV8A 3KRUA 3RK8A 3CB8A 2XN1A 3OBKA 1QO2A 1A53A 4LOCA 3L0KA 5FESA 1WXJA 3LM7A 1OFDA 1THFD 1PV8A 4OQVA 3TX9A 1TO3A 4O1CA 1JRCA 4WXYA 2J9ZA 5HQEA 3DZ1A 1TRIA 4X9SA 4XZ9A 3BLFA 1GQNA 3BARA 2PRLA 1FWSA 1BTMA 1SZGA 4FHAA 1SU5A 3EEGA 1SSDA 2GPTA 1Q45A 4O1AA 3BGJA 1JR1A 3NL2A 3TMLA 1AW5A 3G3MA 4FNQA 1I8JA 3MP3A 4QM1A 5EKYA 4YL2A 5D33A 3W7JA 2NWRA 4X3ZA 1W56A 4IOTA 3LI0A 1IXPA 3M47A 3P7YA 4Z1BA 3S1VA 3CT7A 3OIXA 3CIWA 2X30A 4RXGA 3UY7A 5G4WA 3B06A 5K2ZA 1OX6A 5K4XA 3LHWA 2P1FA 3W1LA 3PBWA 3W76A 2R91A 1H61A 1OABA 1PVNA 4CNPA 4LVBA 4M19A 2QJHA 1UUOA 3SZ8A 2V8ZA 4NQ1A 3L0NA 3HOJA 3T55A 4IMGA 6ALDA 3W7NA 1VCVA 2V0TA 3MO7A 4K8HA 3HPZA 1VLIA 3GIYA 2GVGA 1UCWA 3B05A 1O60A 2RFGA 4O8RA 3W23A 4UTTA 1C8VA 3RLUA 4DF1A 1QR7A 3KVKA 2ZTJA 3FIGA 3GR8A 3IGUA 4RLIA 4ZQRA 3TSBA 3A5VA 5LNVA 1KFKA 1WOBA 3THAA 3I68A 3C2VA 1DOSA 1W0MA 2QUVA 2WOQA 1X1ZA 4O17A 1OX4B 5D30A 3LCGA 4JY9A 5IBXC 2P0OA 3P60A 3RLVA 3ZFHA 1YLVA 3GKAA 3MBFA 3BV4A 5K7JA 3EWXA 4K6AA 3LXBA 4K36A 2Q3OA 2QCDA 4EF8A 2H90A 1XDMA 3Q37A 3ZWTA 4UTHA 2VENA 3FLUA 3FFSA 4C1KA 1I2QA 1H1ZA 1I2PA 3NZRA 3EXSA 3TSDA 1KV8A 3BW3A 1GG0A 3OVQA 1TSIA 1QNVA 2VFFA 1TPFA 1GTEA 4S2BA 5HWMA 1H7WA 2LLEA 4UTWA 4UFJA 1A5BA 3WJYA 5AOUA 5I3KA 3UNDA 1KTCA 1FCQA 4DBDA 3N2MA 4L4LA 4MUZA 2ZA1A 4JTHA 2A6LA 3TA6A 1H63A 1KFBA 3G3DA 3I65A 4JDYA 1T96A 3FKKA 1LCOA 4ORIA 3L68A 1MEWA 4QNWA 5FF2A 1Y0EA 1X7FA 3NQDA 5AHIA 1N7KA 3W83A 3EX6A 3OG3A 5J5RA 2QJGA 2GVJA 5AYZA 4K7VA 3HGRA 3OHIA 3C2FA 3NR0A 1WA3A 4L4MA 1YTKA 3CTLA 3L2IA 3P62A 3L0GA 1I2RA 3VI2A 1LM1A 5DY3A 1S5VA 4WOZA 2Z0IA 2CLEA 2NXGA 1X1OA 1W5PA 1GTHA 2G97A 3LTYA 4A21A 5GVJA 3UWZA 3QPZA 1OVDA 2P10A 5AHMA 2PRMA 3UY8A 4UTLA 3W07A 4R34A 1A50A 3VKJA 2FDSA 2ZZ1A 3E12A 4JX6A 5G2HA 5AFDA 2ABAA 2R8WA 1MXSA 3UXAA 4PCFA 3Q94A 4UXDA 4OV9A 1KFLA 1O4UA 4A22A 3OEXA 4RZ4A 5AHLA 2QCCA 3VE7A 1G4TA 1PS9A 3GB6A 3G1XA 3CLMA 4LVAA 2X1SA 4MIMA 5BRBA 4ICNA 1RR2A 3IVSA 4ADUA 5EPDA 3L5AA 2Z6IA 3P61A 3W87A 1AMKA 4RR4A 1U83A 1JULA 1PE1A 3U2OA 3STFA 3GXNA 2ZCGA 4LU0A 1MZHA 1Z41A 4ONVA 2FFCA 3R12A 4ZL1A 3SI9A 5CSSA 1SR9A 3EX2A 1XUUA 4O19A 2B4GA 3UYCA 3QW3A 3IGXA 3M5YA 3PSVA 3NL5A 3QSRA 1R46A 1T99A 4O4VA 3GDRA 3FA5A 5DN1A 4NZFA 2AAMA 3TJXA 3DFPA 3O06A 3G0XA 1H51A 3CU2A 5CZTA 3QQ0A 4JYDA 4UFMA 3W2MA 3O07A 3O1NA 1W5MA 4ZQNA 4IX2A 4QIUA 5MHBA 3NO5A 1DKWA 3WJSA 3BLIA 3GK0A 4LS2A 2ABBA 4HN4A 3G1VA 2O7SA 4K39A 1BKSA 3S5ZA 4CCDA 2OZ0A 2WO5A 2C18A 1W8SA 1ZCOA 1YADA 3RNDA 1RPXA 4NNCA 3V75A 3PG8A 3NM3A 3FKRA 4A3UA 1F5ZA 1FDYA 3LRKA 3R13A 1SFLA 4N6FA 4DEFA 3Q2DA 1X6UA 4NVTA 1W54A 4MOZA 3FOKA 4Y9AA 1G7VA 5LGXA 5FEWA 1FCUA 3MW7A 1YTDA 1G7UA 2FPVA 3ATZA 3B0PA 1TPB1 3PUOA 4PTNA 2DJXA 1VR6A 4AEOA 3O63A 4AH7A 4JD4A 3PSWA 1IXQA 1A5SA 4CQAA 3EWWA 1F73A 3PUEA 2CU0A 3JRKA 1S5TA 2WV8A 3HG3A 4QJ1A 1VRDA 3GDLA 3UQNA 3C0JA 4XWUA 5G1YA 3LCXA 3QFEA 3KVJA 3UXDA 1ZENA 1XI3A 1AL8A 4AHPA 1JCJA 1DJQA 1G4SA 3RMJA 1VHCA 4UMBA 2F7FA 4RV8A 2ZZ3A 5C55A 3BK0A 5AC6A 1NF0A 5LHFA 2A1YA 4OV4A 1NF7A 1G4EA 4YLWA 3NA8A 4TU1A 4W9TA 4BI5A 5KTLA 1Z44A 3W70A 3C4UA 1FBAA 3LBCA 3A21A 4M6PA 3CC1A 1YYAA 3M5VA 1W31A 3HB9A 1N8FA 4A2SA 1H50A 3S5OA 2HMCA 2QDGA 4N6EA 3W7RA 2JKPA 2QCLA 2QAPA 4UTUA 2XN2A 3P82A 1KBIA 4XKYB 2EGZA 1O94A 3HGOA 1DHPA 3W88A 3NQEA 2GJLA 3AO0A 2NUYA 3N14A 3NQMA 3LHUA 3W7QA 1UBSA 3BO9A 2VFHA 3MHFA 5L6UA 2QCMA 3L9CA 1EB3A 5F1VA 1KA9F 4AF0B 3TV8A 4JS3A 2V2CA 1AK5A 1KM3A 4Y90A 1UUMA 3N34A 4JX4A 3OA3A 2C19A 4DELA 1F74A 3USBA 4AAJA 3MI6A 3S5YA 3C2OA 3GNDA 1QPQA 2C16A 2A6NA 2OCZA 4IUOA 1H7PA 1KM1A 1KBJA 2J9XA 2NV2A 4JIQA 1QDSA 3MBDA 3EKLA 2IQTA 2YSWA 1D9EA 4O13A 2ZZ2A 1B57A 1NAL1 2V30A 1SZNA 1GVFA 4ADSA 1TJRA 3L66A 2ATMA 2VEMA 2Y7DA 2H3DA 1TRDA 3G18A 4M7SA 3W84A 4DO4A 4LS1A 3MHGA 2E6AA 3A24A 4AHQA 3DU0A 3DAQA 3O6DA 3TXVA 1WV2A 4FX7A 1RV8A 3B0UX 4G1KA 1XBXA 1JVNA 4MPQA 4H4IA 2YR1A 4GRSA 4EF9A 3CHVA 4Q33A 4M7TA 1W3TA 1VYSX 5D03A 3UWUA 1TV5A 1S3HA 3NQFA 1I2OA 4GC4A 2H8ZA 3HG5A 2B7NA 3W75A 4E38A 3VE9A 3TCEA 1P0KA 1FCBA 2TSYA 5J5DA 3LTPA 1XFBA 2V5BA 5F1UA 5LNRA 