3PTBA

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptbA02
1ELBA 3I77A 1FLEE 5AHGH 1GMCF 1V2KT 1LQDB 3GY6A 1RTFB 3RXKA 5DP9A 3W95A 3BV9B 1MTNB 3SORA 4IC6A 5CMXH 2VB0A 2P3FH 3ZZ5A 5EXMA 4YLQH 2QIQA 4RSPA 1XKBC 4R8TB 1EUFA 5FX5A 3LKWA 1MZAA 4INHA 1DY9A 4OS1A 4ABBA 2HLCA 3RP2A 1GCTB 5FCRA 1C5VA 2W3IA 4DOQA 1LVYA 5T6DA 1AVGH 3ATWA 1S0QA 3UR9A 3SU3A 2W7UA 2AIPA 2KAIB 1D6WA 1SFQB 1BITA 2OCVB 1BMMH 2ZDVH 1BCUH 1ZJDA 2G8TA 3SN8A 4XFQA 1PPZA 1ELAA 1W12U 3SU1A 1K1IA 2PFEA 1O2JA 1THPB 4OS6A 4JK5A 3K6ZA 4X2YA 1GG6B 1S6HA 4D76A 3DFJA 2PSXA 4UFFH 3VB6A 1ANDA 2ZI2H 1GVLA 2PGBB 1EKBB 3A88A 1T32A 1FV9A 3TGIE 2ZCLP 4IMZA 2CMYA 3SI3H 3GOVB 2BDBA 2ANYA 4HFPB 3U8RH 3LPRA 3OY6U 2NU0E 4H6SB 3Q77A 2Q6DA 1N8OC 1AZZA 2ZU1A 1TNIA 2HPQH 4A5TS 1ELCA 5FXLA 1YPGH 3SV7A 5FBIA 4KGAA 3U8TH 1TPPA 4D9RA 1OYTH 3BN9A 3QK1A 1UHBB 3H5CB 1GL1A 1KY9A 3CS7A 1BQYA 3SI4H 3MWIU 1H1BA 1FXYA 1K22H 1DY8A 2BDYA 5FPTA 2AEIH 4U30A 1LQEA 1VZQH 2P3UB 2BDCA 1EX3A 1DS2E 4E06H 2OLGA 2ZFPH 1S6FA 1LKBA 1BHXF 3PLPA 5EQSA 4LZ1H 1AWFH 3M7QA 1DSTA 4X1NU 3TNTA 1NRQH 1OP0A 3ZV8A 1GHBG 1Y3XA 1IQJA 3DD2H 4MG3A 4DVAU 4AFSA 2Z7FE 1TA6A 3KQCA 1AMHA 2VIQA 3ZZ7A 2C93B 2A1DB 8GCHG 4MNXA 1OSSA 2OQUA 1YCPH 4MNYA 5J4QA 3PMBB 3RXQA 2LPRA 2ZFSA 3M5MA 5C2ZA 1TNGA 1BOQA 3LT3A 4ISLA 1XUHA 4OGYA 2C8YB 3E0PB 1HJ9A 3G01A 1J15A 3S9CA 3D49H 1ZMLA 1V3XA 1C1RA 1KIGH 4MLFB 1O3AA 4Y79A 4XBCA 1JIMA 1HJ8A 4X8UH 1TGNA 1H9LB 2P94A 3TK9A 2FESH 4O9VA 4CRDA 2TIOA 4WMEA 4A1XA 4THNH 4ZKOU 1BTXA 4UFGH 3VXEH 1BHXB 1EZXC 2BD5A 3P95A 1OPHB 2A2QH 4I8KA 2ZTYA 2XWBI 2FM2A 1PQ5A 2YNAA 1RS0A 2Y5GA 4UONA 3K2UA 3H7TA 2ZPSA 3MFJA 1AO5A 2W3KA 1F0UA 1O2LA 1O5CB 3F9GA 5DP5A 1E35B 1TGCA 4X2WA 1DWBH 1A3EH 2XC0A 1MUEB 1HXFH 1P05A 4CRAA 5CHAB 3LOXA 1D9IA 1C5LH 1K1PA 3LGVA 1NTPA 1QL9A 4Y11E 2Z9JA 2ZTZA 5B6OA 1O2PA 2PUQH 1UTJA 4YESB 2OBOA 1O5AB 1JRSA 1EAIA 3U8OH 1ESTA 3A87A 3GISB 4YLUA 4I31A 2WV5A 3BTME 1SGDE 4B76A 3FP7E 2O8TA 1J17T 4JYVH 4JCNA 4ABHA 1G37A 1CT0E 2JH5D 1C1WH 3Q3XA 4ASHA 1AQ7A 4DJZB 3SJ9A 1D3QB 2BY8X 1O3IA 4ABIA 3PMJA 2ZC9H 4NIVA 3RM0H 3GDUA 5DKMA 1EPTA 3K6YA 1O2IA 2C90B 1TX6A 2ZG0H 1NROH 2R2WU 3VGCC 1UVTH 1O2SA 1MBQA 1ELGA 1K21H 2F9UA 4O3UA 2XWAA 3A7XA 4FUHA 1K1LA 3Q76A 1GGDC 2SGAA 1FONA 1HAGE 4X1SU 5GWZA 1C1OA 2F91A 1V2NT 1WUNH 1SGIB 1W7XH 3B23B 4TY7A 4MPWA 1GHAG 1Z6JH 3LIWA 1C5UA 1Z71A 3P92A 2EI8A 3PWCA 1BBRH 1W11U 1AD8H 8LPRA 1RFNA 1C1VH 1KTTB 3GY7A 4ABDA 2QN5T 1NT1A 1UK2A 1G30B 2GDEH 1C5NH 1TIOA 3F9EA 2P8OB 1WBGB 1GI3A 4FXGH 4K1EA 1HYLA 2VIVA 1HIAB 5EXNA 1J8AA 1UJ1A 1DPOA 1ZOMA 4Q2KA 1QRWA 3RMOH 1Q2WA 1G2MA 4BTTB 1JBUH 1WTGH 2RCEA 1EAWA 3D65E 1PYTC 1AKSB 4A1VA 4F49A 2GCTC 3ZZ3A 5C5OA 1QJ1B 3EE0B 4AB9A 4Z0KA 4FUJA 4ABEA 5HMAA 2BD2A 2FOEA 2ZHQH 5F6MA 2Z3EA 1IQKA 1YLDA 2FP7B 1EB1H 3BTFE 2V3HH 1SGCA 1QB6A 1W8BH 2SFAA 2QXHA 2PR3A 1TLDA 1P03A 2Y80A 1O38A 2BXUH 1TE0A 3P8GA 6LPRA 3A7WA 1THSH 4CREA 4Y6DA 1AGJA 1HAYB 2P93A 3A84A 1W0ZU 2ODYB 1BTPA 1GMDF 2ZKSA 4CRCA 3U1JB 1ELTA 4U01A 1SLXB 1IQEA 2JETB 2V3OH 2GV7A 4X6PA 4NFEA 5DP4A 1AB9B 3W94A 3A8AA 3A7VA 3RXTA 2ESTE 3TJVA 5I46H 1O2RA 3A80A 2H2ZA 4NZLA 1TPSA 3LH3A 1SHHB 3JZ1B 1P11E 3O8DA 1QQUA 4X1RU 4LXBH 5A0BA 5I25A 2VH6A 1C5QA 5AF9H 4Q80A 2Q1JA 2A4OA 4MPXA 5GXPA 1TNLA 1SGTA 4X6MA 1NC6A 3BTKE 1VITG 3RMNH 1JRTA 1GJ5H 2PLXA 5JBBS 2GZ8A 1C5XB 2R3YA 3KGPA 1A2CH 1C2EA 2ZHEH 2Q6GA 2R0LA 3TH4H 1W10U 2A45B 4ISIH 1GBIA 4NSVA 5HM9A 1C1PA 5DP8A 1O31A 1O3OA 4AOQA 1EASA 3F68H 4B75A 4JZ1A 4NG9H 3STJA 1E34B 1OWDA 4Y0ZE 1MQ6A 1GJBB 1NRNH 1SGFG 1ESAA 4MNVA 2FLRH 1OYQA 7KMEH 2XRCA 1V2WT 3SUGA 2HGTH 3SV8A 1V2ST 1BTYA 1YM0A 5C20A 4K1SA 3VB4A 4ZKNU 3E8LA 4WWYA 5DP7A 1A61H 1BMNH 2QXJA 1L4DA 2HWLB 5L6NH 1T4UH 1TMTH 2HNTE 4JMYA 3KL6A 2VJ1A 3MU8A 3TITA 4A1TA 1A0HB 5DPAA 4AGKA 1HCGA 4BAHB 4NIWA 3SV2H 1BRCE 1GDUA 2FDAA 2ZFRH 3RM2H 4XBDA 1MKXK 3SNBA 1AFQB 1CT4E 1K1JA 1JXPA 2D2DA 1O5BB 3ZVCA 3ZVAA 2TRMA 3MO3A 2R2MB 1EXFA 4ZXYH 2G55A 1TNKA 2WYJA 3UREA 2CV3A 1QFKH 3M5LA 3SZNA 1OWJA 2AGIX 2P16A 3KF2A 4NWLA 4FUCA 2OP9A 1S83A 2J34A 3BEIB 1O3NA 1VCPA 2XBVA 2QCYA 5J4SA 1G36A 1IQFA 1ANBA 1OOKB 1O32A 2A5IA 5ESBA 5JDUB 3F9FA 1B0FA 4GVUA 1KYNA 2J92A 4D7GA 4MVNA 2GDDA 4ABFA 2A5KA 2DE9A 2R3UA 4BXSA 2Z9IA 2VINA 1Y3UA 4KTSA 2ANMH 1TGSZ 3P8OA 3RXPA 1TMUH 1AIXH 5C1UA 3SNDA 1C5PA 1P9SA 5F03A 1GI5A 2BMGB 1MD8A 2FWWA 1HJAB 2VIOA 4XE4A 5FAHA 3U9AH 4RN6A 2BQWB 1UVSH 3TJNA 1T4VH 1P06A 1YP9A 2BY5X 1O3FA 3EA8A 3VB5A 5SGAE 1S81A 1SGPE 1YPKH 1SFIA 1YPLH 4NFFA 4OS5A 4WJG2 5E0HA 1MD7A 1GJ7B 1DSUA 2GD4B 1O5FH 1UVPA 2A2XH 1VJ9U 3MI4A 2XCFA 5AFZH 2P59A 1XXFA 5IDKA 4XSKU 1SLWB 3F9HA 1J16A 1KDQA 1TYNA 3ATIA 2BX3A 4JZDH 4Y8XA 3P8FA 2G81E 4FU7A 3A82A 1YPHC 1WAYB 4BOHA 4ZUHA 1RD3B 2AMDA 1IQMA 2G52A 2F9PA 3LGUA 5F8XA 3GY3A 3LH1A 2HOBA 1TAWA 4GUXA 1P04A 1O2QA 2ZWLH 4Y10E 4INLA 3BTQE 5GIBA 1GI1A 2HRVA 1CBWC 1H9HE 3ATKA 2CXVA 1O5EH 2VVCA 1HAIH 1KXFA 2BDAA 1PQ7A 3O8BA 1EAUA 2WPIS 5H4IB 1UK3A 2PSYA 1TALA 2JH0D 4ZKRU 1ETSH 1TRNA 3M36A 1EZUC 1DXWA 1LHDH 1HAHH 4E05H 4K69A 1QA7A 1RIWB 2AIQA 4ZKSU 2ILNA 