3PTBA

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptbA02
1Y5AT 3I77A 6ESTA 3ATWA 4FU9A 4OS4A 1GWAA 1P3CA 1MBQA 1ANDA 4MG3A 3L6PA 3MU0A 5G4BA 2FOHA 3KQDA 2B9LA 4CRGA 1QIXB 4YOIA 3PLKA 3SOSA 1O39A 2C3SA 3F6UH 1UTMA 4AZ2B 5EXLA 1C5QA 2BY5X 1OXGA 1TGCA 2GTBA 1G2LA 3OX7U 5A8XA 1CGJE 3Q3YA 1TX6A 2ZHEH 3A8AA 1DY9A 3K6YA 4ASHA 4B2AA 1GHZA 1W3CA 1MKXK 1DSTA 1BTUA 4THNH 1GBIA 4UDWH 3AW1A 1E34B 4JYUH 1H9IE 3KQEA 1GJDB 2Z9LA 3M7TA 3A86A 2F9UA 1GBMA 2FOFA 2W7SA 1QHRB 1OYTH 3LGVA 2BTCE 1D6RA 1AQ7A 1LPKB 3LONA 5CHAC 5LPEA 2W5EA 2ZC9H 1P10A 1T8MA 2V0BA 3PTNA 4ESTE 5C1XA 3RXGA 5CHAB 4KTUA 4YT7H 2SGFE 1CQQA 1GI5A 2BD9A 4CBOA 3ZZAA 1IQGA 1LQEA 1O5DH 1S0QA 1ZZZA 5T6GA 2YNAA 2VINA 3A83A 3E90B 1O3GA 1X7AC 4DW2U 1A4WH 1GI4A 3UTUH 1GVKB 2P16A 4KELA 2QN5T 4ABHA 2W3KA 2P8OC 4H6TA 4I32A 2HOBA 3B8JA 1C2IA 2ZF0H 3BTWE 1SFQB 5FBIA 1IQFA 3Q76A 4D9RA 4FUHA 2ZEBA 4KP0A 4MPXA 1HAGE 1FY1A 3Q77A 2ZU5A 4ISHH 1UTKA 4MVNA 1XUHA 2ESTE 2ZGJA 1D3DB 1ELBA 4IC5A 3ZVFA 2PLXA 2Z94A 3SU4A 1EZXC 1AHTH 1UMAH 3P17H 4NIVA 3SGAE 1J8AA 1O0DH 4Q7YA 3KIDU 5C1UA 1W12U 2ZECA 1AKSA 2BB4A 3UNRA 1HAYB 1O2YA 1ELAA 3P8FA 1ZPZA 5F8XA 4B2CA 1BMAA 4ZKOU 1GHYH 1DWCH 4SGAE 3RU4E 2BOHB 5EXNA 3SNDA 3RC5A 2Z9KA 1UHBB 3UWJH 2BY7X 1Z6EA 3V0XA 1C5XB 1EJAA 1QCPA 1VCQA 3ZV9A 1AY6H 1YPHC 4Y11E 5JDUB 3ZVEA 3GDUA 1QL8A 3PMBB 1C2FA 5JBBS 1NRNH 2VWLA 5GWZA 4Y7AA 3RXRA 3PYHA 4JYTA 1IQMA 4TPIZ 3FZDA 1DXWA 1SR5C 2HGTH 3P8NA 4ABBA 5ETXA 1AVXA 4X6NA 1O2KA 2A4QA 1LHCH 1UCYH 1BBRK 3ZZDA 1GCTC 1O2SA 1MH0A 3RUOA 1BMMH 2DE9A 2XBYA 1OP2A 1PYTD 1EXFA 2O9QA 1GCTB 3SJ8A 1O30A 2ZQ1A 4AG2A 1GMHF 1Y59T 1ANBA 4TY7A 3VFEA 3MO3A 1S85A 3GCOA 3O8BA 1AUJA 1AVWA 2ZDLA 3SUDA 2WV5A 2FI3E 3SV8A 2FOBA 1P8VC 3VB7A 1ZHRA 3S69A 2FS9A 4X8UH 3T26A 1NO9H 3ZYDA 4I8GA 3ATIA 3BTEE 2ZTZA 1ETRH 1DUEA 4MNVA 3MTYA 4IMQA 5F8ZA 1XUJA 4WF8A 4K1EA 5TJXA 5EPNA 7GCHF 2FEQH 4X6MA 1C5LH 2FIRH 1T8OA 2WPLS 1IOEA 1THSH 3TH4H 1K1NA 4O3TA 2PR3A 1CE5A 1Y8TA 3SJOA 4NIYA 1EATA 1JXPA 1RXPA 1SGRE 1LVYA 5IDKA 1RFNA 1EP6A 4BXSA 1EPTC 1ARCA 1NESE 5IYTA 2QAAA 1V2UT 1AE8H 1BT7A 3BIVH 4KTCA 1FPCH 2A0QB 3GDVA 2V35A 1H8DH 2K1QA 1IHSH 3K65B 3DA9B 2Z7FE 3EA7A 3MOCA 5JBTA 1FY4A 2QF0A 1OWHA 1BB0B 1CO7E 2FZZA 3I29A 2J4IA 1QL7A 1PPGE 3LGYA 2CJIA 2HRVA 2V3HH 3HGNA 5CE1A 1V2KT 3U69H 2ASUB 1RIWC 3PMJA 3AASA 3MI4A 3M3SA 4VGCC 1J9CH 3RDZA 1EAUA 3ZZCA 1FN6A 3VXFH 2EI6A 1AZ8A 1RIWB 2VIWA 3F9EA 1YCPH 1NY22 4FUFA 1YP9A 4XFQA 4A5TS 9LPRA 2BXTH 1D9IA 4DG4A 3ZZ3A 1W7XH 2GX4A 6CHAC 1A2CH 1HPGA 1P2KA 3QK1A 3ODFA 1ABJH 3RLYH 1PPHE 2AH4X 4UONA 1V2VT 2Y7ZA 4FU7A 3VGCB 2B7DH 2CGAA 2SNVA 2BQ6B 1V2PT 1YM0A 3PB1E 2OC7A 6CHAB 1XX9A 4FUIA 4FXGH 1O36A 1O5BB 1AGJA 5B6OA 5K0HA 