1H62A 1AG1O 1TIMA 1T8XA 2E09A 3QH2A 4BWLC 3S1WA 3TK7A 2DORA 3NQ2A 3TR2A 4IMEA 2B0MA 1O95A 5C6MA 3R89A 1XCFA 5D05A 1H7RA 2E5CA 2G96A 1L6SA 2A21A 2VOMA 3W1RA 3KOFA 1SO5A 4MLRA 2ZRVA 1D3HA 4KWVA 4GUFA 2WSQA 4MFDA 5K9CA 1FQ0A 2Y63A 1TYGA 2A2IA 2DJLA 3SW6A 2QCGA 3LTSA 5D04C 3I6RA 3NG3A 1R30A 1VHNA 4WUIA 1Q6LA 3PULA 3W7DA 2EKCA 1IXOA 3C6CA 3P84A 5DBUA 1TTQA 3TIMA 1K7EA 3W2KA 3IIZA 4P2VA 2DZSA 4CCCA 5AN7A 3IEBA 3O6CA 5BMWA 1VS1A 4LT9A 2V5LA 3ABSA 4BI6A 3BLEA 4ZMGA 3EX3A 3NZ1A 6TIMA 1C29A 4PA8A 3QMSA 1NEYA 1TCDA 3R5EA 4OT7A 5LZLA 2OT0A 4BF9A 2QUUA 5BNKA 4WOQA 3BG5A 1WBJA 3EX1A 4IWWA 4C1LA 4JTIA 3HJZA 3HPXA 1GOXA 3I7QA 3TAKA 4Z08A 3I7RA 3VFLA 3CIXA 1P1XA 3S1XA 4I7WA 2QAFA 3M5ZA 1TPWA 1X8FA 2YXGA 4R33A 3LHTA 1L6WA 4UUIA 2I1OA 1A5AA 4RXFA 1TQJA 1YXYA 3N73A 1KFEA 3PF3A 4XTIA 4QAIA 4UTWC 2J24A 1LORA 5LGZA 1TMHA 5K9DA 2BLEA 4AVFA 1L2UA 2E1DA 3DGRA 3PM6A 1LROA 3GNNA 3M44A 1I4NA 2YYUA 2GUUA 1FX6A 3ABQA 3S5NA 1Q6OA 1YPFA 1GG1A 4YCPA 2E5BA 4MFEA 5HJLA 1OYBA 4PH6A 3LRMA 4WD0A 3W7OA 1K02A 4HNUA 1OFBA 1DVJA 1KM0A 1Z48A 5I3JA 1F6KA 1I2NA 3HF3A 2VFDA 3GYEA 4CLMA 3IGSA 3O05A 5FEPA 3TXZA 4GJ1A 4E2DA 3FYPA 2OJPA 2CZ5A 5F4SA 3TW7A 4RCXA 4FXSA 1TTPA 3SFKA 3KVMA 2A7RA 1FXQA 4FNRA 4GFSA 5G4EA 1ZY9A 3KX6A 1QMLA 5G5IA 1DQWA 3BW2A 3C3NA 1R2SA 1VPXA 4O12A 2CWNA 3ABRA 3B8DA 1EIXA 3RF9A 1W5QA 3ZR4A 1YDVA 2VFIA 1OX5A 1EA0A 1JUKA 3F03K 1FUYA 3OVPA 3WJWA 2FPTA 4EIVA
chains in the Genus database with same CATH superfamily
1QWKA 4GZJA 2G3NA 1X7IA 1PJ9A 4DHGA 1TJPA 4L5ZA 2AQVA 4GNJA 1E6ZA 4QE5A 4O0ZA 3M64A 4I8DA 1J0HA 3WZ0E 1W1ZA 2Y5EA 4O57A 1MNSA 4HTYA 1KRCC 1CI1A 2CLLA 2I56A 4UTMA 4OHQA 3VM5A 3HFYA 3RRXA 4NJHA 3NDOA 4CD7A 3W86A 3G2GA 4GA8A 4KGLA 2GWGA 4MB4A 3FGCB 4JTKA 4C6LA 4MWAD 1H49A 1E6NA 3WBWA 3FAXA 1RBAA 4LUSA 4B4HA 5CSRA 1WYIA 3ZVHB 1CT5A 1E6SM 2BHZA 5FD0A 3SUSA 2DZVA 1DJYA 2PDPA 4GGBA 2P8CA 3WENA 1UIOA 3GNPA 4FO4A 2YYTA 4NRSA 2Y88A 1UKOA 4PULA 5CPOA 3UJ2A 3LX9A 1REQA 4HK6A 4Q8UA 3CK5A 4B91A 3NIYA 2E9MA 5REQA 3CZKA 3TQPA 1LRTA 1Z3NA 1IZKA 3V36A 4DBUA 4TMCA 2RDXA 4LALA 2GQ9A 2VEGA 4ROQA 2ACRA 4HZMA 1O7AA 4WY0F 4E5TA 3KZPA 4OE7A 4WDTA 4E0CA 1W9DM 3GTNA 5D2WA 1GEQA 2B7PA 1ZAHA 3ES8A 1Q6QA 1GQLA 1RA0A 5PTDA 5BOOA 2OKTA 4B3ZA 4NX5A 4W5ZA 4TXEA 3EAUA 2OGYA 4KRZA 2WZIA 4FNTA 4LUIA 2TODA 7XIMA 4LF2A 3CTTA 1CGVA 4JY8A 3T7VA 1J96A 4HKPA 4ZEPA 4PYSA 1UWRA 5JVLA 1FY6A 1FWJC 2VR2A 3WDPP 4C6BA 4C6FA 3LENA 5FJUA 1YBQB 3DG7A 4I6VA 4P7OA 4RZ6A 1S1PA 3HZ3A 3A13A 1M65A 3CV1A 3ZJ8A 4IXHA 5D9NA 1WAUA 2E1WA 4M5PA 1OQFA 1QI2A 1M5WA 3PZ9A 5LKYA 4XZIA 4PEKA 4QP0A 4LB3A 1RA5A 4ZFCA 3CO8A 3T8LA 3BGGA 2F2KA 1DJHA 2C1HA 3H4XA 4F2TA 5DO8A 1W1IE 1VCFA 3LCWA 1FFQA 5HMEA 4JFWA 1FOBA 3U7BA 1OFAA 2DZWA 4GJIA 3DBPA 2YCIX 5F2MA 1CB7B 3DFOA 3K8KA 2XZ7A 1R85A 2OT1A 3NQBA 5H1WA 3NQGA 2PD9A 2A79A 1EO7A 1HKVA 1NH6A 3GBDA 4X2RA 1JPHA 3LERA 3CNYA 1W1A1 3CL6A 2C1GA 2J8FA 4O4WA 2CZDA 5D8WA 4N4QA 1HKIA 4LV9A 1Q6GA 3C8FA 4A29A 1XLIA 3UPWA 1RQBA 4F2UA 4EK7A 3T05A 4B3LA 1CYGA 4Q6XA 4CD5A 3A3XA 1PX4A 4QJ5B 3F4VA 5C2GA 2HVOA 5KEZA 1DWIM 2NW0A 2YOCA 4QG9A 2X2GA 1TFVA 3BJSA 2XIQA 2J25A 4DYEA 2X1UA 2JE8A 4HCDA 1AJ2A 4UNIA 4US5A 4RE3A 4FX8A 1EHNA 1A3WA 3VIIA 4GUHA 2HVNA 5GNYA 5GNZA 3N9RA 3DDMA 4Q8VA 4MB3A 2PDXA 4AFYA 4Q8MA 1GHRA 2DIEA 4JHOA 3UETA 2PFHA 4HCLA 1H1YA 3P0XA 3A3WA 2PC8A 3NAVA 3EWZA 4Z1YA 1QI0A 1PZ1A 1JF5A 2FB3A 1R9ZA 3PWGA 3GU2A 3WG6A 4YMZA 1TWIA 3T44A 1PCKA 2DZAA 4FIRA 3MY9A 4GVGA 4DJFC 5T26A 4XAGA 1M6JA 4QG6A 4PCSA 2BZNA 3PWAA 1BGAA 1WZKA 1BVWA 4LVDA 3O0FA 3STGA 3LV5A 4HB7A 4LEQA 4EAMA 1XLFA 2Y5JA 3R8HA 1NDWA 4AVNA 3VO0A 4H01A 3IIPA 1Y8BA 3SGUA 2FTYA 1MQRA 3GW0A 4TOQA 2YDSA 2HROA 4DM1A 4ZO7A 1A49A 3S2JA 3E02A 4M51A 3CASA 1SPQA 1BHGA 4L6HA 1GPWA 3AYRA 3NPUA 2HV5A 3CWOX 2VI0A 1QPNA 5HQLA 2PCQA 2V2DA 5EMKA 3GDTA 1B3ZA 1W2PA 1UWSA 4AXNA 1EGZA 2WYSA 5EL1A 1XDLA 4LUJA 3OVRA 5HMDA 1UPPA 4RL3A 1WBHA 4HT3A 4O28A 3S8HA 4OJYA 4PUWA 4KRUA 3HGJA 4BK9A 2QMKA 3R79A 1B30A 4O50A 1ITUA 1RJQA 4BA0A 4F40A 1JXKA 4DJFA 3VABA 4UTIA 