3PSWA

Structure of e97q mutant of tim from plasmodium falciparum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
246
structure length
246
Chain Sequence
b'RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFQRRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Revisiting the mechanism of the triosephosphate isomerase reaction: the role of the fully conserved glutamic acid 97 residue
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 96
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pswA00
4EOUA 3PG8A 4LNYA 3KRZA 3F1QA 2GJLA 1H62A 3LRLA 4UMAA 3LCLA 3MBDA 1TIMA 2QCEA 1P5BA 4OWGA 3PBWA 5ABTA 1YTKA 5IM51 2FFCA 2CLIA 1LRTA 3HF3A 4NZFA 4O19A 2QJHA 3U2OA 2FB3A 4KFOA 4N6FA 2QUUA 3TQ0A 3LHWA 3KVMA 4ML9A 2DJLA 2VFEA 2QR6A 3N2XA 3IIXA 4RLIA 4UTJA 3H53A 3KFTA 5DY2A 3FLUA 3OEXA 1OX6A 3WJZA 4FNPA 3TAOA 2BZNA 4PA8A 1SZFA 2Y61A 4FIQA 4K7VA 1LOLA 2NUXA 1FWTA 4AHPA 3M47A 3FEMA 4TIMA 4ZMGA 1QMLA 2ZQ0A 3RNDA 3W3OA 3C2RA 1EB3A 3UD6A 4FEZA 4ORMA 3DFOA 1FWRA 1PCWA 2VFHA 2KZHA 4DBEA 2E09A 5E1QA 2E6YA 4Z0SA 2QCNA 3W2NA 1Q6RA 2OJPA 4GUGA 4MY8A 4MOZA 3E02A 4TMCA 3ANYA 1TPWA 4BWLA 1LLWA 4JX6A 1FBAA 3KAOA 4IGHA 4N9BA 1TREA 2Y89A 1QDSA 2GJNA 3NQAA 1LZOA 2A6NA 3TJLA 4ZQRA 3RLVA 4YXGA 4NNAA 1VRDA 1OFBA 3JR2A 2V2HA 4UFKA 3G0UA 1O5KA 1T99A 3FYPA 1DV7A 1AW5A 4TU1A 3M5VA 3M5XA 5G2IA 5D37A 1QOQA 1EEPA 4ONVA 2RDUA 2JGQA 4JXCA 4UMBA 5MHBA 1Q3NA 2V8ZA 4A21A 5IBXA 2WNQA 4PFMA 3DGRA 1GG1A 1EX5A 2QCLA 1B4EA 2WKJA 1G69A 2WPBA 4NZJA 4CQAA 4A2SA 1F74A 3Q94A 3NQ6A 4WXYA 3DH7A 5I3KA 2FDSA 4MZ8A 5J5RA 4HKPA 5HWJA 1IGSA 3HG2A 3NM3A 1AW1A 1QNVA 3BG3A 5D03A 3UWYA 3AJXA 4FX8A 5D2WA 1GVQA 3TSMA 1R2TA 4O17A 5AYXA 2ALDA 4UTIA 1EA0A 1TRDA 3FOKA 3KX6A 1FWNA 1W37A 2E5CA 1M7PA 2ATSA 1I4NA 1THFD 3HGSA 1SW0A 3NXFA 3QM3A 1JCMP 2QKFA 4O1AA 1GTHA 3G0SA 4QISA 3NVTA 1OYBA 3PB0A 1OABA 3O63A 4UTUA 1OYAA 1J5TA 1QPQA 1UUOA 2TPSA 3G1FA 2CZDA 3WK2A 3PC0A 3S6DA 4S1FA 2J9ZA 3EWUA 2R91A 2ZZ7A 2C3ZA 3GDRA 5D30A 2ZYFA 4MYXA 1H1ZA 2RKXA 3W7JA 3W2JA 1GQNA 5DCBA 5FF0A 3PS7A 5C2XA 2QCGA 5K9CA 4N4PA 1TV8A 4JYEA 4FXSA 4UMCA 3SI9A 4GUJA 4ADSA 1OFRA 2A7PA 3UQNA 3N9SA 5CZ0A 2Y7EA 3MBFA 4DQWA 4BI7A 2NXGA 1F76A 1EP3A 4HIBA 3LLFA 4LTSA 4QAIA 4QIUA 3L68A 5LNRA 1UASA 1Z42A 3LDVA 4Y6GA 4BI6A 2RDWA 1N7KA 2E6DA 4MUZA 5T26A 3M6YA 1LROA 5AC6A 3C2FA 1O60A 3VFLA 1HG3A 1C9DA 3EX1A 2GVGA 1KFBA 3VI2A 3IVTA 3THAA 2E68A 2TRSA 4LVBA 1IXNA 2Q8LA 2GOUA 4P2VA 3TR2A 4R33A 3QQ1A 1OX4B 5BOOA 3E9AA 1JUKA 3SFKA 4OE7A 1P0NA 4M6QA 1KV8A 3L0NA 1GYNA 1VQTA 1QPNA 4UUIA 3TW6A 4C1LA 2YW3A 3GZ3A 2W79A 3RFAA 4UIOA 5FESA 3VKJA 1LOSA 3N3MA 1XBVA 2VFDA 2FPVA 1TPC1 4FNUA 3LBMA 1ME7A 4DF0A 5D38A 4O0ZA 4O1BA 5D02A 1WV2A 1GG0A 5LZLA 3KVKA 3DFNA 3NEVA 4WJEA 1VPXA 1OF8A 2P10A 1T96A 3MP5A 3UYCA 3WJXA 4JTJA 1OK4A 3C52A 3G1XA 5G5IA 5EBUA 1LORA 4NJGA 3T44A 3DHFA 2Y70A 2GUUA 1SZGA 3MMTA 4Q33A 3M1ZA 1EIXA 5F2MA 1LTDA 3V75A 3W83A 1T8XA 2ATMA 1VR6A 2ABAA 5EA9A 2VFGA 3LTSA 4JTIA 2B4GA 4EVZA 1JULA 1RVGA 3OVPA 2CLOA 2J9YA 2AQWA 3EXRA 3LRKA 3W86A 2CZFA 1TJPA 1YXDA 3O06A 2NX1A 3T4CA 2ZFAA 2DZTA 3T55A 4E2DA 4UR7A 1TPB1 5FEZA 3FA5A 4YLWA 1AL8A 1AL7A 1KTCA 1FCVA 3UY8A 3UXDA 5KZMA 5LNVA 3RK8A 5CZSA 5HWNA 5F2IA 1N55A 5LNWA 3BVJA 2QUVA 2J88A 4PL1A 2V2CA 3A22A 4I9AA 1I2RA 1V7YA 4K8HA 5CSSA 4P61A 4PODA 3GK0A 5CPLA 4K39A 3WK0A 3O8AA 3B0VC 1F7BA 1GWJA 1R2SA 3MW7A 2JBMA 1DBTA 1KM5A 3OG3A 1GJPA 2ZRXA 1I45A 3N2MA 1F2JA 4MZYA 4MPQA 3N34A 2FPYA 3MWAA 2ZZ5A 5I3JA 2ZZ3A 1Y0EA 1W5MA 2F84A 3MHFA 5LSMA 5AFDA 5EPDA 1SZEA 1T0OA 1L2UA 5K7JA 5KZEA 1M7OA 3B06A 5J5DA 2XN1A 2OZ0A 1QOPA 1OFEA 4MJMA 3LLDA 2EF9A 2R94A 3A5VA 1HUVA 2R8WA 3FJLA 2YR1A 3IGXA 3KRUA 1QPOA 1H7WA 5AOUA 3I7SA 1H7RA 3GYEA 2ISSA 3HMJG 4UTTC 3FYOA 3PBUA 3NZRA 1TTJA 1NAL1 2H6RA 3SGUA 3PVFA 4N9EA 2VC6A 5BRBA 4A2RA 1G4EA 1B57A 4O0KA 1FCQA 4CNOA 2Q3OA 1XL9A 3N19B 3GX9A 4RXFA 3EXSA 3LCGA 4Z1CA 3QQ0A 3G24A 4EIVA 4R53A 2FIQA 8TIMA 5HR7A 1QFEA 1XUZA 4PTNA 1VH7A 2YFOA 5A5WA 4OHQA 4W9TA 3KHJA 1PL9A 3PR2A 3MYPA 4AB4A 4DF1A 1FX6A 1P0KA 5FF7A 3BG5A 1KFLA 2YFNA 3G1HA 4JTHA 7TIMA 3VE9A 2QUTA 4UTLA 1PCKA 1OX4A 1Z44A 1W3NA 4N02A 2X16A 3R89A 3U6WA 5LGXA 4JR5A 3W1MA 1X8FA 2RFGA 3NDOA 2ZZ1A 5EYWA 5DBUA 6ALDA 2Y7GA 3W6YA 3S5OA 2FTPA 3MYOA 4CQ9A 1ONRA 2EKCA 4O13A 1EPXA 2V2DA 2FLIA 5K9XA 3ABRA 3ABOA 4WXZA 5F2GA 2VKZG 1H50A 1IF2A 3Q2DA 3F03K 4A22A 4FNRA 5U7SA 1FWSA 5AHMA 4Z1BA 4UFMA 2PCQA 1VLIA 3GLCA 4A3UA 3SECA 3MO7A 2V30A 3GAKA 1D9EA 3CC1A 3HOJA 1OFAA 5EMUA 1YDNA 3P60A 4NJJA 3C61A 3LHVA 3N14A 3QH2A 1L9WA 1FWWA 1KFKA 3IIOA 5FEXA 4GRSA 4WZHA 3SSJA 3EX3A 1EWDA 2VEMA 1A5SA 1XFBA 2YX0A 3NQGA 4LC6A 1PE1A 2JKPA 4G1KA 3NPUA 3BLFA 4RX0A 3EKZA 3PBYA 4WOQA 4UFJA 3W1QA 2QCMA 3LOTA 2WJZA 5HULA 3W2UA 1DHPA 4MY1A 1ICSA 2E5BA 2ZCGA 3EWWA 1I2QA 2Z1BA 4OV4A 1KM0A 4Z1DA 4Q32A 3MP3A 3MJYA 3O6YX 4HPJA 3LXBA 4JIPA 4FX7A 4HN4A 4AHOA 4RCXA 1RQBA 1PHWA 2QAPA 3TMLA 3PY2A 3W22A 4LVGA 4DEFA 4WUIA 4NXKA 1W3IA 3A9IA 2H90A 4BK9A 4MJZA 5G2WA 3QRHA 3TKFA 2Q8ZA 3L0GA 1ZFJA 3LBCA 1GVSA 3P67A 2DZPA 4CQ8A 2NWSA 1BWKA 4IWWA 3L0KA 4NX0A 4AAJA 5KTLA 2X1UA 5L6UA 