4GSOA 5T6FA 3ELAH 1SG8B 4DCDA 1GVKB 1S5SA 3BEFB 2EEKA 2BDHA 4HGCA 1O3MA 2HPPH 5GDSH 1BMAA 4I8GA 3FP8E 6CHAB 3ZVFA 1THRH 1C2KA 4X2XA 6GCHF 1OWEA 2GZ9A 3RXRA 5A2MH 1BT7A 2VWMA 1IHTH 3SJOA 3T27A 3A7ZA 5FPSA 3NK8A 1C9PA 5LPEA 4NA8A 1TQ0B 3LONA 5HXFA 3HK6B 1PPCE 4CBOA 4CRGA 4E7NA 1G3DA 3SW2B 3NZIA 1CGIE 1DOJA 1HAVB 1NU7B 2F3CE 1KXDA 4XBBA 2ALVA 2GGVB 1ZMNA 3KQBA 4JZIA 4U32A 3RXCA 1KXEA 4ZHAA 3M5OA 2GMTC 1ELDE 1OX1A 9ESTA 1HAZB 4YT6H 4B2BA 1CSOE 2QXGA 1FMGA 2FYQA 1O3EA 3KQDA 1S85A 5A8YA 5HM2A 3UUZA 1TGBA 1Z7KA 1FAKH 3V12A 4K8BA 2YOLA 1LMWB 1BA8B 2Z9GA 3DFLA 1NFUA 3ZVDA 2NU2E 4AFQA 4OS4A 1GDNA 3F1SB 1TBRH 3TJOA 1TPAE 2ZCHP 4J1YA 1L1JA 2G5VA 1O30A 4Q7ZA 2W5EA 2XTTB 1P09A 3QUMP 1NPMA 3PYHA 3O8RA 1ZHRA 2SGDE 1HFDA 1SQOA 3LJJA 3E0NB 1GVZA 3HPTB 3SNEA 1UMAH 6ESTA 1V2RT 4I32A 2J95A 3OX7U 2GCHG 3D23A 1EJMA 2J94A 4GHQA 3KIDU 1YC0A 1NRRH 4CRBA 4BANB 4GAWA 2Y5FA 4GCHG 2ANWA 2UWPA 2WYGA 3T26A 2UWOA 3BTHE 1GHVH 5EW1H 1LO6A 1GDQA 2ZHFH 3A89A 4K8YA 5JPMH 3PO1B 1G3CA 4LZ4B 4ZHMU 2BVRH 2OC0A 2ZCKP 3SGBE 2PKAA 3HGNA 1QBOA 1Q3XA 3BEUA 3EYDA 3RC5A 1MTNC 4Y7BA 2FO9A 3N7OA 1HGTH 5E8EH 1P02A 1C2HA 1RGQA 1YKTA 4BXWA 2FLBH 2JH6D 1QJ6B 3I78A 1GHZA 3BTTE 1TONA 1GJDB 3Q3YA 3SV9A 1FIZA 1KLIH 3A85A 3GCTF 3BG4B 2FOFA 5DG6A 4WXVA 1GCTC 2ZPQA 1L1GA 1ZGVA 1GMCG 4TPYA 3SJKA 3LJOA 4A92A 2V35A 1SQTA 3LGWA 3VXFH 1QA0A 1O2WA 1QGFA 1EB2A 4ZMAH 4X8SH 1C5OH 1SC8U 1VGCC 1BRAA 1K1MA 3FANA 3HKJB 3GDSA 3D62A 3A8BA 1NN6A 2BD4A 3UNRA 1LDTT 2B8OH 2WPLS 1GG6C 2G00A 4WH6A 3HKIB 5EPNA 3PWBA 1SGFA 4KTUA 2XNIA 2A7JA 3U69H 3LU9B 3MU0A 1W0YH 1TB6H 1FQ3A 5ESTE 1UCYK 4ZHLU 1EQ9A 1TABE 5EW2H 1BRBE 1A0LA 1GBHA 1PFXC 1W13U 2Z94A 3QZQA 3GCOA 2QC2A 1FDPA 4AYYB 1GI2A 4KELA 3GCHB 1XUKA 3PM3A 3AASA 1GHAF 5K7RA 1J9CH 4X8VH 1TOCB 2NU1E 2O8LA 3EDXB 4BAQB 1P2OA 3SBKA 1GHXH 1SLVB 2ANKH 4K5ZA 2ZQ1A 1XKAC 5BRRE 3VGCB 1PQAA 3OY5U 5JB9S 3M7UA 4A7IB 1HLTH 4NIXA 3PTNA 2TGTA 5F8ZA 3UWJH 1WQSA 2RA0A 1XUGA 3SU2A 1T8LA 1CO7E 4BAMB 1KXAA 1V2VT 1T31A 1JMOH 2C3SA 3U98H 1LTOA 3EA9A 1KXCA 1RTLA 2H9TH 1SB1H 1QY6A 3GCNA 4AN7A 1GBBA 3RDZA 2C4FH 1C1QA 4M7GA 1LPGB 1YYY1 5G4BA 5A0AE 2Z3CA 4YM9A 4O03A 4ESTE 3P17H 2FYRA 3CENA 4MQAA 1QIXB 4UE7H 3BIVH 5DJ7A 1BZXE 4HTCH 4I7YH 2HNTF 4AG2A 4MNWA 2BY7X 3NXPA 2GT7A 3UTUH 2D8WA 2BD8A 4UEHH 2WPJS 4PROA 4GHTA 4LOYH 2VU8E 4Y76A 2BLVA 1C1TA 2XW9A 4AB8A 1QB9A 2PV9B 3MTYA 4O97A 2DE8A 1CA0B 1MCVA 2GZ7A 1Z8IB 3UOPA 1KSNA 2XCNA 3BTGE 4AG1A 1LKAA 4CR5A 3KN2A 1V2LT 3GYLB 1F0RA 2QGRA 2RG3A 1P0SH 1FY5A 4WXIA 1FPCH 1UO6A 3STIA 1OP8A 3RC4A 1MBMA 3SQHE 1PYTD 1IAUA 2QF3A 1BBRE 7GCHF 3H7OA 1VR1H 3VB3A 4DG4A 1G3BA 4INKA 3RMMH 1ARBA 2ZIQH 4BAKB 4B73A 1SLUB 3AAUA 1EOJA 1Y5AT 3VPKA 3A83A 1ORFA 3A86A 5JB8S 2LNCA 4CHAB 1P3CA 3ZV9A 1A5HA 1IHSH 2IOTA 2VGCB 1ZSJA 2K1QA 1C2LA 1FUJA 3QLPH 3MNXA 5A8XA 1FY8E 4MPUA 1WQVH 1C5SA 2FMJA 1YPMH 4IW4E 1M9UA 1HAXB 5A09A 1DFPA 1NZQH 3BF6H 3ODDA 1C5YB 1U6QA 4X6NA 5AFYH 3RXDA 2CJIA 1SSXA 4RKJB 1FY3A 2D26C 1GCDA 3EQ0H 1MKWK 1GI6A 1LCYA 3PROA 4NWKA 1ZTKA 2Z9LA 2F9VA 3M5NA 1XUJA 1AUJA 2ULLA 3SGQE 2BQ7B 1ZHMA 4IMQA 1UTLM 3URDA 4Y8YA 1G32B 2SGFE 1WV7H 1P10A 4SGAE 3UOUA 2UWLA 4FVBA 3RXGA 2PHBA 1AHTH 2EA3A 1PPFE 9LPRA 3NPSA 2Z9KA 3QO6A 3S7HB 1T8NA 1WU1A 2ZFTA 5EG4A 1QL7A 1IOEA 1PJPA 1SOZA 1O2TA 1XXDA 1GJ6A 3Q00A 4TY6A 2WPHS 1BUIA 4IBLH 1SMFE 5A8ZA 2VH0A 5TCCA 4MPVA 1W2KH 3PMHB 2EI6A 4DT7B 1GJ4H 1O2XA 3M3TA 3Q3KA 3SU0A 2G5NA 4Q7YA 3QGNB 2A7CA 2FZZA 2J38A 1VCWA 2XBXA 3TGKE 1DDJA 5L30H 2PUXB 3FVFB 2P8OC 4X6OA 1EJAA 4Y71A 1GBDA 1K1NA 3LGTA 1ARCA 4FUIA 2TGPZ 1MTUA 2HVXA 5C67A 3ZZBA 1OXGA 1E36B 1FIWA 1P2QA 1Q31A 4JZFH 4K1TA 3T5FH 1Y5BT 3GDVA 2STAE 1ANEA 1EP6A 1ZGIA 3MU5A 3OSYA 2B5TB 1AVWA 3SHCH 1P2NA 3AAVA 1O2VA 3RXMA 3UQVA 4MTBA 1O3JA 1A5GH 2PGQB 1BTWA 1E38B 3ODFA 1XX9A 3RC6A 4X1QU 1IQHA 1SHYA 3RXAA 2A4GA 2D1JA 3UWIA 4TWYA 2Y5HA 4VGCB 3QDZB 1MTWA 1AFEH 2ODQA 2ZDMA 2TGAA 1NO9H 1O2ZA 1QJ7B 1Z8RA 1O2MA 4Y0YE 2H9EH 1HUTH 2PW8H 3IWMA 2JETC 3P8NA 4K3JA 1AB9C 1G2LA 1CA8B 4XDEA 1NESE 1YF4A 2A7HA 1WTHD 5LPFA 1SOTA 2BQ6B 3R0FA 2ZHWH 4FUGA 4NA9H 8KME2 1O2YA 1SL3A 2BD7A 1GMHF 5EXLA 1GWAA 2I6SA 1W3CA 2KAIA 1Y3YA 5TJXA 1P3EA 2FI4E 2NU3E 2SNVA 1DXPA 1UCYH 1KTSB 1F0SA 4ISNA 1EPTB 1FNIA 1MAXA 2FOHA 4WY3A 4OS2A 1QR3E 1MTSA 2Y82A 3QWCH 2EI7A 4JK6A 4TPIZ 1YCPK 1C5RA 1V2JT 2ZDNA 1XM1A 2B7DH 3FAOA 4H42U 5PTPA 1CVWH 1E37B 1GBMA 1O2HA 3SGAE 1LVMA 4B2AA 2H6MA 3L3TA 1LVOA 1N6YA 1CT2E 1UTMA 4CR9A 1QURH 1LHCH 1O0DH 2BHGA 2VWLA 3C27B 2AFQB 1G3EA 2VNTA 3MO9A 4NA7A 2FS8A 2QY0B 1CU1A 1Y8TA 3ZVEA 1Z1JA 1AUTC 2VIDA 1CHOF 2PKSC 2FOGA 3PV4A 4WH8A 3DUXH 1K1OA 3KEEA 3LGYA 3T2NA 5EPYA 1HRTH 1SGNE 1C2MA 1L1NA 1LHFH 2ZA5A 3TNSA 5L2ZH 1A46H 3BSQA 1FN6A 2ZDAH 3MHWU 1UHBA 4K60A 1V2MT 1EP5A 5EQQA 1UTPA 1JOUB 4BNRA 2W26A 1P2JA 1O3LA 2BY6X 3LDXH 1AFQC 2XXLA 1MU6B 2G51A 1F92A 4D9QA 5FCKA 3AW0A 3RXOA 2CHAB 4BTIB 2PTCE 3OU0A 2A4QA 4Y7AA 1V2OT 1C1MA 2CN0H 5AVDA 1QBNA 1ZSKA 2V0BA 3A7YA 1V2UT 2I6QA 2A5AA 5LH8A 4LK4A 1K9OE 2GP9B 3MYWA 1QB1A 2ZPRA 4H4FA 4ZXXH 3RU4E 4YTAA 2HALA 2O8WA 