3O7UA 2ZUSA 4F66A 1GEHA 4UIOA 1XD0A 3I3BA 1S5WA 1OB0A 3GX9A 3WLKX 1L6YA 2FHCA 4A8RA 4D72A 3FSUA 1S2WA 1V3MA 1NFBA 3DKJA 5HPOA 1BWVA 3W1MA 1Z89A 2QCHA 3AOFA 4BI7A 3PR2A 1EYEA 1Q7QA 4XB3A 4JNMA 5CPSA 4IIBA 1DQXA 1E4MM 3GHRA 4IJRA 3B9AA 4OBTA 1GK8A 1YTEA 5BRPA 4B5WA 4MG4A 1V6YA 2Q71A 2GQAA 3GKFA 3MVTA 1JUEA 4GQBA 1Z69A 1E1EA 4LGXA 3KRZA 4CEXC 1ICQA 3M07A 4PUJA 3OP2A 2DQWA 4AX6A 1RCXB 3FJ4A 4XK2A 4CNUA 2Z1SA 2G4FA 3ZWSA 4GY1A 3GAYA 1U33A 4QBXA 4TO8A 5TQLA 2C13A 3NSMA 2C8NA 4LNCA 4S3DA 2XN0A 4XAFA 3VOIA 2ZZ6A 2EJ1A 2QMJA 2NSOA 3OTRA 5DLCA 1NY1A 2ZX8A 3QV8A 2Y62A 4GY0A 2QCDB 1QOPA 2H8XA 4MZYA 1QASA 1RHCA 4Q8OA 3IARA 4X2PA 2B7OA 3RX2A 1LWJA 5H8UA 3UF9A 3W00A 1E43A 4EOUA 1KKOA 2G3IA 3CLWA 3BSHA 1GZ1A 4U3AA 3RMEA 1TA3A 3B03A 3GXPA 3BLKA 3NO3A 4UOZA 4YWSA 2W92A 3IRDA 4XISA 3IV3A 4FX6M 4L1WA 3WQFA 1VLWA 3H2OA 1Q8JA 3LYEA 4GY7A 3SIMA 3K2GA 2MNRA 3ABOA 3W85A 3QMTA 1SJAA 3A5FA 1XH0A 3LG3A 4GYFA 3NNTA 2R9RA 1ZPTA 4A05A 3M1ZA 1GPFA 2CKSA 1OFOA 2DZUA 2XISA 2CLIA 3ZQ9A 1KXVA 3GLCA 3NZPA 5EB8A 3NEVA 4LANA 3EDJA 2FKPA 1K6AA 5DY2A 4TX8A 5BZAA 2Z4GA 3ITLA 1XRSA 4EXQA 2CYGA 2D3NA 3FJ6A 2H3BA 4XKMA 1Q85A 2QR6A 1V6UA 3UWWA 4W7UA 3QC0A 5A8GA 1A5MC 3NJ3A 2PDLA 2WMGA 3CUIA 1TTJA 4HJFA 2CNCA 3DFYA 4GX9A 4GPNA 1VP5A 1CXIA 7ODCA 1M7PA 2Z6JA 3IS4A 3WD2A 4JDBA 1RD6A 4ZVJA 2XGIA 2W63A 3EOEA 3TTEA 4PTDA 5CJ5A 1AQFA 4NT0A 3TLLA 5H6HA 1DBTA 4IPPA 4NSBA 1R0MA 1YKWA 4GINA 3PUDA 4JIPA 2ZTKA 2Y89A 3KP1A 3OODA 1AJZA 4NAFA 3SCSA 1GJUA 2A7NA 1B3OA 1O68A 4UBPC 1V93A 2BSLA 1Q6DA 2C3ZA 3CGTA 3M9YA 3NOEA 3HJEA 3VOJA 2AGKA 2W5FA 3WMCA 1M01A 3KLLA 3WQ4A 3E5BA 3CYJA 4P5UA 3SB0A 2CZFA 3OOQA 3C2RA 4C6JA 1GGOA 2VFEA 4YVPA 2F6UA 2EPHA 1ME8A 4S23A 1WXZA 3M7SA 4FOJA 4OTKA 4YYCA 3W28A 4MKNA 4YXGA 1K9EA 3GXIA 1DPMA 4L80A 2WPGA 1LL7A 1SGJA 1MXDA 5HUOA 2H6RA 2YDAA 3TC6A 1S2TA 3TUUA 1MUWA 4C90A 2Y6ZA 1JZ4A 3MVIA 1KLZA 3M46A 2BWGA 4HSNA 1G69A 4BR1A 3POCA 4M80A 3C86A 4HNCA 2ACUA 5EFFA 3SY5A 5D9OA 1FTXA 1DV7A 1AD1A 1P7TA 1CXLA 3TJ4A 3S1UA 1B3WA 1XYFA 1U2YA 3CAQA 1MW3A 1NWSA 3HN3A 3VU2A 5I3FA 1KW1A 5KZDA 1SO6A 2X41A 3CWNA 3BSGA 3FAWA 3S4TA 4C6QA 1VEOA 2FZ8A 3E74A 2PDMA 2NLYA 1RK6A 2ICSA 2P88A 1ISYA 3W7IA 2AAAA 4IQLA 4DNHA 1UR4A 1KFWA 4N9EA 1DQUA 3UWQA 2OO0A 1OIMA 4BF7A 1MI3A 1AH4A 2EPLX 4W86A 3BDKA 1KQYA 2NLIA 4JR5A 1M68A 2ZRUA 4HNVA 2WNZA 3STEA 3RCMA 1Q65A 3WH9A 1WPCA 2PE4A 2OZ3A 1FWWA 3L65A 1K8ZA 3LOTA 2WBKA 4J9JA 4MWAB 1OFQA 1XIHA 3LZ5A 1U1UA 2Y8KA 3H12A 4QJ3B 3PTDA 4C6IA 2DZBA 2NV1A 1XGEA 3AYSA 2Q01A 3II1A 4G56A 4Y9NA 5TIMA 2BASA 1TZ7A 1TELA 2WPBA 4RE0A 3OZMA 1FWHC 1W9VA 3A23A 1RY0A 3I4EA 1BYAA 3AMLA 3N18A 4DO6A 3HG4A 3FS2A 2YA0A 3QZAA 4L6DA 3AWOA 2I9EA 4IM4A 4AIOA 2DSWA 2GZXA 3W26A 1KBBA 2ALDA 3R2GA 1XHGA 3WLQA 2WJEA 3BJFA 4F48A 1CENA 4PL1A 1WUEA 3F2CA 4ORMA 3ANYA 4QISA 4AY7A 1WOAA 3PNUA 2CEQA 1UASA 1VJSA 1DXIA 3E96A 1E56A 2TMDA 1MUMA 1ZNNA 1MEIA 3GO2A 5A2BA 4LW7A 4Q3MA 4GVFA 4IGNA 1E3XA 3RITA 4G9PA 5HWNA 1RQHA 4PC8A 3EX4A 2OSWA 1VPYA 2FIQA 1JPDX 4M29A 1T0OA 3AWNA 1W5OA 4ZE4A 4NJKA 5JH1A 3UP8A 2G37A 2G5WA 4XZMX 5CPQA 3TN3A 1PEZA 1G5AA 1NDYA 4U4MA 3WELA 4C6EA 2EQDA 2QCFA 3MWCA 3B8UA 3B97A 1JNEA 2OWWA 3L4ZA 1DWAM 1EP2A 1B3XA 2IKIA 2AOSA 7CGTA 4W4QA 2HE5A 1T41A 1H4PA 1L0PA 3PWIA 2FLIA 1W2VA 1UR0A 3A9BA 2DPEA 3UJEA 1BTCA 3UA4A 1IEIA 5I07A 1WAWA 1BSLA 3LHYA 2VZOA 4NNBA 4NILA 3MI2A 3K4AA 3GWQA 2JIEA 2OYLA 4IMCA 1POJA 5G1TA 3XIMA 1XS2A 3DH7A 2Q8LA 2XDFA 3WEOA 4AWUA 2DH2A 3I4KA 3TDFA 5DXXA 2NX9A 4EPDC 4HHLA 1TB3A 2WWCA 4HSHA 1UJQA 1TPDA 2CLOA 3HFTA 1A0CA 1HJSA 3URAA 3URQA 3CWHA 4YTTA 4G6CA 4XV0A 3DIPA 2ACSA 2I17A 4PRTA 4C6DA 3QPEA 5E93A 3BZGA 1KFJA 1OFPA 4C91A 2GDQA 1RVKA 1JQVA 4QLJA 3RK8A 1MRQA 3OBKA 4GI8A 1A53A 1AZ2A 1OFDA 4Z2KA 4ERGA 1EDQA 1QT1A 2WBGA 4ICCX 4LJ3A 4WXYA 2J9ZA 2WMIB 4U2YA 1TRIA 4B5SA 3VZZA 5DT5A 1GQNA 3VIOA 3N17A 1UROA 1SU5A 1OGSA 2GPTA 1Q45A 3BTNA 3GVWA 3SM0A 3BCDA 1P1MA 3MP3A 4QM1A 4H9XA 4YL2A 3VIPA 4ZOAA 3UFYA 3LI0A 2PBOA 1U22A 4HGXA 3CT7A 3BOXA 4KBXA 4ZB2A 3W76A 1R3RA 3GXDA 1SVDA 