1THRH 3ZZ7A 2DUCA 2ULLA 3GY6A 1MD8A 3M35A 1SSXA 5H4IB 1OPHB 1NRQH 1YKTA 1GHVH 4HTCH 4AORA 1GMCG 4UFFH 2O8WA 2BVSH 4A6LA 2GDDA 1EB1H 1GG6C 1UHBA 2BLQA 1DPOA 1UO6A 2F9NA 3BN9A 5E2PA 1KSNA 1AUTC 1UTNA 1HAHH 5EGMA 2ODYB 5CMXH 3IWMA 3RU4D 1D3TB 1FXYA 2HPQH 1O2MA 3MFJA 1XVMA 4IBLH 1WTHD 1F0RA 1MUEB 1GJ8B 5BRRE 2VB0A 5L6NH 3L3TA 4YM9A 1SLXB 2HNTC 1MCTA 1OWIA 1WTGH 2CHAB 1C2EA 3SHAH 1O3MA 1SFIA 3SV7A 3RXCA 5L2YH 2XNIA 2XBWA 1EP5A 2VGCC 1D3QB 1E0FD 5C20A 1GHWH 4DY7B 1C1UH 1HAOH 1LHFH 3KF2A 3MWIU 5DP4A 5GXPA 1B5GH 1OX1A 1WV7H 2VGCB 3UY9A 1LVBA 1G3EA 3KCGH 3CENA 3PROA 4BXWA 1TNGA 4AYYB 3LH3A 1NFXA 1RD3B 4NWKA 3RM0H 2P95A 1C5OH 2XWAA 3RXEA 3GCNA 1NFWA 5L2ZH 1SOTA 1AFQB 2UUFB 2FOMB 2BVRH 4GSOA 3E8LA 2EC9H 1DS2E 1V2MT 4IMZA 4B74A 5T6DA 1E38B 3TGIE 5HM2A 4AFSA 1TNHA 3AAUA 2G5NA 3SNEA 1RRKA 1ZOMA 1CT4E 2UWLA 1A0HB 2Y7XA 5HXFA 1EB2A 5F8TA 5GDSH 2BY8X 1TRMA 2XWBI 2BD2A 2GCTB 2GCHG 1GI6A 5C67A 4OS1A 2NWNA 2QXHA 1DE7H 1TWXB 5FCRA 4FUBA 1SL3A 3B9FH 3SN8A 3ZZ8A 1O32A 2ALVA 1P02A 2C8XB 1ZTLA 1KDQA 1ZPCA 5EPYA 1GBTA 2BD7A 4NA9H 5EQRA 3KHVA 3P6ZB 3KNXA 2HALA 1EZQA 3A80A 1IQNA 1KTSB 1A3BH 2H5CA 1C2GA 5GIBA 1GHBG 2XW9A 4WMDA 4ISOA 2IPHA 1O33A 3RXMA 1PPCE 4HFPB 2GDEH 2EA3A 1BRUP 3A85A 4GVUA 2NU4E 3QZRA 2J92A 2SGQE 2VWNA 2YNBA 1UK4A 4RSPA 1V2LT 2CN0H 4X8TH 4JCNA 1NPMA 4MTBA 3SGQE 3UOPA 1C9PA 1TX8A 4WVPE 1OOKB 2PHBA 1EZSC 1ELEE 1KTTB 4MPUA 5JPMH 1FN8A 2Z3CA 1DSUA 2Z9JA 4B2BA 2DE8A 2BLWA 2V6NA 1Z7KA 4YO9A 4YZUA 1VJAU 4DGJA 2OC8A 4NIWA 2FOGA 1O3CA 2P59A 4K1SA 2BD4A 3GCTF 1HXFH 2FTLE 3NUMA 2TGPZ 3GDSA 4ABDA 1QJ6B 3PMAB 3RXQA 5EW2H 2P3TB 2PSXA 1HXEH 1NN6A 1WU1A 4ZKNU 1MTVA 1NRRH 4F4OC 4KKDA 5HGGA 2VIVA 5A0AE 1AO5A 1QR3E 2FDAA 1T8LA 1KXCA 4UFGH 4U01A 2NU2E 4YOJA 2H1UA 1XMNB 2HPPH 1O3AA 1FPHH 1GBKA 1TONA 1RGQA 1O35A 1IQLA 3SZNA 4Z6AH 1BRBE 4CH2B 3QZQA 4X8VH 1QRXA 1UJ1A 1Y3WA 4NGAH 1JMOH 3OYPA 2BX4A 3CS7A 1CSOE 1QRZA 1OWEA 1EAIA 2OBOA 1VGCC 4A1XA 3A8CA 4K1TA 3TVJB 2UWPA 5J4SA 4INLA 3K9XB 4MNWA 1XXDA 1TRNA 4QT8C 1TA2A 1TOMH 1DWDH 3GY3A 3TNTA 2D2DA 1PYTC 1WYKA 2ZG0H 1ELFA 3BSQA 3Q3KA 1GJAB 1O38A 7ESTE 3ZZ9A 5GCHF 1ZTJA 3MH7A 5ABWA 1SHHB 1AWFH 1AKSB 3UR9A 4DCDA 3MO6A 2QCYA 1FY8E 1MKWH 2GV6A 3U8RH 1TGTA 5AVDA 2ZDKA 1OWKA 6GCHG 3MH5A 3A8DA 4MQAA 1SB1H 1ZSJA 3BTDE 1CT2E 1WQVH 2FP7B 1UK2A 2BDHA 1TMUH 1VITG 3QO6A 2VU8E 3MU5A 1E37B 1NT1A 4I31A 2H9TH 1V2RT 3DFJA 3EQ0H 1V2NT 3VB3A 1FI8A 3BG4C 1XUFA 4H4FA 1GHAF 1GBHA 1P09A 1YGCH 4BTTB 5JBAS 3UQOA 5FBEA 3ZZ4A 1ACBE 4CBNA 1GCDA 1TAWA 2VVVA 5F03A 3BG4B 1O3JA 1KXDA 3E0NB 4GCHG 2JH0D 2BLOA 2H6MA 1QGFA 3RC4A 2I6SA 3GY8A 2GGVB 3SU5A 2BLVA 1AZZA 1GBDA 2J94A 4JZEH 4ISNA 1ZRKA 3GY4A 1AB9C 3SU3A 1P2QA 4I8JA 2AGGX 