3LERA 3NL5A 1BEUA 5F4SA 3W1XA 4O50A 1YTEA 1ZAHA 1F73A 4FO4A 1W8SA 3GDTA 4Y8FA 4X3ZA 2H3BA 2BXVA 3HGRA 3CLMA 4X9SA 5E0KA 3C3NA 3BV4A 3CHVA 2BLEA 3GDLA 1LBLA 2G97A 2I1OA 4JN6A 1VC4A 3GVGA 3B05A 4XTIA 5DY3A 1B9BA 1WA3A 3BLEA 3LHTA 5G1YA 3M0ZA 3PSWA 2GVLA 2WV8A 1BWLA 1ZNNA 4K6AA 3E0IA 3W7DA 4JY8A 1SFLA 4JX4A 3NPXA 2QAFA 3B8DA 5EL1A 2DP3A 3LXAA 4JYDA 1MXSA 1UB3A 2Y88A 4LY8A 4A29A 2Q3RA 5D2TA 1TPDA 1PS9A 1VHNA 1QR7A 3QSTA 1X7FA 2AAMA 4KWVA 3G1SA 3FKKA 5AHEA 2ZBTA 3NGJA 1SO4A 3GR8A 3GXPA 3HBLA 4GXMA 4UTHA 4JGDA 4GUHA 1HFBA 3CWOX 3L2IA 3C0JA 2O7SA 2ZA1A 3GIYA 4R34A 2OMAA 4Z1AA 1LRQA 2ABBA 2C6QA 2TMDA 3W70A 3S9YA 2DZUA 1WOBA 3Q37A 1VJIA 4K37A 1WXJA 3DHDA 4Z08A 1YDVA 3S1UA 3R12A 4LRTA 3TX9A 1PHQA 1FCUA 2V9DA 3I68A 1NSJA 3QYQA 2NX9A 1FQ0A 1TRIA 3L67A 4OGZA 3N73A 3NL3A 1IIHA 1L6YA 4LVAA 4O1CA 4YMZA 3QMSA 2FB2A 3FJ6A 4KKXA 1SFJA 3NZ1A 4JTTA 1K7FA 4OT7A 1B4KA 1YDOA 2GQ9A 5CG7A 1RV8A 2A7NA 1CW2A 5KINA 1DJNA 4Y90A 1JCLA 1KFEA 4ZQOA 1X1OA 2R14A 2VFFA 4PEKA 4HT3A 5FF3A 4ZVJA 3W7MA 2W0UA 3TXVA 4O52A 2WSYA 1G4TA 3PUEA 1TYGA 3E96A 2ZZ6A 5HWMA 3NNTA 5HUPA 1H63A 4QSHA 1JJKA 3FKRA 3I6RA 3BARA 4JTEA 2QJGA 3GXTA 1IXOA 1K8XA 1YLVA 3S5YA 3DBPA 2HS8A 3S5ZA 5D2XA 3W7NA 3AO0A 1SPQA 3C2EA 3R13A 4KWWA 1KV5A 1ML1A 3NO5A 1H1YA 5AC8A 3H55A 3W7GA 4LRSA 3TK7A 3W85A 4C1KA 5TIMA 5D2VA 1TPH1 3STGA 4FF7A 4WD0A 3EB2A 1QO5A 3N9RA 3HG5A 3BGJA 4MYAA 4OQVA 2C13A 5DCEA 3BW4A 4N4QA 2C18A 3W88A 3W74A 3LHUA 4CCCA 5KITA 4JIQA 1KFJA 1JRBA 1AW2A 5AHIA 2G96A 3W9ZA 1TMHA 3QZEA 3HGOA 1G7VA 2OT0A 3S42A 4O53A 2PRHA 3TDFA 1V5XA 3CWNA 1VLWA 4LV9A 1ZALA 4M7TA 3TNOA 1W5NA 3DKJA 1GZGA 3UWUA 2E1DA 2V5BA 3CEUA 3LB0A 2WNNA 4DO5A 4Y9AA 4UC5A 4UNLA 4ADTA 1H7PA 1S5TA 3O15A 1IIGA 3QW3A 4MFEA 3HPSA 4LW7A 5CZTA 3DENA 1DKWA 4Z0JA 2NWRA 1XUUA 1W0MA 3ATYA 3KXQA 3OA3A 4HSNA 4IUOA 3S8HA 3B0UX 1WOAA 4ALDA 4N9CA 3HG3A 3KVJA 3C4UA 3MI2A 2QCDB 4O15A 1G7UA 1NVMA 3TU9A 1VYRA 4AWUA 1TPUA 3NQ8A 1TTPA 3BLIA 3R5EA 4S2BA 5D32A 2X30A 1ME8A 1TCDA 4O11A 3HJZA 3GNNA 4I7UA 5HNRA 4GWEA 2VEIA 2G5WA 3W1TA 1KLZA 5CGQA 5E93A 3P5ZA 2HSAA 2YSWA 3L9CA 1LDCA 3LCWA 3B04A 3M43A 2VEKA 3E49A 1XXXA 1TJRA 2QEZA 1JCNA 1OFQA 3OHIA 2YZRA 3T78A 3CIWA 3S5NA 3LCFA 3W2LA 1ZJIA 4QQ3A 1ALDA 3W1UA 3M9YA 3ZWTA 3W7HA 1KTNA 1F5ZA 3W72A 4AWTA 2WSRA 1LOQA 2WO5A 4IMFA 2FJKA 4XUGA 4LC8A 3PUOA 1I2NA 3G1DA 2OT1A 3V1PA 5FF2A 2IQTA 3PULA 5LGZA 1GVRA 2B7QA 5AYYA 5C5YA 3P74A 2YPIA 2ZA2A 1F05A 2PRLA 5L9FA 4O4WA 1M5WA 3IIPA 2VELA 2X1TA 1MEWA 2Z2UA 1VYSX 4ORIA 5F4XA 2H8ZA 2CLFA 4TX9A 1DORA 2D73A 1F6PA 3PAJA 1FDJA 1MSSA 4NU7A 1K7XA 2TSYA 3A21A 4IMCA 3E12A 1D3HA 1JRCA 2CLEA 1C29A 3MP4A 2J9XA 3ATZA 3CM4A 3G18A 4HHPA 2HS6A 5K4XA 1FXQA 1RR2A 5D2YA 4GBUA 4EF8A 4IX2A 2V0TA 3EEGA 5D05A 3KOFA 3PUDA 1ADOA 2YGYA 2GVJA 3L5AA 5AB3A 4HNVA 3GAYA 2PRMA 1KM2A 1YYAA 1VGAA 2Y85A 5K4ZA 4O57A 3NQEA 2ZA3A 3P62A 3STCA 5C6MA 1GVFA 4LV4A 4AH7A 4JS3A 1W3TA 5LHFA 3L21A 1H7NA 4MFDA 5CSRA 4RXGA 3UNDA 3DFPA 4BWLC 4UFLA 2Y6ZA 4YCPA 3C56A 3TAKA 3GDMA 3BPWA 4RK8A 1XCFA 1MEHA 1EUNA 5TQLA 2CLHA 4CNPA 3UWZA 2Z6IA 4XQ6A 4UTMA 3SGZA 3TSBA 2EHHA 1JCXA 1SQ7A 3GKAA 4IMGA 1S5WA 4GE8A 3W1LA 1L6SA 1GPWA 1W5OA 4AHQA 1EP2A 2QCCA 1KLYA 3TV8A 2XN2A 4NXSA 5CKSA 2C19A 1AK5A 1EUAA 3O07A 4PH6A 1DQXA 2CLLA 2G95A 4X22A 5IBXC 3QW4B 3G1VA 2GPTA 3QPYA 4TR9A 2J6XA 4UFHA 4RV8A 3INPA 3P80A 4RZ5A 5F2LA 1YPFA 4AVFA 4QITA 1G4PA 2C15A 4BI5A 3P5YA 3NA8A 4DO4A 4E2BA 4O18A 3DZ1A 3CT7A 2YYUA 1NF0A 1UBSA 2A2IA 4RZ4A 4QNEA 2QCDA 5AN7A 4UTWA 4GUIA 1H51A 1FCBA 2JKEA 4ZQNA 2VENA 4ICNA 4AXKA 1W56A 3FFSA 3M41A 3EWBX 2A1YA 4NJKA 4AF0B 5BMWA 3CTLA 2NV2A 5I3IA 2CW6A 4O16A 3W73A 3M5ZA 3TFCA 2ISWA 4HNNA 1YXYA 5HQEA 3NPWA 4UXDA 4LU0A 1G4SA 4MVAA 1O5XA 1LBFA 3SZ8A 4LOCA 1HO1A 1JCJA 3PWAA 5G4EA 4LVFA 4ZL1A 3W2MA 1XBXA 2WSQA 1IXQA 2UV8G 2V81A 2QDGA 1KA9F 3H54A 2WQPA 3TA6A 2B7PA 3LXCA 4FNQA 4PC8A 3ABQA 3UPWA 3C2VA 1H7OA 3EWXA 3FIGA 3STEA 1CX9A 1JVNA 3W7RA 1ZENA 1PV8A 5DXXA 1WBHA 1M6JA 4ZQMA 4FX6M 1KM6A 1TTIA 3T40A 3O05A 4O28A 2QCFA 4JDBA 5HMSA 4GFSA 3TE9A 3LCXA 4UTKA 1YTDA 4WX2A 4IXHA 1JQXA 4U28A 3LTYA 4OBTA 2GQAA 1SO5A 4O14A 5AYZA 4R7JA 3NL2A 3M7WA 4FXRA 3EWYA 4M19A 3GDKA 2RHGA 4CLMA 2WNZA 4RR4A 4CCEA 1G6CA 1AMKA 3QJAA 3A24A 1UCWA 4LWWA 1W1ZA 3NOEA 3VCRA 4HNTA 1XDMA 4JTSA 1ZHAA 4LT9A 4MIMA 2WOQA 1LCOA 2BWGA 3STFA 4K38A 1H60A 1QAPA 3ZR4A 3TH6A 3C8FA 3O16A 2BX7A 3B03A 4LUIA 4XTDA 3W87A 1A53A 3ZWSA 1B3OA 5DXYA 3UZJA 2B7NA 4IXXA 1TV7A 2ZDRA 3G1AA 3CEPA 1ZY9A 3UWQA 1I2OA 2RDTA 3L65A 4IPIA 3TCEA 2DZXA 3W75A 1RQEA 3G1YA 3DI0A 4RJEA 5G1TA 5C54A 3O6DA 2NLIA 3GKFA 4YL2A 4UNKA 4JEQA 3OBKA 1O94A 4XWUA 5LKYA 5D33A 2CU0A 4FB7A 3IRDA 4O1DA 5I3GA 2NV1A 2NXIA 1HTIA 3TIMA 3BG9A 4L4MA 2DZVA 2CZEA 3HPXA 4LUJA 1GEQA 3HIJA 2EGZA 3SJ3A 1U5JA 4BFAA 3PF3A 5F1VA 1OVDA 1XBZA 3TJXA 3IEBA 1KM4A 5HR6A 1ICQA 3RLUA 4MZ1A 1OK6A 2NZLA 4UFIA 3B4UA 4ZZ9A 4H4IA 1VYPX 4FNSA 4D2JA 1VCFA 3S1WA 1ZCOA 4EF9A 3BW2A 4N2YA 1E51A 1ZAIA 4LVDA 3FS2A 1DL3A 5F4WA 4GNJA 3BO9A 1VCGA 1PIIA 3IIZA 1BTMA 4DXVA 3DXIA 5KMYA 3ABSA 3SIZA 4JY9A 2OX1A 5CPMA 1VCVA 5CPNA 1OFPA 1TPVA 2GQ8A 3SW6A 4AF0A 1XBYA 