2Y7ZA 3DT0H 1K28D 3RMLH 2CGAA 1TFXA 3GY8A 1IQLA 1SBWA 4I8LA 2ZGBH 3SO3A 1HB0B 5DP6A 2G4UA 3RU4T 5GCHG 4J2YB 4YO9A 2FODA 2ZGCA 1O33A 2OQ5A 2ZECA 3ENSB 1G9IE 2GCHF 3QTOH 1BIOA 1A1RA 3S9AA 1F5RA 4GPGA 4I8JA 3V7TA 1BDAA 1ZJKA 1ZTJA 2H5CA 5CE1A 1XVMA 3L6PA 1FZZA 2H1UA 2BB4A 1B0EA 2BDIA 4KP0A 3ITIA 3S0NA 5EODA 1DITH 1Y59T 1HNEE 4TWWA 2GV6A 4WMDA 2F9BH 1ZR0A 1BTHH 1P12E 1C2IA 5E0JA 2AMPA 1OP2A 3IITA 2QYIA 1C4V2 1C2JA 2QF0A 3JZ2B 1HV7A 1NRSH 2BOKA 1Z8JB 1O3GA 1YPHE 1DWDH 3TVJB 1SGYE 1CGJE 1T8OA 1BBRK 4X0WU 3T62A 2B9LA 1TX8A 2ZNKH 3VEQB 2FTMA 8ESTE 1D6RA 3TLOA 5EU8A 5HGGA 4F4OC 3TJUA 3E91A 1N8OB 1AVXA 1WOFA 2ZU4A 3PTBA 1BJUA 1C5MD 2G4TA 1LVBA 2A31A 1HAPH 3M7TA 2J2UA 1CHGA 1GHBF 3RXSA 2F9NA 2OBQA 1O3KA 2J4IA 3I29A 2UUJB 2ZDKA 5TCAA 1F5KU 5E2PA 1L0ZA 1O36A 2OD3B 3HATH 8GCHF 1DUAA 1RIWC 4JYTA 2BVSH 2FOCA 2ZP0H 1GPZA 1SGQE 2OINA 1ETRH 1O5GH 2VVVA 4NGAH 1C2GA 5C3NA 1ZTLA 1DLEA 1SQAA 1FJSA 2ZGXH 6CHAC 1D4PB 1GL0E 3M61U 4ZROA 3NWUA 4DGJA 4HZHA 2SNWA 1VGCB 3T25A 3BTDE 3R3GB 2GT8A 3RLWH 5JBAS 3URCA 1GBCA 1MQ5A 2AS9A 1ABJH 2OXSA 2IJOB 1GHYH 2NU4E 4ISOA 4B1TA 1EAXA 2BDGA 2VWNA 2VIPA 4YOJA 1A4WH 1GBLA 1TBZH 1V2QT 4D8NA 6GCHG 1BJVA 3MO6A 3QTVH 5C1YA 1CQQA 3RXEA 1C5TA 3RLYH 1ABIH 1NY22 1EOLA 3SUDA 1Z8GA 1HIAA 1TQ7B 3TGJE 2PWXA 4FUDA 3MH4A 1S84A 3UPEA 1RTKA 1O2UA 3GY4A 2OTVA 4B71A 5ETXA 5E2OA 2C8WB 4FU8A 4IGDA 2Z3DA 1AKSA 4DW2U 1BB0B 1NFXA 4X2VA 1ZYOA 4AFZA 2BM2A 3A81A 4CH2B 1MKXH 3DHKH 1KDQB 3KCGH 1EJNA 3NUMA 2JKHA 3GY2A 1GBKA 1WCZA 2GTBA 1C2FA 3SNCA 1IQGA 1D3PB 1O3DA 1DANH 4NIYA 3OTJE 5IYTA 3TK5A 2Y7XA 1TX7A 1HBTH 2BXTH 2UUKB 1FI8A 5EQRA 1O34A 3V3MA 1GBAA 5DGJA 1MAYA 2NWNA 1C1UH 4YOIA 1UVUH 2AMQA 4AORA 2ZQ2A 3BIUH 4OS7A 1F5LA 1TNJA 2AH4X 1LPKB 2TBSA 2P3TB 2ZF0H 3ZZ6A 3ATMA 1NS3A 3PO1C 1HAOH 5C5NA 3RXIA 1C5WB 1BTUA 1FN8A 1Z1IA 2FOBA 2O8MA 1AY6H 3ZVGA 1PPBH 4YOGA 1UTKA 1ELEE 1A0JA 1XMNB 4IN2A 3T28A 2STBE 2BVXH 4ABJA 1WSSH 3F6UH 5FBEA 1O39A 3SHAH 1GBTA 4NSYA 1QRZA 2BX4A 1SGRE 1C5ZB 2SGEE 1ESBA 1O2NA 1EZSC 1VJAU 3ZZCA 1B7XB 2BLQA 3BG4C 4ABAA 5JBCS 1IQNA 1GJ9B 1O2KA 3SUFA 2BY9X 1GGDB 1H9IE 3RXVA 1Y5UT 1MH0A 4UFDH 3LC5A 1MZDA 1BRUP 2F9OA 2ZFFH 1DICA 3TPIZ 1PPGE 1OWIA 3GYMA 1MTVA 1HDTH 1NRPH 3UFAA 4D7FA 1P2KA 3FZDA 1T8MA 4RKOB 2WPKS 4O3TA 5GJ4B 3BTWE 4B74A 3QN7A 3GCTG 1DUEA 3U1IB 1J14A 1C1NA 3RXHA 5T3HA 2FI3E 3A8CA 1L2EA 2EC9H 1YBWA 3MNBA 3E1XB 1GJCB 4CRFA 1LPZB 2GCTB 5DO4H 1VCQA 1DX5M 2J9NA 1ZPZA 1FPHH 2O8UA 4KKDA 1FAXA 1HXEH 2WINI 3ZZ8A 3BTEE 1ZRBA 3WY8A 3HK3B 4ABGA 2ZU2A 4TYDA 3GCHC 2BZAA 3PLKA 1S82A 1UTQA 2C8XB 1CE5A 1RRKA 1ANCA 1OWKA 3KQEA 1ZLRA 1TRMA 2A4RA 1JIRA 2SGPE 3UQOA 4DIIH 1TRYA 1O3PB 1TWXB 4YT7H 1BTZA 1A3BH 1VITF 2F83A 2DUCA 1MU8B 1P57B 3ZYDA 3ZVBA 3HGPA 1TPOA 5EOKA 1GI9B 1RJXB 5CHAC 2Z6BD 1DT2A 2GKVE 2ZGJA 3EGKH 3T29A 1DM4B 2ZO3H 3PMAB 1O37A 1O35A 3RXBA 2ZTXA 3SUEA 3A8DA 2Y81A 2IN2A 3SJIA 5JBTA 2GVFA 3VFEA 2AYWA 2Q6FA 2THFB 1Y3VA 2PKAB 1DWCH 2C8ZB 3A7TA 3SNAA 2AGGX 4WF8A 1F2SE 2UUFB 1P2MA 1DE7H 1P01A 2RA3A 3QZRA 1SR5C 2XBWA 2XC4A 1GBJA 3SU6A 2FOAA 1JWTA 1QTFA 4I33A 5T6GA 3GICB 2BTCE 3UIRA 3MH7A 2FEQH 2FIRH 1AZ8A 1EZQA 5GPIB 1WYKA 1NFWA 1O3CA 3MU1A 1UVOA 2FX6A 2RDLA 1C1SA 1CA0C 1OKXA 2A0QB 3CS0A 4AYVB 1ZRKA 2R0KA 5ABWA 1ZMJA 4MDSA 3RXLA 3S9BA 1DWEH 1O5DH 1ID5H 2XYAA 1GBFA 1C4U2 3PB1E 5K0HA 4OGXA 3UY9A 5LPRA 4AX9H 5FX6A 2H5DA 2TPIZ 1LHEH 1V2TT 3E6PH 1W14U 4ISHH 1OS8A 3L33A 1MCTA 3P70B 4IC5A 3SQEE 1DLKB 2TGDA 4CHAC 1MMJN 1TA2A 1N1LA 1A5IA 1Z6EA 3K65B 2VGCC 1ETTH 2HNTC 3RXUA 4FU9A 2CF8H 1C4Y2 1ZSLA 3ATLA 3M37A 5DP3A 4Q7XA 3MH5A 3O8CA 1SPJA 2XBYA 1PPEE 1C2DA 5C1XA 2IPHA 2SGQE 4CBNA 7GCHG 5FPYA 1ZPBA 5FHTA 5DK1A 1LHGH 2R9PA 3ESTA 3E90B 3TK6A 4WMFA 2FTLE 1HPGA 3M35A 1GI7B 3DA9B 3SOSA 3TH2H 1HAVA 5A0CA 1ELVA 3MU4A 4DIHH 4K2YA 1H4WA 3SU5A 3SU4A 4CH8B 2P95A 4X8TH 1CGHA 3CP7A 5F8TA 1QL8A 2VIWA 1NFYA 4DURA 3MH6A 1GI8B 3SV6A 3V0XA 1H8IH 4AFUA 3S69A 2FOMB 3KHVA 1ZPCA 3MOCA 1QCPA 3K9XB 2BYAX 1FY4A 1RXPA 2PKSB 1W7GH 3M3SA 1PPHE 1YGCH 2QXIA 3RXFA 1GBEA 4AGJA 4JZEH 3QGJA 4ZH8A 4BTUB 2ALPA 1F7ZA 4H6TA 1GI4A 3RU4D 3TH3H 4UDWH 1TGTA 1UCYE 2VVUA 3S7KB 4ZAEA 1UTOA 1GMDG 3NCLA 3MMGA 4R0IA 1D3DB 1KLTA 1YCPM 3B8JA 2O9QA 1E0FD 1O2GH 1FY1A 1EATA 3M3VA 1NM6A 2ZDLA 2QA9E 4QT8C 1XUIA 2B0FA 3V13A 1V6DA 1QHRB 2Y6TA 1TBQH 5LGOA 5GCHF 2OC1A 1AWHB 1SVPA 2W7SA 3FZZA 2ZFQH 1O3HA 1H8DH 2BLOA 4NCYA 2BZ6H 4DY7B 1YPJH 4SGBE 1ZHPA 3C1KA 2GX4A 2WPMS 1CBWB 4AZ2B 1V2PT 4UFEH 3SJ8A 1VITH 2UUYA 3EAJA 1OWHA 3EA7A 2YNBA 1AU8A 5E0GA 1P8VC 1PQ8A 1IQIA 4VGCC 2ZU3A 3LGIA 2ASUB 1Y3WA 4UD9H 3TIUA 5L2YH 3ZZ4A 4E7RG 2OC7A 1GJAB 1AI8H 3BG8A 1UK4A 3OYPA 1ACBE 4FVDA 3UNQA 2OUAA 2CF9H 3E16B 3KNXA 1XUFA 2ZU5A 1X7AC 2XC5A 3IG6B 3MNSA 1GJ8B 3AVZA 4BAOB 1F0TA 1T7CA 1ELFA 2VWOA 1BMLA 1K2I1 1XVOA 1DVAH 4X1PU 1NU9A 3TU7H 4Y8ZA 3ZZAA 1S0RA 3FP6E 2ZHDA 5EGMA 3ZYEA 3GY5A 1EPTC 1TMBH 2GMTB 3B9FH 4I8HA 1L4ZA 2A32A 4IN1A 2QAAA 1O2OA 1KXBA 3ZZDA 2AGEX 4HI3A 3VB7A 1SI5H 1AN1E 4KTCA 4FUFA 5JYIA 1GMHG 2ZEBA 1INCA 1B5GH 5BPEA 7ESTE 2V6NA 2ZGHA 2FPZA 2AERH 1GHWH 1QBVH 4Z6AH 3NKKA 3AW1A 7LPRA 1HJAC 1KLJH 2BLWA 1YLCA 4FUBA 3QX5H 4GCHF 1P9UA 4FUEA 3MNCA 1C9TA 3RUOA 1SGEE 1QNJA 2FI5E 1QQ4A 2OC8A 4U2WA 2FX4A 1ZZZA 5HYOA 2M5TA 3FFGA 3PLBA 3UR6A 2QV1A 2FXRA 1AE5A 4A6LA 1A7SA 4B2CA 1TNHA 2WUCA 1YPEH 3E3TA 4IS5A 3ZZ9A 4WVPE 2WUBA 1TOMH 1MKWH 1GI0A 4GLYA 2ZZUH 1UTNA 2H9HA 1CHOG 2BD9A 1QRXA 2CHAC 2ODPA 2BD3A 1AE8H 1P2IA 1D3TB 2PTNA 4JYUH 1N6XA 4YZUA 3RXJA 3UNSA 1O3BA 4XOJA 3LC3A 2BOHB 2FS9A 4NZQA 2WV4A 3P6ZB