1K8CA 3SO7A 4M19A 2FYMA 4US5D 1NP0A 3EOLA 4AY8A 1V3HA 3WFZA 1IEXA 4FPSA 1SM9A 3T55A 4MSSA 6ALDA 1TJ1A 4RUBA 3H24A 5M1TA 2OOFA 4CVWA 1KRAC 1L8NA 1TX0A 2BFGA 3QR3A 1O60A 4PTXA 2RFGA 4DB7A 4O8RA 4PMOA 3KVKA 1EKOA 3WNPA 1ZL1A 3A5VA 4O8AA 5LNVA 1KFKA 1TMQA 3THAA 2WOQA 4BS0A 4GZEA 1QI5A 1ISVA 1B1YA 2HJPA 4X60A 2XIOA 3BV4A 4E3TA 3LXBA 4MMWA 5XIMA 1UOKA 3BZJA 5CAKA 4JNYA 2YL9A 3NTYA 2DSVA 3RRAA 2WZTA 1H1ZA 1XW8A 3BW3A 1TSIA 3N4EA 1U5HA 1H7WA 4UTWA 1A5BA 1ADDA 3QGVA 4D8ZA 4MF4A 4MUZA 4JTHA 3KTSA 1BYBA 1BRLA 1BVNP 5DRIA 3FKKA 2RJGA 2P76A 1C3FA 4QNWA 4XO7A 2DW6A 5AHIA 2VHLA 2QJGA 4K7VA 1O5QA 5ECUA 2W9MA 3U5UA 1WXYA 3HGRA 3NR0A 1WA3A 3C3UA 4L4MA 3P62A 3L0GA 4H8HA 2FMNA 2Z0IA 3DCPA 4RNHA 4AISA 4AG0A 3BANA 1GTHA 4MWAC 1P0EA 3WDRA 1OVDA 5AHMA 1FKWA 4R34A 4H19A 2FDSA 5G2HA 4I5XA 2ABAA 2R8WA 1MXSA 3PJXA 4HA4A 1OY0A 4UXDA 1WKEA 4OV9A 1O4UA 4ZO8A 2XSXA 3TP4A 1HJVA 3MV11 4D1JA 4WIWA 5I09A 4R3UA 4S3GA 4ZFMA 2Z29A 1PS9A 4EACA 3WLIA 3L4YA 2WVTA 2X1SA 1V0KA 3W01A 1RR2A 3IVSA 2BODX 1OT2A 3P61A 2VTFA 1AMKA 4BHYA 3BAWA 2CBVA 4H2CA 2WHKA 4YTSA 1FWCC 3C2YA 2Y0FA 1IEWA 4TUFA 4RDZA 2FFCA 3R12A 3T2PA 3QVQA 4O19A 3H2AA 3UYCA 2A3HA 3IGXA 3W6MA 4A6GA 4LCRA 3QSRA 1JDFA 1T99A 4BJHA 1UH3A 2ZX6A 1U1JA 2MANA 2CHNA 3F5LA 3G0XA 1H51A 1QUMA 5CZTA 4E4PA 4UFMA 3W2MA 5E6YA 5A69A 4ATDA 3NO5A 3WJSA 1BQGA 4CCDA 2OZ0A 4QTGA 2QLYA 1YADA 3RNDA 2F8QA 1BG9A 3NM3A 3ZYZA 4GACA 3R13A 2PP0A 3EWDA 4N6FA 1KO0A 1QRQA 3V4BA 4NVTA 1W54A 4MOZA 1UUQA 4JFVA 1TWWA 1G7VA 3QR0A 2E8YA 4XO6A 1G7UA 4MHBA 1VIZA 5HNNA 3RR1A 4PTNA 9XIAA 3O63A 2QULA 2OPJA 3XISA 1FWFC 1R8LA 3EBVA 1W3KA 2D22A 1QI3A 3PUEA 3THCA 1S5TA 1UD5A 2BGNE 3K1DA 2WXDM 4QJ1A 1VRDA 3UQNA 4V28A 5BWAA 3LCXA 5CBIA 2GJRA 3PAOA 3UXDA 1TKKA 1ZENA 1XI3A 1AL8A 4GYPA 4AHPA 3MUCA 1JCJA 2IXUA 4HMEA 1VHCA 1TVLA 2ZZ3A 4FF5A 4I8YA 5AC6A 1NF0A 5LHFA 2A1YA 1G4EA 3NA8A 4FLOA 3VMNA 5DMLA 4ZB5A 3C4UA 5HOSA 1FBAA 2VMFA 1X97A 3A21A 1RCOB 1JPKA 1W31A 1POKA 4ZTXA 1N8FA 4NP7A 4N6EA 1XSIA 2JKPA 1FWEC 2EGZA 1O94A 4GH3A 4PZVA 4E8DA 4MNKA 1PXGA 2VRQA 3KM8A 1PDYA 3T0AA 1VEMA 1PYMA 4WKFA 4IICA 5F1VA 3R8GA 1KA9F 4AF0B 1BAGA 3E1F1 1UUMA 3M0YA 4QDPA 3OA3A 1F74A 2Z7KA 2PTWA 3USBA 3MI6A 4Q4SA 4B5VA 3FDGA 3C2OA 3HQPA 3CPUA 2C16A 2OCZA 3BE7A 3MUAA 2IQTA 5AY7A 3TN5A 1B57A 1J0KA 3AMGA 2V30A 4XAPA 1C91A 1DP0A 1A4LA 4F0LA 2EBNA 3W84A 1EJRC 4IQDA 1NTHA 4N42A 4TV6A 3GXFA 2X8RA 1CLVA 2EG6A 2ZXAA 1WV2A 4RPQA 2YR1A 3ES7A 4B9ZA 1JNDA 1M7XA 3L4UA 2BY0A 2CXEA 1W3TA 1VYSX 1GQJA 1S3HA 3V0TA 1UP3A 1G0CA 2BHYA 3AMDA 4GC4A 4XD3A 3IJDA 4DLFA 1DWJM 3TCEA 1FCBA 1XH1A 5DT7A 2VOTA 3CV7A 5EGRA 2BMBA 5LNRA 3KTCA 5AECA 3A47A 2Z28A 5H8PA 3BWWA 2E09A 2DV0A 3MCNA 5A6LA 1JZ3A 1RCQA 1JZ5A 4QJ4B 2B0MA 4PUUA 1DYSA 1JDAA 1PBGA 3R89A 3F4DA 1PKLA 1W9UA 2RJHA 3LM3A 2E5CA 1PDZA 2G96A 1L6SA 2A21A 2WHLA 1GNXA 3W1RA 1JCTA 3FA3A 3WH7A 1SFTA 1SO5A 4MLRA 2ZRVA 3TTOA 2WSQA 3GUGA 3AUOA 3WNMA 1CXEA 5IFTA 4M82A 5CLTA 1VRXA 2G50A 3IUIA 3U48A 1VPQA 1HKKA 3NG3A 1V02A 3CUFA 1ZP4A 1UQYA 3RX3A 1AJ0A 3AC0A 4WUIA 1S39A 2EKCA 1A5NC 2WLYA 1OEPA 3IIZA 2OZTA 4KEVA 3IEBA 1R3QA 3O6CA 4PGLA 5BMWA 1GVIA 3EX3A 2R6OA 5J8LA 3QMSA 3R5EA 4W88A 4OT7A 5M17A 4BF9A 4HYRA 4YPJA 2GQ3A 2BBFA 2QUUA 4MPKA 4WOQA 1HX0A 4IWWA 5J04A 1FH7A 4P8XA 3HPXA 3TAKA 3TYEA 3I7RA 3TYUA 2UY2A 3CIXA 2VX4A 1ECEA 4Q22A 2I1OA 4RXFA 1TQJA 3B0YA 1YXYA 3N73A 1LORA 1P0DA 3NDYA 2BLEA 2E1DA 3BOFA 1K4HA 4YYFA 3PM6A 3WH6A 1A5LC 3DGBA 3UXIA 1GG1A 1OGGA 2E5BA 5HJLA 3AXHA 3LPPA 4PH6A 1XIFA 3LRMA 4D6CA 3ARWA 1KM0A 1Z48A 1G01A 4RNFA 5I3JA 1F6KA 4AZIA 1E9IA 4IPLA 4JCLA 2CZ5A 1JGMA 4FXSA 1CGWA 1JZ8A 1RLCL 2VGGA 2G8ZA 4HPHA 2C1IA 3KVMA 2A7RA 3AYVA 4FNRA 1SMDA 1ZY9A 4DXXA 2HQAA 1QMLA 3WF1A 3BW2A 2NQZA 1R2SA 2G3JA 4H9MA 1NWRA 3ABRA 4Q8QA 3IACA 2VFIA 2G0WA 1FUYA 3AXMA 4R88A 3APYA 3OB8A 1XP3A 4JPGA 1RPKA 3GH4A 3FV9A 2O9PA 3XINA 5IXEA 4FXFA 4KWSA 3VNZA 2YX0A 3BXWA 3B04A 4B16A 2VVSA 4JQ2A 1GVEA 3NXFA 1RAKA 1HVQA 4S3KA 5D02A 3A64A 3KCJA 2CHOA 3NURA 4PMUA 3WBYA 2GGHA 4Y6GA 4Q8NA 4LB4A 4B4FA 3QHNA 1LBLA 