1VHCA 3T7VA 3PBVA 1ME9A 1W5QA 1JUBA 1KM3A 2DJXA 4M5PA 4HSOA 4OU1A 2CFFA 3OVQA 1DQWA 1EWEA 4WQ6A 1K8ZA 2OCZA 1VS1A 1LM1A 3P8IA 4LS2A 2BSLA 3WJWA 2H8XA 1FY6A 1K3UA 2JGYA 2NXHA 1GVOA 1R30A 1K03A 4O4VA 2CWNA 3TW7A 3VE7A 3HQ1A 2ZRVA 5I3FA 3C2OA 3R8RA 2A0NA 3SR7A 2ZRUA 4UTTA 4TO8A 1OF6A 1J4EA 3W84A 3NQ2A 4FIRA 2Y7DA 3L5MA 2ZZ4A 3P84A 2O7QA 1EP1A 4J9JA 1Q6OA 3HG4A 3MHUA 2TYSA 2PC4A 5FI8A 3W7PA 1Z41A 4O10A 1TB3A 5D09A 3A23A 4NJHA 1R47A 4RKAA 4JTGA 2NUYA 3BGGA 1F6KA 1LYXA 5CPOA 2V82A 1S5VA 2E6FA 4JYFA 3DFQA 3L66A 1QO2A 4NUWA 2VFIA 3TC6A 3L5LA 4DF2A 4HNUA 3LRMA 3DU0A 3W2KA 4O8RA 2B0MA 2DU2A 5H2ZA 4PL2A 3QMRA 3IVUA 1O4UA 3TSDA 4MKNA 4JTUA 4E0CA 3WJYA 3G8RA 1SUXA 3G8EA 1Z48A 3WK3A 4E38A 1C8VA 1S3HA 3NPVA 4UTWC 3P7YA 2I14A 2YXGA 1JUEA 5DLCA 1KW1A 2J27A 2C1HA 2E77A 3TMQA 1A5CA 2X2GA 1TPFA 5KZDA 3G22A 5A8GA 3QSRA 2VEPA 1FDZA 1W54A 3I7RA 4FHAA 1GTEA 2NX3A 3A5FA 1QPRA 2PE4A 3ZFHA 2CZ5A 2C16A 3GB6A 3P81A 3W07A 3PG9A 4O54A 4JICA 1DOSA 4FNTA 3LI0A 3IIVA 4JX5A 5C55A 3CPRA 1TO3A 3F4WA 2E5DA 3R2GA 2DZWA 4JTFA 1FDYA 3TROA 5K9DA 1P1XA 2YDAA 2W6RA 4M7SA 2EPHA 1WQ5A 3CQ0A 3W1PA 3EWZA 4DELA 4NT0A 5FEWA 2YCEA 3CIXA 4NX5A 1K02A 2P1FA 2XN0A 1YPIA 4U4MA 1JQVA 2JKAA 2JK2A 2B7OA 5G4WA 3OIXA 3BW3A 4JTLA 5KSWA 1RQHA 1X1ZA 3KVLA 2RH9A 1WDWA 3GXNA 5LNUA 3DAQA 5LNSA 1W5PA 1LLZA 3NL6A 1TQJA 3M44A 1QWGA 3ELFA 4MLRA 1GOXA 3QMTA 3UWWA 2ZRYA 3IVSA 3W7IA 1D3GA 1TSIA 1TPEA 4WY0F 3TQKA 5DN1A 3EX4A 3USBA 5HJLA 4JD4A 2A7RA 3LV6A 2ZTKA 3LV5A 3ZS4A 1OX5A 2YW4A 3NQFA 3O6CA 1I2PA 3D0CA 4IJBA 3W7QA 4JDYA 1SSDA 1OFOA 3W1AA 2HMCA 2AGKA 4QNWA 4NNCA 1SO3A 4ZQPA 2Y7FA 3LCIA 4TMBA 5AHLA 2I9EA 2QJIA 6TIMA 4N6EA 4AWSA 4QJ1A 4ZQCA 1TTQA 3UPBA 4JNMA 3LHZA 1AG1O 4GJ1A 1WYIA 2ZZ2A 1RZMA 4WY0B 3MI3A 5DCDA 5FF4A 3W7EA 4XZ9A 1RD5A 1WAUA 3TXZA 2V5LA 1W31A 3HO8A 3IGUA 3EKLA 4Y96A 1NF7A 3NYZA 1U83A 3WFAA 3UWVA 3QPZA 3LX9A 4DO6A 2F7FA 4O12A 1WBJA 2ZRZA 3G3DA 2FPTA 4IMDA 5LHEA 4YWIA 1OJXA 3NQMA 4Q4KA 3UY7A 2J24A 4LS0A 1SU5A 4IX0A 4M6PA 3HB9A 4DPQA 3VNDA 3C6CA 3W7OA 4ADUA 1X6UA 1FUYA 2CLKA 4B5NA 3UZ5A 2HTMA 2VXNA 1IXPA 1GYLA 1LRNA 5BMXA 5HINA 3QEZA 1ZAJA 1CI1A 3MUXA 4BR1A 4M6VA 4GC4A 3Q58A 3UXAA 4BF9A 4XBSA 2YYTA 1SW7A 4K7YA 5K3VA 5DELA 2CLMA 3F4NA 1GT8A 1XKYA 4XKYB 1HL2A 2A21A 4IPJA 3LGEA 1O95A 4NJIA 1SZNA 3PSVA 2EAWA 3I65A 4EWND 5HUOA 3W23A 3W1RA 1MEIA 1ICPA 1K7EA 4UCGA 3G0XA 4OV9A 4GUFA 3HPZA 4IOTA 4JTKA 1XM3A 2FQIA 1XC4A 5FEPA 4AEOA 4CNNA 3TUUA 1H7XA 1TQXA 1KFCA 4N9DA 3O1NA 1FXPA 3GR7A 3GNDA 1R46A 4UR8A 1G67A 3NAVA 5EY5A 5U4NA 3B0PA 4H6KA 4X2RA 1KM1A 1DVJA 4KFPA 1XI3A 3W1NA 2Y62A 1OG0A 3EX6A 3PB2A 2VOMA 3TFXA 3OVRA 5EKYA 4CCDA 1XDLA 1I8JA 3DI1A 5SWUA 1A50A 4S2CA 3NQ7A 4K36A 5I3HA 4MY9A 4NNBA 1Q6LA 5H91A 1VZWA 2ISVA 3DKLA 5TBOA 1SR9A 3NM1A 1OHLA 3TC7A 3K30A 2Y63A 3S1XA 3EXTA 4DBDA 4POCA 3G3MA 3NG3A 2X1RA 3SY5A 2QCHA 4NVTA 4PCFA 3MHGA 4L4LA 1K8YA 3JS3A 4KFNA 3YPIA 1A5AA 2PURA 3QF0A 2Z6JA 1R2RA 3MI6A 1LBMA 5AHNA 3LTPA 1QCWA 2A6LA 3M5YA 3WJSA 2QF7A 3DFTA 5D04C 3LHYA 4AMAA 4LS1A 1OFDA 3QFEA 4HPXA 1PVNA 2LLEA 3WK1A 4NQ1A 4YCOA 2NUWA 1SW3A 3I7QA 2A4AA 3S1VA 1RPXA 3TQVA 1YADA 3NR0A 4XBKA 4MLJA 3P8JA 3QC3A 1UJPA 3M16A 3P82A 1WX0A 1BKSA 4I7VA 2H3DA 3PM6A 3U8GA 2E6AA 3LM7A 3W71A 1KBJA 3KRSA 5GVJA 1Q45A 3JRKA 2BTMA 2QDHA 3RF9A 2P0OA 3NQDA 4QM1A 5K2ZA 4WY0A 3HGJA 1KBIA 2ZRWA 1A5BA 1HO4A 3RMJA 3EX2A 2DZSA 1L6WA 1Q6QA 3NQVA 5DBTA 5CZJA 3W7KA 1MZHA 4DPPA 1OYCA 1TV5A 1NFBA 2DORA 3S0CA 3RU6A 1SO6A 1DJQA 3P61A 2Z0IA 3LI1A 4RZ6A 1LP6A 2C14A 3W7CA 3CU2A 3CB8A 2XFWA 3THQA 5BW6A 1H5YA 1JR1A 3LCHA 5G2HA 5AC7A 3DFSA 4IMEA 2ZTJA 1MO0A 1N8FA 3NQCA 5AHFA 3W76A 1UUMA 2C0AA 4IQLA 1NEYA 3IV3A 1H61A 3BK0A 1KTBA 1YXCA 1JCYA 2A85A 4H3DA 4XKYA 4WOZA 2X1SA 1J2WA 3W7LA 1P4CA 3IGSA 5F1UA 4I7WA 2A5HA 1SSGA 5BNKA 4K8EA
chains in the Genus database with same CATH superfamily
3PG8A 4Q22A 2CIPA 3I4KA 3SCRA 3F1QA 1H62A 6PTDA 1BG4A 3WMCA 1TIMA 3WH6A 1HJVA 3UCCA 1P5BA 3DHUA 1YTKA 2FFCA 1IEQA 4PUDA 3CMFA 3U2OA 3BH4A 2ZX5A 2FB3A 2WWCA 4N6FA 4HB7A 3LHWA 1J0YA 2EG6A 1DWHM 1VPQA 2QR6A 4XAFA 3IIXA 4RLIA 4CD8A 5HPCA 3H53A 4UQCA 3KOXA 2QHAA 3CTTA 4BEQA 4GVFA 1SZFA 1GUVA 3WLTA 4K7VA 5LIWX 1LOLA 3CZGA 1PIGA 4TIMA 4ZMGA 2OSXA 2ZQ0A 2FZDA 1CGXA 3C2RA 3VCNA 3VDCA 1Q7QA 3N29A 4FEZA 4ORMA 4R9XA 3GR4A 2JQXA 3TLQA 3SQLA 2OXNA 2MANA 2QCNA 2CKSA 1GEHA 2FZ8A 4GCXA 4GUGA 3E1F1 3HU7A 4TMCA 1A80A 2R1KA 4D6FA 1UD8A 1LLWA 4US6A 3NQBA 1S2VA 4O0QA 1TREA 2XGZA 3VILA 4TOQA 4GYPA 3NOYA 3NQAA 4PB3A 4FSAA 4JFTA 3TJLA 1R8LA 2REQA 1UKPA 5A6BD 1VRDA 4H19A 3JR2A 3OGSA 4E3VA 3FYPA 4AD3A 3IUHA 3VD5A 3PZUA 1RJQA 1K70A 1LG1A 5RUBA 3QV9A 2JGQA 1Q3NA 4JTRA 5IBXA 3N6HA 2WNQA 3U7BA 3GVQA 1OZMA 4IFOA 1YQ2A 3VGBA 2WSPA 4NZJA 4CQAA 2J8GA 4J2MA 3A4WA 3NQ6A 3IANA 3PJXA 1P0DA 4PTVA 5J5RA 4HKPA 2VCBA 4EXQA 1IGSA 4K8GA 4NG3A 3HG2A 3CS2A 4Z42C 3BG3A 4GQ0A 4C6OA 3K8MA 1UD2A 2E9MA 3OZPA 2ALDA 4UTIA 3FOKA 2CWXA 3DDMA 1M7PA 4U3AA 1KBLA 2VX7A 4A4AA 4F0RA 2D2GA 4ZODA 4DVOA 2NVAA 3GY1A 3NXFA 4O1AA 4QISA 3GXMA 1OABA 1J6PA 2XH7A 3WF0A 2CZDA 3WK2A 4S1FA 1M41A 3EWUA 2ZZ7A 3GDRA 2PDLA 2ZYFA 4MYXA 