chains in the Genus database with same CATH superfamily
1ELBA 3I77A 4RT0A 1FLEE 5AHGH 1GMCF 1V2KT 1LQDB 3GY6A 1RTFB 3RXKA 5DP9A 3W95A 3BV9B 1MTNB 3SORA 5F53A 1WXRA 4IC6A 5CMXH 2VB0A 2P3FH 3ZZ5A 5DN6D 5EXMA 4YLQH 2QIQA 4RSPA 1XKBC 4OM9A 4R8TB 1EUFA 5FX5A 3LKWA 1MZAA 4INHA 1DY9A 4OS1A 4ABBA 2HLCA 3RP2A 1H8ED 1GCTB 5FCRA 1C5VA 2W3IA 4DOQA 1LVYA 5T6DA 1AVGH 3ATWA 1S0QA 3UR9A 3SU3A 2W7UA 2AIPA 2KAIB 1D6WA 1SFQB 1BITA 2OCVB 1BMMH 2ZDVH 5EJ1A 1BCUH 1ZJDA 2G8TA 4Q63A 3SN8A 4XFQA 1PPZA 1ELAA 1W12U 3SU1A 1K1IA 2PFEA 1O2JA 1THPB 4OS6A 4JK5A 3K6ZA 4X2YA 1GG6B 1S6HA 4D76A 3DFJA 4F48B 2PSXA 4UFFH 3VB6A 1ANDA 2ZI2H 1GVLA 2PGBB 1EKBB 3A88A 1T32A 2YMSC 1FV9A 3TGIE 2ZCLP 4IMZA 5HIYA 2CMYA 3SI3H 3GOVB 2BDBA 2ANYA 4HFPB 3U8RH 3LPRA 3OY6U 2NU0E 4H6SB 3Q77A 2Q6DA 1N8OC 1AZZA 2ZU1A 1TNIA 2HPQH 4A5TS 1ELCA 2W6JD 1YPGH 5FXLA 3SV7A 5FBIA 4KGAA 3U8TH 1TPPA 4D9RA 1OYTH 3BN9A 3QK1A 1UHBB 3H5CB 1GL1A 1KY9A 3CS7A 1BQYA 3F0OA 3SI4H 3MWIU 1H1BA 3KQ5A 1E79D 1FXYA 1YY3A 1K22H 1DY8A 2BDYA 5FPTA 2AEIH 4U30A 1LQEA 1VZQH 2P3UB 2BDCA 1EX3A 1DS2E 4E06H 2OLGA 2ZFPH 1S6FA 1LKBA 1BHXF 3PLPA 5EQSA 4LZ1H 1AWFH 3M7QA 1DSTA 4X1NU 3TNTA 1NRQH 1OP0A 3ZV8A 1GHBG 1Y3XA 1IQJA 3DD2H 4MG3A 4DVAU 4AFSA 2Z7FE 1TA6A 3KQCA 1AMHA 2VIQA 3ZZ7A 2C93B 2A1DB 8GCHG 4MNXA 1OSSA 2OQUA 1YCPH 2QF5A 4XRNA 4MNYA 5J4QA 3PMBB 3RXQA 2LPRA 2ZFSA 3M5MA 5C2ZA 3DCLA 1TNGA 1BOQA 3LT3A 4ISLA 1XUHA 3F2HA 2C8YB 3E0PB 2KCAA 4OGYA 1HJ9A 3G01A 1J15A 3S9CA 3D49H 1ZMLA 1V3XA 1C1RA 1KIGH 4MLFB 1O3AA 4Y79A 4XBCA 1JIMA 1HJ8A 4X8UH 1TGNA 1H9LB 2P94A 3TK9A 2FESH 4O9VA 4CRDA 2TIOA 4WMEA 4A1XA 4THNH 4ZKOU 1BTXA 4UFGH 3VXEH 1BHXB 1EZXC 2BD5A 3P95A 1OPHB 2A2QH 4I8KA 2ZTYA 2XWBI 2FM2A 1PQ5A 2YNAA 1RS0A 2Y5GA 4UONA 3K2UA 3H7TA 2ZPSA 3MFJA 1AO5A 2W3KA 1F0UA 1O2LA 1O5CB 3F9GA 5DP5A 1E35B 1TGCA 4X2WA 5C17A 1DWBH 1A3EH 2XC0A 1MUEB 1HXFH 1P05A 4CRAA 5CHAB 3LOXA 1D9IA 1C5LH 1K1PA 3LGVA 1NTPA 1QL9A 4Y11E 4P02A 2Z9JA 2ZTZA 5B6OA 1O2PA 2PUQH 1UTJA 4YESB 5CDFE 2OBOA 2W6ID 1O5AB 1JRSA 1EAIA 3U8OH 1ESTA 3NRLA 3A87A 3GISB 4YLUA 4I31A 2WV5A 3BTME 1SGDE 4B76A 3FP7E 2O8TA 1J17T 4JYVH 4JCNA 4ABHA 2F43B 2WSSD 1G37A 1CT0E 2JH5D 1C1WH 3Q3XA 4ASHA 1NBMD 1AQ7A 1EFRD 4DJZB 3SJ9A 1D3QB 2BY8X 1O3IA 4ABIA 3PMJA 2ZC9H 4NIVA 3RM0H 3GDUA 5DKMA 1EPTA 3K6YA 1O2IA 2C90B 1TX6A 2ZG0H 1NROH 2R2WU 3VGCC 1UVTH 1O2SA 1MBQA 1ELGA 1K21H 2F9UA 4O3UA 2XWAA 1OHHD 3A7XA 1K1LA 4FUHA 3Q76A 3PV5A 1GGDC 2SGAA 1FONA 1HAGE 4X1SU 5GWZA 5HIZA 1C1OA 2F91A 1V2NT 1WUNH 1SGIB 1W7XH 3B23B 4TY7A 4MPWA 3H09A 4B6EA 1GHAG 1Z6JH 3LIWA 1C5UA 1Z71A 3P92A 2EI8A 3PWCA 1BBRH 1W11U 1AD8H 8LPRA 1RFNA 1C1VH 1KTTB 3GY7A 4ABDA 2QN5T 1NT1A 1UK2A 1G30B 2GDEH 1C5NH 1TIOA 3F9EA 2P8OB 1WBGB 1GI3A 4FXGH 4K1EA 1HYLA 2VIVA 1HIAB 3OEHD 5EXNA 1J8AA 1UJ1A 1DPOA 1ZOMA 4Q2KA 1QRWA 3RMOH 1Q2WA 1G2MA 4BTTB 1JBUH 1WTGH 3UB0A 2RCEA 1EAWA 3D65E 1PYTC 1AKSB 4A1VA 4F49A 2GCTC 3ZZ3A 5C5OA 1QJ1B 5GNDA 3EE0B 4AB9A 4Z0KA 1QZ8A 4FUJA 4ABEA 5HMAA 2BD2A 2FOEA 2ZHQH 5F6MA 5KEDA 2Z3EA 1IQKA 1YLDA 2FP7B 1EB1H 3BTFE 2V3HH 1SGCA 1QB6A 1W8BH 2SFAA 2QXHA 2PR3A 1TLDA 1P03A 2Y80A 1O38A 2BXUH 1TE0A 3P8GA 6LPRA 3A7WA 1THSH 4CREA 4Y6DA 2K8IA 1AGJA 1HAYB 2P93A 3A84A 1W0ZU 2ODYB 1BTPA 1GMDF 2ZKSA 4CRCA 3U1JB 1ELTA 2QF4A 4U01A 1SLXB 1IQEA 2JETB 2V3OH 2GV7A 4X6PA 4NFEA 5DP4A 1AB9B 3W94A 3A8AA 3A7VA 3RXTA 2ESTE 3TJVA 5I46H 1O2RA 2LELA 2H2ZA 3A80A 4NZLA 1TPSA 3LH3A 1SHHB 3JZ1B 2KZ4A 1P11E 3O8DA 1QQUA 4X1RU 4LXBH 5A0BA 5I25A 2VH6A 1C5QA 5AF9H 4Q80A 2Q1JA 2A4OA 4MPXA 5GXPA 1TNLA 1W0KD 1SGTA 4X6MA 1NC6A 2CK3D 3BTKE 1VITG 3RMNH 1JRTA 1GJ5H 2PLXA 5JBBS 2GZ8A 1C5XB 3CNRA 2R3YA 3KGPA 1A2CH 1C2EA 2ZHEH 2Q6GA 2R0LA 3TH4H 1W10U 2A45B 4ISIH 1GBIA 4NSVA 5HM9A 1C1PA 5DP8A 1O31A 1O3OA 4AOQA 1EASA 3F68H 2WHXA 4B75A 4JZ1A 4NG9H 3STJA 1E34B 1OWDA 4Y0ZE 1MQ6A 1GJBB 1NRNH 2V7QD 1SGFG 1ESAA 4MNVA 2FLRH 1OYQA 7KMEH 2XRCA 1V2WT 3SUGA 2HGTH 3SV8A 2PP6A 1V2ST 1BTYA 1YM0A 5C20A 4K1SA 3VB4A 4ZKNU 3E8LA 4WWYA 5DP7A 1A61H 1BMNH 2QXJA 1L4DA 2HWLB 5L6NH 1T4UH 1TMTH 4ACAA 2HNTE 4JMYA 3KL6A 2VJ1A 3MU8A 3TITA 4A1TA 1A0HB 5DPAA 4AGKA 1HCGA 4BAHB 4NIWA 3SV2H 1BRCE 5EIYA 1GDUA 2FDAA 2ZFRH 3FKSD 3RM2H 4XBDA 1MKXK 3SNBA 1AFQB 1CT4E 1K1JA 1JXPA 2D2DA 1O5BB 3ZVCA 3ZVAA 2TRMA 3MO3A 2R2MB 1EXFA 4ZXYH 2G55A 3U28C 1TNKA 2WYJA 3UREA 2CV3A 1QFKH 3M5LA 3SZNA 1OWJA 2AGIX 2P16A 3KF2A 4NWLA 4FUCA 2OP9A 3DSOA 1S83A 2J34A 3BEIB 1O3NA 1VCPA 2XBVA 2QCYA 5J4SA 1G36A 1IQFA 1ANBA 1OOKB 1O32A 2A5IA 5ESBA 5JDUB 3F9FA 1B0FA 4GVUA 1KYNA 2J92A 4D7GA 2KCPA 2GDDA 4MVNA 4ABFA 2A5KA 2DE9A 2R3UA 4BXSA 2Z9IA 2VINA 1Y3UA 2J98B 