5E1QA 4QQ3A 2RDUA 2NQHA 2OYKA 2W79A 4IPNB 3TJIA 3VD5A 4DUOA 1XH2A 1GVYA 2NSXA 3QW4B 1KD0A 1JRBA 9XIMA 3N9SA 3EOOA 2FZDA 5HNUA 2ISDA 2C7FA 4MYAA 2ZXDA 4HNNA 4ZOBA 1H5YA 4JN8A 3M6YA 1A5KC 4AZ5A 3MT1A 4GX8A 3ITCA 4AMAA 1XSJA 3GC4A 2ZBTA 1EWDA 1HW6A 1NP2A 2BOFX 1CGYA 1IF2A 3GTIA 3T40A 1MEHA 2E68A 3QM3A 2PZNA 1XGZA 2PGFA 1IIHA 3LQLA 3VOHA 3W1QA 1E4IA 3IANA 3MUIA 5CZJA 1EEPA 5C2XA 4RE2A 3DC8A 1KB3A 2CFFA 1R9YA 2GK1B 4PMDA 4C6CA 2I14A 4RE4A 4WEVX 1LQAA 3HV9A 3KL0A 1QVBA 3IPWA 1OK4A 3OLEA 1O66A 2GFTA 4DZ5A 2AMGA 5BWFA 2XVKA 2CBIA 3GVRA 3VDCA 1XYAA 1EJSC 3C52A 2EPMX 4UFHA 3DYMA 1LLZA 4Q4PA 2EJAA 2FTPA 2PDHA 1CCWB 4IIHA 5F2GA 3NPWA 1PO9A 3QC3A 1JFHA 3UZJA 1BEUA 4HJWA 1FHDA 4RZBA 5JH2A 4A4AA 3LB0A 2CLMA 1JI1A 1RZMA 1ME9A 1HO4A 1PTGA 4CNNA 3KTXA 3WQDA 5FKYA 5ABTA 2ZZ4A 3HGSA 1SZEA 4A8NA 3QV9A 4S1FA 4ZXOA 2Q8XA 4H8VA 1ZUAX 3DESA 1H09A 5I78A 3ELFA 1XSKA 3R0UA 1WNOA 1VJZA 4HN8A 3N25A 1PX8A 4OIFA 1CPUA 4PTVA 3EYPA 2JIWA 2WNNA 4LBRA 1T6MA 3VZXA 2D2GA 1C8XA 2CBUA 1GW1A 3GC2A 2F6XA 1K8YA 1IR1A 4GUJA 2B81A 3LU2A 1EJXC 1F3WA 1AMYA 1VBUA 3EDEA 4GBUA 1QNPA 4EE9A 4DJEC 3JR2A 3VGEA 2NV9A 4DN1A 3LGGA 1GOMA 1ZJIA 1KGUA 3DERA 3D6NA 3TQVA 2WKJA 2GLKA 1Y5VA 2XM1A 1XLEA 3CS2A 3W1UA 1XL9A 1YMYA 2ZZ7A 4HHPA 2XPKA 5KITA 3SSZA 5FA5A 1WDWA 1V7YA 4PCNA 1LLOA 2W27A 4PMJA 1OM0A 1V6XA 2EXOA 3UG3A 2RH9A 4W8BA 3BPWA 1EF2A 4UTFA 2GQ8A 4BEUA 2QKFA 1GYLA 5DELA 3FHQA 6PTDA 3GAKA 4JXCA 4I5UA 2ATSA 1VKFA 4HVXA 3B9OA 2J88A 4Z2HA 4MY1A 4IJBA 1LLWA 1B0IA 1YDOA 1TZ9A 3CJPA 4IMDA 1RVGA 7REQB 1VFSA 1VFHA 1QI4A 1B4EA 2E5DA 4H6KA 5DQPA 1LBMA 4JIRA 5IHRA 4WKHA 4LRTA 4AZGA 5A1AA 4ZA0A 3IIOA 4NL1A 2YBVA 3MHUA 4E8GA 2C79A 4REQB 2V5CA 3PAJA 3EA1A 1ADOA 1JF6A 2YFNA 1E1CA 1GVSA 4J2PA 3LI1A 3W7MA 5CQ1A 2ZXBA 4LAKA 4CD8A 5HNTA 2DUAA 2NXIA 1WO2A 2PWGA 4PMVA 2VXNA 4R7JA 2GSEA 2X1IA 3VDAA 3QJAA 3APGA 4LVFA 3U2CA 1JI2A 1XLKA 2OG9A 3N13A 3HQ1A 2HTMA 2TRSA 2C14A 3P5YA 4OOZA 4D2JA 3V35A 3NQAA 2OMAA 3W6YA 1F4AA 2GOUA 1SFSA 1FWDC 2V63A 1ODZA 1R5YA 2GGIA 3EWUA 3R8RA 3B8WA 4H6EA 2PP1A 3E0WA 4I9JA 3LNMA 2HXUA 5EA9A 3TC7A 3G8EA 2J66A 1TJ2A 1EC7A 3NM1A 3AALA 2RAGA 2ZRZA 3E38A 2YPIA 4J27A 3M0ZA 1JAEA 3VD7A 5F7UA 2PWEA 2Y7GA 4IPIA 2VCBA 4MADA 1UG6A 1L6GA 4WQ6A 1XC6A 1HXJA 2DZXA 1MO0A 3KRSA 3TW6A 5D09A 4IJCA 1QHZA 4UR9A 2I5IA 4QR6A 3GTFA 2YBUA 3PJTA 2XINA 3QTPA 3HM7A 3W2UA 2OR2A 3WQVA 2DDXA 2Z2BA 1LBFA 1Q7ZA 3TTYA 4KF1A 3OHMB 2ISFA 3WLPA 4FA3A 3W1AA 1IYXA 1KR1A 3WD1A 1WDDA 4JTLA 3LHZA 3VD3A 2NXHA 2OZ8A 4MY8A 2J7GA 1BYDA 3PY2A 1DWFM 5F4WA 4B5UA 1KV5A 5A6BD 2X05A 5HR7A 5BU6A 4RW5A 3QSTA 3TMQA 2J6VA 1J8VA 1YDNA 2VC6A 1PX3A 3TCSA 4WCJA 1TWZA 1R2TA 2FDMA 4MAVA 3RO8A 2ISVA 3ITYA 4PUKA 3B8TA 1EP1A 3WD0A 3W7CA 3VX0A 2H9AB 2YCJA 3UWVA 5GNXA 4JTFA 4AYSA 4RPPA 3ISIX 3LLDA 1SW0A 3PBYA 2RDWA 1C9WA 1FH9A 2AGTA 5CKSA 1VH7A 5A6KA 3EPOA 3FX4A 1KCXA 3P8IA 3DENA 3T08A 4GIRA 3RXZA 2J8TA 4Y96A 5D2YA 5CGMA 2PLCA 4O14A 3MMTA 3EKZA 4D9PA 3PS7A 1EL3A 4GXPA 1EYWA 1C9DA 3RCNA 3KOZA 5DXYA 3G8RA 3P5ZA 1V7AA 1G6CA 1C93A 3W7GA 1EDTA 3NDZA 4LX4A 3FA4A 3UG5A 4ZQPA 4MZ8A 2CLFA 2RGLA 4NYYA 3TW9A 2XFYA 1PHWA 1EPVA 4H2HA 2AKZA 4G7EB 3C0LA 4O1DA 3WK2A 1BXBA 1SJDA 4HSOA 3OYXA 2ZUVA 4AWTA 2Z1KA 1W1B1 3TZFA 3ZSSA 2QNEA 4OUEA 3FXGA 4JKMA 3I3DA 2HS6A 3HV8A 3VPLA 2EHHA 4WSKA 2IMRA 2WMIA 3T81A 1PKMA 1DJNA 2ZVIA 2Q3RA 4Q4KA 4PSRA 4GC3A 3D46A 4MYXA 3QEZA 4HPXA 1O5XA 1DWGM 1A5CA 2YB1A 3N2OA 4IG2B 1IGSA 2D73A 5EMUA 1AA1B 1HO1A 1E1FA 5JMUA 3TVAA 3QZEA 2V9DA 3WNNA 2FZ9A 4UFLA 3EXRA 2BGSA 1AFSA 2J6XA 1J0ZA 4L7ZA 3MSGA 1TQXA 1CXKA 2DT2A 3RLHA 1V5XA 3UR2A 1IT8A 4AZCB 1G4PA 3MSYA 4ZE5A 4O11A 1HL8A 4E4FA 1XWYA 4PEEA 3UJSA 4GCAA 3VDHA 4UNKA 3I10A 4PUDA 5HNRA 3A3HA 3FGCA 2WC4A 1DE6A 2FVKA 4QX4A 2WM0A 4H9VA 2Q8ZA 4JHMA 5IBXA 3DUGA 2DGAA 1HUVA 3MANA 2NQLA 3CEUA 2A3CA 2VCCA 4DI9A 4NZ1A 3M41A 1BYCA 3K8MA 3DHFA 5GJPA 4YJ5A 3KDNA 1DEDA 3G1AA 4TIMA 2WMKA 3BOLA 5E9AA 2DFAA 3WQ6A 3LUTA 4KWWA 1ZBKA 4C7FA 5AVNA 1JYVA 1YXCA 5D2TA 1PCWA 3M6DA 3HA1A 3NZQA 1UKTA 3WN6A 5AHNA 1TE1A 2PWUA 