1H1ZA 1VENA 3CV6A 2PDUA 1OEPA 3W7JA 3W2JA 1GQNA 4IUGA 5DCBA 3WLPA 1KNWA 5FF0A 4HOWA 3TA9A 4N4PA 1MUCA 3RM9A 1N2VA 3SI9A 2C79A 5CZ0A 4QLLA 2Y7EA 1WXZA 1CGVA 4DQWA 2W61A 1E9IA 4HIBA 3LLFA 2WMIB 1BFNA 4QIUA 5LNRA 1BG9A 1Z42A 3TEVA 3CYVA 3LDVA 5A8QA 3IS4A 1RP8A 2RDWA 1TKKA 3BJFA 1X8CA 1UIPA 3VFLA 1UWIA 1J8VA 1W91A 1KFBA 2HNEA 3VI2A 1GOMA 1CWYA 3E2SA 3HTWA 1Q2RA 4HHMA 4Z2JA 2Q8LA 2GOUA 3A64A 4AX6A 2ZOXA 3WEOA 5D9NA 1OX4B 1TMLA 1Q13A 1JUKA 4M6QA 3AYRA 3A12A 3H8AA 1JAEA 1QPNA 4UUIA 3WKZA 3TW6A 4NZ4A 3HV8A 4C1LA 2IQ0A 3RFAA 3VKJA 5CEWA 1XBVA 4IIFA 1TPC1 1BHGA 4F2UA 4GABA 1VFSA 3T2OA 1RJPA 5D38A 3OYXA 3KVKA 3U0HA 3C0QA 4WJEA 1VPXA 2P10A 4XAGA 8A3HA 1W2VA 3MP5A 4TVCA 4GHRA 3WJXA 4CN4A 3UVAA 5EBUA 1LORA 1BXBA 3T44A 3VCCA 3N4EA 4ZB0A 2GUUA 4Q33A 1ZB5A 5EFDA 1B31A 3AS3A 1NH6A 2YDQA 1EIXA 3WLKX 1V0LA 4H9UA 3OGVA 1IT0A 1T8XA 5A69A 1VR6A 2B4GA 4BJHA 1BAGA 2QZRA 2CLOA 2WLYA 3LRKA 4XZIA 3W86A 4F8XA 2CZFA 1TJPA 1YXDA 4RE3A 4WDXA 3VMOA 2J7BA 1OIFA 2ZFAA 2DZTA 4M24A 3APYA 1SM9A 5FEZA 4V28A 1UC4A 4PUMA 4GVIA 4R3UA 3GO2A 4UR9A 1FCVA 1GOKA 3NVDA 1NDYA 1HZYA 4W4QA 3UXDA 3R1ZA 2ANUA 5LNVA 2VR5A 3E3HA 1E0XA 2VWTA 5IFTA 2WCGA 3AHXA 4ACZB 1ZJAA 2ODOA 3QGKC 1I2RA 5BOEA 4IM4A 3GK0A 4LYKA 1CCWB 5CPLA 3O8AA 1T40A 2ZE0A 5CPTA 2JBMA 4RV3A 2DZAA 1XIHA 3AISA 1AUSL 3N34A 2ZZ5A 4WJ8A 1M3UA 3TP4A 3B06A 1WAWA 2WC7A 4GY7A 1UZHA 1QOPA 1P0EA 1OFEA 3WLLA 1MYRA 3KRUA 2VQTA 4KCTA 1H7RA 3GYEA 3FYOA 3PBUA 1RBAA 3NZRA 1B54A 1ZS2A 3BLLA 3RDKA 3ITXA 2F38A 3SGUA 4Z1YA 1B57A 1F4AA 3VC6A 2Q01A 4IP5A 4JHMA 4W88A 2HVOA 1ELSA 1ISXA 1O5RA 4Z1CA 3AXIA 4JHOA 2J8FA 3A3WA 4JZ5A 8RUCA 4HCHA 1QFEA 1DJYA 3A4XA 1WXYA 4OHQA 1W2PA 2GGHA 3ITLA 3PR2A 3SCUA 1KFLA 2YB1A 5CC3A 5AY7A 7TIMA 2QUTA 4UTLA 1J10A 1E6RA 1PCKA 2AGTA 1Z44A 5EMLA 4N02A 3U6WA 1FWGC 4JR5A 3W1MA 2QMJA 1E15A 3NDOA 3GNXA 3UP8A 4OTKA 1KQZA 4HYRA 3S5OA 4LUSA 2V2DA 4RW3A 3ABOA 3TN3A 1V6UA 2J8TA 2OOFA 1H50A 3Q2DA 3F03K 4PMDA 3CUZA 3MPGA 4Z1BA 1IZCA 5CC5A 4AC7C 4L4PA 4UFMA 2Z27A 2DT2A 2GGEA 4BZYA 3BQ5A 1XYCA 3GAKA 3HOJA 2XH4A 2X05A 4LEFA 2C8NA 3LHVA 3QH2A 1L9WA 3GTHA 1EDTA 4X63A 1FWBC 3CV1A 3NZGA 4WZHA 4ILSA 3SSJA 3SRDA 1BGAA 3CHCA 3NQGA 3VO0A 2DIKA 4Y2WA 3ZVHB 1PE1A 3IUIA 3OU8A 1CXFA 2Q09A 3W1QA 3LOTA 2WJZA 1A5OC 2QV5A 3B3DA 2ZCGA 1TIWA 4DWSA 4GACA 3RPDA 4Z1DA 3O6YX 1IEWA 4AHOA 2VWSA 4RCXA 4EE9A 1J6OA 2QAPA 1VJSA 3SCQA 3W22A 4Z2KA 3GBEA 2Y8KA 3QGVA 1E71M 1WDDA 2QQ6A 2Y5JA 1WDPA 3R10A 3LBCA 1GVSA 1LWHA 1BD0A 1Z6KA 1BWKA 3L0KA 4WCJA 3WBWA 4Q4MA 2P76A 5KTLA 1PTDA 1UH4A 5L6UA 3FDGA 1DP0A 7REQB 4O50A 3MCNA 3BAJA 1RHCA 1WCGA 3PTDA 4Y8FA 2H3BA 4MB1A 3CLMA 1XP3A 1S1PA 4UQ9A 3L4YA 4WKFA 5H8UA 1WKDA 3QHOA 2BLEA 4P7NA 4YS1A 5CPSA 2MUCA 2BVWA 2FJUB 3ARQA 4FXJA 1WA3A 3IAPA 4GYKA 3PSWA 1V3HA 1BWLA 3SSZA 1XH1A 4TVUA 2R1LA 1SFLA 3NPXA 3W26A 3MKCA 3AMKA 4B5XA 4DZAA 2Y88A 3SY8A 4OUIA 4Q3MA 3BMWA 1VHNA 1QR7A 3QSTA 3G1SA 1EEXA 4F40A 5AHEA 3TN5A 1J11A 1SO4A 2OYLA 3GR8A 3GXPA 3RX2A 3I3DA 1QXLA 4JGDA 1HFBA 2ZA1A 2HVMA 2OMAA 4Z1AA 2ABBA 2C6QA 4AZCA 3S9YA 3KL0A 2WVSA 1VJIA 4Z08A 3LQLA 4XBJA 3S1UA 3SM0A 4LRTA 1JPHA 2V9DA 4AMCA 1NSJA 5T8GA 5I09A 2OQHA 2NX9A 2ZKMX 4D6HA 3B8TA 3NL3A 1IIHA 5I2UA 4QJ4B 4HMNA 4GGHA 4AISA 3HA1A 3VINA 2J79A 4P5UA 2X7VA 3NZ1A 2RDXA 2C1IA 1B4KA 3SN1A 1RV8A 3EWCA 5DT5A 2FGLA 2GOKA 3WUGA 3OBAA 1MXGA 1K6WA 1X1OA 2R14A 2Z1KA 4INFA 4ZVJA 5HAOA 3DIPA 1ZTVA 4O52A 3PUEA 4F9DA 1K9DA 1W9PA 2ZZ6A 5HUPA 4KEUA 2OQLA 2QJGA 1YLVA 3E2RA 3FAXA 4I9TA 4AXNA 4RE0A 2HS8A 2ZXBA 3R13A 2PDQA 2EPLX 2P53A 3WMBA 5AC8A 4G7EA 4PUJA 4L80A 3WMSA 2XSBA 4LRSA 3H23A 2WNWA 4TVDA 1UP2A 5D2VA 3LM3A 4FF7A 3EB2A 4TV5A 4MYAA 4OQVA 3ARYA 3MUAA 5DCEA 1RH9A 4C1NB 1MQRA 3BW4A 1OGGA 3ARVA 4N4QA 4WDTA 4UQBA 3LHUA 2BS9A 1WZKA 4CCCA 2VRKA 5KITA 4JIQA 3OIHA 3FXGA 4ZB2A 3ITTA 1S39A 1BRLB 1KFJA 5AHIA 1EDGA 3TQPA 1R3YA 2G96A 1UWAA 1TJ1A 3VA8A 3MUCA 2BHYA 2VZSA 5BRPA 3S42A 2IQDA 2PRHA 1NY1A 3TDFA 1V5XA 4LV9A 1NP2A 1ZALA 3ITCA 4M51A 2HE8A 4C6CA 4REQB 2XVGA 4UC5A 4ADTA 1H7PA 1F8IA 4ZSTA 3ZMRA 1TZ9A 3FX4A 3HPSA 1DKWA 4Z0JA 3OB8A 3M0JA 2NWRA 1M03A 5JBFA 3KXQA 4HQVA 4IUOA 1WOAA 4N9CA 3HG3A 5JBEA 2QCDB 4R7WA 1VYRA 1YHTA 1AH3A 3S1GA 3GHUA 2VGBA 4GQQA 1TPUA 1BKHA 3R5EA 4EPBC 2WZEA 5D32A 1OT2A 3U48A 1TV4A 4F0HA 3SO7A 5HNRA 3B8SA 3AXKA 1KLZA 1FWIC 4H7VA 2YSWA 3L9CA 2GJPA 3LCWA 3PK7A 1AJ0A 4FZIA 2XIOA 3MU7A 5HA7A 1QHZA 4XD3A 1Y5WA 4IQEA 1ZJIA 2VR2A 3I6EA 1ALDA 1UD3A 1QWKA 3W7HA 1KTNA 2HISA 1F5ZA 2WSRA 1HKJA 1LOQA 1P43A 4KCUA 3S46A 1OT1A 4IMFA 1YX1A 2FJKA 3EWDA 3QY8A 3PUOA 2V68A 5HATA 2BY0A 1M7JA 1DJGA 2B7QA 3UCQA 2PRLA 1JF6A 1M5WA 1M7XA 4A6GA 1MEWA 2H8ZA 2GWGA 2IPWA 4TX9A 2BVDA 3LPFA 2J77A 5LXEA 2TSYA 3CV2A 1QK0A 1D3HA 3ZJKA 4HHPA 3G18A 4HVXA 5AC5A 4R5EA 3GW0A 5K4XA 1FXQA 1RR2A 3FDKA 3M64A 3FVMA 2W92A 2YB4A 3F5JA 2V0TA 4PUWA 4HK5A 5JMUA 4HNVA 2VC7A 3H7VA 1MI3A 5DRIA 5K4ZA 4MAVA 2ZA3A 3EB3A 3FW6A 4IIBA 1GQIA 2VHLA 4EKJA 3GUGA 4RNFA 1H7NA 4MFDA 5CSRA 2DY3A 4RXGA 1IWPA 4BWLC 1PWMA 4UFLA 2Y6ZA 3C56A 3BPWA 5TQLA 1AJ2A 2GJXB 3B8WA 1R6WA 4LSBA 2Z6IA 2FZMA 2GGJA 3TSBA 3CXOA 3BICA 3JW7A 2J7HA 1E5NA 1W5OA 