2ANMH 4KTSA 1TGSZ 3P8OA 3RXPA 1TMUH 4P00A 1AIXH 5C1UA 3SNDA 1C5PA 1P9SA 5F03A 1GI5A 4ZCNA 2BMGB 1MD8A 2FWWA 1HJAB 2V3MA 2VIOA 4XE4A 3U9AH 5FAHA 4RN6A 2BQWB 1UVSH 2L6OA 3TJNA 1T4VH 1P06A 1YP9A 2BY5X 1O3FA 3EA8A 3VB5A 5SGAE 1S81A 1SGPE 1YPKH 1SFIA 1YPLH 4NFFA 4OS5A 4WJG2 2L74A 5E0HA 1MD7A 1GJ7B 1MABB 1DSUA 2GD4B 1O5FH 1UVPA 2A2XH 1VJ9U 3MI4A 2XCFA 4RI0A 5AFZH 2P59A 1XXFA 5IDKA 4XSKU 1SLWB 3F9HA 1J16A 1KDQA 1TYNA 3ATIA 2BX3A 4JZDH 4Y8XA 3P8FA 2G81E 4FU7A 3A82A 1YPHC 1WAYB 4BOHA 4ZUHA 1RD3B 2AMDA 1IQMA 2G52A 2F9PA 3LGUA 5F8XA 3GY3A 3SZEA 3LH1A 2QE7D 2HOBA 1TAWA 4GUXA 1P04A 1O2QA 2ZWLH 4Y10E 4INLA 3BTQE 5GIBA 1GI1A 2HRVA 1CBWC 1H9HE 3ATKA 2CXVA 1O5EH 2VVCA 1HAIH 1KXFA 2BDAA 1PQ7A 3O8BA 1EAUA 2WPIS 5H4IB 1UK3A 2PSYA 1TALA 2JH0D 4ZKRU 3F2FA 1ETSH 1TRNA 3M36A 1EZUC 1DXWA 1LHDH 1HAHH 4E05H 4K69A 1QA7A 1RIWB 2AIQA 4ZKSU 2ILNA 4GSOA 5T6FA 3ELAH 1SG8B 4DCDA 1GVKB 1S5SA 3BEFB 3OAAD 2EEKA 2BDHA 2JJ1D 4HGCA 1O3MA 2HPPH 5GDSH 1BMAA 4I8GA 3FP8E 6CHAB 3OFND 3ZVFA 1THRH 1C2KA 4X2XA 6GCHF 1OWEA 2GZ9A 3RXRA 5A2MH 1BT7A 2VWMA 3FO8D 1IHTH 3SJOA 3T27A 3A7ZA 5FPSA 5EJLA 3NK8A 1C9PA 5LPEA 4NA8A 1TQ0B 3LONA 5HXFA 3HK6B 1PPCE 4CBOA 4CRGA 4E7NA 1G3DA 3SW2B 3NZIA 1CGIE 1DOJA 1HAVB 1NU7B 2F3CE 1KXDA 4XBBA 2ALVA 2VBCA 2GGVB 1ZMNA 3KQBA 4JZIA 4U32A 3RXCA 1KXEA 4ZHAA 3M5OA 2GMTC 1ELDE 1OX1A 9ESTA 1HAZB 4YT6H 4B2BA 1CSOE 2QXGA 3GS9A 1FMGA 2FYQA 1O3EA 3KQDA 1S85A 5A8YA 5HM2A 3UUZA 1TGBA 1Z7KA 1FAKH 3V12A 4K8BA 2YOLA 1UW7A 1LMWB 1BA8B 2Z9GA 3DFLA 1NFUA 3ZVDA 2NU2E 4AFQA 4OS4A 1GDNA 3F1SB 1TBRH 3TJOA 2YMSD 1TPAE 2ZCHP 4J1YA 1L1JA 2G5VA 1O30A 4Q7ZA 2W5EA 2XTTB 1P09A 3QUMP 1NPMA 3PYHA 4RT1A 3O8RA 1ZHRA 2SGDE 1HFDA 1SQOA 3LJJA 3E0NB 1GVZA 3HPTB 3SNEA 1UMAH 6ESTA 1V2RT 4I32A 2J95A 3OX7U 2GCHG 3D23A 1EJMA 2J94A 4GHQA 3KIDU 1YC0A 1NRRH 4CRBA 4BANB 4GAWA 1SQRA 2Y5FA 4GCHG 2ANWA 2UWPA 2WYGA 3T26A 2UWOA 3BTHE 1GHVH 5EW1H 1LO6A 1GDQA 2ZHFH 3A89A 4K8YA 5JPMH 3PO1B 1G3CA 4LZ4B 4ZHMU 2BVRH 2OC0A 2ZCKP 3SGBE 2PKAA 3HGNA 1QBOA 1Q3XA 3BEUA 3EYDA 3RC5A 1MTNC 4Y7BA 2FO9A 3N7OA 1HGTH 5E8EH 1P02A 1C2HA 1RGQA 1YKTA 4BXWA 2FLBH 2JH6D 5IK2D 1QJ6B 3I78A 1GHZA 3BTTE 1TONA 1GJDB 3Q3YA 3SV9A 1FIZA 1KLIH 3A85A 3GCTF 2J5UA 3BG4B 2FOFA 5DG6A 4WXVA 1GCTC 2ZPQA 1L1GA 1ZGVA 1GMCG 4TPYA 3SJKA 3F3BA 3LJOA 2V35A 4A92A 1SQTA 3LGWA 5B6LA 3VXFH 1QA0A 1O2WA 1E1RD 1QGFA 4ACBA 1EB2A 4ZMAH 4X8SH 1C5OH 1SC8U 1VGCC 1BRAA 1K1MA 3FANA 3HKJB 3GDSA 3D62A 3A8BA 1NN6A 2BD4A 3UNRA 1LDTT 2B8OH 2WPLS 1GG6C 2G00A 4WH6A 4Z1MD 3HKIB 5EPNA 3PWBA 1SGFA 4KTUA 2XNIA 2A7JA 1YLNA 3LU9B 3U69H 3MU0A 1W0YH 1TB6H 1FQ3A 5ESTE 1UCYK 4ZHLU 1EQ9A 1TABE 5EW2H 1BRBE 1A0LA 1GBHA 1PFXC 1W13U 2Z94A 3QZQA 3GCOA 2QC2A 1FDPA 4AYYB 1GI2A 4KELA 3GCHB 1XUKA 3PM3A 3AASA 1GHAF 5K7RA 1J9CH 4X8VH 1TOCB 2NU1E 2O8LA 3EDXB 4BAQB 1P2OA 3SBKA 1GHXH 1SLVB 2ANKH 4K5ZA 2ZQ1A 1XKAC 5BRRE 3VGCB 1PQAA 3OY5U 5JB9S 3M7UA 4A7IB 1HLTH 4NIXA 3PTNA 3UAIC 2TGTA 5F8ZA 3UWJH 1WQSA 2RA0A 1XUGA 3SU2A 1T8LA 1CO7E 4BAMB 1KXAA 1V2VT 1T31A 1JMOH 2C3SA 3U98H 1LTOA 3EA9A 1W0JD 1KXCA 1RTLA 2H9TH 1SB1H 1QY6A 3GCNA 4AN7A 1GBBA 3RDZA 2C4FH 1C1QA 4M7GA 1LPGB 1YYY1 5G4BA 5A0AE 2Z3CA 4YM9A 4O03A 4ESTE 3P17H 2FYRA 3CENA 4MQAA 1QIXB 4UE7H 3BIVH 5DJ7A 1BZXE 4HTCH 4I7YH 2HNTF 4AG2A 4MNWA 2BY7X 3NXPA 2GT7A 3UTUH 1YWUA 2D8WA 2BD8A 4UEHH 4B6FA 2WPJS 4PROA 4GHTA 4LOYH 2VU8E 4Y76A 2BLVA 1C1TA 2XW9A 4AB8A 1QB9A 2PV9B 3MTYA 4O97A 2DE8A 1CA0B 1MCVA 2GZ7A 1Z8IB 3UOPA 1KSNA 2AHME 2XCNA 3BTGE 4AG1A 1LKAA 3WW7A 4CR5A 3KN2A 1V2LT 3GYLB 1F0RA 2QGRA 2RG3A 1BMFD 1FY5A 1P0SH 4WXIA 1FPCH 1UO6A 3STIA 1OP8A 3RC4A 1MBMA 2XNDD 3SQHE 1PYTD 1IAUA 2QF3A 1BBRE 7GCHF 3H7OA 1VR1H 3VB3A 4DG4A 1G3BA 4INKA 3RMMH 1ARBA 2ZIQH 4BAKB 4B73A 1SLUB 3AAUA 3OE7D 1EOJA 1Y5AT 3VPKA 3A83A 1ORFA 3A86A 5JB8S 2LNCA 4CHAB 1P3CA 3ZV9A 1A5HA 3WWFA 1IHSH 2IOTA 2KM0A 2VGCB 1ZSJA 2K1QA 1C2LA 1FUJA 3QLPH 3PRBA 3MNXA 5A8XA 1FY8E 4MPUA 1WQVH 1C5SA 2FMJA 1YPMH 4IW4E 1M9UA 1HAXB 5A09A 1DFPA 1NZQH 3BF6H 3ODDA 1C5YB 1U6QA 4X6NA 5AFYH 3RXDA 2CJIA 1SSXA 4RKJB 1FY3A 2D26C 1GCDA 3EQ0H 1MKWK 1GI6A 1LCYA 3PROA 4NWKA 1ZTKA 2Z9LA 2F9VA 3M5NA 1XUJA 1AUJA 2ULLA 3SGQE 2BQ7B 1ZHMA 4IMQA 1UTLM 3URDA 3DSGA 4Y8YA 1G32B 2SGFE 1WV7H 1P10A 4SGAE 3UOUA 2UWLA 4FVBA 3RXGA 2PHBA 1AHTH 2EA3A 1PPFE 9LPRA 3NPSA 2Z9KA 3QO6A 3S7HB 1T8NA 1WU1A 2ZFTA 5EG4A 1QL7A 2F4LA 1IOEA 1PJPA 1SOZA 1O2TA 1XXDA 1GJ6A 3Q00A 4TY6A 2WPHS 1BUIA 1SKYE 4IBLH 1SMFE 5A8ZA 2VH0A 5TCCA 4MPVA 1W2KH 3PMHB 3PRDA 2EI6A 4DT7B 1GJ4H 1O2XA 3M3TA 3Q3KA 3SU0A 2G5NA 4Q7YA 3QGNB 2A7CA 2FZZA 2J38A 1VCWA 2XBXA 3TGKE 1DDJA 5L30H 2PUXB 3FVFB 2P8OC 4X6OA 1EJAA 4Y71A 1GBDA 1K1NA 3LGTA 1ARCA 4FUIA 2TGPZ 1MTUA 2HVXA 5C67A 3ZZBA 1OXGA 1E36B 1FIWA 1P2QA 1Q31A 4JZFH 4K1TA 3T5FH 1Y5BT 3GDVA 2STAE 1ANEA 1EP6A 1ZGIA 3MU5A 3OSYA 2B5TB 1AVWA 3SHCH 1P2NA 3AAVA 1O2VA 3RXMA 3UQVA 4MTBA 1O3JA 1A5GH 2PGQB 1BTWA 1E38B 3ODFA 1XX9A 3RC6A 4X1QU 1IQHA 1SHYA 3RXAA 2A4GA 2D1JA 3UWIA 4TWYA 2Y5HA 4VGCB 2OK5A 2XOKD 3QDZB 1MTWA 1AFEH 2K0QA 2ODQA 2ZDMA 2TGAA 1NO9H 1O2ZA 1QJ7B 1Z8RA 