3PSWA

Structure of e97q mutant of tim from plasmodium falciparum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFQRRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Revisiting the mechanism of the triosephosphate isomerase reaction: the role of the fully conserved glutamic acid 97 residue
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 96
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pswA00
4ZQPA 4FF7A 2EGZA 3P62A 1DOSA 4UTUA 4UTHA 4LVDA 3LCLA 2GJNA 3QM3A 4UUIA 3IIXA 3VE7A 4CQAA 2H8XA 2NLIA 3SGZA 3MI6A 2PCQA 4Q4KA 5I3JA 3C52A 4NXKA 3WK2A 3GX9A 3STFA 3TXZA 3O8AA 5EBUA 2VXNA 2C15A 2TYSA 1NSJA 2BWGA 1X8FA 5LHEA 1SFJA 5BOOA 3USBA 3TNOA 3N14A 4JIPA 4M6VA 1TYGA 5D2TA 2RKXA 3BGGA 3GAKA 2QKFA 3W85A 2V2HA 5ABTA 1TREA 3QQ1A 3M41A 2FQIA 1C29A 3W1PA 3BPWA 5MHBA 3AJXA 2HTMA 3EWXA 1SUXA 3NZRA 3PVFA 2VEIA 1VYPX 3KFTA 4K6AA 4MIMA 4Y90A 2B0MA 3M5XA 3O6YX 3TSDA 2QCHA 4UTKA 4IQLA 1YPFA 4DPPA 1IXOA 5F2LA 3TR2A 1VLIA 3HO8A 5HUPA 3G1SA 3L0KA 5U7SA 2ABBA 2C1HA 5HR7A 1EEPA 1IGSA 1A5CA 2G96A 2X1SA 4N9CA 2Y70A 4MJZA 5F2MA 3WK3A 2P1FA 4I9AA 4I7WA 2QJIA 4N9EA 4RXGA 5SWUA 2Y6ZA 1XBYA 3FKKA 4JTTA 4TMBA 2YFNA 5AC6A 1K8ZA 3BW2A 3M5YA 2H8ZA 3W2UA 3TAOA 3UYCA 1WDWA 2RHGA 3UPBA 3VE9A 1S5VA 1VJIA 4IMFA 4R7JA 2KZHA 1OFQA 2ATSA 3PG8A 3UWUA 3F4WA 4XZ9A 2Z6JA 2VFHA 2YCEA 1ICSA 1KV8A 2QJHA 3E96A 4N2YA 3QPYA 1S3HA 3UQNA 2A4AA 1ADOA 4ZQNA 1EA0A 3ZR4A 4O0ZA 2OMAA 2X1UA 1HG3A 1FWSA 2RDTA 1DQWA 3LXBA 3LHTA 3W1TA 1R2SA 2X16A 5L9FA 4RX0A 5F2GA 5IBXC 1I8JA 3O05A 3G0UA 4LVFA 3SZ8A 2WNNA 1H63A 2E77A 2WNQA 3MHGA 3GLCA 3B05A 2CLLA 4BR1A 3SW6A 4UTTA 4FXRA 1W3TA 5FF2A 3PUOA 3DXIA 5CSRA 1AW1A 2V5LA 3HG3A 2CLHA 4ORMA 1QR7A 3VCRA 4FEZA 3NQ8A 3BV4A 4HNNA 5G2HA 3W86A 1IXNA 4JTEA 2CZFA 4JGDA 1PS9A 3H55A 1G67A 5DY3A 3NDOA 3P8JA 3G1AA 5HQEA 5K4ZA 4XBSA 2C13A 5CZ0A 3LCHA 2WNZA 2Y7DA 5AC8A 3PSWA 3FYOA 1ZCOA 4CNOA 1RD5A 1XI3A 1FUYA 4PL2A 4FXSA 3B04A 1TQXA 3GNDA 2E6AA 3G1DA 1NVMA 3T44A 3UZ5A 4CQ9A 1MEWA 1WQ5A 4OQVA 5DCBA 2EKCA 1G69A 5C5YA 1Z44A 3MI3A 4E2BA 1K7XA 4E2DA 3MI2A 5FF7A 5G1TA 5DLCA 5AN7A 3PY2A 5F1VA 3TXVA 2VFIA 2R91A 1QCWA 2OJPA 2VFFA 1TJRA 2QUUA 1Y0EA 3C61A 3TX9A 1OFAA 3THAA 1C9DA 4A2RA 1TTPA 3HMJG 3QSTA 4RKAA 4JS3A 1UBSA 3ZFHA 3NQAA 1RQBA 3NM1A 3MO7A 3L0GA 3LGEA 4CQ8A 1PIIA 4GC4A 4LVAA 1QWGA 3W1RA 1QDSA 3BW4A 2JKEA 3PB0A 4LU0A 2YYTA 3A9IA 2VFEA 1KFKA 4EVZA 3SGUA 4LOCA 3NGJA 4KFOA 3W73A 4O0KA 1SR9A 4ZL1A 5CPMA 4UFJA 1XBZA 3GVGA 5G2WA 5CKSA 2C14A 3O6CA 3TSMA 4S1FA 3SJ3A 1F05A 1KA9F 4MZ1A 4E0CA 3FEMA 2B7QA 4DQWA 3N9SA 4WOZA 3B03A 3NQGA 2WV8A 3QSRA 3NL6A 3LCIA 2YX0A 4K7YA 2OT0A 2ZDRA 3W7JA 3W1AA 4IX2A 2R14A 1A50A 3P5YA 4WQ6A 3PBUA 3MHFA 3GDLA 4CLMA 4GRSA 2YW4A 2YR1A 1B3OA 1QO2A 3L21A 3G1HA 3W07A 1H1YA 3P5ZA 5FEZA 4N02A 3TU9A 1GVRA 4MY9A 2Y62A 1YXDA 1FY6A 2CFFA 3TQVA 4N6FA 1SFLA 1KLYA 3H54A 4DPQA 2TRSA 3GK0A 4JYFA 3HG2A 3R12A 2PRLA 3Q58A 3T55A 3NEVA 3I68A 2JKAA 4BWLA 3OEXA 3TCEA 3BLEA 3D0CA 4UXDA 3WK1A 1NAL1 1RQHA 1LRTA 1UUMA 4JYEA 4AHOA 3P7YA 2ZZ4A 2VFGA 5E0KA 2CLMA 5GVJA 3GYEA 3SIZA 1YTKA 3W1MA 2ZTJA 2DZPA 3WJXA 3A24A 2DZVA 4UFLA 4YL2A 1ALDA 3G8EA 4MFDA 1MXSA 3ATZA 1RZMA 3M9YA 1SO5A 1I2PA 2ISSA 3MP3A 1OX4B 1KTBA 1SW7A 3NM3A 1KTNA 3GNNA 4RR4A 2ZZ1A 2F7FA 3AO0A 1LOSA 4I7VA 2V2CA 2YSWA 1MO0A 1ONRA 4O18A 1H60A 4RXFA 1JCLA 3NQCA 2QCFA 4O57A 3VI2A 1G4TA 4QQ3A 4ZMGA 3NPVA 1M7PA 3TE9A 3A22A 4GXMA 3TQKA 2FLIA 4M19A 2QJGA 3CT7A 3O1NA 4UFKA 2FB2A 1VPXA 4AWSA 1XUZA 3W7IA 4NUWA 2CLIA 1LZOA 3TW7A 4NNAA 4JICA 4GUFA 4EWND 2VELA 5G4WA 3W7LA 1XL9A 3EB2A 5CZTA 2FTPA 1QOPA 3RU6A 3EX2A 2ZQ0A 2JKPA 3BG9A 3IVUA 4FNQA 4NNCA 1H7XA 3L9CA 4DO4A 2DZTA 4OV9A 3UWWA 3R8RA 4IWWA 5HWJA 1SU5A 2DZXA 3W84A 1KM1A 2O7SA 1O5XA 3KX6A 4DBDA 2RDWA 3P61A 1G4EA 3LI1A 5IM51 1TV7A 3OVRA 1OX6A 3L5MA 1W31A 1K8YA 4PODA 1D3HA 2E6FA 1ZAIA 4XTIA 1V7YA 3SR7A 1OFBA 1VHCA 1W5OA 1ME9A 1OX4A 4O13A 3W71A 1SO6A 5DBTA 3W2JA 5D09A 3LHUA 3W7KA 4ZVJA 3CM4A 2V0TA 4RJEA 3JRKA 3CHVA 1Z42A 2Y88A 1NFBA 1IIHA 1VCVA 3LM7A 3C2OA 5CGQA 3N9RA 3N2XA 4CCDA 1R47A 3N3MA 3GR7A 1TO3A 2OCZA 1OABA 4NQ1A 2ZZ5A 4YCOA 3P81A 1F73A 1QPRA 3NPXA 4X2RA 4RZ4A 3NL2A 1YLVA 4IOTA 1HO1A 5D32A 4BI6A 3WJZA 3EEGA 5BNKA 4MLRA 4UTLA 5HMSA 3S9YA 4QISA 1YDOA 4AMAA 5D04C 2A5HA 2A6LA 3C8FA 1WOAA 2Y7EA 5D37A 5BW6A 1SO4A 2CLEA 4O17A 4MY8A 5KZDA 1OK6A 5I3FA 4JTGA 1OFEA 3W88A 5LNUA 3ATYA 2QCLA 2NX3A 2ALDA 2XN1A 3LHZA 4OWGA 1P0KA 1W3IA 3T7VA 2YYUA 3QYQA 1I2QA 1GVFA 4LW7A 4M7TA 3TKFA 2E1DA 3QRHA 3G8RA 4JTLA 2YGYA 3INPA 4N4PA 3NYZA 1DORA 1GYNA 1RQEA 1TCDA 3U6WA 1A5SA 1FWNA 3S5NA 5DXXA 1JUEA 1TB3A 4LS1A 3SSJA 1OG0A 4R53A 4O15A 1TIMA 3UXAA 1OVDA 4HIBA 3C3NA 3FJ6A 5AOUA 3TFCA 3L68A 5C2XA 4FIRA 2ISVA 1G6CA 4ZQOA 1K02A 4JDBA 5BRBA 3O07A 4MYAA 5LHFA 3W3OA 4UMBA 3N2MA 2V5BA 3PBYA 1N7KA 1UB3A 5HNRA 5I3GA 4EF8A 3FKRA 1GPWA 2RH9A 2GVJA 3B0PA 3W1XA 3EXTA 4OGZA 3IEBA 1SO3A 2QUTA 2QF7A 4ORIA 4DF0A 1K8XA 1O95A 2FPYA 4NZFA 5BMXA 3IVTA 3KOFA 4Y6GA 3LDVA 2Y61A 3HF3A 2E5CA 3ABSA 5AHMA 4L4LA 1U5JA 3DI0A 4JD4A 4UC5A 4O14A 2GUUA 4FNRA 1T0OA 2HSAA 3EWZA 3DU0A 3MJYA 1DHPA 3W23A 