4FUGA 2ZCLP 1DITH 1NRPH 4ABIA 4CH8B 3UUZA 1TNKA 3FANA 1AB9B 1DWBH 3UR6A 1Z71A 1GL0E 1MTWA 1VCWA 1TYNA 1OP8A 2Y5GA 4M7GA 8ESTE 1UCYE 1DLEA 4Q7XA 1HCGA 1GJ6A 3P70B 1EAWA 1S5SA 1K1IA 2PW8H 3A89A 1ZGVA 1P3EA 1Z1IA 4FUDA 3SI4H 3OU0A 2WINI 2QGRA 2AMDA 2FODA 1LHDH 2RDLA 1DVAH 2QXGA 5EODA 2STAE 1XKBC 3UWIA 1S82A 4I8LA 1GI0A 1P11E 1FUJA 2CV3A 4X6OA 2GZ9A 1RTLA 3MYWA 2RG3A 3H7OA 1JOUB 1LO6A 4GUXA 1SQAA 1QB6A 2VIOA 2XC0A 2XRCA 2W7UA 4AFZA 1GJ7B 1O2XA 2TPIZ 1M9UA 2FO9A 1JIMA 3PWCA 4OGYA 2PUQH 3K6ZA 3SJIA 2VJ1A 1S81A 3F9FA 4AGJA 3R0FA 2ZFSA 4WH6A 2QV1A 2BDGA 3TIUA 1ABIH 1GMDF 2P8OB 1B7XB 1QBOA 3SV6A 7KMEH 4NIXA 5C5OA 1FZZA 1MU6B 2ALPA 2FXRA 2ZIQH 2ANYA 5HM9A 1O2PA 4XSKU 1WSSH 4BAQB 2ANMH 1GBJA 1KY9A 3TK6A 3BTGE 1YCPM 3AAVA 1O2IA 1TQ7B 1LHGH 3TPIZ 4ABJA 1GDUA 2ZPSA 1O3KA 2FS8A 3O8CA 3BF6H 3T28A 1ANCA 5I25A 4WH8A 3RMMH 1IQIA 3M36A 1GJCB 1O2GH 2JKHA 1TB6H 1WQSA 4ZROA 3SO3A 1PPEE 1NTPA 5FXLA 2A5IA 5C1YA 2OC0A 1K1LA 5C2ZA 3RXDA 4XDEA 1FONA 3NKKA 3SU2A 1YLDA 1A46H 4Y6DA 4XBCA 3EGKH 5LPRA 1MTUA 2C93B 4XBBA 3B23B 2OUAA 1E35B 2ZO3H 5AF9H 1CHOF 2BDIA 2FOCA 1W0ZU 2Q6GA 1A5HA 5J4QA 3TGKE 3QUMP 2V3OH 3T5FH 4IW4E 3S9AA 3TH3H 1K21H 1QBVH 3CS0A 1TMTH 2PKSC 1O2QA 3BEFB 1C1TA 1LVMA 1C5TA 2STBE 2ZP0H 2ZGHA 1TBQH 3O8RA 1NRSH 4BAMB 1QA7A 2SGPE 4FVDA 4FUJA 1XUIA 1JRSA 2PGQB 1MZAA 2P93A 2ZDNA 1TNIA 2GP9B 2H2ZA 2Q6DA 2BZ6H 2EI7A 1PPZA 1Z1JA 1MTSA 5DP6A 2Q1JA 1P2MA 1H8IH 4ZHLU 1ZSLA 2BD5A 1VZQH 1AWHB 2CMYA 1FAKH 1GMHG 4ZUHA 3DFLA 4JYVH 2G81E 3RXPA 3TJUA 3TGJE 1HV7A 4A7IB 1QQ4A 3MHWU 2ZDMA 2I6QA 5ESTE 1ELTA 1ELCA 3NWUA 1SGFG 3HKIB 1MZDA 1O2UA 1ELVA 1RS0A 3F9HA 4J2YB 2BD8A 5A0BA 3LGWA 1F5KU 1NU9A 2AMPA 3SI3H 1P12E 2PKAB 2ZA5A 1C2HA 7GCHG 2ODPA 1QJ1B 3PV4A 3RXBA 1A5GH 1EPTB 2FI4E 3U8TH 1KLIH 1O3OA 2PTNA 1CGIE 3LKWA 4BANB 3GY2A 2ZHQH 1SGDE 1UTQA 1CA0C 1LDTT 4AB9A 4DIIH 2PSYA 3URDA 1O2OA 1KDQB 4A1VA 3M5NA 2Y82A 3T62A 4AG1A 4D9QA 1O3FA 1PQ5A 2A7JA 3GOVB 4R8TB 1SHYA 1L1GA 1TNLA 1HAVB 2P3FH 1ZMJA 3A7YA 3LOXA 4X1RU 2J9NA 4ISIH 4NWLA 4ZH8A 2LNCA 4X2XA 4X0WU 1YPJH 1CVWH 5E0JA 1FLEE 3SHCH 4XBDA 2IN2A 3ITIA 4VGCB 1ZHMA 2NU1E 4R0IA 3T2NA 3GY5A 3HK3B 5EQSA 1XM1A 4E7RG 5DPAA 4AOQA 1HAPH 3NPSA 2G55A 3M7QA 2OXSA 2WUCA 1T8NA 1TNJA 2B8OH 4E7NA 2OCVB 1FJSA 5AFYH 3S9CA 3RMLH 2F3CE 3GY7A 1GVLA 3A7ZA 1J17T 1C2MA 2Z6BD 4BAKB 1C9TA 3D23A 1P0SH 1G3CA 4Y0YE 3PWBA 2FMJA 1BTXA 3QGNB 1GMCF 4TYDA 2F9OA 1QQUA 1MD7A 2ODQA 4K3JA 1CBWC 1O3LA 1C2DA 2FOAA 2ZTYA 7LPRA 1HUTH 1DANH 8KME2 1C2JA 4AFUA 2VWMA 1SLUB 5LGOA 1SGNE 1SG8B 4AB8A 1GG6B 4NSYA 4J1YA 3F68H 2Y81A 5DGJA 1H9LB 1L4ZA 1SLWB 4GHQA 2ZWLH 1MKXH 2A4GA 1BDAA 1IHTH 4O03A 3RXVA 1P2NA 2THFB 3HK6B 1C2LA 2CXVA 1K28D 1WCZA 1YPKH 4K5ZA 