1M68A 3UJFA 4CU7A 5CKSA 2UY3A 1ZJHA 2RJHA 3O07A 3PWGA 5ABGA 4HTBA 3VD9A 1UJQA 1G1YA 1BYBA 1PDYA 3G1VA 2J6XA 2CESA 5I06A 3P80A 2VRQA 1YPFA 4QITA 1G4PA 5REQB 4JTAA 3AIWA 2HVNA 4DO4A 1UA3A 4CKQA 3DZ1A 4G7FA 4AFYA 4J3WA 2PEVA 4S23A 1F9CA 3OA5A 3ZQ9A 3BSGA 3DG7A 3ALGA 1KQYA 2GFTA 4RZ4A 4ZQNA 2VENA 3WD4A 4DIAA 4FR1A 3FJ4A 3VZZA 2ZUUA 1SJBA 3S2CA 4LAKA 4AF0B 3L12A 4OBRA 5GNZA 5BZAA 1CECA 1FVPA 3LBOA 3V18A 3MY9A 3VMNA 4WDWA 3VGHA 1CYGA 6TAAA 1GOQA 4IP4A 5HQEA 5AVNA 1XIIA 2PWHA 3DG6A 5ECUA 2Y4SA 1EYEA 1CENA 1LBFA 1NFGA 1JCJA 4OECA 3S9IA 2YCIX 5HJYA 4MGGA 2ZXAA 1NM9A 1W3HA 4FNQA 3E0LA 4PEEA 3C2VA 1H7OA 3EYPA 4I5UA 1JVNA 2B31A 1ZENA 1PV8A 4LANA 5DXXA 1WBHA 4ZQMA 4FX6M 2VC9A 4RDYA 2QCFA 4JDBA 4P8WA 3EDJA 5AZ1A 4UTKA 3BJSA 4XSLA 4GH1A 2GQAA 3NDYA 3ARXA 1LF1A 1SO5A 1XLIA 1KGUA 2XH2A 3DFYA 3TYEA 3NL2A 3WQPA 3V3WA 4LYPA 2UBPC 4BEUA 3WD3A 4LJ3A 2RHGA 1LT8A 4ZE5A 4CLMA 4CCEA 1G6CA 2QW5A 4LWWA 3WBEA 1XLCA 2A3EA 2PF8A 3CPUA 2E7FA 2WOQA 4KS0A 1LCOA 4JQ3A 4Q6JA 1DIOA 5I0DA 5A8PA 5DANA 3ZR4A 2AL1A 3PANA 4LUIA 1NTHA 3W87A 1OC6A 3ONCA 3UZJA 4IXXA 1RCXB 1TV7A 3G1AA 1AZ2A 2VNCA 3CEPA 3L65A 4YN5A 1ISZA 4KRTA 4RJEA 3O6DA 3K4AA 1N8WA 2PTYA 4S38A 3OLDA 2BG5A 3OBKA 2MNRA 4QG8A 4FB7A 4O1DA 3CPGA 4HHHA 1PZ3A 2EGZA 3BOLA 1TX2A 1U5JA 3PF3A 1OVDA 4IGMA 2V3FA 1TG7A 1KM4A 5HR6A 1EX1A 1VYPX 2QXWA 4FNSA 3T0TA 3WBXA 1ZCOA 3UG4A 3ARSA 3BW2A 1E51A 1ZAIA 3KRBA 5LA1A 2D2JA 3FS2A 3TJ4A 1W1YA 3O9NA 4H83A 4GNJA 3BO9A 1PIIA 1EO5A 3N3TA 3ENLA 4IMAA 1RPKA 2H9AB 3BTNA 4AIBA 4E8DA 4JY9A 5CPMA 1VCVA 5CPNA 1KRMA 4DRSA 3BDKA 3NJ3A 5EFFA 1VHCA 2PDBA 1ME9A 2BASA 4AZBA 3ARWA 3H7UA 4HSOA 3G77A 2WVTA 1DQWA 3CL6A 1K8ZA 2OCZA 4LS2A 4YVXA 2ZIDA 1K3UA 1WP6A 4W8BA 3WH7A 1Q63A 2NVCA 1PKMA 3A4JA 3OGRA 1KR0A 2ZRVA 4H6QA 3R8RA 1HKVA 1QJWA 4F79A 3LSBA 3BQ6A 2YBVA 1OF6A 4B9ZA 1NDVA 1IGWA 1ZBCA 4FIRA 4QJ5B 4YTRA 3KM8A 3CZLA 3MHUA 1PX8A 1LQ0A 3WL0A 1UP0A 3H2MA 3PZTA 4PUUA 5D09A 4RKAA 3TZNA 1F6KA 2R6OA 4J27A 5CPOA 3RLGA 3QZ6A 5IOBA 4O1EA 4NUWA 3L5LA 4DF2A 1K4HA 2B0MA 3GYCA 1E4LA 1XLGA 4L1XA 2VCCA 3UR5A 3ZJ7A 3G8RA 1SUXA 3URNA 1J18A 3WK3A 3BUVA 3PZOA 1XIEA 2PBOA 2X0SA 5E5CA 2YXGA 4B3ZA 3SQSA 3PZQA 5M5DA 2C1HA 4FALA 2A3AA 2O9TA 1M9HA 1DYSA 4PMZA 1A5CA 5A8GA 3QSRA 1W54A 4KGJA 4KT2A 4FHAA 1DJXA 5C71A 1ONEA 4ZO7A 5IDIA 2PE4A 2CZ5A 2C16A 4GI4A 3GB6A 4O54A 2QJNA 3MKKA 1RK5A 4JICA 3V4BA 5C55A 4J3ZA 4GNKB 4L65A 2E8ZA 3CPRA 3F4WA 3R2GA 3ZT7A 5K9DA 4N7QA 1UP3A 3DUGA 2YDAA 4RNIA 2W6RA 4D6GA 4HJWA 2EPHA 3LPGA 3B9EA 4PRWA 4EPDC 3CZKA 5FEWA 2YCEA 3QGAC 3RX3A 4MMWA 5FCZA 4LGXA 2JK2A 4JTLA 1X1ZA 2PP3A 1WDWA 3EOUA 3TTYA 4IIEA 1RBOB 1LLZA 2VGFA 2WK2A 1REQB 3BMXA 4J5NA 3TNBA 1SFTA 4UZSA 3QMTA 3UWWA 4A8NA 5ABFA 3IVSA 4MM1A 1TSIA 4WY0F 3TQKA 2V3DA 5HDRA 3EX4A 1R87A 1B3XA 3LV6A 4DAFA 4YVVA 1DHKA 3AUOA 3IACA 1JEZA 3W1AA 4AY7A 2HMCA 3R8HA 1S2TA 3IJ6A 3D3FA 5C9RA 3TLLA 3UERA 4PUNA 4NAFB 1C7SA 1OD8A 3C3UA 3VD3A 3UPBA 1GHSA 4GJ1A 3UBPC 3IWPA 3N13A 5KETA 1RZMA 3VOCA 3MI3A 5DCDA 3W7EA 6CGTA 2ZC8A 3EGJA 5AKQA 1W31A 4AUBA 2POTA 3NYZA 1K9EA 3FVDA 1KGXA 3QPZA 3MMDA 2XG9A 2ZRZA 3G3DA 5LHEA 4I3GA 2AL2A 4IX0A 4M6PA 3R79A 2Z26A 1BWVA 2CLKA 4B5NA 4W8AA 1GYLA 3RCMA 2RAGA 1TE1A 3UZXA 4BR1A 3Q58A 1ZBKA 4BF9A 2R82A 4QSFA 1L2QA 4Q8WA 4XBSA 5K3VA 5JH1A 5DX7A 1GT8A 1S2CA 1XKYA 3KDNA 4NL1A 4Q4SA 3GFYA 1ISVA 1O95A 1KKOA 3WUBA 2IPJA 1PYMA 2EAWA 4EWND 2GK1A 3AHTA 3W23A 3W1RA 1DEDA 3F2CA 1CIUA 1ICPA 2OU4A 1X1NA 4UCGA 3G0XA 4GUFA 4W7WA 4DJDD 1TQXA 2FHFA 2VZOA 3WO8A 1R46A 3PZVA 3UXKA 4M1BA 4XIAA 4BF7A 4HCDA 2G3NA 3GWQA 4H41A 3T81A 1KM1A 4KFPA 1XI3A 3M0MA 2UY5A 4GI8A 3EX6A 3PB2A 3TFXA 4CCDA 2QPSA 2BXZA 5SWUA 4XX6A 3C5QA 3PNZA 3CUJA 3GG0A 1NOFA 4DJEC 5C2CA 4LAZA 4NNBA 1XYMA 1AQMA 1XR2A 3DKLA 4IGNA 2HJPA 3B40A 3FSUA 2DPEA 2PLMA 4S3KA 1Z7AA 3NG3A 1DIDA 3SY5A 4EXBA 2J74A 3VDGA 3SRFA 4Y9PA 3DG3A 3PZIA 4W5UA 3YPIA 4FA3A 2DQXA 1JYWA 4HPNA 4ATWA 2Z6JA 5AHNA 2PDIA 3LTPA 2VZTA 3M5YA 3WJSA 5T9BG 4ZOCA 3DFTA 3RYSA 4E2VA 3TCSA 3QFEA 4HPXA 1PVNA 5C2GA 3WK1A 1GYMA 5DMNA 2NUWA 3UW6A 3MCMA 3IJLA 3S2LA 1EIBA 1W3LA 4A3QA 1RPXA 3TQVA 4PMOA 4XBKA 4MLJA 4WEVX 3GHRA 3M16A 4HZ7A 4DXKA 4JL1A 3U8GA 2E6AA 1Y5VA 1B3VA 3UPMA 2EQDA 3KTXA 1UH3A 1KBJA 1O68A 1LL7A 2WAGA 1P7TB 2I5IA 4WKHA 4MNJA 5C9WA 5JVLA 1JPIA 4ZO6A 1FWDC 1A5BA 3RMJA 3EX2A 1G94A 2PP0A 2DZSA 1L6WA 5CZJA 3SJNA 3QV8A 3W7KA 1TV5A 1K6AA 1H1NA 4YU1A 3WLJA 2V69A 5H1WA 2C14A 5IHSA 3W24A 3UETA 3W7CA 2IKIA 3CU2A 1XRSA 3THQA 1XYBA 3TOPA 1H5YA 2PDFA 1GJUA 5AC4A 4IMEA 2FTYA 1N8FA 3NQCA 5AHFA 3W76A 4CVWA 4GPNA 4IQLA 4OOUA 4OUEA 1OGSA 1POKA 1TWDA 1YXCA 1DWGM 4XKYA 2X1SA 3G1RA 4F2TA 3IGSA 3QXBA 1SSGA 4LNYA 1E3ZA 3KWXA 4HOZA 4WR3A 2E40A 3LRLA 3LCLA 3BOXA 4B15A 1V3IA 3GS6A 4K2SA 2QCEA 1V6VA 5IM51 3N2CA 1XYFA 4ZFMA 3N4AA 1J79A 3VPLA 3QTGA 3LYEA 1G01A 5JIWA 4JHZA 3WQ8A 3I6TA 4AVOA 5DY2A 4MB3A 3PUGA 3FLUA 1AA1B 1OX6A 3F4VA 2BZNA 2Y61A 2PGRA 2NUXA 1FWTA 2VEGA 2O56A 3FEMA 4FOKA 1QMLA 3GVRA 3RNDA 3W3OA 4XAZA 3UD6A 3F5LA 1KGWA 2WC4A 1FHUA 2YJQA 1TR9A 5I00A 5E1QA 4ENLA 3BANA 3F4DA 1Q6RA 3A3XA 3VD4A 2OJPA 4N42A 1C91A 1B9ZA 2XHYA 3ANYA 3AU6A 4N9BA 