4EF9A 2XFWA 1Q3NA 2OZ0A 1ME8A 4UR7A 2C19A 3W74A 1LORA 3LCGA 4RV8A 4ZQCA 4GUJA 2NXHA 3R13A 4PC8A 4K8EA 2H6RA 3OIXA 1Q6LA 1PHQA 3FA5A 1GTEA 3F1QA 4PCFA 1G7UA 1XDLA 4M6PA 4K38A 4MYXA 3RF9A 1EP2A 5IBXA 1GEQA 4JTSA 2A7NA 2VOMA 1VR6A 2FB3A 5EA9A 1JCMP 3EXRA 4IXHA 1WXJA 1E51A 4I7UA 4AXKA 2QUVA 3HGOA 3DI1A 4GUIA 3W76A 1JRCA 2CZDA 4WUIA 4O1CA 1LDCA 2QCGA 5LSMA 4OT7A 2B7PA 5D38A 4K37A 1UASA 1UUOA 3CEPA 1R2RA 1TTJA 3KRUA 3EX3A 4FNPA 3LV6A 3NNTA 1ZENA 4UMCA 1LM1A 4WZHA 3PB2A 2J27A 4LC6A 1OFPA 2E5BA 1YDVA 2ZRZA 2PRMA 3P67A 4ALDA 3FS2A 2DJXA 2P10A 4IMEA 3M43A 1B57A 1LOQA 3S1XA 3TJXA 7TIMA 1FDJA 4DEFA 5H2ZA 3HPXA 4N4QA 3LHVA 5G4EA 5F1UA 2NWRA 4UTWA 2B7NA 4X9SA 1HFBA 3Q37A 3Q2DA 3C2VA 3PF3A 3KAOA 1F2JA 2RFGA 3NPUA 1X1ZA 4O1DA 4GUGA 1W5NA 3LLFA 5LKYA 1CI1A 4JTFA 1ZNNA 1TQJA 3QMTA 2QCNA 1TPH1 2CU0A 3B4UA 3CWOX 1JCJA 1A53A 3L5LA 5FF4A 3NG3A 3O16A 3N19B 4MFEA 2DZSA 1LBLA 1AW5A 2V9DA 4CNNA 1SSDA 4Z0SA 3TA6A 3I7SA 1R30A 3PBVA 3A23A 2ZBTA 3CWNA 3NL5A 1PVNA 4K7VA 4HSOA 1DBTA 3VFLA 4JTJA 3G24A 2J6XA 2A1YA 2Y7GA 3QJAA 1SZNA 1O5KA 3E9AA 1TRIA 1OF8A 3P84A 1LOLA 1K3UA 1ML1A 4NNBA 1W8SA 1FCVA 3B8DA 1DJQA 1G4PA 1GYLA 5AHIA 4BI5A 3E12A 4P61A 4JTKA 2JK2A 1BWKA 1D9EA 3P80A 3IGUA 4PEKA 2GQ8A 1PE1A 2GQAA 3W1NA 1O4UA 4IPJA 4IMDA 3U8GA 4JY8A 5J5DA 3E49A 3GDRA 2YDAA 1K7EA 1Z48A 1OFDA 5EPDA 5FEXA 3KXQA 4WD0A 3SI9A 4GJ1A 1JRBA 3DHFA 4NJIA 5I3IA 4O11A 1H62A 3T40A 4TMCA 2BSLA 4JYDA 5K2ZA 1H7RA 2FDSA 4FX7A 4WXZA 5EKYA 1GTHA 3TQ0A 3LTSA 4OE7A 3TSBA 2ZZ7A 3NOEA 4TX9A 4UTWC 2AQWA 4D2JA 3WK0A 2C0AA 5A5WA 3W7NA 4HT3A 3ABOA 3IGXA 2DZWA 2I9EA 4XBKA 3NQFA 3P60A 3GAYA 1PCKA 1YTEA 4N9DA 3R89A 2BXVA 3G3DA 4PTNA 1HUVA 1BTMA 3STGA 3MWAA 1O60A 5A8GA 3ANYA 5I3HA 1KBIA 4RZ6A 1JULA 1OK4A 3QFEA 1VGAA 4HKPA 4KKXA 1RV8A 3GDTA 4JY9A 1KV5A 3ABQA 3G0SA 4XKYB 1ICPA 1GVOA 3SY5A 4O4WA 4JEQA 1G7VA 1H1ZA 1JUBA 3F4NA 1F76A 1HTIA 1J2WA 3TDFA 3TV8A 1TPVA 4IMGA 2FIQA 3A21A 4Z1AA 1B9BA 4PA8A 4TIMA 4P2VA 1J4EA 2ZRWA 4HSNA 4JXCA 5CZSA 5FEPA 4LS2A 1LBMA 3QW4B 3PULA 2I14A 1HO4A 4RLIA 3PR2A 1NF7A 1OFRA 2NXGA 1XUUA 4Q32A 2A21A 3DH7A 3CU2A 1M7OA 4IJBA 1TV5A 4NJKA 4X3ZA 4AAJA 3NL3A 5BMWA 1JCYA 1VZWA 1TPUA 3MBDA 1W0MA 2HS6A 4C1LA 1I2OA 4ZQRA 1KM6A 1OYAA 1FWRA 3DFQA 1SQ7A 3B0VC 5TIMA 3BLFA 3DFTA 4O12A 1LLWA 4POCA 3HOJA 4LWWA 2C6QA 3DFNA 3RMJA 3EX1A 4WY0F 1ME7A 1ZALA 1EP1A 3I6RA 4GBUA 3W7RA 4ICNA 3LBCA 3G3MA 3NQVA 2H3DA 5G2IA 1H61A 4NJGA 1L6WA 4A2SA 2TMDA 3KRSA 1TPEA 1QPQA 1TSIA 1A5AA 2J24A 4XKYA 3PUDA 4M5PA 4HNVA 5C55A 3QEZA 4JIQA 3S1VA 2OT1A 5H91A 5CPNA 3NQ7A 4OU1A 3NO5A 3TROA 3NA8A 1I4NA 1DKWA 2GVGA 3K30A 2NZLA 3L5AA 2W0UA 1KFBA 3UZJA 1L9WA 1GG1A 1XBVA 3BG3A 3BG5A 3RNDA 4MLJA 2J9ZA 3W7DA 2DP3A 4BFAA 2IQTA 2X1TA 3OBKA 3EKLA 2VC6A 4AH7A 3TAKA 2BX7A 3DGRA 1MEHA 3F03K 3UY7A 1W37A 1OYCA 2Q8LA 3M6YA 3A5VA 1HL2A 4UR8A 1VS1A 1OFOA 5D2VA 2WPBA 3GB6A 3DHDA 1OF6A 1P1XA 3PSVA 5HWNA 4JN6A 3W87A 3T4CA 4UFIA 2ZA1A 1SZGA 3WJYA 3CPRA 3L66A 1TPWA 5E1QA 1H7NA 1AG1O 1GVSA 1JQXA 3KVLA 1AW2A 1SW0A 3TW6A 4KWWA 3LXAA 2A85A 3E0IA 5HINA 2WSYA 5D2YA 4AHPA 5CZJA 3HPSA 4BF9A 3LI0A 4U4MA 3LRLA 2A7PA 4J9JA 3STEA 2O7QA 2Y63A 3W7QA 1F7BA 4WOQA 3LHYA 3LTPA 1LTDA 1S5WA 4WXYA 3UPWA 2EPHA 1T99A 1TV8A 5LNSA 1PCWA 2C16A 5LNRA 2WKJA 4WX2A 1GQNA 3FLUA 1I2RA 3NR0A 3M5ZA 3NAVA 3TMQA 1P4CA 3TMLA 1IXPA 3L2IA 4LC8A 1N8FA 3LX9A 5CPOA 4NVTA 1FXQA 3IGSA 1KM4A 3QW3A 1MZHA 1WAUA 2A6NA 4YWIA 3I65A 1W56A 1P5BA 5C54A 2E6YA 3LOTA 4ML9A 2VEKA 2VENA 2X2GA 4KWVA 4LRSA 2X30A 3M44A 2NV2A 1OYBA 5AHEA 4JTIA 4G1KA 2QDGA 1TTQA 1EPXA 1W5MA 3MBFA 1YXYA 5CSSA 2FPTA 3HG4A 5HULA 3RLVA 2E6DA 1XC4A 3PM6A 5F2IA 1VCFA 4CNPA 5EY5A 4EOUA 3IIZA 3JR2A 3TK7A 2BLEA 2QCMA 3BARA 2FJKA 1W3NA 2ZCGA 2V8ZA 3EKZA 2PC4A 2YZRA 3THQA 1ICQA 4MZYA 3W2KA 3FIGA 3C2FA 5K9DA 3O15A 2YW3A 2JBMA 3G0XA 2PURA 3IIOA 3G1VA 4QM1A 2Y85A 4JX6A 4QIUA 3W22A 3W83A 1KBJA 2AAMA 3QQ0A 6TIMA 2F84A 1BWLA 1YADA 2OX1A 3S1WA 3M7WA 2J9XA 1VH7A 3W7EA 1XCFA 3HGSA 2VKZG 4GE8A 3UWVA 4UCGA 4ADTA 1EIXA 3P82A 3B06A 3FOKA 1PHWA 3BO9A 1V5XA 2X1RA 3CIXA 1KM5A 2J88A 1JQVA 5LNVA 1UJPA 4M7SA 4O1AA 3TUUA 3EX4A 1AL7A 1F5ZA 1ZJIA 1QPOA 1RPXA 5FI8A 4M6QA 3QC3A 4YLWA 4AWTA 1GOXA 3M5VA 1JR1A 3HPZA 4JR5A 4O50A 2EAWA 2NUXA 4Y8FA 4ADUA 5LNWA 1W1ZA 4EIVA 3ELFA 3G18A 4GUHA 4JTUA 3HBLA 2QCCA 1ZY9A 1RR2A 1W5QA 2VFDA 4NT0A 1H5YA 1U83A 3QPZA 4MKNA 1TPB1 4LNYA 1MSSA 1GG0A 4YXGA 4UMAA 1JVNA 3LV5A 2GPTA 2ZTKA 5TBOA 4NX5A 3YPIA 1KM3A 1SZFA 1KFLA 3DFOA 1IF2A 5L6UA 2QR6A 5F4SA 3L0NA 2QEZA 3R5EA 5U4NA 3TC6A 3GXTA 3VKJA 1TPDA 4LT9A 2E68A 1T8XA 5DN1A 2ZRUA 2FFCA 5FESA 5D03A 2PE4A 3B0UX 1DV7A 4K8HA 3GR8A 4LY8A 1VC4A 5DY2A 2WQPA 3DFSA 3LRKA 4WY0B 5KSWA 2ATMA 4N9BA 4MUZA 3PUEA 4BK9A 5G5IA 1F6KA 1LP6A 5CPLA 1B4EA 3EXSA 2RDUA 3LLDA 1LLZA 4Z1BA 3GXPA 2QAPA 5AYYA 3FFSA 4W9TA 1M5WA 5AHNA 2ZRVA 3VNDA 3C2EA 1JJKA 3MYPA 3LB0A 1EX5A 2NUYA 3CEUA 2G97A 1L6SA 5KZMA 3JS3A 4HPJA 3CTLA 2WO5A 3LXCA 1QMLA 3BGJA 1EP3A 3V75A 1TPFA 4RCXA 4L4MA 2WSRA 4C1KA 1QNVA 3MHUA 3PS7A 5KTLA 3O6DA 3DKLA 3OG3A 1OHLA 3R2GA 2JGYA 3BVJA 1VHNA 3KHJA 2VEPA 4XQ6A 4RK8A 2GOUA 2V82A 5D2XA 