1O2MA 4Y0YE 2H9EH 1HUTH 4TT3D 2PW8H 3IWMA 2JETC 2J97A 3P8NA 4K3JA 1AB9C 1G2LA 1CA8B 4XDEA 1NESE 1YF4A 2A7HA 1WTHD 2WV9A 5LPFA 1SOTA 2BQ6B 3R0FA 2ZHWH 4FUGA 4NA9H 8KME2 1WDIA 1O2YA 1SL3A 2BD7A 1GMHF 2KCYA 5EXLA 1GWAA 2I6SA 2WPDD 1W3CA 2KAIA 1Y3YA 5TJXA 1P3EA 2FI4E 2NU3E 2SNVA 1DXPA 1UCYH 3FOAA 1KTSB 1F0SA 4ISNA 1EPTB 1FNIA 1MAXA 2FOHA 4WY3A 4OS2A 1QR3E 1MTSA 2Y82A 3QWCH 2EI7A 4JK6A 4TPIZ 1YCPK 1C5RA 1V2JT 2ZDNA 1XM1A 2B7DH 3FAOA 4H42U 5PTPA 1CVWH 1E37B 1GBMA 1O2HA 3SGAE 1LVMA 4B2AA 2H6MA 3L3TA 1LVOA 1N6YA 1CT2E 1UTMA 4CR9A 1QURH 1LHCH 1O0DH 2BHGA 2VWLA 3C27B 2AFQB 1G3EA 2VNTA 3MO9A 4NA7A 2FS8A 2QY0B 1CU1A 1Y8TA 3ZVEA 1Z1JA 1AUTC 2VIDA 1CHOF 2HVYB 2PKSC 2FOGA 3PV4A 4WH8A 2KR7A 3DUXH 1K1OA 3KEEA 3LGYA 3WWBA 3T2NA 5EPYA 1HRTH 1SGNE 1C2MA 1L1NA 1LHFH 2ZA5A 3FN8A 3TNSA 5L2ZH 1A46H 3BSQA 1FN6A 2ZDAH 3MHWU 1UHBA 4K60A 1V2MT 1EP5A 5EQQA 1UTPA 1JOUB 4BNRA 2W26A 1P2JA 1O3LA 2BY6X 3LDXH 1AFQC 2XXLA 1MU6B 2G51A 1F92A 4D9QA 5FCKA 3AW0A 3RXOA 2CHAB 4BTIB 2PTCE 3OU0A 3OTPA 2A4QA 4Y7AA 1V2OT 1C1MA 2CN0H 5AVDA 1QBNA 1ZSKA 2V0BA 3A7YA 1V2UT 2I6QA 2A5AA 5LH8A 4LK4A 1K9OE 2GP9B 3MYWA 1QB1A 2EY4C 2ZPRA 4H4FA 4ZXXH 3RU4E 4YTAA 2HALA 2O8WA 2Y7ZA 3DT0H 1K28D 3RMLH 2CGAA 1TFXA 3GY8A 1IQLA 1SBWA 4I8LA 2ZGBH 3SO3A 1HB0B 5DP6A 2G4UA 3RU4T 5GCHG 4J2YB 4YO9A 2FODA 2ZGCA 1O33A 2OQ5A 2GJGA 2ZECA 3ENSB 1G9IE 2GCHF 3QTOH 1BIOA 1A1RA 3S9AA 3VG8A 1F5RA 4GPGA 4I8JA 3V7TA 1BDAA 1ZJKA 1ZTJA 2H5CA 5CE1A 1XVMA 4FOUC 3L6PA 1FZZA 2H1UA 2BB4A 1B0EA 2BDIA 4KP0A 3ITIA 3S0NA 5EODA 1DITH 1Y59T 1HNEE 4TWWA 2GV6A 4WMDA 2HLDD 2F9BH 1ZR0A 1BTHH 1P12E 1C2IA 5E0JA 2AMPA 1OP2A 3IITA 2QYIA 1C4V2 2RDEA 1C2JA 2QF0A 3JZ2B 1HV7A 1NRSH 2BOKA 1Z8JB 1O3GA 1YPHE 1DWDH 1KMHB 3TVJB 1SGYE 1CGJE 1T8OA 1BBRK 4X0WU 3T62A 2B9LA 1TX8A 2ZNKH 3VEQB 2FTMA 8ESTE 2YMSB 1D6RA 4FETA 3TLOA 5EU8A 5CHBA 5HGGA 4F4OC 3TJUA 3E91A 1N8OB 1AVXA 1WOFA 2ZU4A 3PTBA 1BJUA 1C5MD 2G4TA 1LVBA 2A31A 1HAPH 3M7TA 2J2UA 1CHGA 1GHBF 3RXSA 2F9NA 2OBQA 1O3KA 2J4IA 3I29A 3MQKC 2UUJB 2ZDKA 5TCAA 1F5KU 5E2PA 1L0ZA 1O36A 2OD3B 3HATH 8GCHF 1DUAA 1RIWC 4JYTA 2BVSH 2FOCA 2ZP0H 1GPZA 1SGQE 2OINA 1ETRH 1O5GH 2VVVA 4NGAH 1C2GA 5C3NA 1ZTLA 1DLEA 1SQAA 1FJSA 2ZGXH 6CHAC 1D4PB 1GL0E 3M61U 4ZROA 3NWUA 4DGJA 4HZHA 2SNWA 5T1VA 1VGCB 3T25A 3BTDE 3R3GB 2GT8A 3RLWH 5JBAS 3URCA 1GBCA 1MQ5A 2AS9A 1ABJH 1S6LA 2OXSA 2IJOB 1GHYH 2NU4E 4ISOA 4B1TA 1EAXA 2BDGA 2VWNA 2VIPA 4YOJA 1A4WH 1GBLA 1TBZH 1V2QT 4D8NA 6GCHG 1BJVA 3MO6A 3QTVH 5C1YA 1CQQA 3RXEA 1C5TA 3RLYH 1ABIH 1NY22 1EOLA 3SUDA 1Z8GA 1HIAA 1TQ7B 3TGJE 5C0TA 2PWXA 4FUDA 3MH4A 1S84A 3UPEA 4M9FA 1RTKA 2WZQA 1O2UA 3GY4A 2OTVA 4B71A 5ETXA 5E2OA 2C8WB 4FU8A 4IGDA 2Z3DA 1AKSA 1E1QD 4DW2U 1BB0B 1NFXA 4X2VA 1ZYOA 4AFZA 2BM2A 3A81A 4CH2B 1MKXH 3DHKH 1KDQB 3KCGH 1EJNA 3NUMA 2JKHA 3GY2A 1GBKA 1WCZA 2GTBA 1C2FA 2EQNA 3SNCA 1IQGA 1D3PB 1O3DA 1DANH 4NIYA 3OTJE 5IYTA 3TK5A 2Y7XA 1TX7A 1HBTH 2BXTH 5HKKD 2UUKB 1FI8A 5EQRA 1O34A 3V3MA 1GBAA 5DGJA 1MAYA 2NWNA 1C1UH 3N7DA 4YOIA 1UVUH 2AMQA 4AORA 2ZQ2A 3BIUH 4OS7A 5KECA 1F5LA 1TNJA 2AH4X 4ASUD 1LPKB 2TBSA 2P3TB 2ZF0H 3ZZ6A 3ATMA 1NS3A 3PO1C 1HAOH 4XD7D 5C5NA 4AC9A 3RXIA 1C5WB 1BTUA 4YXWD 1FN8A 1Z1IA 2FOBA 2O8MA 1AY6H 2IJD1 3ZVGA 1PPBH 4YOGA 1UTKA 1ELEE 1A0JA 1XMNB 4IN2A 3T28A 2STBE 2BVXH 4ABJA 1WSSH 3F6UH 5FBEA 1O39A 3SHAH 1GBTA 4NSYA 1QRZA 2BX4A 1SGRE 1C5ZB 2SGEE 1ESBA 1O2NA 1EZSC 1VJAU 3ZZCA 1B7XB 2BLQA 3BG4C 4ABAA 5JBCS 1IQNA 1GJ9B 1O2KA 3SUFA 2BY9X 1GGDB 1H9IE 3RXVA 3N7EA 1Y5UT 1MH0A 4UFDH 3LC5A 1MZDA 1BRUP 2F9OA 2ZFFH 1DICA 3TPIZ 1PPGE 3W1EA 1OWIA 3GYMA 5C0UA 1MTVA 1HDTH 1NRPH 3UFAA 4D7FA 1P2KA 3FZDA 1T8MA 4RKOB 2WPKS 4O3TA 5GJ4B 3BTWE 2KCOA 4B74A 1VKYA 3QN7A 3GCTG 1DUEA 3U1IB 1J14A 1C1NA 4HG6A 3RXHA 5T3HA 2FI3E 3A8CA 1L2EA 3AK5A 2EC9H 1YBWA 3MNBA 3ZIAD 3E1XB 1GJCB 4CRFA 1LPZB 2GCTB 5DO4H 1VCQA 1DX5M 2J9NA 3F2GA 1ZPZA 1FPHH 2O8UA 4KKDA 1FAXA 2M2AA 1HXEH 2WINI 3ZZ8A 3BTEE 1ZRBA 3WY8A 3HK3B 4ABGA 2ZU2A 4TYDA 2JJ2D 3GCHC 2BZAA 3PLKA 1S82A 1UTQA 2C8XB 1CE5A 1RRKA 1ANCA 1OWKA 3KQEA 1ZLRA 2LP6A 1TRMA 2A4RA 1JIRA 2SGPE 3UQOA 4DIIH 1TRYA 1O3PB 1TWXB 4YT7H 1BTZA 5EJZA 1A3BH 1VITF 2F83A 1FX0B 2DUCA 1MU8B 1P57B 3KYFA 3ZYDA 3ZVBA 3HGPA 1TPOA 5EOKA 1GI9B 1RJXB 5CHAC 2Z6BD 1DT2A 2GKVE 2ZGJA 3EGKH 3T29A 1DM4B 2ZO3H 3PMAB 2J98A 1O37A 1O35A 3RXBA 2ZTXA 3SUEA 3A8DA 2Y81A 2IN2A 3SJIA 5JBTA 2RFKC 2GVFA 3VFEA 2AYWA 2Q6FA 2THFB 2JDID 1Y3VA 2PKAB 1DWCH 2C8ZB 3A7TA 3SNAA 2AGGX 4WF8A 1F2SE 2UUFB 1P2MA 1DE7H 1P01A 3N99A 2RA3A 3QZRA 1SR5C 2XBWA 5KGOA 2XC4A 1GBJA 3SU6A 2FOAA 1JWTA 1QTFA 4I33A 5T6GA 3GICB 2BTCE 3UIRA 3MH7A 2FEQH 2FIRH 1AZ8A 1EZQA 5GPIB 1WYKA 1NFWA 1O3CA 3MU1A 1UVOA 2FX6A 2RDLA 1C1SA 1CA0C 1OKXA 2A0QB 3CS0A 2JIZD 4AYVB 1ZRKA 2R0KA 5ABWA 1ZMJA 4MDSA 3RXLA 3S9BA 1DWEH 1O5DH 1ID5H 2XYAA 1GBFA 1C4U2 3PB1E 5K0HA 4OGXA 3UY9A 5LPRA 4AX9H 5FX6A 2H5DA 2TPIZ 1LHEH 1NBME 1V2TT 3E6PH 1W14U 4ISHH 1OS8A 3L33A 1MCTA 3P70B 4IC5A 3SQEE 1DLKB 2TGDA 4CHAC 1MMJN 1TA2A 1N1LA 1A5IA 1Z6EA 3K65B 2VGCC 5C94A 1ETTH 2HNTC 3RXUA 4FU9A 2CF8H 1C4Y2 1ZSLA 