1ME7A 5D9MA 2PMQA 1HNYA 1J5TA 1JJKA 1WUFA 2TAAA 3QPYA 1TREA 1EHAA 1UMLA 3ZT6A 2Y7EA 5CLWA 3DOPA 4GISA 5K4ZA 3F4NA 5DF0A 3P2VA 3W22A 3TN4A 1EQCA 3KBNA 4KW2A 2JFEX 3WQ8A 3W1NA 3P80A 4O0KA 5CPMA 4GKTA 3TTQA 3W1PA 5D2XA 3M7WA 4M6UA 4A3QA 3MKCA 2ON3A 2ZA3A 3GR4A 3HBLA 2R1NA 2PB1A 1LP6A 5HR6A 1YRRA 5CEWA 1W5NA 1FXPA 1N55A 5TNVA 1KC7A 3QOMA 4NUWA 1BFNA 4AIUA 2YZRA 1EX5A 1CDGA 1ADSA 3CQIA 3SCNA 3KWSA 5EU9A 3PBUA 2PU0A 3FDKA 1A47A 1Z8AA 2ONEA 3AROA 1LRQA 1B9BA 3NQ7A 3AIBA 1EFZA 1LYXA 3IVUA 4C1NB 5C71A 4NYUA 3B0VC 1ZBVA 2X0YA 3V5FA 3W7EA 4N9CA 4PB3A 7TAAA 4YCOA 4JZ5A 3N1AA 1UPMB 4N2YA 1TV2A 2DY3A 3USZA 4JIIX 4TX9A 3MKKA 2IQ0A 3T0DA 1OHLA 5MF5A 7ENLA 4P7QA 2ZXQA 5JU6A 3MTWA 3O6AA 3PN8A 2POZA 2L5HA 3G77A 4QRNA 3S47A 1S38A 3CL8A 5A2AA 5AYIA 4H8NA 3FVDA 3RCYA 3SCUA 4A8IA 4H9TA 2W66A 1VIWA 3V0SA 3V5OA 3VK5A 4CU6A 1NQKA 1GORA 2P53A 4HIBA 4NAEB 3W29A 3WQOA 3G0SA 3URNA 3ICJA 3QN3A 1QAPA 2PAJA 1XLHA 5G2IA 1JZ2A 4ACZA 3K13A 1FRBA 1UP0A 1D3GA 2UY5A 4AIBA 1OF8A 2INEA 3NVTA 1J2BA 9RUBA 1F6PA 3CUZA 2FFIA 3E6EA 2ZYFA 3WJXA 5LNUA 5FEXA 3CUGA 4UOJA 1ECQA 4DNMA 3V1PA 3AIQA 1AD4A 2YGYA 2Q09A 3U2EA 4YVXA 5M3WA 5HMFA 3MUZ1 5U4NA 1LUCB 1QNQA 3GXMA 3OIHA 5C8BB 4UQAA 3R0DA 2DT1A 4J4KA 3BVJA 4DO5A 2V82A 1UWIA 1E1CB 4HU4A 3K8LA 5CG0A 4DWDA 4X61A 1XJBA 3GM8A 3RAOA 1TPH1 4NU7A 1WE5A 2QYGA 1NSJA 4A3HA 2E6DA 4M0XA 4KMQA 2D0FA 2VWSA 1JUBA 3N11A 2ZX7A 3AJ7A 3UD6A 3SIZA 3BMVA 4CNSA 4ZQCA 1QBAA 2NZLA 5EYWA 3LGEA 3QHMA 1EUAA 3WUBA 1MRAA 1Q6FA 4UTJA 1K6WA 3AJXA 2VYOA 4BFAA 1CIUA 4GXMA 3ARRA 3LPFA 2J9YA 1UR2A 4CU7A 2PP3A 1KM6A 4CQBA 2VUNA 2FQIA 1HKJA 2PC4A 2Y7FA 3UZ5A 3T4WA 3NO1A 3RR4A 3CMGA 3SCTA 1KXHA 5EY5A 4UFKA 1UWTA 2WSRA 3KUMA 3PNZA 3D0CA 4QQUA 1CGTA 4PTMA 4G7EA 3AFBA 5ABFB 7A3HA 3CHFA 4WJXA 5KZEA 2BY3A 2WNQA 5C9XA 4G5DA 4LPCA 1J9YA 1Z7AA 1ONRA 1F4HA 1EEXA 2YIHA 1K9TA 2ZKMX 1XYCA 2ZRYA 2GJNA 3PB2A 4NZJA 2J7HA 5FL0A 3ORWA 3FYYA 2D24A 4AB4A 4D1IA 3KBJA 1P0BA 3UGVA 3TAOA 1ODUA 4K8EA 3QQWA 1EO5A 3B8SA 1O6IA 2Z2UA 4J40A 3SQSA 1H7XA 4A3RA 3NQ6A 4NNAA 3UR7A 3CXOA 3OW1A 1CLKA 4IX0A 2X1TA 2QW5A 3V1HA 3N3MA 4BWLA 4G8TA 4AMCA 3VAVA 3W1TA 3W24A 5EMLA 3VIKA 1SUXA 3PJWA 4JYFA 5H8MA 1SJBA 2DIKA 1TIWA 1Q6RA 1GZGA 4J3VA 1Q3NA 2PDIA 3TFCA 1ITQA 3EB2A 2XVLA 2FGLA 5EBUA 1BKHA 1R2RA 3TROA 4KWUA 3W2NA 4DQWA 3OA5A 1XRVA 3N19B 4XBKA 3AS2A 3CHDA 3GQYA 3HPSA 1HZYA 4B5NA 1E0VA 4MDPA 2PDNA 1F9CA 3SCQA 3CB8A 1QW8A 3WLTA 2D23A 4PCPA 1W1VA 1A0EA 1PV8A 3TX9A 4Z17A 3NCOA 4P8WA 1R3SA 2AKMA 2V5KA 5HQEA 4CNTA 4JTAA 2GOKA 4X9SA 2FVLA 2FMOA 5LIUX 4AZ7A 4UQDA 2O9OA 4QSFA 3AZTA 5LA0A 3OLIA 1SZGA 4GGHA 1SSDA 2OQHA 1JR1A 3NL2A 3UG8A 2MUCA 1AW5A 3G3MA 4FNQA 3CO4A 3OPSA 1UKSA 3BH4A 1OGBA 3WY1A 4ATWA 4ERAA 1QHPA 2NWRA 4MGGA 4X3ZA 1W56A 3M47A 3EB4A 2VWTA 4Z1BA 3S1VA 1P6CA 1H11A 4RXGA 3WD4A 5ECVA 1OX6A 3LHWA 2DSZA 4UWMA 2P1FA 3W1LA 4TTGA 1RP8A 3AIEA 2QDDA 1W91A 1CXHA 4CNPA 4LVBA 4XVEA 3SZ8A 4KCVA 4L9ZA 3QTGA 4NQ1A 4EXBA 1KCLA 3HOJA 4FS9A 3KRBA 1BPLB 4K8HA 5C9RA 3F4CA 5DMMA 1P48A 1UZHA 3ONCA 4IUGA 4XAYA 4HPNA 3WLJA 2GVGA 3EDKA 3B05A 1XIMA 3RLUA 2BV9A 3FIGA 3GR8A 3TSBA 3S1GA 1WZLA 4MNLA 4G7FA 4LXFA 4GNVA 1GKPA 2GUBA 2Z25A 1W0MA 4O17A 4JTQA 3UR8A 3GU1A 5D30A 4JY9A 4UZSA 3RLVA 1PAMA 3MBFA 4FR6A 4DWSB 1J79A 3EWXA 4AD3A 4K6AA 2GSJA 4K36A 2Q3OA 4CU8A 2WZEA 1MQPA 4CKQA 1UMYA 4UTHA 2VENA 1I9CB 5ABEA 4C1KA 3AISA 3M0VA 3FNDA 1I2QA 3NZRA 2DVTA 1KV8A 2YL8A 4WDWA 1GG0A 1TPFA 2R1MA 1GTEA 4ML4A 3UNDA 2HE8A 1PPIA 2BOEX 2PDYA 3RHGA 3MU7A 1D7KA 3WUFA 4DBDA 4L4LA 2ZA1A 1A0DA 1DE5A 1WDRA 4XZLX 8A3HA 1T96A 1YQ2A 4ORIA 4H7VA 5HQMA 1Y0EA 5E70A 1UWQA 2NT0A 1N7KA 3W83A 3OG3A 5AYZA 1V0LA 3GFYA 4DYJA 3OHIA 1GOKA 3MDUA 1YTKA 5IDZA 4XUYA 3WMLA 4QDMA 4LBUA 1S5VA 2VGBA 3BMWA 2GDUA 3S2NA 3RJYA 5GVJA 2BVDA 2HRWA 2OKOA 5M2FX 3SCRA 3UY8A 1PKNA 2IQDA 3W07A 1A50A 2CWXA 2ZZ1A 4H9ZA 5AFDA 4NI3A 3Q94A 2WJDA 2CHRA 3OEXA 4RZ4A 1R3YA 3EA2A 3WQCA 3TOPA 2NQ9A 3FCPA 3GB6A 4MIMA 2PDUA 4ADUA 3AIRA 3L5AA 2Z6IA 4FR1A 4WRHA 3KOWA 4IFKB 3GXNA 3P6LA 4HU8A 1OC6A 3GC5A 1IHIA 1P6WA 