3LBMA 2C3ZA 3CLMA 3ZWTA 5J5RA 4K36A 3EWYA 3G22A 5AFDA 3IVSA 3GZ3A 3NXFA 2R8WA 3PC0A 4Q33A 4Z08A 1GT8A 1TMHA 4DO6A 4ZZ9A 1H51A 4TO8A 4H4IA 3W70A 4WY0A 1SZEA 4FNUA 3L67A 5KZEA 2GQ9A 5LGXA 2TSYA 3LTYA 4MZ8A 2DZUA 4HNUA 4FIQA 4MVAA 4XTDA 3EX6A 1YDNA 2B7OA 3PG9A 4UTIA 3HQ1A 5AYXA 4HN4A 2HS8A 3S5YA 3QMSA 1GJPA 4DO5A 2QDHA 4Y96A 5K4XA 2ZRYA 2W6RA 3UWYA 4NJHA 2Y7FA 1BEUA 2ZFAA 5DXYA 2QAFA 1NF0A 3S6DA 2H90A 2V2DA 2NWSA 4ONVA 3UWQA 1YTDA 1QPNA 3STCA 4IGHA 3W6YA 4TR9A 1CW2A 5K3VA 1K7FA 2V81A 3UY8A 1SPQA 3WFAA 1K03A 3WJSA 4JTHA 2A2IA 2ZZ2A 4LRTA 3NQ2A 3P8IA 4O10A 1RVGA 1L2UA 4H6KA 4LS0A 3W7PA 1FX6A 4U28A 3GXNA 3DFPA 1FWWA 1FQ0A 3W2LA 1P0NA 3LERA 3A5FA 3GDKA 4O53A 1UCWA 5D33A 2E5DA 3IRDA 3S5OA 4MPQA 1Q6RA 3G1XA 4HHPA 3PBWA 2DU2A 8TIMA 1EWEA 3W2MA 1GWJA 4K39A 1ZHAA 3M47A 4FX8A 5AB3A 4XUGA 1S5TA 3LCXA 1VCGA 3S42A 4QNEA 1LRQA 5DELA 4Y9AA 3C0JA 1WBHA 1XDMA 1GZGA 2Z1BA 3BLIA 4ZQMA 1J5TA 5C6MA 4R34A 5D05A 2Q8ZA 2GVLA 4X22A 3RFAA 4BI7A 5KITA 5F4WA 5CG7A 4E38A 3NZ1A 4AB4A 2CLKA 3GIYA 3KVKA 4PH6A 5I3KA 2FPVA 2B4GA 4IX0A 3SECA 3QF0A 3EWBX 1I2NA 1QAPA 3N73A 3T78A 4DXVA 2Q3OA 3HIJA 1F6PA 2NXIA 1KFEA 2ZA3A 5D2WA 4MOZA 1ZAHA 4LVGA 1LRNA 4O19A 1PL9A 3ZWSA 4DF2A 3MUXA 1Q6OA 1YXCA 3W7MA 3OA3A 4O1BA 3CQ0A 3NQMA 4QJ1A 3UWZA 4ADSA 5TQLA 4QNWA 5DBUA 5KMYA 3E02A 4Z0JA 1KM0A 3KVMA 4KFPA 4UTTC 2Z2UA 4GFSA 5HJLA 1ZFJA 3HGJA 1C8VA 3NQEA 3NQ6A 2DJLA 4N6EA 3DAQA 3OHIA 3MYOA 4GWEA 3M1ZA 4FNSA 4NX0A 1EB3A 1VYRA 4FB7A 1X1OA 4IPIA 2CLOA 2V30A 1LBFA 1EUNA 4OHQA 4S2CA 4CCCA 3OVQA 4A29A 3M16A 1EWDA 3NVTA 4HNTA 5EYWA 2DORA 5LZLA 2I1OA 1KTCA 3HGRA 1GVQA 2E09A 3I7RA 1QO5A 1EUAA 3W2NA 3FJLA 4DELA 3BK0A 2G5WA 2NX1A 4UFMA 4Z1DA 4LUIA 4IMCA 1WYIA 2CZ5A 5HR6A 5LGZA 3HB9A 1R46A 3LHWA 3NPWA 4TU1A 4IUOA 3N34A 2G95A 4FO4A 5T26A 1FDYA 3C6CA 5AYZA 2LLEA 2ABAA 4MY1A 1N55A 3KVJA 3LCFA 4DBEA 5K9CA 4LVBA 1DQXA 5DCDA 3EWUA 3H53A 1R2TA 2CLFA 1L6YA 1OJXA 1I45A 2Z6IA 3G1YA 2QCDB 4O16A 3DENA 1YYAA 3TIMA 3W7GA 3GDMA 4LV4A 2Q3RA 1XM3A 4LTSA 5EMUA 4S2BA 3SFKA 1T96A 3IV3A 4GNJA 1F74A 3MP4A 1QFEA 1KM2A 2WSQA 3WJWA 5AC7A 3I7QA 3S0CA 1H7WA 2J9YA 1VQTA 3HJZA 2W79A 1THFD 5AHFA 2BTMA 5K9XA 5FF3A 3S5ZA 4AEOA 2UV8G 4RZ5A 3V1PA 1M6JA 1D3GA 1MEIA 2CW6A 3UD6A 3W72A 2ZRXA 3IIVA 4LUJA 3RLUA 1VLWA 4R33A 4H3DA 3RK8A 3ABRA 1FCUA 1FDZA 1X7FA 1XXXA 1IIGA 5KINA 2NV1A 4NZJA 4YCPA 4O8RA 4JNMA 1VYSX 4O28A 3TFXA 5AHLA 2TPSA 3C2RA 3W1LA 5E93A 4HPXA 4WJEA 2C18A 4BWLC 1W54A 1IXQA 1SW3A 1PV8A 4AWUA 1LROA 1ZAJA 3FYPA 4NXSA 1TTIA 3LRMA 1TJPA 2NUWA 3UXDA 4JX5A 4AF0B 4UIOA 2A7RA 1B4KA 1FCQA 1Q45A 2BZNA 1G4SA 2QCDA 1KLZA 3MW7A 1JUKA 1AL8A 3EWWA 2XN0A 3NQDA 3W7CA 4JX4A 4O4VA 3MP5A 1DVJA 1H7OA 3W9ZA 2EHHA 3L65A 2H3BA 4IXXA 1XFBA 1KFJA 4JDYA 1FBAA 2XN2A 3G1FA 3Q94A 3O63A 4O52A 5D30A 5FF0A 1QOQA 1X6UA 4O54A 4OV4A 1KW1A 1WA3A 2EF9A 4UNKA 4NU7A 5HUOA 5FEWA 1DL3A 3S8HA 4FHAA 4FNTA 2ZA2A 4A3UA 4B5NA 3MMTA 3TH6A 2ZZ3A 4AHQA 3PWAA 2AGKA 2YXGA 1NEYA 1TPC1 2R94A 2CWNA 4FX6M 3DKJA 5D02A 2PRHA 3KRZA 1CX9A 3OVPA 1H50A 3C56A 2YPIA 1FCBA 1WOBA 1XBXA 1XKYA 2P0OA 4LV9A 3LCWA 3W75A 3TJLA 3QMRA 3S1UA 4NJJA 5K7JA 3UNDA 2D73A 3BW3A 4A22A 2ZYFA 2HMCA 1A5BA 1WX0A 4YMZA 2QCEA 4UNLA 3PAJA 1VRDA 4UFHA 4A21A 1Q6QA 4AF0A 4QITA 1WV2A 1JCNA 4MJMA 6ALDA 4XWUA 3W1UA 2YFOA 1WBJA 1JCXA 1FXPA 4DF1A 3DZ1A 5DCEA 2NX9A 1OX5A 3GKFA 4QSHA 1YPIA 4CCEA 2Y89A 3W7HA 5HWMA 2CZEA 1LCOA 2ISWA 4UTMA 3ZS4A 4PFMA 5F4XA 4PL1A 3W1QA 4QAIA 3C4UA 1Z41A 1H7PA 2ZZ6A 5EL1A 1FWTA 2Z0IA 1TRDA 4OBTA 1KFCA 4KFNA 1BKSA 5G1YA 2A0NA 3QZEA 2WOQA 3TC7A 3IIPA 1O94A 2GJLA 1LYXA 4AVFA 3O06A 3W7OA 1AK5A 2WJZA 3CIWA 3U2OA 3QH2A 3M0ZA 1AMKA 1W5PA 2VEMA 1DJNA 3P74A 3DBPA 3HG5A 4Z1CA 3CC1A 4UTJA 2JGQA 1SSGA 3CB8A 3GKAA
chains in the Genus database with same CATH superfamily
4FF7A 1Q6EA 3EDJA 4EPEC 2GJNA 1KCKA 1UWTA 2QIIA 4L9XA 3QM3A 4UUIA 4V28A 2H8XA 2D0HA 5FKYA 2DUAA 5I3JA 4X60A 4E3TA 1JAKA 2VXNA 2C15A 1NDWA 1TE1A 1NSJA 1X8FA 1SFJA 3UXKA 4HU0A 3N14A 4C65A 3VGDA 3T2PA 4TX8A 1XDJA 3A6OA 1R87A 3MS8A 3BGGA 4ZO6A 3G5EA 4P7NA 2V2HA 5JH1A 1I6NA 4QRNA 1R9YA 2Y24A 1X6LA 2FQIA 2WANA 2ZUMA 1HGYA 4W86A 2WWCA 3ZT5A 5HPOA 2VQUA 2HTMA 1SUXA 2VEIA 1VYPX 3WUGA 4Y90A 4L9ZA 1I9CB 3TSDA 3RJYA 1YPFA 3PP7A 1IXOA 5F2LA 3TR2A 4JCMA 2XGZA 3WSUA 4XKMA 1EEPA 1IGSA 3N1AA 1UP3A 2VD8A 2G96A 2NQZA 1D8CA 2Y70A 1EF3A 4W8LA 1UR8A 2NV9A 4I9AA 1DTUA 2CHOA 2QJIA 2QJJA 2DVXA 3LPGA 1SR0A 4IGSA 3FEQA 5AZ1A 1RXOB 3AIEA 5DFAA 3FKKA 2YFNA 1K9DA 5AC6A 2E7FA 3W2UA 2CIPA 3U2ZA 3VE9A 1PZ1A 4QLLA 2WVTA 4BY3A 4DZIA 1XLEA 2ATSA 3QHMA 1KXVA 3B8VA 3UWUA 4S3EA 4PUKA 5FAGA 3BZJA 3CQIA 2PDFA 4V1XA 1WZLA 1KV8A 2ALRA 1RCOB 1JPMA 4GACA 2A4AA 1W2PA 4PTWA 3KBNA 5M5DA 2XG9A 1FWSA 1XW8A 2E25A 4IPPA 1VAHA 2E1WA 1R2SA 3LUTA 1EJXC 5F7UA 5F2GA 3ARTA 2NVDA 4PYSA 3VK5A 2EPKX 1H63A 2WNQA 1KKRA 3GLCA 3B05A 2CLLA 3PUOA 5CSRA 2XSAA 3BAIA 1CLXA 4R27A 3FCPA 4FEZA 5G2HA 1QW9A 2W91A 2XIMA 4JGDA 3H55A 4PULA 2YLAA 1J6PA 3G1AA 3H2CA 5CZ0A 1TKKA 3LCHA 4I5RA 1W1IE 5CPQA 2F38A 4FR1A 4AEEA 1PO9A 1PXGA 1HIZA 1XHGA 2IKIA 4FXSA 3MO4A 3R7MA 5B80A 4DZHA 4CQ9A 1MEWA 2HDJA 