3ATLA 3M37A 5DP3A 4Q7XA 5DSFA 4DT4A 3MH5A 3O8CA 1SPJA 2XBYA 1PPEE 1C2DA 5C1XA 2IPHA 2SGQE 4CBNA 7GCHG 5FPYA 1ZPBA 5FHTA 5DK1A 1LHGH 2R9PA 3ESTA 3E90B 3TK6A 4WMFA 3OEED 2FTLE 1HPGA 3M35A 1GI7B 3DA9B 3SOSA 3TH2H 1HAVA 5A0CA 1ELVA 3MU4A 4DIHH 4K2YA 1H4WA 3SU5A 3SU4A 4CH8B 2P95A 4X8TH 1CGHA 3F0PA 3CP7A 5F8TA 1QL8A 2VIWA 1NFYA 4DURA 3MH6A 1GI8B 3SV6A 3V0XA 1H8IH 4AFUA 3S69A 2FOMB 3KHVA 1ZPCA 3MOCA 1QCPA 3K9XB 2BYAX 1FY4A 1RXPA 2PKSB 1W7GH 2IPQX 3M3SA 1PPHE 1YGCH 2QXIA 3RXFA 1GBEA 4AGJA 3EE7A 4JZEH 3QGJA 4ZH8A 4BTUB 2ALPA 1F7ZA 4H6TA 1GI4A 3RU4D 3TH3H 4UDWH 1TGTA 1UCYE 2VVUA 3S7KB 3SYJA 4ZAEA 1UTOA 1GMDG 3NCLA 3MMGA 4R0IA 4Q4LA 1D3DB 1KLTA 1YCPM 3B8JA 2O9QA 1E0FD 1O2GH 1FY1A 1EATA 3M3VA 1NM6A 2ZDLA 1K0HA 2QA9E 4QT8C 1XUIA 2B0FA 3V13A 1V6DA 1QHRB 2Y6TA 1TBQH 5LGOA 5GCHF 2OC1A 1AWHB 1SVPA 2W7SA 3FZZA 2ZFQH 1O3HA 1H8DH 2BLOA 4NCYA 2BZ6H 4DY7B 1YPJH 3PV2A 4SGBE 1ZHPA 3C1KA 2GX4A 2WPMS 1CBWB 4AZ2B 1V2PT 4UFEH 3SJ8A 1VITH 2UUYA 3EAJA 1OWHA 3EA7A 2YNBA 1AU8A 5E0GA 1P8VC 1PQ8A 1IQIA 4VGCC 2ZU3A 3LGIA 4F55A 2ASUB 1Y3WA 4UD9H 3TIUA 2KFWA 5L2YH 3ZZ4A 4E7RG 2OC7A 1GJAB 1AI8H 3BG8A 1UK4A 3OYPA 1ACBE 4FVDA 2KX4A 3UNQA 2OUAA 2CF9H 3E16B 3KNXA 1XUFA 2ZU5A 1X7AC 2XC5A 3IG6B 3MNSA 3KYGA 1GJ8B 3AVZA 4BAOB 1F0TA 1T7CA 1ELFA 2VWOA 1BMLA 1K2I1 1XVOA 1DVAH 4X1PU 1NU9A 3TU7H 4Y8ZA 3ZZAA 1S0RA 3FP6E 2ZHDA 5EGMA 3ZYEA 3GY5A 1EPTC 1TMBH 2GMTB 3B9FH 4I8HA 1L4ZA 2A32A 4IN1A 4TSFD 2QAAA 1O2OA 1KXBA 3ZZDA 3DSPA 2AGEX 4HI3A 3VB7A 1SI5H 1AN1E 4KTCA 4FUFA 5JYIA 1GMHG 2ZEBA 1INCA 1B5GH 5BPEA 7ESTE 2V6NA 2ZGHA 2FPZA 2AERH 1GHWH 1QBVH 4Z6AH 3NKKA 3AW1A 7LPRA 1HJAC 1KLJH 2BLWA 1COWD 1YLCA 4FUBA 3QX5H 4GCHF 1P9UA 4FUEA 3MNCA 1C9TA 3RUOA 1SGEE 1QNJA 2FI5E 1QQ4A 2OC8A 4U2WA 2FX4A 1ZZZA 5HYOA 2M5TA 3FFGA 3PLBA 3UR6A 2QV1A 2FXRA 1AE5A 4A6LA 1A7SA 4B2CA 5FL7D 1TNHA 2WUCA 1YPEH 3E3TA 4IS5A 3ZZ9A 4WVPE 2WUBA 1TOMH 1MKWH 1GI0A 4GLYA 2ZZUH 1UTNA 2H9HA 1CHOG 2BD9A 1QRXA 2CHAC 2ODPA 2BD3A 1AE8H 1P2IA 1D3TB 2PTNA 4JYUH 1N6XA 4I86A 4YZUA 3RXJA 1H8HD 3UNSA 1O3BA 4XOJA 3LC3A 2BOHB 2FS9A 4NZQA 2WV4A 3P6ZB
chains in the Genus database with same CATH topology
1ELBA 3I77A 1FLEE 5AHGH 1GMCF 1V2KT 1LQDB 3GY6A 1RTFB 3RXKA 5DP9A 3W95A 3BV9B 1MTNB 3SORA 4IC6A 5CMXH 2VB0A 2P3FH 3ZZ5A 5EXMA 4YLQH 2QIQA 4RSPA 1XKBC 4R8TB 1EUFA 5FX5A 3LKWA 1MZAA 4INHA 1DY9A 4OS1A 4ABBA 2HLCA 3RP2A 1GCTB 5FCRA 1C5VA 2W3IA 4DOQA 1LVYA 5T6DA 1AVGH 3ATWA 1S0QA 3UR9A 3SU3A 2W7UA 2AIPA 2KAIB 1D6WA 1SFQB 1BITA 2OCVB 1BMMH 2ZDVH 1BCUH 1ZJDA 2G8TA 3SN8A 4XFQA 1PPZA 1ELAA 1W12U 3SU1A 1K1IA 2PFEA 1O2JA 1THPB 4OS6A 4JK5A 3K6ZA 4X2YA 1GG6B 1S6HA 4D76A 3DFJA 2PSXA 4UFFH 3VB6A 1ANDA 2ZI2H 1GVLA 2PGBB 1EKBB 3A88A 1T32A 1FV9A 3TGIE 2ZCLP 4IMZA 2CMYA 3SI3H 3GOVB 2BDBA 2ANYA 4HFPB 3U8RH 3LPRA 3OY6U 2NU0E 4H6SB 3Q77A 2Q6DA 1N8OC 1AZZA 2ZU1A 1TNIA 2HPQH 4A5TS 1ELCA 5FXLA 1YPGH 3SV7A 5FBIA 4KGAA 3U8TH 1TPPA 4D9RA 1OYTH 3BN9A 3QK1A 1UHBB 3H5CB 1GL1A 1KY9A 3CS7A 1BQYA 3SI4H 3MWIU 1H1BA 1FXYA 1K22H 1DY8A 2BDYA 5FPTA 2AEIH 4U30A 1LQEA 1VZQH 2P3UB 2BDCA 1EX3A 1DS2E 4E06H 2OLGA 2ZFPH 1S6FA 1LKBA 1BHXF 3PLPA 5EQSA 4LZ1H 1AWFH 3M7QA 1DSTA 4X1NU 3TNTA 1NRQH 1OP0A 3ZV8A 1GHBG 1Y3XA 1IQJA 3DD2H 4MG3A 4DVAU 4AFSA 2Z7FE 1TA6A 3KQCA 1AMHA 2VIQA 3ZZ7A 2C93B 2A1DB 8GCHG 4MNXA 1OSSA 2OQUA 1YCPH 4MNYA 5J4QA 3PMBB 3RXQA 2LPRA 2ZFSA 3M5MA 5C2ZA 1TNGA 1BOQA 3LT3A 4ISLA 1XUHA 4OGYA 2C8YB 3E0PB 1HJ9A 3G01A 1J15A 3S9CA 3D49H 1ZMLA 1V3XA 1C1RA 1KIGH 4MLFB 1O3AA 4Y79A 4XBCA 1JIMA 1HJ8A 4X8UH 1TGNA 1H9LB 2P94A 3TK9A 2FESH 4O9VA 4CRDA 2TIOA 4WMEA 4A1XA 4THNH 4ZKOU 1BTXA 4UFGH 3VXEH 1BHXB 1EZXC 2BD5A 3P95A 1OPHB 2A2QH 4I8KA 2ZTYA 2XWBI 2FM2A 1PQ5A 2YNAA 1RS0A 2Y5GA 4UONA 3K2UA 3H7TA 2ZPSA 3MFJA 1AO5A 2W3KA 1F0UA 1O2LA 1O5CB 3F9GA 5DP5A 1E35B 1TGCA 4X2WA 1DWBH 1A3EH 2XC0A 1MUEB 1HXFH 1P05A 4CRAA 5CHAB 3LOXA 1D9IA 1C5LH 1K1PA 3LGVA 1NTPA 1QL9A 4Y11E 2Z9JA 2ZTZA 5B6OA 1O2PA 2PUQH 1UTJA 4YESB 2OBOA 1O5AB 1JRSA 1EAIA 3U8OH 1ESTA 3A87A 3GISB 4YLUA 4I31A 2WV5A 3BTME 1SGDE 4B76A 3FP7E 2O8TA 1J17T 4JYVH 4JCNA 4ABHA 1G37A 1CT0E 2JH5D 1C1WH 3Q3XA 4ASHA 1AQ7A 4DJZB 3SJ9A 1D3QB 2BY8X 1O3IA 4ABIA 3PMJA 2ZC9H 4NIVA 3RM0H 3GDUA 5DKMA 1EPTA 3K6YA 1O2IA 2C90B 1TX6A 2ZG0H 1NROH 2R2WU 3VGCC 1UVTH 1O2SA 1MBQA 1ELGA 1K21H 2F9UA 4O3UA 2XWAA 3A7XA 4FUHA 1K1LA 3Q76A 1GGDC 2SGAA 1FONA 1HAGE 4X1SU 5GWZA 1C1OA 2F91A 1V2NT 1WUNH 1SGIB 1W7XH 3B23B 4TY7A 4MPWA 1GHAG 1Z6JH 3LIWA 1C5UA 1Z71A 3P92A 2EI8A 3PWCA 1BBRH 1W11U 1AD8H 8LPRA 1RFNA 1C1VH 1KTTB 3GY7A 4ABDA 2QN5T 1NT1A 1UK2A 1G30B 2GDEH 1C5NH 1TIOA 3F9EA 2P8OB 1WBGB 1GI3A 4FXGH 4K1EA 1HYLA 2VIVA 1HIAB 5EXNA 1J8AA 1UJ1A 1DPOA 1ZOMA 4Q2KA 1QRWA 3RMOH 1Q2WA 1G2MA 4BTTB 1JBUH 1WTGH 2RCEA 1EAWA 3D65E 1PYTC 1AKSB 4A1VA 4F49A 2GCTC 3ZZ3A 5C5OA 1QJ1B 3EE0B 4AB9A 4Z0KA 4FUJA 4ABEA 5HMAA 2BD2A 2FOEA 2ZHQH 5F6MA 2Z3EA 1IQKA 1YLDA 2FP7B 1EB1H 3BTFE 2V3HH 1SGCA 1QB6A 1W8BH 2SFAA 2QXHA 2PR3A 1TLDA 1P03A 2Y80A 1O38A 2BXUH 1TE0A 3P8GA 6LPRA 3A7WA 1THSH 4CREA 4Y6DA 1AGJA 1HAYB 2P93A 3A84A 1W0ZU 2ODYB 1BTPA 