1O3NA 4X1NU 2IJOB 3MU8A 3JZ2B 1EUFA 1O3PB 1GPZA 8GCHF 1K1OA 1V2QT 1QY6A 2PTCE 3RXKA 4U30A 1F2SE 2H9HA 1N1LA 1ZLRA 2AIQA 3UNQA 9ESTA 1C2KA 4XE4A 3M3TA 1W14U 3SU0A 1H9HE 1VR1H 3T25A 1ARBA 1BTPA 2AIPA 3PO1C 4YT6H 5SGAE 2AFQB 2ILNA 1SLVB 2SFAA 5ESBA 3A7VA 1GI7B 3E1XB 2R2WU 1MCVA 4ZKSU 3PM3A 4D8NA 1EQ9A 2RA3A 3UPEA 1EJMA 5FX5A 1DT2A 2Y80A 2OC1A 3ZVDA 4Y79A 1L2EA 2F9VA 5LH8A 1SI5H 4NFEA 5A09A 1HAXB 1SPJA 1IQHA 4A92A 4D7FA 3FP7E 1W7GH 4I33A 1UVSH 2ZFFH 2G52A 1C5VA 2PKAA 2GCHF 2OBQA 1YPLH 3E16B 4JZ1A 2J34A 3LJOA 1ZYOA 5EG4A 3ESTA 2KAIB 3RM2H 1O31A 5FPYA 1EPTA 1NZQH 5DJ7A 3WY8A 1QJ7B 2BY9X 1JBUH 1V2OT 2A5AA 1W8BH 2R9PA 4Y76A 5HYOA 2OTVA 3TJNA 3QTOH 4AGKA 3SNBA 2H9EH 1A7SA 2G4UA 2Z9GA 3RC6A 1C4U2 1F5RA 1HAVA 1WOFA 4U32A 5EW1H 3QLPH 1LKAA 2FWWA 1PQ7A 2XCFA 2UUJB 1MU8B 1N6XA 3FVFB 1HFDA 3ZVGA 3STIA 3DUXH 4BOHA 1KXBA 1BA8B 1NFUA 1TLDA 5FX6A 1K2I1 1OYQA 3D49H 4X1PU 4AN7A 3O8DA 2VNTA 1WUNH 1INCA 2O8TA 2FYRA 1Z8IB 3KQBA 3LGTA 2AERH 1BTYA 1T4UH 2UUYA 1MBMA 1XKAC 1ZMNA 1BBRH 1C1MA 1LCYA 1V2ST 4HGCA 3BEUA 1V2TT 3VXEH 2A1DB 1ELGA 4MPWA 1Z8RA 3GISB 1DWEH 2J2UA 1B0EA 2RCEA 1EJNA 1FNIA 2QYIA 5L30H 2AGIX 1GJBB 3N7OA 4K69A 4RKJB 5TCCA 3UREA 1C5MD 1ZGIA 1EZUC 1YPEH 2FM2A 2FPZA 2Y5FA 3RXOA 4DT7B 2OQ5A 2SGEE 2JH5D 1O5AB 2C4FH 2BDCA 3M5OA 1C5NH 4KGAA 4YESB 3GCTG 3LGUA 1QB1A 1UCYK 3LH1A 1YPMH 1QURH 1O5CB 4Y8XA 3UNSA 1VCPA 4ZMAH 1GI9B 3P8GA 1DUAA 1RJXB 1SOZA 3S7HB 2WPHS 1U6QA 2O8LA 1QB9A 2BDYA 2A2QH 4A1TA 3K2UA 1N8OC 2R2MB 4NA7A 2P94A 4JK5A 3ZVBA 1N8OB 1D6WA 5A0CA 2ZGBH 2SGAA 1YLCA 3AW0A 1LMWB 1TMBH 3D65E 2GT7A 3A8BA 3SNAA 3SU1A 3EDXB 4WXIA 1CGHA 1VGCB 1NS3A 3GCHC 1ZHPA 5F6MA 1O3HA 1DOJA 4BTIB 1HJ8A 4X6PA 1C5SA 1P03A 4UFEH 3SBKA 3RXSA 2FX4A 4CR9A 1KLTA 1P9SA 3HGPA 2VIQA 1G9IE 2O8MA 3LGIA 2VIPA 5EOKA 2GD4B 2PWXA 4YOGA 1P57B 1O3DA 3SQHE 2BY6X 3QWCH 3BTKE 3UOUA 1RTFB 2A5KA 1J15A 2BXUH 4ZXYH 5T6FA 2GMTC 1C5PA 2D1JA 4Q80A 4ZHAA 2BQ7B 4WY3A 3M5MA 3BEIB 1SQOA 1NU7B 1DY8A 2WPMS 1GI2A 5E0GA 1UVPA 2GMTB 4X8SH 1ELDE 2W3IA 2ZFTA 2LPRA 1W2KH 4K60A 3A81A 1UVOA 2H5DA 2KAIA 3R3GB 2BM2A 3ELAH 2FTMA 4ZHMU 3VPKA 2SGDE 1LTOA 2QC2A 3ZZ5A 1TPSA 3TJVA 1F5LA 1P06A 4UEHH 4B73A 2GVFA 4BTUB 1OKXA 1JIRA 1QRWA 2R0KA 3Q00A 4I7YH 2C8WB 1TGSZ 2Z3DA 1P9UA 1F0SA 3IG6B 3E91A 3U8OH 1Z6JH 3MH4A 4DOQA 2A4RA 4INHA 4CRAA 4CRDA 1BHXF 1GJ4H 1SGPE 1Q3XA 4FVBA 3TNSA 6LPRA 1LQDB 4O9VA 1N6YA 1NC6A 1ZJKA 4LOYH 5A2MH 3A7TA 3GICB 4K8YA 4BNRA 1PPBH 2ZQ2A 3U9AH 2ZFQH 3E6PH 3MNSA 3BG8A 2TBSA 4ABAA 1O5FH 4JMYA 1ZTKA 3V3MA 2BDAA 3QX5H 5JB8S 2BDBA 3TK9A 8LPRA 1O2RA 2EEKA 3FZZA 2OLGA 3UFAA 4Y10E 4LK4A 1GHXH 2FESH 3LJJA 2M5TA 1O5EH 4YTAA 5DP3A 1ESTA 4RN6A 3S9BA 1C1QA 4OS2A 1O2LA 1L0ZA 1TGNA 2XXLA 