4OQVA 3GC2A 4X2PA 2EKCA 3MI3A 4DUOA 2R91A 4P8XA 4MGGA 4PUMA 4A2RA 1CLVA 3HMJG 3WDJA 1BHGA 3K4AA 3S2LA 3ZFHA 3NQAA 2XFRA 2DH2A 2PGWA 3L0GA 3LQLA 1CB7B 3KDNA 2E67A 1QDSA 4DM1A 3BW4A 3OZOA 3PB0A 1JF5A 2J79A 3M0VA 4CN6A 4EVZA 3SGUA 4FPSA 3SQSA 1IQ8A 4O0KA 4LYRA 1XLDA 2V68A 4UFJA 3JZEA 4EK7A 1H0GA 1BKHA 1XBZA 3BICA 3GVGA 2C14A 4HK5A 3BLLA 2B7QA 4EE9A 3B03A 3FAXA 2FTWA 1HP5A 2OT0A 2FGBA 4AEFA 3W7JA 5REQA 3TTQA 3W1AA 1TCMA 3WLHA 1UZ1A 2R14A 2VQTA 3ID7A 4S3BA 1KR0A 4WQ6A 1DIDA 2MUCA 2DT0A 4GCAA 4MWAC 4NHVA 5C9XA 1CGWA 2Y0FA 2A79A 4GY0A 1K6AA 2VUNA 2PDKA 3ZR6A 1SFLA 4DPQA 3IJDA 4QE5A 3HG2A 4X0VA 5A2BA 1CGVA 3M07A 3RLHA 4K8GA 4Q4SA 4E2VA 1C7TA 3TCEA 2FJUB 1JF6A 3SADA 4AD3A 3RR1A 4AHOA 1X8CA 2WSPA 4UQBA 1ZGDA 2VFGA 1AA1B 5E0KA 5GVJA 3SIZA 3EKGA 2ZTJA 3WJXA 4H6RA 2DZVA 4UFLA 4YL2A 4D6HA 3G8EA 4MFDA 2QUMA 5AC4A 5E70A 1AQFA 2YBVA 1XH1A 2Q71A 4TV6A 2ISSA 1N2VA 3NM3A 4RR4A 2WZMA 1VFSA 3OYZA 2VC9A 1OB0A 3WLLA 4AFYA 1XIIA 2V2CA 1MO0A 4AY8A 4GY1A 3B8IA 4MNKA 4DVOA 2QMJA 3S46A 1CT5A 2J7CA 4J5NA 2QCFA 3WY1A 3EA2A 3TQKA 4C90A 1CNVA 4M19A 4L65A 3H2AA 1BSLA 4UFKA 2FB2A 5CPSA 3FV9A 4L6HA 3MKVA 2XWDA 4NUWA 1RK6A 5FCZA 3TW7A 1HJQA 4BZYA 4MDOA 3QPEA 3T9PA 1XL9A 5CZTA 2FTPA 3EX2A 3DDMA 3DFHA 2VT0A 3IVUA 3O7UA 4J3ZA 1Y5WA 4Q4MA 2DZTA 3UWWA 2WBKA 5HWJA 5DMYA 3W84A 1S38A 4HA4A 3BCDA 2Z2BA 1O5XA 4DBDA 2XGBA 1W9PA 1G4EA 3LI1A 1FWGC 1GW9A 5IM51 2DEPA 3G1RA 2IS7A 1TUFA 1RLDA 1TV7A 1TV4A 1W1TA 1AQHA 3PFRA 1OX6A 3L5MA 1W31A 1K8YA 1RALA 1D3HA 4H9UA 1DQUA 1ZAIA 5I6SA 3SR7A 2E9BA 3GIPA 2P88A 4YVVA 1OX4A 1GGOA 4O13A 3W71A 4XIAA 1SO6A 3W2JA 2CYGA 5D9MA 4ZVJA 4FA3A 2PGFA 3VZYA 3LM3A 4C6DA 3VXGA 1E6ZA 5A8NA 1S2WA 1DIEA 2W61A 2OCZA 1JPKA 2ZZ5A 2ZUSA 4J2PA 3GC4A 4RZ4A 3GBEA 3NL2A 1JYXA 2WNWA 2I5QA 5FJPA 1XD1A 2G3NA 3WJZA 4Z2KA 4H9XA 3PTDA 4Q4RA 1CXFA 3S9YA 1IGWA 4DLMA 2EO7A 4AMAA 1A49A 3C8FA 3LK6A 3RLGA 4AZ5A 4YHGA 3BOFA 3APTA 3W88A 2VD9A 3S2JA 1DWFM 4KCTA 1PIFA 4GVHA 1W3IA 3HZ3A 3ARRA 3T7VA 1OBAA 1M1BA 3TTOA 1KRMA 3EDEA 1TWZA 3F2CA 1NQ6A 4JTLA 2YGYA 4UR9A 4D6DA 1RQEA 4RW3A 3S5NA 1UD3A 4PSRA 4CNTA 5ECVA 4R53A 1EA9C 1ZP3A 5C2XA 5BRBA 5LHFA 2UY4A 4L64A 2A3BA 4J40A 2GJPA 2VOTA 4U2ZA 1K9EA 5HNRA 5I3GA 4GX9A 1GPWA 1NTHA 2WHMA 2R6OA 3AIWA 3HURA 3W1XA 4IQDA 3L4WA 1E6QM 1S2CA 3GTHA 2QUTA 2QF7A 4UOJA 3UCQA 3KOFA 1CXLA 3W38A 1AMYA 1NY1A 3WFZA 2E5CA 3ABSA 3GVQA 1HKJA 1U5JA 4JD4A 4UC5A 4M1RA 5I03A 4O14A 2YXOA 1T0OA 2HSAA 3ZJ6A 1UR2A 2A3EA 1E43A 4J3WA 1V03A 2Z26A 3W74A 1KBBA 4ZQCA 4GUJA 2NXHA 3R13A 1GVIA 4PC8A 4K8EA 3NEHA 3VUPA 1PHQA 1GTEA 3F1QA 3CUFA 2PTZA 3SUTA 4M6PA 4MYXA 4KRUA 2GQ3A 1E72M 2A7NA 4YTSA 3M0YA 3GYCA 5FJTA 3QLLA 3EXRA 1JZ7A 3H4XA 1RBAA 2WVSA 4I7UA 3DI1A 4GUIA 4O1CA 2QCGA 5LSMA 1S1PA 2B7PA 3CEPA 1R2RA 1GOKA 3EX3A 3KRUA 4WGXA 1X96A 4UMCA 3GRIA 1ODZA 2J27A 4DIAA 1DXFA 3RRXA 1YDVA 5JVLA 3II1A 4LX4A 2PRMA 1Y5VA 1A0DA 1UKQA 2DJXA 4Y9MA 3RX2A 3TJXA 1ELSA 2VRQA 4DEFA 4AWEA 5H2ZA 1TG7A 2WMHA 3S1GA 3FXGA 4OJYA 5G4EA 4UTWA 2B7NA 1HFBA 3REQB 1VIWA 3Q37A 3KS6A 4DYJA 3N2OA 5H6HA 3LLFA 5LKYA 1CI1A 4C7GA 1I0DA 3POCA 1VFOA 1C7SA 1FHUA 1TQJA 3WH5A 2CU0A 1V0NA 3CWOX 3WF2A 1A53A 4EWJA 3N19B 4MFEA 2DZSA 4C6JA 2OQHA 4CNNA 5HXMA 4CU6A 1EF2A 1R30A 4BA0A 4XG1A 4B3LA 2X40A 1DBTA 3IUHA 1MDLA 3QJAA 3ZYZA 2PDQA 3VOJA 1TRIA 3SUWA 1OF8A 2A3AA 3A4XA 3FN9A 5I2UA 1SJBA 1ML1A 1EDTA 3OO2A 3SY8A 5BU9A 7A3HA 2J25A 4EPDC 3MDUA 4BQ3A 1Q7ZA 2C71A 4ZFMA 3RGTA 1XYBA 1R8LA 1UR9A 4KERA 2JF6A 2Y8VA 4PEKA 4I9JA 4FLQA 4IMDA 1BYDA 4JY8A 2QJMA 2YDAA 4NYUA 1Z48A 5EPDA 3SI9A 1JDDA 4NJIA 2VDGA 3T40A 4JYDA 1H7RA 2FDSA 4FX7A 4W87A 4UCFA 5EKYA 4MTVA 3TSBA 4IIFA 1JAEA 5A5WA 4HT3A 2DZWA 3GHTA 3ZJ7A 4TTUA 3ARUA 3GAYA 4QG8A 1Z8AA 2BXVA 1DWIM 2VR2A 1TX2A 3LNPA 2J7DA 4DBUA 4BJHA 5DO8A 3M4HA 4TQTA 3ANYA 3N2CA 4HOWA 1KBIA 3UA4A 4FLOA 3QFEA 4HKPA 3GDTA 3PHAA 3G0SA 3IUDA 4IP7A 1E3XA 4XKYB 3VAVA 1EZ2A 4DX3A 5LA1A 3FHAA 1H1ZA 1YBQA 1F76A 2FFIA 3AS0A 2JEQA 1TPVA 1RJPA 2IXUA 1UZ4A 4JQ4A 1J4EA 2ZRWA 4HSNA 4JXCA 4XO6A 4AYSA 5FEPA 1HT6A 2BBFA 5LA2A 2I14A 1HO4A 3OG2A 1OFRA 3KHDA 1S2AA 3GH5A 4H2CA 2ZE0A 4HOZA 1CXEA 1WNOA 4HGXA 4UWMA 1TV5A 4AAJA 3GTNA 1QWKA 1TIWA 1X1NA 2OYLA 4LPCA 1N82A 5IDIA 3HTWA 4GIYA 4OECA 2HS6A 1I2OA 4Q3MA 2IPJA 3SBFA 3RITA 1XYZA 3B0VC 3QQWA 3BLFA 3DFTA 5D9OA 4O12A 1UD5A 3QOKA 3TCSA 2NVAA 1IT8A 2JF7A 3I6RA 1FP9A 1V6YA 4DWSB 1U1HA 5HDRA 4NSBA 3ZR5A 2H3DA 3LSBA 1H61A 1KGXA 2WAGA 3KM8A 4GLEA 2WWDA 1IZKA 4E2OA 5DRIA 3N29A 4PSPA 2J24A 2XIQA 1TWIA 1V4YA 3QEZA 4JIQA 3S1VA 1PZ2A 5CPNA 3NQ7A 3R1ZA 1J6OA 4PZVA 1F4AA 2L5HA 2Q01A 1Z89A 3BG3A 4G1NA 3MA8A 4MLJA 3WIJA 3W7DA 4HU3A 1P6CA 3TVAA 4Y2WA 3S9ZA 2P8CA 2WCAA 1OYCA 5JMUA 2Q8LA 1QI0A 5HNTA 2WJDA 1M53A 3A5VA 4LCRA 1HL2A 1HX0A 3WDRA 2ZXQA 1OFOA 4ZB5A 3B8TA 4GOAA 1A3WA 5TNVA 4GJIA 1A0EA 1OF6A 5EGRA 4S38A 4JN6A 2ZA1A 3FHQA 4PMNA 3CZGA 3ARYA 1GPFA 4LUSB 1H7NA 1AG1O 1JQXA 1V0MA 4N42A 3LXAA 3E0IA 4WSJA 1TWSA 2PUZA 1PKYA 2WSYA 4GQBA 5D2YA 3S6OA 4B5VA 4BF9A 1OQFA 4LUTB 1R3TA 3WD2A 1K9FA 4ML4A 3AMGA 1PX8A 2Y63A 3W7QA 1F7BA 1LTDA 4WXYA 3UPWA 2PTYA 3R58A 4BQ4A 5LNSA 1PCWA 2C16A 