5CSSA 3SRDA 2B4GA 3VC6A 2F2HA 1LL4A 2JALA 3PSVA 1XYBA 2VQUA 1ZSXA 4NZFA 2AAMA 1XG3A 3O06A 2WSPA 1K1DA 3PZOA 5XIAA 3KOYA 3Q45A 4UQ9A 1VFTA 3O1NA 3B8IA 2JEQA 1MNZA 5MHBA 3OJGA 3GK0A 4NF7A 3TYDA 3JUGA 3VKBA 3G1VA 3ARXA 5TD4A 2PEVA 2O7SA 3ME3A 1XQKA 1W8SA 4CN6A 1EXBA 4PR4A 2QV4A 3FKRA 4H7CA 1W3HA 3SRKA 3RM9A 3LRKA 2W4XA 1RH9A 4DZAA 4GZIA 1QNSA 4Y9AA 1WCGA 4GI9A 4PUEA 5ENLA 2R82A 4H6RA 1XIIA 5LGXA 3JU2A 4DLMA 3MW7A 4DXKA 1YTDA 2FPVA 4ZTYA 4ASTA 1VR6A 5A3HA 4L1GA 4AEOA 4AH7A 2AL2A 4JD4A 3QLDA 1VFMA 4CQAA 3R58A 4F3HA 4J35A 1R87A 2CU0A 3C0JA 4XWUA 3KVJA 2BVWA 4R7WA 5C7VA 3O3RA 4CD4A 3ZZ1A 5FSDC 1EOMA 1DJQA 1HJWA 4UMBA 4ICMA 3WMSA 2HNEA 1AH0A 4HZ7A 4QCEA 3UZWA 3GHTA 1V02E 1NF7A 1JDEA 4I9TA 4JQ3A 4W9TA 4BI5A 1A3HA 1Z44A 4UQEA 4XZWA 1CGXA 1YYAA 3HB9A 4AD1A 1H50A 2QDGA 2CITA 4UTUA 3GDBA 2XH2A 4XKYB 5EMJA 3O9NA 1UA3A 3JZEA 3U7VA 3VMOA 2XIBA 4GIAA 4KEUA 3GG0A 5L6UA 2XVGA 2QCMA 4WVXA 1EB3A 2YL5A 2PODA 1K9DA 2QUMA 3TV8A 4JS3A 3UG4A 4Q7IA 1AK5A 4RNJA 4Y90A 2E4TA 4JX4A 3VZYA 2C19A 4DELA 3N2CA 3RG6A 2I57A 3EMZA 3GNDA 1QPQA 3VNMA 1KM1A 1KBJA 2NV2A 1C8YA 3D47A 4O13A 1DXFA 4QHRA 1FWBC 4ADSA 1NDZA 2X40A 3L66A 2VEMA 2Y7DA 4H83A 3TYZA 4DO4A 1NU5A 4LS1A 1G9HA 4L56A 3W25A 1CTNA 4M81A 3MHGA 4DJDC 3A24A 4ZR8A 4AHQA 3DYOA 3DU0A 3DAQA 3O6DA 4J3TA 1MVYA 4WJ8A 3UVIA 1M3UA 4FX7A 4G1KA 1XBXA 4ENLA 4MPQA 3IUDA 3ARZA 1QNRA 4GRSA 4EF9A 3CHVA 4GIEA 3UYIA 4Q33A 4M7TA 2D0GA 3BQ5A 3IWPA 1J18A 3A6OA 2E28A 4QE4A 1M03A 2PLKA 2H8ZA 3HG5A 5DX7A 1OSEA 3EDFA 2GJXB 5CZKA 2V3DA 2TSYA 5J5DA 3ZT5A 4DAFA 3QYSA 5F1UA 5E9XA 1T8XA 4BWLC 1OCNA 3TK7A 1ISWA 2DORA 3TR2A 2J7BA 4IMEA 1O95A 1US0A 5C6MA 2J62A 2E9BA 1TMLA 2Y2WA 4HA1A 2DQXA 4Q6JA 1CNVA 3KOFA 3VMPA 3IV8A 2Q6ZA 5A8MA 2I5QA 2A2IA 4W5UA 2VC9A 3SW6A 3SJNA 1GOOA 1VHNA 1Q6LA 2DIJA 3C6CA 3P84A 1IZJA 1LG2A 4Z42C 3HURA 1K7EA 2GL5A 2RGMA 3RLGA 1HJXA 2YJQA 4GYKA 1VS1A 2WKGA 4DJDA 2V5LA 4X0VA 4BI6A 3NZ1A 4JTRA 6TIMA 3VKKA 4CQDA 3IK2A 5A6TC 2JEPA 3H6OA 2XHYA 1BQCA 4PMYA 3EX1A 1DIKA 4FOUA 4JTIA 3HJZA 1GKRA 3T42A 3SBFA 2HK1A 1P1XA 1XYMA 1EJVC 3OLGA 2YXGA 4S38A 4IIEA 1L6WA 1NARA 3AXKA 3CQHA 1J0IA 1MQQA 1ESWA 3PF3A 4AQLA 4UTWC 5LGZA 2D2OA 2HZGA 1SMAA 3N29A 3UW6A 4RNIA 3GNNA 1GOIA 3F2BA 2YYUA 2GUUA 1FX6A 3S2CA 3ABQA 1Q6OA 1VBJA 3ZVHA 5CPTA 2KAUC 1MWOA 2UY3A 1HKWA 1AH3A 4WD0A 3UJFA 1K02A 4HNUA 1JYWA 1RP9A 1XLDA 3TWAA 1DWHM 3TR9A 2DT0A 1ZBCA 2VFDA 2OSXA 3GYEA 1VF8A 3UGRA 5FEPA 3TXZA 4ECLA 4GJ1A 3WDHA 3IJ8A 4I90A 4E2DA 3FYPA 2PCEA 5A8PA 5F4SA 4PE8A 1TTPA 3RPMA 7PTDA 3KX6A 1ISXA 4IFOA 3MZ2A 2QJMA 2ANUA 3EDDA 1LT7A 2VR5A 4LCQA 2BVYA 1W5QA 3RF9A 3ZR4A 1EA0A 3CAKA 1IWPA 3NSNA 1BSIA 1FHLA 2YBTA 4TV5A 4GQGA 3ARTA 4FNSA 5DBTA 3WNKA 1GOWA 1FH8A 3L2MA 4DUWA 1RSCA 1XIDA 4AC7C 1R86A 1OJXA 1OC5A 3HU7A 3AHTA 3DG6A 4RDYA 2B7QA 2VP8A 3VNDA 2XFRA 3M0KA 5E0CA 3K5XA 4W8LA 1VBHA 3W72A 3TTSA 4B5XA 4MJMA 3ARSA 5EBAA 4MNMA 1FWRA 1GYMA 1MYRA 2DUXA 4Q8TA 4WSHA 1VJIA 3NYDA 2PDFA 4TQTA 1JZ7A 3UPBA 4TX6A 4R27A 2EPNA 4N4PA 1R3VA 5A6BA 1TV3A 3N12A 4YTQA 3GTXA 2KZHA 5CZSA 4PB5A 3VTRA 3U4FA 3W6LA 4EAYA 1K3UA 5D38A 2FPYA 1EQPA 3MMDA 3WDJA 1IWAA 2OQYA 4O54A 3W2LA 3RUBL 2Z1XA 2AL1A 1W3IA 4K38A 3PBVA 3PFMA 1ALDA 3ZIZA 3TU9A 2RUSA 1SQ7A 1UOZA 1TPVA 3WFAA 2NUWA 3K4WA 2JF6A 4GI6A 4M1RA 3LHVA 1M53A 4RJEA 2V2HA 4FK9A 3T78A 3V5CA 1LZOA 1JD7A 1KBKA 4RV3A 1K7XA 1CX9A 3WLRA 4AVOA 3BURA 3W7PA 1REQB 2R94A 1B9ZA 1WKYA 4CCEA 3NXLA 2OXNA 3AMCA 5JIPA 4PMXA 3RGTA 2ZX5A 3SECA 3GBEA 5FJIA 2Y70A 5KINA 3MC5A 4F8XA 4HYVA 2OX4A 4IGSA 3VVGA 4JFUA 3H23A 4HD5A 4ZXLA 1XBVA 3AZRA 1FKXA 2XH4A 1YBQA 2WZHA 3L5LA 1GONA 1W6TA 1RK5A 2J13A 4E2VA 1T40A 1FWIC 1YHTA 2OEKA 1XXXA 2QVHA 4O1BA 2J79A 1KGXA 3H53A 2GGEA 4WX2A 4UQBA 4AEFA 5C0QA 2IKGA 1TV7A 4RKAA 5CXPA 2POTA 2GVLA 4WR3A 3R7MA 4Z1AA 4F0SA 1QWGA 2V38A 1LOQA 4BQ3A 3LS9A 3K1GA 4I9AA 4IQEA 3P3BA 3QRHA 1LOSA 2D3LA 1UR8A 2GJPA 4IMAA 2I7GA 5G1MA 2PS2A 2HXTA 8RUCA 3VC5A 3CL7A 1D2KA 1EPXA 2W0UA 1ISZA 4W89A 1QPOA 4JN6A 3L21A 1US2A 2BHUA 2X1RA 4TVUA 8TIMA 3CMJA 3FEMA 2ZUUA 2VDHA 