2BY3A 1ZSXA 2Y89A 1QDSA 1Q2SA 4LBUA 5I24A 4HZMA 2A6NA 4YTUA 1ZJBA 4YXGA 2PWFA 4NNAA 3QKEA 4DB7A 4UFKA 5C8BB 3MSRA 2GJRA 3APGA 3BZJA 1DV7A 1AW5A 4ZOEA 3LU2A 5C0QA 1H49A 2RDUA 1M01A 5MHBA 3E0FA 3VUPA 4PCPA 2RGMA 3LD5A 3UR2A 3VKKA 1BSLA 4UQEA 4HU3A 1B0IA 1BYCA 2QCLA 4C6FA 2WPBA 3Q94A 2D3NA 3ORWA 1YBQA 5I3KA 2FDSA 2YKKA 4LFYA 3G6MA 5HWJA 3RITA 3NM3A 5D03A 1W3JA 2BOEX 3SUSA 3L2LA 2FZBA 2GVEA 1GVQA 3TSMA 1R2TA 1MRQA 3XIMA 1EA0A 1W37A 1AQHA 1TVLA 4B5TA 1I4NA 1EGVA 1GCYA 1XD0A 1THFD 2WQDA 1EH9A 3HQPA 4KGLA 1IEXA 1JCMP 4NRRA 2QKFA 5A6SA 1OY0A 2YA1A 3G0SA 4JPGA 2EPKX 3U2EA 3NVTA 1OYBA 3TTOA 4UTUA 4AZIA 1V6XA 1TCMA 3DYOA 3PC0A 1X6LA 2GSJA 5FAGA 3J7HA 2VOTA 2R91A 2C3ZA 2OTDA 2YBUA 1EXPA 3S6TA 3M6DA 3L4UA 3AZTA 1FH8A 2W63A 1K4GA 2G3FA 3PS7A 2V67A 3GNRA 5CG0A 4PULA 3GM8A 4S3BA 1UKSA 1VJZA 4JYEA 4ZSUA 4Z2LA 1JNDA 2A7PA 3EA2A 3N9SA 1YNPA 1R7AA 5TF0A 1JPMA 3GFXA 3MBFA 4DUWA 4BI7A 1QNRA 1DWIM 1F76A 1EP3A 2C1GA 4R27A 4IFKA 1UASA 2PWVA 2ZX9A 2ISDA 4GK8A 1UIOA 2DFAA 3RM4A 1N7KA 2E6DA 1BF6A 3M6YA 1W1VA 1LROA 4XO6A 3G2GA 4K68A 2GVGA 1PEZA 3RPMA 3TYAA 3ZSTA 2E68A 2TRSA 5A2BA 4K1GA 4XD6A 3VUSA 4S3EA 4P2VA 4R33A 3U3HA 2F9RA 3SFKA 3DFHA 1VQTA 2OLSA 3GE7A 2AMGA 4P8UA 4AD5A 2W79A 4P7LA 2NT1A 4QE5A 3WMLA 3SURA 1KWGA 3SCPA 4O0ZA 1UMYA 2D0HA 3MB9A 4OJYA 2FZ9A 1OF8A 1GPFA 3UYCA 4JTJA 5G5IA 1YPXA 3EOSA 1YKWA 4JOMA 4NJGA 4TUFA 4B3LA 4CU8A 1NQ6A 4MWAB 2GUBA 3GH5A 3C8NA 1IV8A 3M1ZA 3CMJA 2HZGA 1CXEA 1EGZA 1YIXA 2JFEX 4FXFA 1R7OA 4JTIA 3OJGA 3QYSA 5BWAA 4HU4A 3OVPA 1XLAA 2J9YA 4XD4A 3AWNA 1CEOA 1GOOA 4Q7NA 3T8LA 2NX1A 2XWDA 4YWSA 3L4ZA 3T4CA 3VD7A 4E2DA 4UR7A 5CGMA 3FA5A 4CEXC 1AL8A 1BVNP 3QY7A 7A3HA 4Q4PA 4R7OA 3UT0A 1S2UA 3RK8A 5CZSA 5HWNA 1FKXA 5F2IA 1N55A 2E9BA 3BVJA 2J88A 4PL1A 3DGBA 1V7YA 2V5JA 1FRBA 2AAAA 1R2SA 3TYDA 4FMVA 3RXZA 2ZRXA 3N2MA 1F2JA 3OLGA 3QLDA 3MWAA 3AYVA 5LSMA 1W5MA 3GVWA 1JD7A 1FP8A 5KZEA 3VFCA 1M7OA 4GKTA 2OZ0A 4DXXA 3CAKA 1E6PA 4MJMA 1HUVA 4KQNA 3FJLA 4H9VA 2YR1A 1ZP4A 2F61A 2VYOA 1AD1A 4D1IA 3BCJA 3I7SA 4MJ4A 3HMJG 1XJBA 3R11A 3AZSA 3CIVA 5FKYA 2VC6A 4C7DA 3WEMA 1FCQA 2P5NA 4I5RA 1P6WA 1XL9A 4PR4A 3LMYA 3GX9A 3OBEA 4X60A 4TQTA 1A0CA 3LPPA 4A8LA 2FIQA 5E70A 4JFUA 1UG6A 1XUZA 2V5DA 5A5WA 3NUKA 4W9TA 1PL9A 4DF1A 4AB4A 1FX6A 1KB3A 3JVAA 5FF7A 1DPMA 2BHZA 3G1HA 3S2JA 3RM8A 4M80A 4DYKA 1W32A 2R1MA 2X16A 1OGBA 2DUXA 5EYWA 4WGHA 5DBUA 1CTNA 2PU1A 3VIKA 4GKLA 4GD0A 2Y1HA 2WLZA 5I03A 4S3FA 2FTPA 1ONRA 1WZAA 4W87A 3ALFA 1IF2A 4DLMA 4A22A 1FHVA 5U7SA 3OZMA 2DW6A 3E0WA 3QV6A 3GLCA 1VLIA 4A3UA 4AW7A 1UC5A 4KETA 3GNOA 1E1CA 2IPFA 2IS7A 4R88A 3AJ7A 2V30A 4MWAD 2XYLA 5EMUA 3F7JA 1YDNA 1UOZA 2G0WA 4G5DA 1CLKA 4US5A 2VGIA 1Q4NX 3N14A 3T0BA 3IIOA 3GW3A 4L9ZA 1JIBA 3EX3A 4GISA 1EWDA 2HPMA 2VEMA 2JF7A 4TTGA 1XFBA 2JKPA 3BLFA 3EKZA 3PBYA 3II1A 1IEIA 4UFJA 2IKJA 2QCMA 2OLAA 1BGGA 1GONA 5FJPA 4L5ZA 2OB3A 2YDSA 3SBFA 3MJYA 4HPJA 1TUXA 3GHTA 3UYIA 1PZ2A 1RUSA 4MNLA 4JN8A 5B7ZA 4RE4A 1AQFA 1SMDA 5I6SA 4CD5A 1PHWA 3V0TA 1LUCA 4LVGA 4DI9A 4NXKA 5HNUA 4XZWA 5D9MA 3TKFA 3WCZA 5CSUA 1L6FA 1PUDA 3VABA 3E5PA 1JDDA 1TWSA 4QX4A 4EPKA 4G8TA 3L23A 3MCOA 4XKMA 5FJJA 3T2PA 5J04A 5TAOA 4AAJA 3LERA 5BXSA 3W1XA 2RJGA 3TTQA 4V15A 4NYUA 4J3XA 3KP0A 3AS2A 4MF4A 3N4FA 4FO4A 4LB3A 4X3ZA 5CLTA 4EACA 1T7LA 3IPWA 2Y5SA 2WCAA 1ZGDA 4X9SA 3D3AA 4P7OA 1BXNA 1O6IA 3LNPA 3VXGA 1Y7VA 3BV4A 3CHVA 3AWOA 3GDLA 4JN6A 3BLEA 3LHTA 2WV8A 3BZGA 5DF0A 1XS2A 4B90A 1FWHC 3AMLA 1XHGA 3W7DA 4JX4A 2QAFA 2EBNA 3VU2A 2DP3A 3GG8A 1A49A 1MXSA 3OP2A 1WE5A 3RG6A 3VKDA 1GQLA 4NZ1A 5FJIA 3FKKA 3QV7A 1XLKA 3N2TA 3AHYA 3C86A 2OPJA 4H8VA 4GUHA 3T2QA 3L2IA 3C0JA 4ZCWA 3B8IA 4PSPA 3LK6A 3W70A 1RXOB 4B91A 4L61A 4K37A 3IJDA 4XSMA 1ENUA 1IZJA 2WVUA 1PHQA 2P50A 3I68A 3QYQA 4KPLA 1D8CA 4NILA 1V3MA 3N73A 3QHMA 1LWIA 4O1CA 3IGHX 3T0AA 3AIQA 3FJ6A 1ODZA 4QCEA 2GLKA 3DECA 1J12A 4C90A 5I23A 3SUVA 1A3WA 5CG7A 4QLKA 4RUBA 3F2BA 3WQCA 1XIGA 4Y90A 1JCLA 1KFEA 4GX8A 3PTQA 3C0SA 1AODA 3W7MA 4X0NA 2WSYA 5FA5A 4GQRA 1KWKA 1IR1A 2PDNA 4KERA 2DUAA 3PFMA 3I6RA 1XX1A 3GXTA 1JF5A 1K8XA 3DBPA 3W29A 4DI8A 4ZOBA 1WKFA 2CHRA 3BLOA 3W7NA 1BLIA 4F66A 2XPKA 4I6VA 3NO5A 1H41A 3W7GA 3V16A 1FKWA 4C1KA 3EMZA 2QMKA 4D8LA 1I0BA 3WD1A 3AYTA 2Z29A 5CBJA 2C18A 4I8YA 4DJFC 3CUXA 1HVQA 1JRBA 1AW2A 4GIEA 1LQ2A 1UKQA 3IJ8A 3W9ZA 1LL4A 1TMHA 4EK7A 2ON3A 3UF9A 3QZEA 1G7VA 2OT0A 3UJ2A 4O53A 1VLWA 2Z7GA 3FCPA 3IK2A 3TNOA 2ISFA 1EGMA 1GZGA 3WG6A 2WNNA 2FH8A 1ZU8A 2VP8A 3O15A 2INFA 4U31A 3DENA 1EJ7L 4D8ZA 4GI6A 1US2A 3EPNA 1NFPA 3RIKA 3WQOA 1QUMA 1V0MA 2UWFA 5I77A 4JL2A 4IHCA 4WLCA 3S9ZA 4AWUA 4XV0A 3NQ8A 4KWSA 4GQBA 4Q8VA 4S2BA 1Q6GA 3AROA 3OYZA 1JZ2A 1ME8A 4FF5A 4O11A 4UZUA 3HJZA 4ZENA 4I7UA 2VEIA 3W1TA 4H2CA 5CGQA 3TTSA 1LDCA 1UZDA 1N82A 1N8IA 3B04A 2VEKA 3VKBA 1XXXA 3SUUA 1OFQA 3T78A 3CIWA 3SB0A 2XSXA 2ZUVA 3W1UA 3M9YA 3PPFA 3EDEA 1CGUA 4XUGA 1EHNA 4LC8A 1I2NA 3G1DA 3GU9A 3V1PA 3DYPA 4IG2B 5AYYA 2G41A 3P74A 5LA2A 2YPIA 4RDVA 2ZA2A 5C5YA 1F05A 4UTFA 1R9XA 5L9FA 4O4WA 4MUPA 3BCDA 2Z2UA 1VYSX 4ORIA 4S3AA 2CLFA 1DORA 4AD0A 4XZBA 1LT7A 1FDJA 1MSSA 4NU7A 2XDFA 4DYEA 