5ABFB 1BLIA 1E9IA 4XZNX 3NAVA 1TX0A 4TTGA 3TMLA 3L2IA 1R38A 1N8FA 3OYXA 1FXQA 3TEVA 3ZT6A 3E6EA 1EQCA 3QW3A 3NFUA 1W56A 4B5UA 4ML9A 4A3HA 2X30A 4HD5A 4M6UA 2V67A 1BGGA 2BV9A 2G0WA 4X0NA 4PMJA 2D24A 1X38A 1EPXA 1W5MA 5CSSA 3HG4A 3H7RA 1KGUA 4WDWA 5HULA 2WMIB 5KETA 2XFYA 4IISA 3GO2A 3PM6A 1VCFA 5CG0A 4CNPA 3PJWA 3TK7A 1OG6A 3BARA 2FJKA 3EKZA 4AZGA 3K1GA 4MZYA 3FIGA 5A94A 2Y4SA 1NU5A 3O15A 4R7OA 2JBMA 1NOWA 3MU7A 3FY1A 3T4WA 5M3WA 4DUWA 2OQLA 4QIUA 2E8ZA 2AAMA 4DYEA 4XD6A 3SCNA 1WB0A 2R1MA 1YADA 2OX1A 3M7WA 3W7EA 4LEFA 4PUUA 4UCGA 3P82A 2CBUA 5IFTA 1HP4A 5I06A 1AL7A 1ZJIA 4IL0A 1WKEA 1HJXA 5IDZA 1W1PA 3EDDA 1JR1A 2EAWA 2NUXA 1W1ZA 4EIVA 1SFSA 1M01A 5FA5A 5TD4A 5JIWA 1KO0A 4Q8TA 1YKWA 3HBLA 2YKKA 5C9RA 1H5YA 3QPZA 4YU1A 1CEOA 1Z9AA 4GNKB 4RNFA 4W88A 2JIWA 1GG0A 1JVNA 3T0TA 2ZTKA 5TBOA 2WC4A 2PGRA 1BQGA 4D1IA 4AVNA 4IHCA 1KM3A 4I90A 3DFOA 1VP5A 4LT9A 4CU8A 2ZIDA 2BOGX 2WMGA 4C1NB 3KTXA 1J0YA 1KRBC 1J8VA 1POKA 5C9UA 3DFSA 1JNDA 4Q6XA 3GNPA 3DYOA 4N9BA 1S2UA 1F6KA 2GFTA 3OQ8A 4D8LA 7REQB 2V5JA 3EXSA 2RDUA 1CGYA 1PX3A 2QAPA 3FFSA 2OXNA 4L7ZA 2I5IA 4HK6A 4S23A 3C2EA 3VNZA 3ZLHA 3MYPA 3LB0A 3SN0A 2PDWA 2NUYA 4M80A 3IJ6A 3CEUA 4IQJA 3BCFA 3JS3A 3CTLA 3H8AA 1EJTC 1MFUA 2VM8A 2DW7A 1TPFA 1X7IA 4PUDA 3C5QA 3MHUA 3NZQA 1DJYA 1V7AA 1E0XA 3CL8A 5CQ1A 4UOQA 4LCQA 4YTQA 2D20A 2WHKA 3BVJA 4K2SA 3CH0A 3UT0A 1PTAA 3VZZA 2ZDSA 5CXPA 4IFRA 2C3ZA 3CLMA 5J5RA 4Z08A 4Q33A 5C2CA 1P7TA 1J0IA 1H51A 2Z24A 3LPOA 4WY0A 3L67A 1U1UA 1XSJA 4GI8A 1BVWA 1DTNA 1NFGA 1ZP4A 1RH9A 4J1OA 1V3KA 3EX6A 4FF5A 5AYXA 1W91A 2ZRYA 2W6RA 3UWYA 8XIMA 1JIBA 2BP1A 2Y7FA 1PDZA 2RJHA 3WLIA 1A0CA 2VWTA 1NF0A 3ZLFA 2V2DA 3A3XA 2NWSA 4HMCA 3UWQA 4J28A 2VZUA 3KRBA 4DJFD 3AYRA 1R3YA 3T1GA 1AH4A 3IPWA 2V81A 2YL6A 1G0CA 1SPQA 3HMCA 3WQGA 3NJ3A 2A2IA 2YXXA 3P8IA 3PJUA 2CXEA 2PDIA 1OZMA 3CPGA 2E9MA 2HVNA 1OC6A 2PFHA 1P0NA 3LERA 3GDKA 1A5LC 3HA1A 2WVVB 3AIUA 1Q6FA 1Q6RA 4F8XA 2XIOA 1RAKA 1EWEA 3N4EA 3N2BA 4QTGA 4IIHA 3M47A 5E0FA 3LCXA 1NP0A 1LRQA 5DANA 3KCJA 3DCPA 2EG7A 1V6XA 2BB0A 1CPUA 4R34A 3R0UA 2ZC8A 3B9AA 2J4GA 3EYPA 1BYCA 3NZ1A 2J77A 3NDYA 4PH6A 4YTTA 2FPVA 2OO6A 1QAPA 3N73A 4DXVA 3HIJA 1KFEA 2ZA3A 4LEQA 4UOZA 1LRNA 2HNHA 3KZSA 5MKGB 1UW9A 4UQAA 4W93A 3UWZA 4ZTYA 4QNWA 1X39A 2CHRA 3E02A 4Z0JA 5EU9A 4OOZA 1BPLB 2P53A 4DBSA 4QS5A 3HGJA 1C8VA 3NQEA 4DUXA 3NQ6A 3DAQA 1EGVA 9XIMA 4REQA 3GDBA 3MYOA 1LUCA 3KZPA 4IT1A 5IHSA 4GWEA 2VRJA 4FNSA 3LGGA 4HHLA 1UYQA 2CLOA 3DC8A 5EBAA 1KRAC 1JYWA 3WQOA 4S2CA 1S1RA 1WZAA 3TN6A 3M16A 3WO8A 4HSHA 1F3TA 4Q8OA 4XZLX 5EYWA 5CBIA 2X7VA 3E38A 5ABGA 1GQIA 3HGRA 1VIZA 3AHTA 2E09A 5FOOA 1EGMA 1WXYA 4N0RA 3IGHX 2INEA 4LSBA 2XZ9A 1ISVA 2NX1A 3JVAA 1QU4A 1WYIA 1R46A 3NPWA 1YMYA 3ZJKA 3P14A 2QW5A 4MSSA 4UQ9A 3EMQA 1W32A 3CMJA 3C6CA 5AYZA 2ABAA 2XSXA 5K9CA 4DBEA 2QVHA 4S3DA 1D7KA 1DQXA 3FAWA 2QDDA 5DCDA 3H53A 2CLFA 4A4AA 2HRWA 2Z6IA 4O16A 3DENA 1YYAA 2VNCA 4L6OA 5C2GA 5JUVA 2Q3RA 3ZVHB 1UP2A 1F74A 2DSZA 3MP4A 1BWVA 3I7QA 3QYSA 2YL5A 4AD2A 1I1WA 2VL4A 3MT1A 3ARSA 5BRQA 3BJTA 3OOQA 3BAYA 4ZBCA 1THFD 5FF3A 1O5QA 4AD4A 2EPNA 4RZ5A 1D3GA 4MNJA 1FWJC 3BQ6A 2ZRXA 4H3DA 4E4FA 1BG9A 4Q8NA 3G77A 2BVYA 3S47A 1HNYA 4AW7A 1FDZA 4BS0A 3AOFA 3WLRA 3RO8A 2CESA 1OCNA 4TX6A 1U5HA 3GVWA 2TPSA 2POTA 2OFJA 3W1LA 3BMWA 3TC3A 3PTQA 2C18A 1IXQA 1MFVA 1VBGA 3BC9A 1RSCA 2GLKA 1JFXA 1TTIA 3UXDA 2RGLA 2QCDA 1IT7A 1KLZA 2ANUA 2PU1A 1E71M 1JUKA 2XN0A 3W7CA 1K1DA 1A3XA 1H7OA 4C6PA 3ANUA 3BDKA 2EHHA 1JYVA 2OG9A 1XFBA 1KFJA 4JDYA 1FBAA 1KBLA 3PANA 5FF0A 1JI2A 1CENA 2QV5A 1DJIA 2EF9A 3TZNA 3WD3A 4NU7A 1W2VA 3IACA 1N8IA 4LUSA 3MMTA 3TH6A 3O2LA 1PPIA 2BFGA 3WENA 3PWAA 3BAXA 1IR1A 1T6MA 1FH9A 1NEYA 1QVBA 4PRWA 4F4RA 2R94A 4LUTA 3MMWA 1UWQA 3GHRA 3DKJA 1QASA 3GW0A 4W84A 4US5D 4Q8PA 4C6NA 1BXNA 1UWAA 3VMNA 2WZHA 1EOKA 4G7EA 4OVXA 1XIMA 4JHZA 4QEHA 1W1A1 5A2CA 3LN3A 4YMZA 2QCEA 1VRDA 4UFHA 4XX6A 4Y9OA 4GX8A 4GG9A 3F4CA 3ALFA 1NDZA 4XAZA 2HCVA 1WV2A 3IARA 4NYYA 3AU2A 2PA6A 4DJFA 2BVWA 2YFOA 1VKFA 1M7XA 1FXPA 2VX5A 1IT0A 3M0KA 2UWFA 1LCOA 3ARQA 1SMDA 2ISWA 4PFMA 2G50A 5F4XA 3UR7A 3T0DA 1Z41A 2CWXA 1TRDA 4WRHA 1BKSA 4MUPA 3QKEA 4R5EA 3MB9A 3IIPA 1O94A 2VDHA 3EBVA 1LYXA 3UWEA 3QFWA 4AZ7A 3WLKX 2YA1A 3M0ZA 2XYLA 4I9TA 1DJNA 1JZ2A 2JGQA 3TTSA 3KBJA 2GSHA 3GKAA 4ZQPA 4Q7BA 1AQMA 1ZLPA 1DOSA 4DJED 1F8MA 3V0UA 3N17A 3IIXA 3VM7A 1QHZA 1TA3A 3H2EA 3RM4A 3W01A 2TYSA 3N3TA 4QFUA 3SUUA 3UW6A 1DE5A 3HFYA 3S2NA 1M3UA 3LEPA 1UWSA 3GAKA 2ZX9A 1R85A 1B3VA 4MJ2A 5ABTA 1CYGA 4KRTA 3BLKA 1U2YA 2E40A 3CV6A 3VGGA 3W1PA 1J0KA 1FHDA 1MW1A 2VUYA 3BPWA 2YBUA 1EDQA 3E5BA 3BMVA 3C86A 3EPMA 1MQQA 2XH4A 3NZRA 4MIMA 1UWIA 2B0MA 1VF8A 3NCOA 4DPPA 4AX6A 3DC0A 4GY7A 1VLIA 5EMYA 3HO8A 5HR7A 4R9XA 4Z2GA 5I09A 2WHJA 5A6MA 2X1SA 1MDRA 4LAZA 1BSIA 2HISA 3A47A 4N9EA 4I8DA 4JQ3A 3KBVA 1OEPA 1SJDA 2Y6ZA 1XBYA 1XKJA 5HNNA 1CTNA 4JTTA 4TMBA 2PGEA 2E8YA 1K8ZA 3BW2A 3E74A 3M5YA 3TAOA 2JALA 2RHGA 4MWAB 4X63A 3UJSA 1S5VA 1VJIA 3WFLA 4IMFA 2VX7A 1NDVA 1XISA 3VM5A 4XZ9A 1CXIA 3MUAA 1ICSA 3ARZA 1S3HA 3ME3A 2R9RA 1ADOA 3FA3A 4ERGA 1EA0A 5GNXA 1XYFA 