5JB9S 1BOQA 3V7TA 3A82A 3TU7H 3U98H 1QA0A 3PTBA 3SV2H 1FDPA 1TFXA 2ZDVH 2Z9IA 3SUEA 2BMGB 1C5WB 2OD3B 1FV9A 3F9GA 4X1SU 4E06H 1DLKB 1W11U 1T7CA 3MU1A 3RP2A 4AX9H 4NA8A 4NZQA 5AFZH 4B71A 2VH6A 3BV9B 4OS5A 5GJ4B 1Z8JB 3UQVA 5AHGH 3TK5A 1C5ZB 5DP5A 5BPEA 4KTSA 1BIOA 1EKBB 1L1JA 1CT0E 1GBFA 4CRBA 1LPGB 2FLBH 4JZFH 2A2XH 1GVZA 1BMNH 1VJ9U 3S0NA 1HAIH 3TLOA 1F7ZA 1T4VH 3ZYEA 1Z8GA 1ZR0A 1FIZA 4OS7A 4UD9H 2O8UA 4B1TA 1GDNA 1TBZH 2Q6FA 5DO4H 3RMNH 4HI3A 4CREA 4ISLA 3OSYA 5I46H 2ZNKH 1DICA 4NZLA 1G32B 4XOJA 4DURA 1C1WH 1AN1E 1LKBA 3NZIA 4Q2KA 1HAZB 1GMDG 2OP9A 1FY5A 1HDTH 3TITA 1O3EA 3E3TA 1TOCB 4MNXA 2TIOA 3QDZB 2WYGA 3H7TA 3PLBA 3E0PB 1T32A 5JBCS 1CA8B 2B5TB 3LIWA 4DJZB 1OWJA 2FLRH 3PLPA 1BTZA 1QL9A 3OTJE 4CRFA 1K1JA 4X1QU 4AYVB 4CHAC 2A7CA 2F9BH 1VITH 3BTQE 1P01A 3TJOA 4WWYA 1L4DA 3BTHE 5JYIA 4CHAB 1BJUA 2GV7A 4LXBH 1KYNA 3KQCA 1C5YB 3MNCA 2BYAX 4GHTA 2BHGA 5E2OA 4D76A 1BTHH 1Q2WA 1XUGA 2VIDA 2AEIH 1TPPA 1UTPA 1C5UA 1QFKH 4D7GA 1AIXH 1UVUH 1SGEE 2XTTB 3KL6A 1CHOG 2J38A 1Y3VA 2UUKB 1Q31A 4H6SB 1SGIB 4IS5A 1BQYA 1DX5M 1PQ8A 4FUEA 4WJG2 2WPKS 1SBWA 2A4OA 2PKSB 1GGDC 2BX3A 2XC5A 3P95A 4B76A 3URCA 1O2HA 3RXFA 1G36A 2HLCA 4Y8YA 1SGQE 1GGDB 4NSVA 4FU8A 4SGBE 1C1VH 3T29A 3LDXH 1GI1A 1FMGA 2VVUA 4JZIA 1SGCA 2C8ZB 1IAUA 4GLYA 1C4V2 1TE0A 2NU0E 1G3DA 1YC0A 2F9PA 3A88A 3A87A 3SJKA 3QN7A 3RLWH 3D62A 2QIQA 2VH0A 1PPFE 1CHGA 3FP6E 4RKOB 1AD8H 2SNWA 1KXEA 1YPHE 1YF4A 2A31A 1UTJA 4I8KA 1P05A 2GT8A 1F0TA 3CP7A 1GBLA 4WMEA 3SV9A 1HNEE 2YOLA 1BTWA 2TGAA 1LVOA 1EOLA 3SJ9A 1O2WA 1J14A 3A84A 1TX7A 4O3UA 1C1NA 2ZTXA 4ABFA 5FCKA 3IITA 5HMAA 4MPVA 1MQ5A 2ZU1A 1ID5H 1CA0B 1S84A 2ZDAH 2AS9A 1AU8A 2HVXA 2XBVA 2G5VA 1TPAE 4NFFA 2ZU3A 2VVCA 1GI8B 3W95A 2JETC 1S6FA 2Y6TA 1OWDA 4E05H 2P3UB 2ZHDA 2JETB 3NCLA 5GPIB 3M61U 1UTOA 1THPB 4BAHB 1TRYA 4I8HA 1AE5A 3ENSB 1MKWK 1FY3A 2XCNA 3ATMA 1H1BA 2ZHFH 4ZAEA 1JWTA 4IC6A 3HKJB 4GAWA 1WBGB 3S7KB 4OGXA 1A61H 3VGCC 2C8YB 1H4WA 1PQAA 1BMLA 1O3IA 5A8YA 1T31A 1AVGH 2ZGCA 3MO9A 3C27B 3PMHB 4X2YA 2D26C 3AVZA 1HJAC 1QBNA 1S6HA 1OSSA 5FPTA 3SGBE 2AMQA 2FI5E 3EAJA 5DG6A 1SMFE 1CU1A 4ABGA 1BBRE 1CBWB 1MAYA 3LC5A 1HJAB 1GJ5H 1A0JA 2HWLB 2XC4A 1C5RA 1O2ZA 2BQWB 5K7RA 3EYDA 1ESAA 3P8OA 1HYLA 2G4TA 1KIGH 1ZRBA 1GBCA 1EOJA 1HLTH 4IN1A 2QXJA 2PV9B 1TBRH 1Y5BT 1PJPA 1G2MA 1MMJN 1GL1A 1V3XA 1NFYA 2ANKH 4Q7ZA 5FPSA 3BTTE 1A0LA 2IOTA 2ANWA 3LPRA 4Y7BA 1HJ9A 2CHAC 2TRMA 1FIWA 3SNCA 1A1RA 4INKA 1LHEH 4ABEA 1HRTH 3EA8A 2G51A 1GI3A 1GDQA 4PROA 1HGTH 2C90B 1RTKA 1J16A 3GYLB 1EX3A 1L1NA 1UK3A 2ZHWH 1MTNC 1SGFA 1G37A 3I78A 4TY6A 8GCHG 2HNTF 1TABE 1XUKA 1O2NA 1P2OA 3PO1B 5FAHA 3M5LA 1V2WT 3NK8A 2GZ7A 1BITA 1MTNB 5C5NA 4X2VA 2F83A 1C1RA 