3A21A 4V33A 3E12A 1L8PA 1RLCL 4HJFA 4XO7A 4L9YA 2BFGA 2J9XA 1WDRA 3CM4A 3H2CA 3T07A 5D2YA 4GBUA 4DNMA 1XG3A 4RL3A 3KOFA 3PUDA 1ADOA 2YGYA 2GVJA 3L5AA 5FL1A 5LIUX 3QY6A 2Y85A 3L4VA 4PMNA 3NQEA 3P62A 5C6MA 1YNYA 5JBDA 4GY0A 2Y8UA 1W3TA 5LHFA 2DH3A 3UNDA 3DFPA 4XAYA 3E6EA 4OOZA 1MVYA 4YCPA 3E5BA 1JYNA 1VFTA 4RK8A 5I3DA 2DVXA 1NIUA 2NQZA 1EUNA 1ZPTA 5LIYX 4CNPA 4U2ZA 3UWZA 3QVQA 2VD8A 5CC7A 5XINA 1SFSA 2BNJA 1W3KA 4IMGA 1A3XA 1TJ0A 2EPOA 1QVBA 1S5WA 4PMJA 3PTKA 1GOWA 4E4PA 4IFRA 4YHEA 4F0LA 1EP2A 4JQ2A 2HXTA 3TV8A 2XN2A 4NXSA 2PZ0A 1GKQA 1Q8JA 2YL9A 2NLYA 4PH6A 4LCSA 4ZOAA 2ADAA 1KCXA 2FFIA 5IBXC 3QW4B 2CETA 4TR9A 5F2LA 4FLQA 1ZL1A 1Q6EA 2JF6A 1WB0A 4BI5A 3K46A 3P5YA 3V1HA 4AEFA 4E2BA 4O18A 3CT7A 1AD4A 1NF0A 4F48A 4GZJA 1XIBA 1PZ1A 2XGBA 5AN7A 1IYXA 4C6EA 3E38A 1A47A 4C5ZA 5JU6A 2DH2A 4ICNA 4BQ4A 4QCFA 4HU8A 1W56A 4MNMA 2A1YA 2D69A 1D7FA 3CTLA 4M8UA 2WC3A 5I3IA 1A5KC 4O16A 3REQB 3M5ZA 3HFTA 2ISWA 1V08A 1YXYA 4KEMA 1X6NA 3NPWA 3EEZA 5JH2A 3VK5A 3MA8A 3RO8A 1HO1A 5FJTA 3APTA 3NIYA 3H2EA 1K9TA 3UGVA 4ZL1A 3KZSA 3W02A 4GVGA 3Q65A 4GBDA 1EO7A 1XBXA 2UV8G 1AH0A 1TA3A 3ARTA 4G1NA 3TA6A 2B7PA 4RZBA 4PC8A 2DT3A 3ABQA 3UPWA 5GJPA 3STEA 2VDIA 3W7RA 2EPMX 3ECQA 3UWEA 1TTIA 4GCAA 4GZ7A 4O28A 3A6OA 1WUEA 3TE9A 2DSKA 1JI2A 1HGYA 4ZO9A 4L64A 1JQXA 4OBTA 3WH9A 1TX0A 5AYZA 5HNTA 1V02A 3M7WA 3V7PA 3ARUA 5DMMA 1XKJA 3GDKA 4M19A 2I9UA 2VM8A 1AMKA 1DWFM 2D3LA 2W27A 3VM5A 3NOEA 2YCLB 4NP7A 3RU8X 4HNTA 3OO2A 4LT9A 3T0CA 3NURA 4JFWA 3K8LA 3MANA 3C8FA 3AS1A 3NXLA 2BX7A 3B03A 5FAJA 3CZEA 2ZVIA 5DXYA 3UA3A 2OWWA 2ZDRA 3EDFA 4ICMA 3R58A 2QDDA 4PCSA 1FHLA 3VIMA 2XIJA 1O7AA 5G1TA 3H24A 2X0HA 2I17A 1OZQA 1O94A 7TAAA 1R9ZA 3M4HA 5A8MA 2NV1A 2R9RA 3WQVA 3BG9A 2DZVA 3TW9A 3K1GA 2CZEA 2PDGA 3VYLA 4KRZA 5F1VA 4JFVA 1JZ5A 4AU0A 3UG8A 3MO4A 1XF0A 1OK6A 2NZLA 3B4UA 2YDRA 5A6LA 4N2YA 3KBWA 1HXJA 1XGDA 1DL3A 4KWOA 4QQUA 2XVPA 1A5NC 1B5TA 4A05A 2JIWA 1BTMA 4MWAE 3ABSA 1E0TA 4KCVA 3IAQA 4DHGA 4E4FA 1JDAA 4B4HA 5M2FX 3MT1A 1PX4A 4LX4A 1FOBA 4DM1A 3PBVA 5IFPA 1JUBA 1KM3A 4OU1A 3OVQA 1EWEA 1FWJC 3CT2A 4WQ6A 1KXHA 4RDWA 2W91A 1VS1A 1LM1A 2FVKA 4J3UA 1XYAA 3VZYA 2BOFX 2NXHA 3RN6A 1GVOA 1R30A 4J4KA 2YL8A 2CWNA 4IIDA 2PA6A 3VE7A 3UR8A 5I3FA 1V6WA 3L4XA 1U1JA 3IUDA 4UTTA 3UGRA 4GIYA 1U5VA 3N04A 2Y7DA 3K13A 1OB0A 3L5MA 2VZVA 3P84A 3MUIA 2XIMA 3P0XA 3HG4A 1NOUA 3KUMA 1OC7A 2PC4A 3URQA 3CHFA 2BVTA 3KCOA 2CLPA 4JTGA 4IL2A 2E6FA 1P6BA 1IR2A 5CSYA 3DU0A 1CZ1A 3SN4A 1XIDA 4LUTA 2DU2A 2PDPA 3DHPA 3IVUA 4GLEA 2QYGA 2NQ9A 4L9XA 4GH3A 1B3ZA 3WJYA 2VZUA 3G8EA 4NSBA 5H6HA 1EA9C 1S3HA 3NPVA 4JCMA 2QPUA 1GQKA 1S46A 1HP4A 3WDJA 2J27A 2YIHA 4GVHA 5JUVA 2PDMA 4E8CA 4W8LA 2X2GA 4F0KA 1B3YA 3CQHA 1VBGA 2VEPA 3TONA 2W9MA 3VM7A 2OO6A 1GTEA 3A5FA 1OWQA 3W07A 4Q6XA 4B2DA 1XRVA 3VKCA 1DOSA 2CPUA 4IJCA 3ITGA 5HMFA 4S3CA 1FDYA 3TROA 1P1XA 1S5MA 3VNMA 3B0YA 2OLHA 4B5WA 1WQ5A 3CQ0A 3R7MA 3W1PA 3EWZA 4DELA 3TC3A 4Q7BA 3P6LA 3CIXA 1NWTA 3MDWA 1V8EA 4NX5A 3T09A 1YPIA 4LPCA 4U4MA 1XQLA 2B7OA 2NQ5A 5LNSA 4HP5A 4H9XA 3AALA 3QTPA 3ZSSA 2EG8A 4MB5A 4MLRA 4HYWA 4RE2A 2ZRYA 1D3GA 1E0VA 2J6VA 2CXGA 5DN1A 3USBA 2VRJA 3ZIZA 4JD4A 2A7RA 4NAEB 1OX5A 1CB7B 3VNKA 4IZGA 1KRCC 4YTTA 3NQFA 4HA1A 3D0CA 4JDYA 5LYRA 1R3TA 3PZGA 5CJ5A 3JUGA 2R1PA 3TR9A 1SO3A 3ISIX 2Y7FA 5AHLA 1KCKA 2QV4A 1CPUA 3H2OA 2OSYA 4ZQCA 1TTQA 1AG1O 1WYIA 2XUCA 5JIPA 2ZZ2A 4WY0B 1KBKA 3VIOA 3MV11 4AQLA 1C8QA 3FNDA 2YLLA 3P93A 1V51A 4Y96A 3EKLA 2Q6ZA 1B30A 3M0KA 1R3VA 1XCWA 3VGEA 4O12A 2XIIA 1WBJA 2FPTA 4MKSA 4R9OA 3NQMA 2BY2A 2J24A 3HB9A 3H2NA 1ITXA 3VNDA 3W7OA 1S5NA 2HTMA 4GFIA 3QEZA 1BVZA 2WHLA 1ZAJA 3MUXA 3N17A 4RNJA 3CGTA 2OQYA 1GW9A 5GQBA 1U1HA 5HJXA 3QOKA 4K7YA 4GYFA 2HRWA 4KIRA 5DELA 1E6QM 4DN1A 4F3HA 6XIAA 1A3HA 4DM2A 3CHDA 3U57A 1HL2A 3W0KA 4FS9A 2Z1XA 4ERIA 2PWUA 2WMKA 4QDWA 1MEIA 1K7EA 1QNPA 1E56A 4A3HA 3GTXA 4ASTA 4NIRA 1AFSA 2PWDA 1XM3A 2FQIA 1XC4A 5FEPA 2L5HA 1XDJA 2CZVA 3ANVA 3WQWA 4Z2IA 3TUUA 4ZTYA 4KRUA 3O1NA 1EBGA 5DFAA 2Z4GA 4P7QA 4UR8A 4NHVA 4Y9NA 3QR3A 3MVTA 3SCSA 2Y62A 1OG0A 2QGYA 5EKYA 3DI1A 1XWYA 1U5HA 4KBXA 3NQ7A 4M1RA 3KBJA 3H7RA 5I3HA 4W84A 1KO0A 2C0HA 2PUZA 1E6SM 3TC7A 1DIKA 3K30A 5E09A 4E2OA 2BB0A 2GSHA 4POCA 2OSWA 1UKTA 1EQCA 1R0MA 2QIIA 4X61A 4H7CA 3SIMA 2J62A 4QE4A 5FIPA 1EZ2A 1K8YA 4J40A 3JS3A 4MNKA 5ENLA 3S6OA 3R43A 1LBMA 1EJUC 2REQB 1QCWA 1A0EA 1KXVA 4PSRA 2QF7A 4DJFD 2YXXA 4LH8A 1QNSA 4PTMA 3I7QA 1WZMA 3NTYA 3A9BA 2A4AA 1YADA 2PWEA 1UJPA 3B9AA 2E3ZA 2H3DA 5DT7A 3PM6A 7PTDA 3LM7A 2HROA 3W71A 4J3TA 4QS6A 3GNPA 3JRKA 1PX3A 3RF9A 4QM1A 1PAMA 3QR0A 3RLHA 3BC9A 4HK7A 1HO4A 5LA0A 1CNVA 1ECQA 1JPDX 1Q7MA 3EAUA 2ZWYA 5DBTA 4Q4QA 1EZWA 1OYCA 1XCXA 4IGSA 3CQKA 2QUMA 1DJQA 1NWSA 5HBFA 4WVXA 3P61A 4DO7A 2O55A 3LA4A 3LI1A 2WM1A 2XZ7A 3TJIA 1LP6A 2D1ZA 4C6MA 1W6TA 3AIEA 3RPTA 3GZAA 3SEPA 1DJZA 1JR1A 2YL5A 2AMXA 3DFSA 1MO0A 4ZO8A 1J0KA 3DCPA 1NEYA 1H61A 6REQA 1EPVA 3NZQA 2F6XA 4V1YA 4H3DA 4WOZA 2G37A 2Y2WA 4W93A 2A5HA 4Y7EA 5BNKA 4EOUA 2BV9A 3VX1A 1VFOA 3GC2A 3KRZA 2GL5A 3FGCA 4UMAA 3MBDA 2D24A 1Z9AA 2CYGA 3Q4DA 4OWGA 5ABTA 3V5FA 1LRTA 