2RDTA 1DQWA 1GJWA 1OC5A 4GZJA 3LXBA 1J2BA 3VX1A 2X16A 5RUBA 1AFSA 3PZIA 3RM9A 6REQB 5CAHA 1E0UA 2F61A 4JL2A 2REQA 4LVFA 4IM4A 1UZHA 2GJXA 2P76A 2FZ8A 4F0MA 2C91A 4OTKA 1Q4WA 4M82A 4UTTA 4F0LA 1W3TA 1EX1A 1V79A 2XVKA 2V5LA 2CLHA 4NL1A 3VCRA 3NQ8A 2OWWA 3DOPA 4TVDA 2XDFA 4JTEA 4YPJA 2YZ5A 3AIBA 5HQEA 1U22A 1MMFA 2IPFA 2P3ZA 5XINA 2WNZA 2Y7DA 2WJFA 3B9DA 1GKPA 3URAA 4HJWA 1ZCOA 1RD5A 1Q5MA 1XI3A 3ECQA 4PL2A 4S3KA 1UH2A 3WF1A 1TQXA 3GNDA 3QV9A 4L1XA 1VD6A 1M04A 5BZAA 4QCFA 5DCBA 4INFA 2IXVA 3PFMA 5C5YA 3KCLA 3KE0A 4E2DA 3MI2A 5FF7A 3LZ5A 5AVNA 3E3HA 2PWUA 3WNLA 4O1EA 5TAOA 1QCWA 2OJPA 5AC5A 2VFFA 1TJRA 2QUUA 5JQ9A 4HJFA 2YA2A 1OFAA 3THAA 1C9DA 3L4XA 1AH0A 3NQBA 1ITQA 4JS3A 3GTXA 3H4GA 1KCZA 5M1TA 1EJRC 5A3HA 1PIIA 3EOUA 5B7ZA 1AD1A 2BG5A 4LF1A 2JKEA 2OSWA 1Q65A 4LU0A 4PMUA 1JNEA 3ZQ9A 4LOCA 3NGJA 4KFOA 4CN4A 1FTXA 4LGXA 3W73A 4EACA 4CU7A 1SR9A 4AZCB 4UNIA 4ACZB 5G2WA 2GL5A 3O6CA 4S1FA 4MZ1A 2E0PA 3UEQA 2OODA 2WV8A 3A3HA 2QQ6A 3QSRA 5XIAA 4K7YA 3TNBA 1BGAA 3F2DA 1OT1A 2DFAA 3V35A 4IX2A 1MWOA 6TAAA 4XB3A 1QUMA 4W85A 2D23A 1GOMA 1CGXA 3APGA 2PPGA 3GDLA 4CLMA 4GRSA 3SURA 5ABEA 3F2BA 3LMZA 4CGTA 3OQEA 3L21A 1QO2A 1H1YA 4G56A 4F0KA 3CV1A 1GVRA 1E9YB 4MY9A 4WEVX 2CFFA 1R7OA 2HXTA 4US5A 4JNZA 1HVXA 5DMNA 2OKOA 3GK0A 4JYFA 3R12A 1GQKA 4IJCA 1K4GA 3Q58A 4DUVA 4DJDC 3TJIA 4BWLA 4HZ7A 5HK4A 2G3IA 2GVYA 2XUCA 1EZWA 3D0CA 1NAL1 3P7YA 3WNPA 3AU6A 1XICA 5MKGA 3GYEA 2R82A 3CQJA 3SFWA 3V16A 4WDXA 4Z17A 1ALDA 1E6SM 2GSEA 2VGGA 3ATZA 1RZMA 4LB3A 3VKAA 2ONEA 1I2PA 1SW7A 1KTNA 2HVMA 4OKDA 7PTDA 4I7VA 1Q66A 2PDYA 2YSWA 5J04A 4S39A 3LY0A 3VIFA 2QPXA 1ONRA 4IZGA 1VPQA 3IUIA 1G4TA 4QQ3A 3TTYA 3MSRA 3NPVA 1M7PA 3DX5A 3TE9A 3XISA 3CT7A 2C7FA 2EPMX 3WDQA 3BL3A 3W7IA 3N4AA 2PWFA 2WLZA 4MWAD 2YB1A 2DSKA 3N6HA 3EB2A 3N2TA 4XD4A 2W92A 4QDWA 2H9AB 2PMQA 1QHOA 3EPNA 2VRKA 2ZQ0A 4DJEA 4K1GA 1QPKA 1WPCA 1UR1A 3L9CA 2WMFA 4FLSA 3R8RA 4HYWA 2QDEA 3KW3A 3KX6A 2Z7KA 2JIEA 4BEQA 1YRRA 2RDWA 1RA0A 2X42A 3UGRA 4AMCA 1JXKA 5LIXX 2XVLA 1VFFA 4ZEPA 4MMWA 3QC0A 5G1MA 1V7YA 3RU8X 1OFBA 2ZUUA 1ME9A 1SYTA 1RCXB 4CQDA 3CYVA 4JIEA 1VBRA 2G41A 2X05A 5D09A 3W7KA 1EC9A 3CM4A 1NQKA 2V0TA 1KXHA 4PE8A 3JRKA 2Y88A 1E6NA 2AMGA 3W25A 1IIHA 4A6GA 5CGQA 1Q6DA 3N9RA 4XZBA 3N2XA 3PZMA 3N3MA 5GJNA 4FMVA 1PTDA 1TO3A 1OABA 1YE4A 3ANVA 4CD7A 4YCOA 3P81A 1GCYA 1QPRA 4X2RA 2OSXA 2JFEX 2V3FA 5BNKA 1O5RA 2X09A 2A5HA 2F2KA 3GXIA 4PMZA 5CEWA 1SO4A 5D9NA 4O17A 4H6QA 3BMXA 5BROA 2X0SA 4JPGA 5I3FA 2J6VA 4JTGA 3I4KA 3WMBA 5LNUA 1A5UA 2NX3A 3LHZA 3KOYA 3AUJA 4ZTXA 3URNA 3VC5A 1T41A 4LW7A 2WZTA 2E1DA 1K9TA 4GQGA 1NWTA 3QRHA 3QGKC 3RCNA 3I6TA 4ILSA 3O6AA 3NYZA 3DESA 1GYNA 1TCDA 1TMLA 2I9UA 3VINA 3MWCA 1JUEA 1TB3A 4HHMA 4LS1A 1KR1A 4CD8A 3SSJA 1TIMA 5J8LA 4HIBA 2GJRA 1UKOA 3LD5A 3C3NA 4JN8A 4LUYA 3U2CA 4LJ3A 5I79A 3VGFA 3HU7A 3GUGA 3JW7A 4OOUA 4MYAA 3W3OA 2V5BA 1N7KA 3FKRA 4PFHA 2GVJA 3STPA 3PZTA 3EXTA 4P7RA 3UYIA 1KCLA 1ZBKA 4ORIA 1DYSA 4NZFA 4F0SA 1O6IA 2Y61A 3SRHA 4M29A 1QNSA 3MJMA 5AHMA 4IG2A 1FWBC 5DQPA 2X1IA 2J7GA 3VNMA 1UD2A 3EWZA 3DU0A 3MJYA 3W23A 4EF9A 1LL4A 1QBBA 1Q3NA 2OZ0A 1ME8A 1V6WA 3CXOA 3UR5A 3H2FA 2IPWA 1TWDA 1IV8A 1K77A 4PCFA 3HQOA 1KBKA 1G7UA 5CSUA 3WLQA 1JDAA 2VOMA 4NILA 2OB3A 2QMKA 3R8GA 3AQUA 4ZOCA 4IXHA 1E51A 1MUCA 3AMCA 2QUVA 3HGOA 4PTVA 3W76A 3ZVIA 4WKFA 3TYUA 4WUIA 1HKKA 1LDCA 2YOCA 3D3FA 4OT7A 4Z2HA 5D38A 4PBGA 4K37A 1TTJA 3FK4A 2C1IA 2XM2A 1ZENA 1LM1A 4ROPA 2EQDA 1OFPA 4NKCA 4AD5A 2SFPA 2P10A 3CUXA 3ZXWA 1D3CA 2VR5A 1LOQA 3EAUA 7TIMA 2NLYA 3ITTA 3HPXA 1WO2A 4G2DA 3MMUA 2ACUA 1YPXA 3OLDA 3LA4A 4QP0A 1E1FA 1V02A 1XIFA 1F2JA 4IGNA 3EMCA 3NPUA 4O1DA 4GUGA 3OZMA 3SRKA 2QCNA 3L7RA 1XG3A 1B0IA 4JQ1A 2VC5A 2V9DA 2WC3A 3TA6A 5BRPA 3A23A 6CGTA 2ZBTA 3CWNA 1Z6KA 4H8UA 2DUXA 4KW2A 4KEUA 3VFLA 2ZX5A 2J6XA 2Y7GA 4K68A 2O56A 3LENA 1O5KA 3E9AA 4P8VA 2VC7A 1NOFA 2XH7A 3KDOA 3C8NA 1K3UA 1FCVA 4ZE5A 4H2HA 3LZ3A 4BI5A 3E12A 1GZJA 3BJSA 3IGUA 1UC5A 2GQ8A 1PE1A 2GQAA 3W1NA 4IPJA 2XISA 4QQUA 2EPLX 1A5NC 1H0IA 1OFDA 3KXQA 4WD0A 5MF5A 3OLGA 4O11A 1PTGA 2BSLA 5GJMA 1O1ZA 1EC7A 1GTHA 3BLOA 3TQ0A 4MWAA 3LTSA 4OE7A 2ZC1A 4UTWC 2AQWA 4D2JA 3WK0A 1V51A 2QUNA 3P60A 1W1B1 4RDYA 4N9DA 3H4WA 2DIJA 3TYEA 4PTNA 3W6MA 1BTMA 3WH9A 1DXEA 3IJ7A 4HPNA 3EOSA 5A8GA 4QSFA 5I3HA 1E9LA 5KEZA 3O0KA 2RUSA 1RV8A 3SCVA 4GYJA 3B8WA 5CJNA 3SY5A 1T40A 1WKFA 1G7VA 4Q4PA 2IQDA 3FGCB 3Q4DA 1HTIA 3WUEA 3TDFA 1E0VA 4IMGA 5MHBA 4TIMA 4UB9A 1KWGA 1AVAA 1U33A 3PR2A 3LPFA 4XZWA 2IW0A 3HQPA 4EXAA 4IJBA 4X3ZA 3A13A 1LLOA 3NL3A 4CUCA 1JCYA 1VZWA 3B8SA 2VMFA 3PZ9A 3N4FA 3B9EA 3CLWA 4J2MA 1KM6A 1GOIA 2I56A 4WSKA 2W63A 3FVDA 1LLWA 3SY1A 2G37A 3OHMB 3UJ2A 3NTYA 4LXFA 2Y5EA 4WY0F 4KPLA 2VO5A 1FHVA 1ZALA 4YVXA 2YIHA 3VKCA 1EP1A 4GBUA 2OVLA 3G3MA 3NQVA 3R43A 5G2IA 3GG8A 4NJGA 1WAWA 1Q2SA 4A3YA 5EMKA 1A5AA 2DZAA 1JG9A 4NAEA 1W9UA 2GGHA 1VBJA 3PUDA 4HNVA 5C55A 3QHOA 2OT1A 3TJ4A 2VGBA 4G7FA 3PPCA 3NA8A 2J7BA 4DM2A 3GUWA 1ECQA 2G4JA 3L5AA 5DRCA 3L2LA 1QK2A 3B8UA 1JPHA 2NQ9A 3V5OA 1WDSA 2GGEA 4YVPA 4BFAA 2VC6A 3IJQA 7ENLA 2BX7A 3F03K 4GYKA 1DJXA 