5EU8A 3HATH 1PFXC 3VB6A 1AFQC 4CRCA 3SU6A 1GBBA 4MDSA 2JH6D 4Y8ZA 2BD3A 1W0YH 1P2JA 3RXLA 4O97A 1O37A 4MLFB 3A7XA 2XYAA 4JK6A 3DHKH 3G01A 2ZCKP 1BRCE 4YLUA 4OS6A 3STJA 1AMHA 3JZ1B 5E0HA 1MAXA 1K9OE 1BJVA 4FUCA 3H5CB 5DP9A 2HNTE 3NXPA 1YPGH 3SQEE 1C4Y2 1WAYB 1P2IA 2TGTA 2AYWA 1BZXE 2GCTC 2QXIA 1G3BA 1D4PB 3DT0H 2VWOA 3QGJA 1F92A 1TIOA 2WPIS 2FOEA 2TGDA 4GPGA 3V12A 5EQQA 3VB4A 1K1MA 1Y5UT 3VEQB 4Z0KA 3EE0B 2Y5HA 2GKVE 1O2JA 3FAOA 4B75A 1OP0A 3VB5A 1DM4B 1TPOA 1B0FA 3KGPA 1GHBF 1O5GH 1FAXA 2QF3A 2AGEX 1YYY1 3HPTB 3UIRA 1QTFA 3Q3XA 4WMFA 2FX6A 3BTFE 5TCAA 3DD2H 3QTVH 1OS8A 3ZZ6A 2ZCHP 3MH6A 1ZSKA 2Z3EA 3U1IB 1HIAB 2ZPRA 1SGYE 3ZVCA 1IQJA 2ZFRH 1W13U 1Y3YA 1P04A 3MNXA 4ZKRU 4U2WA 3V13A 1YBWA 5E8EH 3BTME 1K1PA 1ETTH 3M37A 3KN2A 2NU3E 1Y3XA 1AI8H 3ATKA 3M7UA 1EASA 4IN2A 1O34A 1GBEA 3OY6U 5FHTA 1IQEA 2XBXA 5LPFA 1Y3UA 3MMGA 2WV4A 2G8TA 2CF8H 2WUBA 3KEEA 4K2YA 4HZHA 4JZDH 1V6DA 1SVPA 5C3NA 3MU4A 3ZZBA 1D3PB 3F1SB 4LZ1H 1O2VA 4CR5A 1BUIA 1HBTH 2F91A 2ZU4A 4DVAU 1BRAA 1TGBA 1C1OA 1E36B 1LPZB 2ZU2A 2ZI2H 1A3EH 2R0LA 5DKMA 1TQ0B 2BVXH 3RU4T 3RXTA 3TH2H 3L33A 1O2TA 1UVTH 1O3BA 2ZGXH 1BCUH 1QNJA 1EAXA 2B0FA 2W26A 2QY0B 4YLQH 4Y0ZE 1G30B 1ANEA 3RXUA 2CF9H 3ODDA 3OY5U 1FQ3A 1SQTA 3W94A 3M3VA 4K8BA 3SUGA 3ZVAA 1SC8U 1C1PA 4F49A 3ZV8A 2BOKA 1K22H 3LC3A 2GZ8A 3FFGA 3RXAA 4NG9H 1KLJH 3FP8E 3BIUH 2QA9E 3GCHB 3SUFA 2PFEA 4IGDA 1SGTA 5DK1A 2A7HA 1ORFA 1MQ6A 1DDJA 4UE7H 2G00A 1DXPA 1UTLM 2OINA 3GYMA 4H42U 2BZAA 4UFDH 4WXVA 1DFPA 4DIHH 1ESBA 3C1KA 6GCHF 1TA6A 1ZMLA 1KXFA 1KXAA 1JRTA 3A7WA 5GCHG 2ZPQA 3LT3A 1TALA 1VITF 1XVOA 4TPYA 4TWYA 4NCYA 1W10U 3MNBA 3P92A 2EI8A 2A32A 4AFQA 5DP7A 3SW2B 2D8WA 1NROH 2ZKSA 3RXHA 5EXMA 3LU9B 4ZXXH 2J95A 4BAOB 3RXIA 2PUXB 2R3YA 4GCHF 5PTPA 4LZ4B 3T27A 1C1SA 1ZJDA 1YCPK 2OQUA 1BHXB 1GBAA 1F0UA 1HB0B 3ATLA 3U1JB 1GHAG 2FYQA 1AFEH 1NM6A 3RXJA 1ZPBA 5T3HA 4X2WA 1XXFA 1ETSH 1S0RA 3RMOH 5A8ZA 4Y71A 1IQKA 2ZZUH 2A45B 4TWWA 2WPJS 2ZFPH 4MNYA 1V2JT 2R3UA 1A5IA 2WYJA 1HIAA 3EA9A 3SORA 2RA0A 1GJ9B 1S83A 2PGBB 5DP8A 2UWOA
chains in the Genus database with same CATH superfamily
4Q4LA 1Y5AT 3I77A 6ESTA 3ATWA 4FU9A 4OS4A 1GWAA 1P3CA 1MBQA 1ANDA 4MG3A 3L6PA 3MU0A 5G4BA 2FOHA 2EY4C 3KQDA 2B9LA 4CRGA 1QIXB 4YOIA 2KZ4A 3PLKA 3SOSA 1O39A 2C3SA 2WHXA 3F6UH 1UTMA 4OM9A 4AZ2B 5EXLA 1C5QA 2BY5X 1OXGA 1TGCA 2GTBA 1G2LA 3OX7U 5A8XA 1CGJE 3Q3YA 1TX6A 2ZHEH 3A8AA 1DY9A 3K6YA 4ASHA 4B2AA 1GHZA 1W3CA 1MKXK 1DSTA 1BTUA 4THNH 5DSFA 1GBIA 4UDWH 3AW1A 1E34B 4JYUH 1H9IE 3KQEA 1GJDB 2Z9LA 3M7TA 3A86A 2F9UA 1GBMA 2FOFA 2KCPA 2W7SA 1QHRB 1OYTH 3LGVA 2BTCE 1D6RA 1AQ7A 1LPKB 3LONA 5CHAC 5LPEA 2W5EA 1E79D 2ZC9H 1P10A 1T8MA 2V0BA 3PTNA 4RT0A 