1GMDF 2ZKSA 4CRCA 3U1JB 1ELTA 4U01A 1SLXB 1IQEA 2JETB 2V3OH 2GV7A 4X6PA 4NFEA 5DP4A 1AB9B 3W94A 3A8AA 3A7VA 3RXTA 2ESTE 3TJVA 5I46H 1O2RA 3A80A 2H2ZA 4NZLA 1TPSA 3LH3A 1SHHB 3JZ1B 1P11E 3O8DA 1QQUA 4X1RU 4LXBH 5A0BA 5I25A 2VH6A 1C5QA 5AF9H 4Q80A 2Q1JA 2A4OA 4MPXA 5GXPA 1TNLA 1SGTA 4X6MA 1NC6A 3BTKE 1VITG 3RMNH 1JRTA 1GJ5H 2PLXA 5JBBS 2GZ8A 1C5XB 2R3YA 3KGPA 1A2CH 1C2EA 2ZHEH 2Q6GA 2R0LA 3TH4H 1W10U 2A45B 4ISIH 1GBIA 4NSVA 5HM9A 1C1PA 5DP8A 1O31A 1O3OA 4AOQA 1EASA 3F68H 4B75A 4JZ1A 4NG9H 3STJA 1E34B 1OWDA 4Y0ZE 1MQ6A 1GJBB 1NRNH 1SGFG 1ESAA 4MNVA 2FLRH 1OYQA 7KMEH 2XRCA 1V2WT 3SUGA 2HGTH 3SV8A 1V2ST 1BTYA 1YM0A 5C20A 4K1SA 3VB4A 4ZKNU 3E8LA 4WWYA 5DP7A 1A61H 1BMNH 2QXJA 1L4DA 2HWLB 5L6NH 1T4UH 1TMTH 2HNTE 4JMYA 3KL6A 2VJ1A 3MU8A 3TITA 4A1TA 1A0HB 5DPAA 4AGKA 1HCGA 4BAHB 4NIWA 3SV2H 1BRCE 1GDUA 2FDAA 2ZFRH 3RM2H 4XBDA 1MKXK 3SNBA 1AFQB 1CT4E 1K1JA 1JXPA 2D2DA 1O5BB 3ZVCA 3ZVAA 2TRMA 3MO3A 2R2MB 1EXFA 4ZXYH 2G55A 1TNKA 2WYJA 3UREA 2CV3A 1QFKH 3M5LA 3SZNA 1OWJA 2AGIX 2P16A 3KF2A 4NWLA 4FUCA 2OP9A 1S83A 2J34A 3BEIB 1O3NA 1VCPA 2XBVA 2QCYA 5J4SA 1G36A 1IQFA 1ANBA 1OOKB 1O32A 2A5IA 5ESBA 5JDUB 3F9FA 1B0FA 4GVUA 1KYNA 2J92A 4D7GA 4MVNA 2GDDA 4ABFA 2A5KA 2DE9A 2R3UA 4BXSA 2Z9IA 2VINA 1Y3UA 4KTSA 2ANMH 1TGSZ 3P8OA 3RXPA 1TMUH 1AIXH 5C1UA 3SNDA 1C5PA 1P9SA 5F03A 1GI5A 2BMGB 1MD8A 2FWWA 1HJAB 2VIOA 4XE4A 5FAHA 3U9AH 4RN6A 2BQWB 1UVSH 3TJNA 1T4VH 1P06A 1YP9A 2BY5X 1O3FA 3EA8A 3VB5A 5SGAE 1S81A 1SGPE 1YPKH 1SFIA 1YPLH 4NFFA 4OS5A 4WJG2 5E0HA 1MD7A 1GJ7B 1DSUA 2GD4B 1O5FH 1UVPA 2A2XH 1VJ9U 3MI4A 2XCFA 5AFZH 2P59A 1XXFA 5IDKA 4XSKU 1SLWB 3F9HA 1J16A 1KDQA 1TYNA 3ATIA 2BX3A 4JZDH 4Y8XA 3P8FA 2G81E 4FU7A 3A82A 1YPHC 1WAYB 4BOHA 4ZUHA 1RD3B 2AMDA 1IQMA 2G52A 2F9PA 3LGUA 5F8XA 3GY3A 3LH1A 2HOBA 1TAWA 4GUXA 1P04A 1O2QA 2ZWLH 4Y10E 4INLA 3BTQE 5GIBA 1GI1A 2HRVA 1CBWC 1H9HE 3ATKA 2CXVA 1O5EH 2VVCA 1HAIH 1KXFA 2BDAA 1PQ7A 3O8BA 1EAUA 2WPIS 5H4IB 1UK3A 2PSYA 1TALA 2JH0D 4ZKRU 1ETSH 1TRNA 3M36A 1EZUC 1DXWA 1LHDH 1HAHH 4E05H 4K69A 1QA7A 1RIWB 2AIQA 4ZKSU 2ILNA 4GSOA 5T6FA 3ELAH 1SG8B 4DCDA 1GVKB 1S5SA 3BEFB 2EEKA 2BDHA 4HGCA 1O3MA 2HPPH 5GDSH 1BMAA 4I8GA 3FP8E 6CHAB 3ZVFA 1THRH 1C2KA 4X2XA 6GCHF 1OWEA 2GZ9A 3RXRA 5A2MH 1BT7A 2VWMA 1IHTH 3SJOA 3T27A 3A7ZA 5FPSA 3NK8A 1C9PA 5LPEA 4NA8A 1TQ0B 3LONA 5HXFA 3HK6B 1PPCE 4CBOA 4CRGA 4E7NA 1G3DA 3SW2B 3NZIA 1CGIE 1DOJA 1HAVB 1NU7B 2F3CE 1KXDA 4XBBA 2ALVA 2GGVB 1ZMNA 3KQBA 4JZIA 4U32A 3RXCA 1KXEA 4ZHAA 3M5OA 2GMTC 1ELDE 1OX1A 9ESTA 1HAZB 4YT6H 4B2BA 1CSOE 2QXGA 1FMGA 2FYQA 1O3EA 3KQDA 1S85A 5A8YA 5HM2A 3UUZA 1TGBA 1Z7KA 1FAKH 3V12A 4K8BA 2YOLA 1LMWB 1BA8B 2Z9GA 3DFLA 1NFUA 3ZVDA 2NU2E 4AFQA 4OS4A 1GDNA 3F1SB 1TBRH 3TJOA 1TPAE 2ZCHP 4J1YA 1L1JA 2G5VA 1O30A 4Q7ZA 2W5EA 2XTTB 1P09A 3QUMP 1NPMA 3PYHA 3O8RA 1ZHRA 2SGDE 1HFDA 1SQOA 3LJJA 3E0NB 1GVZA 3HPTB 3SNEA 1UMAH 6ESTA 1V2RT 4I32A 2J95A 3OX7U 2GCHG 3D23A 1EJMA 2J94A 4GHQA 3KIDU 1YC0A 1NRRH 4CRBA 4BANB 4GAWA 2Y5FA 4GCHG 2ANWA 2UWPA 2WYGA 3T26A 2UWOA 3BTHE 1GHVH 5EW1H 1LO6A 1GDQA 2ZHFH 3A89A 4K8YA 5JPMH 3PO1B 1G3CA 4LZ4B 4ZHMU 2BVRH 2OC0A 2ZCKP 3SGBE 2PKAA 3HGNA 1QBOA 1Q3XA 3BEUA 3EYDA 3RC5A 1MTNC 4Y7BA 2FO9A 3N7OA 1HGTH 5E8EH 1P02A 1C2HA 1RGQA 1YKTA 4BXWA 2FLBH 2JH6D 1QJ6B 3I78A 1GHZA 3BTTE 1TONA 1GJDB 3Q3YA 3SV9A 1FIZA 1KLIH 3A85A 3GCTF 3BG4B 2FOFA 5DG6A 4WXVA 1GCTC 2ZPQA 1L1GA 1ZGVA 1GMCG 4TPYA 3SJKA 3LJOA 4A92A 2V35A 1SQTA 3LGWA 3VXFH 1QA0A 1O2WA 1QGFA 1EB2A 4ZMAH 4X8SH 1C5OH 1SC8U 1VGCC 1BRAA 1K1MA 3FANA 3HKJB 3GDSA 3D62A 3A8BA 1NN6A 2BD4A 3UNRA 1LDTT 2B8OH 2WPLS 1GG6C 2G00A 4WH6A 3HKIB 5EPNA 3PWBA 1SGFA 4KTUA 2XNIA 2A7JA 3U69H 3LU9B 3MU0A 1W0YH 1TB6H 1FQ3A 5ESTE 1UCYK 4ZHLU 1EQ9A 1TABE 5EW2H 1BRBE 1A0LA 1GBHA 1PFXC 1W13U 2Z94A 3QZQA 3GCOA 2QC2A 1FDPA 4AYYB 1GI2A 4KELA 3GCHB 1XUKA 3PM3A 3AASA 1GHAF 5K7RA 1J9CH 4X8VH 1TOCB 2NU1E 2O8LA 3EDXB 4BAQB 1P2OA 3SBKA 1GHXH 1SLVB 2ANKH 4K5ZA 2ZQ1A 1XKAC 5BRRE 3VGCB 1PQAA 3OY5U 5JB9S 3M7UA 4A7IB 1HLTH 4NIXA 3PTNA 2TGTA 5F8ZA 3UWJH 1WQSA 2RA0A 1XUGA 3SU2A 1T8LA 1CO7E 4BAMB 1KXAA 1V2VT 1T31A 1JMOH 2C3SA 3U98H 1LTOA 3EA9A 1KXCA 1RTLA 2H9TH 1SB1H 1QY6A 3GCNA 4AN7A 1GBBA 3RDZA 2C4FH 1C1QA 4M7GA 1LPGB 1YYY1 5G4BA 5A0AE 2Z3CA 4YM9A 4O03A 4ESTE 3P17H 2FYRA 3CENA 4MQAA 1QIXB 4UE7H 3BIVH 5DJ7A 1BZXE 4HTCH 4I7YH 2HNTF 4AG2A 4MNWA 2BY7X 3NXPA 2GT7A 3UTUH 2D8WA 2BD8A 4UEHH 2WPJS 4PROA 4GHTA 4LOYH 2VU8E 4Y76A 2BLVA 1C1TA 2XW9A 4AB8A 1QB9A 2PV9B 3MTYA 4O97A 2DE8A 1CA0B 1MCVA 2GZ7A 1Z8IB 3UOPA 1KSNA 2XCNA 3BTGE 4AG1A 1LKAA 4CR5A 3KN2A 1V2LT 3GYLB 1F0RA 2QGRA 2RG3A 1P0SH 1FY5A 4WXIA 1FPCH 1UO6A 3STIA 1OP8A 3RC4A 1MBMA 3SQHE 1PYTD 1IAUA 2QF3A 1BBRE 7GCHF 3H7OA 1VR1H 3VB3A 4DG4A 1G3BA 4INKA 3RMMH 1ARBA 2ZIQH 4BAKB 4B73A 1SLUB 3AAUA 1EOJA 1Y5AT 3VPKA 3A83A 1ORFA 3A86A 5JB8S 2LNCA 4CHAB 1P3CA 3ZV9A 1A5HA 1IHSH 2IOTA 2VGCB 1ZSJA 2K1QA 1C2LA 1FUJA 3QLPH 3MNXA 5A8XA 1FY8E 4MPUA 1WQVH 1C5SA 2FMJA 1YPMH 4IW4E 1M9UA 1HAXB 5A09A 1DFPA 1NZQH 3BF6H 3ODDA 1C5YB 1U6QA 4X6NA 5AFYH 3RXDA 2CJIA 1SSXA 4RKJB