4UR8A 2J8FA 1VS1A 2DPEA 1HQTA 1ZBWA 3DYMA 2WPBA 2OLHA 2IQ0A 3GB6A 5HMDA 3P0XA 3M0LA 3CT2A 3PSVA 4IFOA 3UR2A 4DB7A 5HWNA 8RUCA 4ZA0A 3T4CA 2GK1A 4RNHA 3WJYA 5BXPA 3CPRA 4QJ5B 5KZ6A 3IWPA 1SW0A 4DXKA 4Y8EA 1XCXA 5HINA 4XVEA 5CZJA 3HPSA 3LPPA 3LI0A 2WC7A 1J79A 2QZRA 4H6EA 5I5RA 2YCLA 2GDUA 4J9JA 2IKJA 4WOQA 1ZU8A 3LHYA 2DT3A 4B9YA 1CLKA 3H2MA 2EPHA 2I16A 4ATLA 1B9ZA 1EPVA 3N15A 1TV8A 5CGMA 3B0YA 2WKJA 1GQNA 3CHCA 3NR0A 3GSMA 3M5ZA 1ZZMA 1P4CA 1IXPA 1UR4A 1NH6A 4X61A 5FJOA 1ADSA 2C79A 1NOUA 1J10A 3CASA 3L12A 2A6NA 3I65A 2E6YA 2OGYA 4C7FA 4HPGA 3KTCA 2X2GA 1RP9A 4KWVA 1BFNA 1OYBA 3FJ4A 4H7ZA 3GFXA 1EC8A 3WCZA 2FKPA 3H70A 1YXYA 2WK2A 2XSBA 4A8NA 3DERA 4GZ7A 5EY5A 2BVTA 3HFTA 4GO9A 3JR2A 3L23A 2BLEA 3QN3A 2QCMA 3SEPA 2ZCGA 2BVDA 2YZRA 1ICQA 4UQDA 2UZ9A 2A3LA 1E5NA 2XTKA 5IRPA 1NWSA 5FL1A 4IH3A 3WLJA 3G1VA 5LYRA 4QM1A 1KBJA 3P0WA 3QQ0A 3R6IA 2XVNA 3C0QA 3PTKA 2J9XA 3QTPA 1VH7A 1LQ0A 1QW8A 3UWVA 3B06A 2JEPA 3FOKA 1HL9A 1J01A 1PHWA 2X1RA 1KM5A 2XFFA 2PDXA 1JQVA 3QY8A 5LNVA 4M7SA 3EX4A 4M6QA 2GUYA 4HA1A 1EIBA 3HPZA 4JR5A 1YW1A 3V4BA 4PEEA 2WQDA 2F8QA 4GUHA 3OLIA 4N7QA 2VFDA 5H8MA 1JGIA 3RX4A 1TPB1 4LNYA 1MSSA 4UMAA 4GQQA 2VR4A 4GISA 3YPIA 1SZFA 1KFLA 2J8TA 1BF6A 1IEXA 1UKSA 4S3FA 3L0NA 3TC6A 3UZZA 3MTWA 2E68A 3DYPA 5JXQA 1TE6A 1XLKA 2FFCA 3TZFA 5D03A 1KXTA 3TONA 1DV7A 2TODA 4FSAA 5EFFA 1PDYA 4LY8A 2WQPA 5KSWA 2ATMA 3BANA 3HJEA 3PUEA 4GH3A 5G5IA 5CPLA 1B4EA 1ZB5A 1R3VA 1R5YA 4AX7A 2VVNA 3A4JA 1VFTA 2EPOA 4W9TA 4V15A 3VNDA 2NQ5A 1V6TA 1QW7A 4P8UA 3U4AA 2ADAA 1DJZA 1H49A 4HPJA 2WO5A 3DHUA 3GQYA 2DSUA 4L4MA 2ZXBA 1XGZA 1B5TA 3RM8A 3VNJA 1OY0A 4BQ5A 2JGYA 1VHNA 4ZOBA 3KHJA 1B3XA 3TYBA 2VEPA 4QJ3B 4RK8A 1REQB 2V82A 4J7RA 1C90A 5DF0A 1WDRA 3FW6A 3LBMA 1XQKA 1FH8A 3TLLA 4C6MA 3EWYA 1XLBA 1M65A 4ICCX 2OPJA 2POZA 3EMZA 1GT8A 3R79A 4DO6A 4WSHA 3W70A 1J96A 3TQPA 4F2BA 1PAMA 5I02A 2GQ9A 3VIKA 2TSYA 4E3VA 4W4QA 2DZUA 2P50A 4HNUA 3OW1A 1AD4A 1IYXA 2FVLA 4MVAA 3PG9A 4UTIA 3PK7A 3CAWA 4HN4A 3S5YA 2QDHA 4Y96A 5CLTA 3QVQA 4GQRA 1BEUA 5E09A 4QGCA 2QAFA 4NAFA 4LALA 2X7WA 1A5MC 4ENLA 3STCA 4TR9A 5K3VA 4IIBA 2G3MA 4E4UA 4KBXA 2BXZA 3K8MA 3NZPA 1JFHA 3QR3A 3WFAA 1EXBA 1K03A 4JTHA 3AXXA 3NQ2A 3QZ6A 4Q8UA 1V3LA 3NO3A 1L2UA 2OTDA 2XZ7A 3WQVA 3FSUA 4IJRA 2INZA 3DFPA 3WG6A 3K4WA 4EXQA 2QT3A 1E4NA 2E5DA 3VIOA 2O55A 3S5OA 4E8GA 4MPQA 3PBWA 3N6JA 1GWJA 1EJSC 3TOYA 4FX8A 4XUGA 4J4KA 5CC3A 4QLJA 5DELA 3NSNA 1P6WA 3C0JA 1XDMA 3S3GA 4PUJA 3BLIA 4E6MA 5C8BB 4L4OA 2V6AA 4RZBA 3THCA 2Q8ZA 3KOZA 3BTNA 2AL2A 4BI7A 4QG6A 3TYZA 5CG7A 4E38A 3GHSA 4AZHA 2B4GA 2EJ1A 3QF0A 4P7QA 1UH4A 3EDKA 1UWUA 3AXHA 1KD0A 1F6PA 2D2OA 5D2WA 1YDYA 4MOZA 3AZRA 4LVGA 4O19A 1E1CA 2ACRA 2EEXA 4YN5A 1Q6OA 1YXCA 3W7MA 4O1BA 2DSVA 5BWAA 3NQMA 1F9CA 4ADSA 1RBLA 1BF2A 1KM0A 3KVMA 4BQ2A 3S2MA 3HQNA 2Z2UA 4GFSA 5HJLA 2HE5A 3VD9A 1B90A 2VWSA 3GH4A 4ES4A 3ERPA 5GQBA 3CHFA 1FWFC 4GYPA 4GH1A 4QR6A 3DFYA 5FJRA 3W0KA 2F6XA 1VYRA 4FB7A 1M68A 3WX7A 1LBFA 4PTDA 2W27A 4I5UA 1Y5XA 4CCCA 5DEZA 4RE3A 3CGTA 2PSNA 1R3QA 4DN1A 4KWOA 3TTEA 5LZLA 2I1OA 2NSXA 1P0DA 4B16A 7XIMA 4MB1A 3I7RA 3UCDA 4ZOAA 3FJLA 2BNJA 4UFMA 4Q8WA 1S46A 1V6UA 2CZ5A 4RUBA 5LGZA 3DECA 3LHWA 3WQ8A 3GIQA 1CIUA 1MW3A 3M0IA 3PJXA 2HWGA 2G95A 3FGCA 1A4LA 3QV6A 3CV2A 4LANA 5T26A 4PGLA 2D0FA 2XU2A 3Q65A 4MY1A 3RDKA 4B92A 1J0HA 1V02E 1KKOA 1IZJA 2A3CA 1XR2A 1I45A 1XRSA 4HZMA 3CJPA 5B7YA 4LTSA 1FWCC 1R9ZA 1AUSL 2FTYA 1T96A 3SFKA 1QFEA 4PRTA 3H12A 1KM2A 5AC7A 4AC1X 3S0CA 4KS0A 2ESCA 2OWCA 4GXWA 3WBXA 3HJZA 1UKPA 4KCWA 5AHFA 2BTMA 3NWRA 5I3DA 4AEOA 1M6JA 3CH9A 4QEEA 3T05A 3W72A 5M17A 3RLUA 2QGYA 1VLWA 2VGFA 1XQLA 2G8ZA 2OU4A 3GXDA 3V3WA 1T5AA 1FWHC 4CKQA 3GVRA 2PS2A 4UZSA 1XINA 1JDCA 1X7FA 1XXXA 2BY1A 4HTBA 1IIGA 1UR3M 4NZJA 4YCPA 4O8RA 3U2EA 1VYSX 4O28A 1VPYA 3TFXA 1HKWA 5AHLA 3SQMA 1OD0A 2GGJA 4WJEA 4H19A 2YCKX 1W54A 1SW3A 4KEZA 3FXYA 1HKIA 4MWAE 3CB3A 1LROA 1ZAJA 1RBOB 2RGMA 3FYPA 3I10A 3LRMA 3CAVA 1J12A 1J9YA 2NUWA 1V08A 4JX5A 4OFCA 4HCLA 2A7RA 2FZDA 3ARXA 4DHGA 3F5LA 2BZNA 3TA9A 4F9JA 3NQDA 2G4FA 3GTFA 3MP5A 1DVJA 3W9ZA 1WDPA 4LH8A 1H5VA 3VPLA 4P7OA 4I6VA 2H3BA 3VCNA 4C60A 5IOBA 1B3WA 2V5KA 3WLPA 4O52A 1EOMA 2AOSA 1X6UA 4O54A 1KW1A 3F4DA 2WMKA 2ZXAA 3DGBA 4Z2LA 5HUOA 5I0DA 1BVNP 3S8HA 1DWJM 4GBDA 4A3UA 1E4MM 3IJ9A 3SN4A 2AGKA 4AZIA 1HKMA 2DQWA 3EWDA 2PDLA 4FX6M 1MQRA 5D02A 3VOFA 2IMRA 1CX9A 3LYEA 2GDVA 3OVPA 5JIPA 1XPYA 1TJ0A 4J3TA 3P93A 3MCNA 4C6LA 3T42A 1XG4A 4RNJA 3WQ5A 3W75A 3S1UA 1O1HA 4AIUA 2GVEA 5K7JA 3UNDA 1DHKA 2D73A 4A22A 2HMCA 1XLLA 2CXGA 2QPSA 4F0RA 5LIYX 3PAJA 3QHNA 5E0CA 4E8DA 2GDQA 3EOLA 2PDGA 4FXFA 4AF0A 4QITA 1XLHA 4MJMA 3WNNA 4HOXA 1L0PA 3E0VA 1DIOA 3DZ1A 5DCEA 3URQA 2NX9A 1OX5A 1OWQA 2QVNA 4CCEA 5T8GA 2Y89A 3HN3A 2CZEA 3OODA 4HPHA 5BOFA 3BOXA 3ZS4A 2WM0A 1E6RA 4G5DA 4IMAA 2EG8A 2Z0IA 1GHSA 1HN1A 1EJWC 2RDXA 3XINA 3TN3A 2GJLA 3O06A 3WQFA 5E6ZA 1AK5A 2FGZA 1MXDA 1OADA 4G8TA 3DBPA 3HG5A 3QGAC 3CC1A 3WNMA 3DHFA 1J0JA 2EGZA 3P62A 2PTXA 1MRQA 4UTHA 3LCLA 1AJ0A 3A3WA 4NRSA 4CQAA 2BGQA 2NLIA 1EJ7L 2OYKA 1X98A 4Q4KA 3C52A 4NXKA 2P0IA 