4ESTE 5C1XA 3RXGA 5CHAB 4FETA 4KTUA 4YT7H 2SGFE 1CQQA 1GI5A 2BD9A 5C17A 4CBOA 3ZZAA 1IQGA 1LQEA 1O5DH 1S0QA 1ZZZA 5T6GA 2YNAA 2VINA 3A83A 3E90B 1O3GA 4TSFD 1X7AC 4DW2U 1A4WH 3KQ5A 3PRBA 1GI4A 3UTUH 1GVKB 2P16A 4KELA 3PRDA 2QN5T 4ABHA 2W3KA 2P8OC 4H6TA 4I32A 2HOBA 3B8JA 1C2IA 2ZF0H 3BTWE 1SFQB 5FBIA 1IQFA 3Q76A 4D9RA 4FUHA 2ZEBA 4KP0A 4MPXA 1HAGE 1FY1A 3Q77A 2ZU5A 4ISHH 1UTKA 4MVNA 1XUHA 3AK5A 2ESTE 2ZGJA 1D3DB 1ELBA 4IC5A 3ZVFA 2PLXA 2Z94A 3SU4A 1EZXC 1AHTH 1UMAH 3P17H 4NIVA 3SGAE 1J8AA 1O0DH 4Q7YA 3KIDU 5C1UA 1W12U 2ZECA 1AKSA 2BB4A 3UNRA 1HAYB 1O2YA 1ELAA 3P8FA 1ZPZA 5F8XA 4B2CA 1BMAA 4ZKOU 1GHYH 1DWCH 4SGAE 3RU4E 2BOHB 5EXNA 3SNDA 3RC5A 2Z9KA 1UHBB 3UWJH 2BY7X 1Z6EA 3V0XA 1C5XB 1EJAA 1QCPA 1VCQA 3ZV9A 1AY6H 1YPHC 4Y11E 5JDUB 3ZVEA 3GDUA 1QL8A 5CHBA 3PMBB 1C2FA 5JBBS 1NRNH 2VWLA 5GWZA 4Y7AA 3RXRA 3PYHA 4JYTA 1IQMA 4TPIZ 3FZDA 1DXWA 3N99A 1SR5C 2HGTH 3P8NA 4ABBA 5ETXA 1AVXA 4X6NA 1O2KA 2A4QA 1LHCH 1UCYH 1BBRK 3ZZDA 1GCTC 1O2SA 1MH0A 3RUOA 1BMMH 2DE9A 2XBYA 1OP2A 1PYTD 1EXFA 2O9QA 1GCTB 3SJ8A 1O30A 2ZQ1A 4AG2A 1GMHF 1Y59T 1ANBA 4TY7A 3VFEA 3MO3A 1S85A 3GCOA 3N7DA 3O8BA 4XRNA 1AUJA 1AVWA 2ZDLA 3SUDA 2WV5A 2FI3E 3SV8A 2KM0A 2FOBA 1P8VC 5EJLA 3VB7A 1ZHRA 3S69A 2FS9A 4X8UH 3T26A 1NO9H 3ZYDA 4I8GA 3ATIA 3BTEE 2ZTZA 1ETRH 1DUEA 4MNVA 3MTYA 4IMQA 5F8ZA 1XUJA 4WF8A 4K1EA 5TJXA 5EPNA 7GCHF 2FEQH 4X6MA 1C5LH 2FIRH 1T8OA 2WPLS 1IOEA 1THSH 3TH4H 5KECA 1K1NA 4O3TA 2PR3A 1CE5A 1Y8TA 3SJOA 4NIYA 1EATA 1JXPA 1RXPA 1SGRE 1LVYA 5IDKA 1RFNA 1EP6A 4BXSA 1EPTC 1ARCA 1NESE 5IYTA 2QAAA 1V2UT 1AE8H 1BT7A 3BIVH 2WPDD 4KTCA 1FPCH 4ZCNA 5C94A 2A0QB 3GDVA 2V35A 1H8DH 2K1QA 1IHSH 3K65B 3DA9B 2Z7FE 3EA7A 3MOCA 5JBTA 1FY4A 2QF0A 1OWHA 1BB0B 1CO7E 2FZZA 3I29A 2J4IA 1QL7A 1PPGE 3LGYA 2CJIA 2HRVA 2V3HH 3HGNA 5CE1A 1V2KT 3U69H 2ASUB 4Z1MD 1RIWC 3PMJA 3AASA 3MI4A 3M3SA 4VGCC 1J9CH 3RDZA 1EAUA 3ZZCA 1FN6A 3VXFH 2EI6A 1AZ8A 1RIWB 2VIWA 3F9EA 1YCPH 1NY22 4FUFA 1YP9A 4XFQA 4A5TS 9LPRA 2BXTH 1D9IA 4DG4A 3ZZ3A 1W7XH 2GX4A 6CHAC 1A2CH 1HPGA 1P2KA 3QK1A 3ODFA 1ABJH 3RLYH 1PPHE 2AH4X 4UONA 1V2VT 2Y7ZA 4FU7A 3VGCB 2B7DH 2CGAA 2SNVA 2BQ6B 1V2PT 1YM0A 3PB1E 2OC7A 6CHAB 1XX9A 4FUIA 4FXGH 1O36A 1O5BB 1AGJA 5B6OA 5K0HA 1THRH 3ZZ7A 2DUCA 2ULLA 3GY6A 1MD8A 3M35A 1SSXA 5H4IB 1OPHB 1NRQH 1YKTA 1GHVH 2XOKD 4HTCH 4AORA 1GMCG 4UFFH 2O8WA 2BVSH 4A6LA 2GDDA 1EB1H 1GG6C 1UHBA 2BLQA 1DPOA 1UO6A 2F9NA 3BN9A 5E2PA 1KSNA 1AUTC 1UTNA 1HAHH 5EGMA 2ODYB 5CMXH 3IWMA 3RU4D 1D3TB 1FXYA 2HPQH 1O2MA 3MFJA 1XVMA 4IBLH 1WTHD 1F0RA 1MUEB 1GJ8B 5BRRE 2VB0A 2KCYA 5L6NH 3L3TA 4YM9A 1SLXB 2HNTC 1MCTA 1OWIA 1WTGH 2CHAB 1C2EA 3SHAH 1O3MA 1SFIA 3SV7A 3RXCA 5L2YH 2XNIA 5HKKD 2XBWA 1WXRA 1EP5A 