2XZ9A 1UZ4A 4X9YA 4LVGA 3RN6A 1F3EA 2HS8A 1NOFA 1FDJA 2XG9A 1J2WA 3BAKA 2QCEA 4H41A 4YTUA 1W1TA 4HU3A 5HMSA 3GRIA 1PWLA 1VQTA 1U1HA 1YXDA 2J8GA 2A5HA 4JEQA 2ADAA 4S3FA 5GPRA 4JTSA 1EA9C 3D3FA 4GWEA 3WO8A 3G1RA 3LY0A 3KFTA 5BU9A 4Y9MA 5K9XA 2VT0A 1N2VA 1PSCA 3U8GA 3BG3A 2BX7A 1GQIA 3EOUA 2VX7A 2XFWA 3JS3A 3I3EA 3FYOA 5HINA 1EJUC 2AMXA 2HDJA 3IJQA 4HNTA 3FSTA 1O12A 2CETA 1V79A 2R1PA 4NAEA 1UP2A 4DBWA 3IJ9A 2F9RA 3H2NA 4FF7A 4LRSA 2D0HA 3WKZA 2WANA 3RIKA 3S6DA 1WKDA 3PVFA 1FHUA 3LMZA 3ALGA 1RBLA 1G67A 3T9PA 2QQ6A 1HG3A 1UH4A 5FJTA 1QPRA 5TBOA 3R0KA 2XIJA 1EBGA 2C6QA 2PWFA 1TUXA 4U3CA 3CHCA 4TVCA 4GUGA 3L4WA 4NHVA 3B0XA 2RDTA 2OLHA 3RPDA 1TWSA 2J74A 1AW2A 1F7BA 4BQ5A 3BAIA 2PGRA 3DHDA 1OCQA 5JBFA 4Z0SA 5TF0A 1HN1A 2VFGA 3TYCA 5HWJA 3SURA 3AMKA 3QY8A 1OT1A 3MV01 4OGZA 2YKKA 1VBRA 1B3YA 2OWCA 3IAQA 4RX0A 3STPA 2PD5A 2WW5A 4AZHA 3ZLGA 5CPLA 1SYTA 1U5JA 1F2JA 2PWVA 3DFTA 3KS5A 2R1LA 4EVZA 1MDLA 1BD0A 3N6JA 4DYKA 3WDQA 4NG3A 1XDJA 1E9YB 1UR3M 2X16A 1TE6A 4DF2A 3F7JA 4HHMA 1XLBA 1HP4A 4JTJA 3TKFA 3PZTA 1KWGA 1Z6KA 4JCMA 2D69A 2HEJA 5ABFA 1ZB5A 1E3ZA 4RDVA 2VUYA 1AQMA 1N8WA 1RY8A 3KBVA 4WDUA 3BMXA 3G1YA 5AZ0A 1RXOB 4QNEA 4B2DD 1PUDA 5FJJA 2QJJA 1JCLA 1ZALA 1EP3A 1Y65A 3NL3A 2EPOA 3GHUA 2E6YA 2E6FA 3LPOA 3P8JA 4FB7A 2EF9A 5FF0A 1DIOA 1ZJBA 3R10A 5AYXA 4UR8A 1PKYA 1WQ5A 3CZJA 3ITGA 1VZWA 4JTDA 4LAMA 1JGIA 1H0IA 2VRKA 3M5XA 1XBZA 3AHXA 4R9OA 3L4TA 4OWGA 2ZC1A 3GG1A 4MJZA 4U5KA 3TYAA 3SCOA 3V3WA 3ITOA 1HP5A 1QATA 5CC6A 2JGQA 2Y8VA 3LCFA 5D37A 3MYPA 5I7GA 2SFPA 1K9FA 4KT2A 1BXCA 4EPKA 1WDSA 1HGYA 2WSYA 3APTA 3AXIA 2CESA 2C15A 3OGSA 3LXAA 4LAOA 3ALFA 1KM5A 1XRTA 2A0NA 3DHUA 1GUVA 5A8QA 3S6TA 2J75A 2YW4A 4AZCA 2NX1A 4NZ5A 4WK9A 5E6ZA 2XH0A 5FOOA 3SUWA 1ZAIA 3TH6A 5SWUA 2XU2A 2O4QA 2VX5A 4QXIA 2OOGA 3F4WA 4U33A 1Z42A 1PTAA 2V81A 4LC8A 3TLQA 5C5YA 2YB4A 1UWAA 1KRMA 2QJIA 3NL6A 3WLMA 2WQDA 3WF0A 3AIWA 4IP7A 4JIEA 1BGGA 4IG2A 3WLNA 3Q67A 2YZ5A 4J5NA 5B7ZA 4FLSA 2NVAA 2PSNA 1LT8A 2A85A 1I45A 4HPGA 4NJIA 2A3LA 4I7VA 3SRHA 2QUTA 4Q8PA 1V6TA 1RD5A 3SJ3A 2PWDA 1CGUA 1JEZA 2DZPA 4RK8A 3PZNA 2O56A 1M1BA 4XTDA 1XLLA 3SQMA 2PDJA 4R5EA 4ACYA 1B31A 3VDGA 2WVVA 1MW2A 3UCDA 1XX1A 5AYBA 4YS1A 3TYBA 4O16A 6XIMA 1O5KA 1P4CA 3M16A 4H3DA 1IGWA 4Q4QA 2O0TA 1MSSA 2W62A 4PBGA 4LUTB 4S2CA 1J11A 3CQKA 4O52A 2XIMA 1QW7A 4LH8A 4NIRA 4NJGA 1VC4A 3U6WA 1KKRA 3V16A 4GUIA 4F0MA 4M1BA 1IIGA 3GDMA 3O8AA 4AYGA 1ZTVA 3FVMA 4QAWA 1D3CA 3DI0A 3GSMA 1TUFA 4KCTA 3QF0A 3ARYA 4MKSA 5BROA 2WHMA 3Q58A 2R1KA 1ONEA 4LS0A 3COTA 1JCMP 2VEIA 1LRNA 2YCLA 1YPXA 4ML9A 6REQB 4GLEA 4NASA 3CQ0A 2JGYA 4R53A 1L2QA 4UTTC 3RFAA 1PL9A 2VX6A 1OWQA 4XUGA 1YE4A 4FNPA 4M24A 3HTWA 3LCLA 3DI1A 3WQEA 3THQA 4RZ5A 4LNYA 2F84A 2NWSA 1UZDA 2DP3A 3AHVA 2V3FA 3QYQA 1LDCA 2WMHA 1YW1A 3OVGA 1W17A 3CV6A 3OQEA 3I7SA 2FHBA 3F1QA 4POCA 1KM2A 3UU0A 4ZQMA 1B3VA 1EBHA 2YXXA 1BWLA 3GVVA 4YNGA 4GBDA 5KSWA 3QY6A 2J77A 5AB3A 5I3GA 2R14A 4ZGYA 1AODA 3N15A 5BW6A 2RHGA 3IAPA 4UTKA 4JICA 1DJGA 1EWEA 4MNJA 3SEPA 3RU6A 2AQWA 1J4EA 5HPCA 2CPUA 3TQ0A 2DVUA 3GR7A 4N9DA 4C65A 5HXMA 4MKVA 4AY1A 4D8AA 3UWEA 2BB0A 2X7VA 4P7NA 3UZXA 4AZ6A 3FK4A 3UNTA 4V2XA 3EPMA 4JGDA 3LA4A 3IVTA 3L2LA 1V0NA 3RPTA 4HPJA 2DW7A 2NX3A 2INZA 3OLDA 3T2OA 4PRWA 1W1PA 2HNHA 4LYKA 1A5OC 4GFIA 2JF7A 1WKFA 1RQEA 4KQNA 1P7TB 5JIWA 1DXEA 2P50A 4UMCA 3VD9A 1UR1A 3E0IA 1R3TA 3ZT7A 2QPSA 1EF3A 2E3ZA 1F3TA 3OZYA 5F2LA 1ICSA 5I79A 1IWBA 2J7EA 5G2WA 3PB0A 2FH6A 5IRPA 3S2MA 2DZTA 3S46A 1JPMA 1GYNA 3CPRA 3W73A 3B3DA 5I3DA 3BLDA 3J7HA 1PYFA 3W02A 4HTBA 4NZ3A 2RKXA 2C0AA 4V27A 1DHKA 1OG0A 3P0WA 3MJYA 3ZMRA 1IZCA 3NSXA 4CVUA 1XKYA 1ZLPA 4R85A 3GXTA 1DL3A 2JKAA 3LSBA 5H91A 4ZSUA 1DTNA 2GDVA 3QY7A 2DEPA 3MMUA 4OECA 1UZ1A 4LV4A 3G1DA 4C6OA 3QBUA 4BCEA 2ZDRA 5GJNA 1H7OA 2X2YA 1XCWA 4W8AA 4TVDA 2V68A 3MP5A 3R43A 2FGZA 2Y61A 5KMYA 4GK8A 2P0IA 4JKLA 3ID7A 4IPJA 4FXRA 1AVAA 1KNWA 4U10A 3AU6A 3UR5A 1PZ3A 2VKZG 4YIWA 2JKEA 3MO4A 4UR7A 2VEFA 3DFSA 1V77A 4KKXA 1RJRA 3W37A 1XPGA 1S2CA 3MUY1 4N0RA 3H2MA 3LQGA