3UG8A 3QR1A 3O8AA 5EBUA 3W6LA 4RL3A 5BOOA 3V5FA 3ITCA 5HBFA 4JIPA 4M6VA 3FJNA 4JFVA 1A47A 3ARVA 1KCXA 2RKXA 4IFKA 3ITLA 4GVGA 1IEQA 1Q13A 2QKFA 3MZNA 1Q4NX 3T8QA 1RA5A 3QQ1A 3M41A 4B5TA 4H9MA 1DWGM 2Y5SA 3AJXA 5A6SA 2FVKA 3EWXA 2CZVA 1FKXA 3KFTA 3M5XA 3O6YX 2J78A 1PUDA 4IQLA 1ZSXA 2HPIA 4WHBA 4M51A 5HUPA 5U7SA 3TWBA 4AUBA 3UG5A 3OIHA 1FA2A 2I17A 4EX4A 1A5CA 4RV3A 4DI9A 4F2TA 4US6A 4B5WA 1FWEC 4JQAA 4MJZA 5F2MA 3WK3A 2P1FA 4I7WA 2YL8A 3L4TA 4RXGA 4ZB0A 5SWUA 5D4YA 3M7SA 4MF4A 2H8ZA 2I7GA 4QE4A 2FHBA 1ITXA 1WDWA 4R7JA 2KZHA 1OFQA 1IWPA 1I75A 2RAGA 3MZ2A 3U57A 3AHVA 5LIWX 2Z6JA 3TLQA 1Y65A 1QI2A 2YCEA 4F66A 2QJHA 4N2YA 3W37A 3UQNA 3MSGA 4WJ8A 3CQHA 3WD4A 3ZR4A 2X1UA 3WBAA 4H04A 1G01A 2X0YA 3ZJ8A 4BKNA 4IP4A 1BVZA 3UJEA 4RX0A 4Q8VA 4H7CA 1P48A 5IBXC 1S5NA 3G0UA 3NUKA 3V5CA 3ZOAA 3D3AA 4QLKA 3UR8A 3CUJA 3MHGA 3RHGA 3ZSTA 4BR1A 1RCQA 3CL6A 1MUWA 3DXIA 2GUBA 2NQHA 1FFQA 4LY4A 5AECA 1GOQA 3HG3A 1EBHA 1QR7A 3PWIA 3H7UA 4Q6JA 3W86A 1D2KA 3BXWA 2DVUA 1BQCA 3NDOA 4MPKA 3P8JA 1GOWA 4P7LA 6ENLA 1CECA 2C13A 3KUMA 3CO8A 5REQB 3U3HA 1V0LA 3FYOA 1EGZA 3UVIA 2CKSA 4ATDA 1FUYA 4KEVA 4GIAA 2PWHA 4YYFA 3G1DA 3VNIA 2XWEA 4AY7A 1NVMA 1C92A 1XIDA 3UZ5A 1G69A 4E2BA 3WQDA 1EQPA 5FSEC 1L8NA 1JZ4A 3KP0A 5F1VA 3JZUA 3UERA 3B3DA 4HCDA 2KAUC 3C61A 3TX9A 2CITA 4WR3A 3BV7A 4YNGA 4RKAA 1C8YA 3AI0A 5FSDC 3NM1A 3U7BA 2PU0A 3MO7A 3LGEA 4CQ8A 4LVAA 3W1RA 2D3LA 3LG3A 2YYTA 2VFEA 4ZSUA 1LJYA 1QI5A 4KIRA 3DN5A 3QLDA 3AALA 1AJ2A 3BWWA 3SJ3A 1F05A 2O4MA 1XIGA 4DQWA 2XVPA 2HBVA 4GCXA 3NQGA 4PCNA 3LCIA 2YX0A 2YBTA 4OIFA 3T8LA 1QNRA 1CDGA 1A50A 1JXJA 3BAKA 1YNQA 3MUIA 2J8GA 1BYBA 3E2QA 3MHFA 2DQXA 2YR1A 1B3OA 2J47A 3UG4A 3G1HA 3P5ZA 4N02A 2VI0A 4BHYA 3TU9A 2V63A 2Y62A 1YXDA 1W1YA 1TJ1A 3TQVA 4H7VA 1KLYA 3H54A 1XRFA 3WN6A 4PMRA 3NEVA 4FOJA 1Q8JA 4KETA 3UESA 3I68A 1M7JA 3M6DA 1U30A 3AWOA 1R3SA 2PDCA 1ZCCA 3BLEA 3WH6A 3MY9A 3WK1A 1RQHA 1LRTA 1UUMA 4JYEA 3W29A 1PX4A 3CAKA 3UJFA 3L4VA 1YTKA 2GZXA 5CBJA 3VILA 3GZAA 2OX4A 4EPBC 3S6TA 1GKQA 2HBXA 1PJ9A 3AISA 1OX4B 2ZZ1A 3V18A 1EYEA 2F7FA 3AO0A 1DWHM 3MCOA 1LOSA 4FR6A 3QY7A 4GKTA 1GKRA 1K70A 1H60A 2DY3A 1JCLA 3NQCA 1WKYA 1Q85A 3A22A 4GXMA 2V5DA 2FLIA 3O1NA 5ECUA 4AWSA 1XUZA 1LZOA 3K5XA 1XYLA 3CZEA 4NNAA 3R25A 1R3RA 1O12A 2PWDA 4CD5A 4EWND 3FNDA 2AMXA 5G4WA 3W7LA 3SRFA 1QOPA 1JPIA 1ONEA 1BXBA 2BASA 3BG9A 4D6GA 4DJDD 1H7XA 3VMPA 2DVTA 3AXKA 1SU5A 5FACA 1BXCA 1DP0A 2O7SA 2MNRA 3P61A 1W3KA 5A2AA 3OVRA 4IPLA 4FI4A 1R6WA 4PODA 3L4ZA 2PDJA 3V7PA 2PODA 2GWGA 4EXBA 3K1DA 1FWAC 1EO5A 3LHUA 3SJNA 1GK8A 4RJEA 1PKNA 4AY1A 1ZL1A 2AAAA 3DG7A 3CHVA 1Z42A 4GXPA 4FALA 5CLWA 1NFBA 3WLMA 3A4AA 5HA7A 1XIBA 1LWJA 1VCVA 5G4HC 5CC5A 4AVOA 3C2OA 1G94A 1R47A 2DT2A 3AS2A 3VFCA 3GR7A 4L6DA 5HJYA 1R3WA 1YLVA 4PMVA 3E2RA 4BI6A 4GI9A 1P43A 1MW0A 3HM7A 1YDOA 2A6LA 3VDAA 3R94A 3TWAA 2CLEA 5KZDA 2R1NA 4GIRA 4QDPA 1XF0A 3AIRA 3QXBA 3VKKA 2OWXA 4OWGA 2XN1A 1RJRA 3MANA 5C7VA 1MNSA 2YYUA 3QYQA 1I2QA 1GVFA 3TKFA 4XVDA 4C6KA 4PB3A 3OA5A 3V0TA 3UZXA 3WDPP 1EBGA 2BGNE 4FLRA 2J7HA 1XS2A 1A5SA 1TWWA 5DXXA 2PWEA 1OG0A 4O15A 2XHYA 1OVDA 1SGJA 3FJ6A 5AOUA 3TFCA 3L68A 1EH9A 3SSZA 4GQ0A 2ISVA 3UZYA 4ZFCA 1IZCA 2ACSA 4NRRA 3N2MA 3RO6A 4O1FA 1Q6CA 3S9IA 3WF3A 1HXJA 3CZLA 1EHNA 1UB3A 4XAPA 1H11A 1KFWA 4FK9A 3IEBA 1SO3A 4HU4A 3T07A 3IVTA 4Y6GA 3UJRA 3LDVA 3NXLA 4TVUA 4C7DA 2QGHA 3OB8A 2HVOA 4J3SA 3ES7A 3PZUA 2D2JA 4XD3A 4LYQA 3R8HA 1C9WA 4FNRA 5DT5A 3FSTA 3WF0A 4F9DA 3AUOA 4DWSD 1BD0A 4YWSA 1A5OC 3WF4A 3AHZA 4HA0A 3MPGA 1LORA 3LCGA 4C5ZA 2CBVA 3VDCA 3LGDA 1OCQA 3W82A 4LBRA 1XDLA 4K38A 1EP2A 3O3RA 4G9PA 1F6YA 2BHUA 1TZZA 2J74A 5EA9A 2FYMA 5HPCA 2OGJA 1JCMP 1WXJA 3AZSA 3AC0A 4AXKA 4M3PA 2CZDA 4KRZA 2KX9A 1CWYA 4PCPA 1ENUA 1UUOA 2PF8A 2DSWA 4FNPA 3GY1A 3LV6A 3E0FA 4WZHA 3OZPA 3PB2A 2PDHA 4LC6A 3ITOA 5CC6A 2PZNA 3C0SA 2ZRZA 2Q09A 1C91A 1AODA 3IANA 4JTAA 4HMEA 5C7HA 3M43A 2IPGA 3CWHA 1F4HA 1B57A 3S1XA 1FDJA 4NZ1A 4JTDA 3LHVA 5F1UA 2NWRA 4X9SA 1ONWA 3Q2DA 3K46A 3PF3A 3GBDA 3KAOA 3OZYA 2RFGA 2WBGA 2PLCA 1UBPC 3PPGA 1FRBA 1QT1A 2J62A 3IJIA 3VOGA 4D6FA 1ZTVA 1RLCL 3QMTA 3RR4A 1TPH1 3TYAA 1JCJA 5AKQA 3L5LA 5IHRA 5FF4A 3NG3A 3OP2A 4PBEA 4NY2A 2Z00A 1LBLA 4HYRA 4BF5A 1E73M 4Z0SA 1TELA 3I7SA 4HBKA 3RMEA 1E0WA 3NL5A 4K7VA 1PVNA 4A35A 1QNQA 4JTJA 4GZEA 1SZNA 1YBQB 1EHAA 1FOBA 1LOLA 1IEIA 4ZODA 3B8DA 1G4PA 1GYLA 3AJ7A 4WK9A 4P61A 4V27A 1E56A 3W24A 4GABA 2Z29A 3MV11 3PBGA 3ES8A 4AG0A 3AS1A 1O4UA 3U8GA 3VNLA 4NF7A 2OZ3A 3BOLA 3E49A 4L5ZA 1K7EA 2EG6A 1JRBA 3U7VA 5I3IA 1H62A 1XLIA 4TMCA 2PWGA 4WXZA 2OZ8A 4AISA 1W9XA 4B3ZA 4LAKA 3UGVA 3U5UA 3NOEA 3K13A 3REQA 4AYGA 4GINA 2C0AA 1WDQA 2I9EA 2J7EA 4O8AA 3VIJA 1PCKA 1YTEA 3R89A 3K4DA 3GXFA 1HUVA 4DJDA 5CPTA 3ITGA 2Q8XA 1VFMA 4JN7A 3VTRA 3MWAA 2UY5A 3SCPA 2ZICA 4RZ6A 4GMEA 1VGAA 3RG6A 4KKXA 4JY9A 1KV5A 3TOPA 1ICPA 4ZXOA 1GVOA 4WCJA 2Z27A 4JEQA 4GO8A 3D6NA 1J2WA 3NURA 4K3ZA 3AIQA 1OM0A 2FIQA 1V3IA 4XAGA 4Z1AA 1B9BA 5CZSA 4EANA 2YB4A 3QW4B 3WUBA 3CNYA 1KRCC 1IWAA 2NXGA 1XUUA 2OZTA 2HJPA 3DH7A 1M7OA 1NELA 2PLMA 3QY6A 1GYMA 2O4QA 4GK8A 4NJKA 3APYA