3HF3A 4NZFA 4O19A 2QJHA 2I57A 2DQWA 1DJWA 4KFOA 2OZ8A 3WNNA 3KVMA 4ML9A 2UY4A 1YNQA 3QZAA 3MSGA 4KESA 5I07A 5A8NA 5BXRA 2W3ZA 3ES7A 4PA8A 1LL6A 5CCZA 1VF8A 1GNXA 4UOZA 4AHPA 3BXWA 2XJ7A 2GSEA 1UMLA 2PPGA 3DFOA 2DW7A 1FWRA 1PCWA 2KZHA 1HVXA 1A5MC 4DBEA 2E09A 1ZUAX 4F9JA 2J78A 2GZXA 3AXHA 4MJ2A 1SMAA 4MOZA 2DGAA 3GDBA 3R0DA 4KWUA 2P88A 4JX6A 2BDQA 4W85A 4IGHA 1EOMA 2WVVA 1ZZMA 4HPHA 2GJNA 4DNHA 4N0RA 5BU9A 2Z25A 5MKGA 3RLVA 4AVNA 3AHZA 3DOPA 5M03A 2X2YA 2V2HA 9XIAA 1W1PA 3G0UA 3VAVA 5GNXA 3M5VA 3M5XA 2P0IA 5G2IA 1OBAA 5D37A 4HMDA 1MDRA 4Q8NA 4QRNA 4JXCA 4ZTXA 4UMBA 3XISA 4EANA 1OCQA 4PFMA 2Z1SA 5HMDA 4DJDC 3DGRA 1GG1A 5FD0A 4H6EA 2F2KA 1EX5A 1B4EA 2WKJA 1G69A 2WBKA 3R25A 5GJNA 1F74A 2AOSA 4MZ8A 2WWDA 2OZTA 4UNIA 1QATA 4F0MA 4MG4A 3CJPA 3UWYA 4FX8A 5D2WA 4O17A 5AYXA 9XIMA 1TRDA 5HXMA 2FKPA 3KX6A 1FWNA 2E5CA 3CUHA 2VEFA 4Z17A 5FL0A 3SFWA 2ATSA 1V7AA 3AIBA 3EA1A 3A4AA 4GINA 3QLLA 3B9OA 3HGSA 3W82A 1E55A 1LJYA 3LEPA 4C6IA 1RVKA 3AZRA 3PB0A 3O63A 4YIWA 1V03A 1O66A 1QPQA 3G1FA 2TPSA 4QXIA 2YBTA 2CCRA 1CXKA 3OQ8A 2J9ZA 4AIOA 1K8CA 3HPAA 5E6YA 5D30A 4KEVA 4D71A 3DYMA 1IE7C 3LUTA 3SAZA 4YTSA 4ZXOA 5C2XA 2J7EA 2QCGA 1PJ9A 5K9CA 1TV8A 4QG9A 4ADSA 4GUJA 2NSXA 1OFRA 3UQNA 2V5CA 3THCA 4Z2HA 3DX5A 3KTSA 1KXQA 3CK5A 3KBSA 3KEHA 4UB9A 1Z89A 4WGXA 3BOFA 4BI6A 5T26A 4Q8MA 1MRAA 3C2FA 2XVKA 1C9DA 4H9TA 3EX1A 1HKMA 1CT5A 3UG5A 2NT0A 2BHUA 3THAA 1XIFA 3BAIA 2G3JA 3NGFA 2CBIA 4FOUA 4RW5A 3T08A 1FFQA 2WYSA 3CLWA 3QQ1A 1QBAA 4LXFA 1X7IA 5I78A 2OVLA 3L0NA 1GYNA 2GWNA 2YW3A 3B8UA 4PBGA 2FVLA 1LOSA 3N3MA 4LUSB 5AVHA 2FPVA 4ZGYA 3LBMA 3CV7A 1TZZA 1ME7A 3GIQA 3AC0A 5D02A 1IT7A 1GG0A 5LZLA 3AYSA 2HNHA 3NEVA 1K1DA 3WF3A 4GA8A 1T96A 3MWCA 4ERAA 5HANA 1ZQ5A 2QJJA 2PMQA 2EO7A 3DHFA 3WSUA 4XD5A 4YHGA 2PCEA 2Y70A 3MMTA 2XFYA 1XINA 2DT0A 4LQ1A 3GTNA 3ZJ8A 1UH2A 1RA0A 4HYVA 1LTDA 3V75A 1UWUA 3W83A 2VFGA 3L7RA 4EVZA 2PS2A 1JULA 2PF0A 3WQFA 1W1A1 1RVGA 3PN8A 3RJYA 1OD0A 3EXRA 3PBGA 3B8VA 4HNOA 2XINA 3KW3A 3T55A 1TPB1 4Q8UA 4YLWA 1DWJM 2VX6A 1KTCA 3EPOA 3UY8A 5KZMA 2ZXDA 3IJQA 1FH9A 3QQWA 2X1IA 1IEVA 1HT6A 3IRSA 2FGZA 2WXDM 3A22A 4I9AA 5CSSA 3S4TA 2ZICA 4IQJA 4GIRA 4PUKA 3N9KA 3WQ6A 3FY1A 1HJSA 3HN3A 1U30A 1I9CB 2PD9A 3EMQA 3VDAA 1DBTA 1KM5A 3OG3A 1GJPA 3O0FA 4MZYA 4W89A 4MPQA 2FPYA 2X42A 2ZZ3A 1EOKA 2F84A 5AYIA 5AFDA 1L2UA 1A5UA 1B2YA 2XN1A 2OWXA 3WZ0E 3D47A 3LLDA 2EF9A 4XZHA 3NEHA 2R94A 4JTCA 4B4FA 1SR0A 1VFFA 3IGXA 5IHRA 5AOUA 2ISSA 4QDPA 4E6MA 3VVGA 4YPJA 3BE7A 1NAL1 2H6RA 4OZOA 3PVFA 5BRBA 4A2RA 4O0KA 2VR4A 5D4YA 4CQCA 3N19B 2WMIA 4RXFA 3EXSA 3LCGA 2G4FA 4LBSA 3QQ0A 3TOYA 4EIVA 4DZHA 3CBWA 4R53A 4Q8QA 3F2DA 1DIEA 2OEMA 5HR7A 5C7VA 1VH7A 3KHJA 5CH9A 4GIAA 2BVYA 3BG5A 3FA4A 2TAAA 4FLSA 3CAVA 5DRCA 1Y65A 3TVAA 4BCEA 2PAJA 3QC0A 1OX4A 1W3NA 5LGXA 3SN0A 4AZCB 1UWRA 2NVDA 1X8FA 2RFGA 3TN4A 1XSKA 2ZZ1A 2AKZA 6ALDA 4IJRA 3SCVA 5LIXX 3W6YA 5EU9A 4CQ9A 3MYOA 4QE1A 1EPXA 2FLIA 3ABRA 4MDOA 5F2GA 2VKZG 5BRQA 3WLIA 3WNKA 1E6XM 2PCQA 4CD7A 1C8YA 3GRIA 3SECA 4JIIX 1D9EA 3RAOA 1K77A 3CC1A 1VKFA 2G8ZA 1NELA 4MADA 3C61A 2D0FA 4A8IA 5FEXA 4GRSA 5HMEA 3P0WA 4FP1A 4QG6A 1A5SA 3URAA 2G4JA 3IV8A 4HN8A 4B5SA 3NPUA 4WOQA 1V0NA 1R3RA 2HWGA 1JXKA 1Q5MA 4DWSD 3VNYA 3W2UA 1DHPA 4MY1A 1ICSA 2E5BA 4L6OA 3EWWA 3KTCA 2Z1BA 4OV4A 4PMUA 2ONEA 4FX7A 4HN4A 4ZB5A 4G7EB 5HQLA 3OG2A 4Y8EA 1RQBA 4ACZA 4OVXA 4DEFA 3M0XA 2DV0A 2H90A 1HL8A 4DLFA 5G2WA 2OKTA 5DMLA 1UW9A 4AIUA 1ZFJA 1ITCA 5BU6A 1HKWA 1E72M 4GGBA 2DZPA 1AVAA 4IL0A 2X1UA 5F4SA 1YEYA 1YTEA 1ZAHA 3WQ4A 1H4PA 1W8SA 3OLEA 2JIEA 2BXVA 3RHGA 4CGTA 1ZBWA 7XIMA 1LBLA 1TWZA 2G97A 1J0HA 1HNYA 5G1YA 5CC6A 4J1OA 3WQDA 1UWTA 3TZFA 2NSOA 3E0IA 5IRPA 4JY8A 3VX0A 5FSEC 3B8DA 5EL1A 4U10A 3RMEA 4JYDA 5A2AA 5EMYA 2PWGA 4LY8A 4A29A 2Q3RA 1PS9A 4CCZA 4KWVA 4KH2A 2ZVRA 2ZBTA 3CQIA 3N18A 4GXMA 4GXWA 3ZJ6A 1FP9A 3CWOX 1HGWA 1KFWA 3GIYA 1CGWA 3GHSA 1KBBA 1VPYA 4R34A 2PBGA 2TMDA 2DZUA 1M65A 3Q37A 1RP9A 1I75A 1WXJA 3AOFA 3DHDA 3ME3A 5CAKA 2BBFA 1JZ3A 1V02E 3NCOA 3TX9A 2WZHA 1FCUA 3WD2A 2PZNA 1FQ0A 1TRIA 4XG1A 2D2OA 4IF2A 3WD0A 4UOJA 3QMSA 1V93A 2FB2A 3FEQA 2PDXA 1SFJA 5FACA 1K7FA 4TX8A 1YDOA 4G9PA 1XSIA 1DJNA 1OINA 1FHDA 1E4IA 1R3WA 4WIWA 2VFFA 4HT3A 1G9HA 4AX7A 3NSXA 4JKMA 4C6NA 2W0UA 3KP1A 4H6RA 1CLXA 3UZYA 2ZWZA 3MSDA 3VOHA 3ZVHA 1TYGA 1F3XA 1H63A 4QSHA 1JJKA 5LXXA 3BARA 4JTEA 3S5YA 1HX0A 4J3SA 3VDBA 5D2XA 4QTGA 1AZ1A 1SPQA 2AKMA 3C2EA 3ZLGA 1Y8BA 1H1YA 1QW7A 1Z69A 3H55A 3W85A 3D46A 2JALA 4FLRA 4L4OA 1JAKA 7CGTA 4WD0A 3VNZA 1QO5A 3BGJA 3UZZA 2C13A 4PBFA 3W74A 1BQCA 3VZXA 2WZTA 2QNEA 1UQYA 3OZYA 3DERA 3HGOA 7REQA 3S2MA 3ZYZA 4ECLA 1EL3A 3CWNA 1LG2A 5HOSA 4M7TA 4YNGA 1HJUA 1GOIA 3W37A 1XLBA 1SJCA 3AMGA 4HNLA 4UNLA 4WHBA 1IIGA 3BURA 3NDZA 2WZMA 4MWAC 3DESA 4H8UA 1XUUA 1W0MA 4LF1A 4C91A 3S8HA 3POCA 4HSNA 3B0UX 2IW0A 4ALDA 3C4UA 4L6HA 3MI2A 2QPXA 4O15A 1WKEA 4MKVA 1E1FA 1NVMA 2WHMA 4WKAA 4G2DA 1JDCA 2X30A 1TCDA 1U2YA 4C6LA 3GNNA 4GWEA 2G5WA 4DBSA 3P5ZA 2HSAA 4ROPA 3GU2A 4OBSA 4I6KA 1J0ZA 3E49A 1TJRA 3JZEA 3MZ2A 3OHIA 2YZRA 2J13A 3MQTA 4QQ3A 3HFYA 3CO4A 1FTXA 3UZWA 2WO5A