2VGCC 1D3QB 1E0FD 5C20A 1GHWH 4DY7B 2M2AA 1C1UH 1HAOH 1LHFH 3KF2A 3MWIU 5DP4A 5GXPA 1B5GH 1OX1A 1WV7H 2VGCB 3UY9A 1LVBA 1G3EA 3KCGH 3CENA 3PROA 4BXWA 1TNGA 4AYYB 3LH3A 1NFXA 1RD3B 4NWKA 3RM0H 2P95A 1C5OH 2XWAA 3RXEA 3GCNA 1NFWA 5L2ZH 1SOTA 1AFQB 2UUFB 2FOMB 2BVRH 4GSOA 3E8LA 2EC9H 2J98B 1DS2E 1V2MT 4IMZA 4B74A 5T6DA 1E38B 3TGIE 4XD7D 5HM2A 4AFSA 1TNHA 3AAUA 2G5NA 3SNEA 3DCLA 1RRKA 1ZOMA 1S6LA 1CT4E 2UWLA 1A0HB 2Y7XA 5HXFA 1EB2A 5F8TA 3OFND 2BY8X 1TRMA 2XWBI 5GDSH 2BD2A 2GCTB 2GCHG 1GI6A 5C67A 4OS1A 2NWNA 2QXHA 1DE7H 1TWXB 5FCRA 4FUBA 1SL3A 3B9FH 3SN8A 3ZZ8A 1O32A 2ALVA 1P02A 2C8XB 1ZTLA 1KDQA 1ZPCA 5EPYA 1GBTA 2BD7A 4NA9H 5EQRA 3KHVA 3P6ZB 3KNXA 2HALA 2HVYB 1EZQA 3F0PA 3A80A 1IQNA 1KTSB 1A3BH 2H5CA 1C2GA 5GIBA 1GHBG 2XW9A 4WMDA 4ISOA 2IPHA 1O33A 3RXMA 1PPCE 4HFPB 2GDEH 2EA3A 1BRUP 3A85A 4GVUA 2NU4E 3QZRA 2J92A 2SGQE 2VWNA 2YNBA 1UK4A 4RSPA 1V2LT 2CN0H 4X8TH 4JCNA 1NPMA 4MTBA 3SGQE 3UOPA 1C9PA 1TX8A 4WVPE 1OOKB 1EZSC 2PHBA 1ELEE 1KTTB 4MPUA 5JPMH 1FN8A 2Z3CA 1DSUA 2Z9JA 4B2BA 2DE8A 2BLWA 2V6NA 1Z7KA 4YO9A 4YZUA 1VJAU 4DGJA 2OC8A 4NIWA 2FOGA 1O3CA 2P59A 4K1SA 2BD4A 3GCTF 5CDFE 1HXFH 2FTLE 3NUMA 2TGPZ 3GDSA 4ABDA 1QJ6B 3PMAB 3RXQA 5EW2H 2P3TB 2PSXA 1HXEH 1NN6A 1WU1A 4ZKNU 1MTVA 1NRRH 4F4OC 4KKDA 5HGGA 3WWFA 2VIVA 5A0AE 1AO5A 1QR3E 2FDAA 1T8LA 4I86A 1KXCA 4UFGH 4U01A 1YWUA 2NU2E 4YOJA 2H1UA 1XMNB 2HPPH 1O3AA 1FPHH 1GBKA 1SKYE 1TONA 3H09A 1RGQA 1O35A 1IQLA 2J5UA 3SZNA 4Z6AH 1BRBE 4CH2B 3QZQA 4X8VH 1QRXA 1UJ1A 1Y3WA 4NGAH 1JMOH 3OYPA 2BX4A 3CS7A 1CSOE 1QRZA 1OWEA 1EAIA 2OBOA 1VGCC 4A1XA 3A8CA 4K1TA 3TVJB 2UWPA 5J4SA 4INLA 3K9XB 4MNWA 1XXDA 1TRNA 4QT8C 1TA2A 1TOMH 1DWDH 1FX0B 3GY3A 3TNTA 2D2DA 1PYTC 1WYKA 2ZG0H 1ELFA 3BSQA 3Q3KA 1GJAB 1O38A 7ESTE 3ZZ9A 5GCHF 1ZTJA 3MH7A 5T1VA 5ABWA 1SHHB 2J98A 1AWFH 1AKSB 3UR9A 4DCDA 3MO6A 2QCYA 1FY8E 1MKWH 2GV6A 3U8RH 1TGTA 5AVDA 2ZDKA 1OWKA 6GCHG 3MH5A 3A8DA 3N7EA 4MQAA 1SB1H 1ZSJA 3BTDE 2KCAA 1CT2E 1WQVH 2FP7B 1UK2A 2BDHA 1TMUH 1VITG 3QO6A 3F2FA 2VU8E 3MU5A 1E37B 1NT1A 4I31A 1W0JD 2H9TH 1V2RT 3DFJA 3EQ0H 1V2NT 3VB3A 1FI8A 3BG4C 1XUFA 2JJ2D 1GHAF 3OEHD 1GBHA 1P09A 1YGCH 4H4FA 4BTTB 5JBAS 3UQOA 5FBEA 3ZZ4A 1ACBE 4CBNA 1GCDA 1TAWA 2VVVA 5F03A 3BG4B 1O3JA 1KXDA 3E0NB 4GCHG 2JH0D 2BLOA 2H6MA 1QGFA 3RC4A 3F2GA 2I6SA 3GY8A 2GGVB 3SU5A 2BLVA 1AZZA 1GBDA 2J94A 4JZEH 4ISNA 4B6EA 1ZRKA 3GY4A 1AB9C 3SU3A 1P2QA 4I8JA 2AGGX 4FUGA 2ZCLP 1DITH 1NRPH 4ABIA 4CH8B 3UUZA 1TNKA 3FANA 4AC9A 1AB9B 1DWBH 3UR6A 3DSOA 1Z71A 1GL0E 1MTWA 1VCWA 1TYNA 1OP8A 2Y5GA 4M7GA 8ESTE 1UCYE 1DLEA 4Q7XA 1HCGA 1GJ6A 3P70B 1EAWA 1S5SA 1K1IA 2PW8H 2KR7A 3A89A 1ZGVA 1P3EA 2RFKC 1Z1IA 4FUDA 3SI4H 3OU0A 2WINI 2QGRA 2AMDA 2FODA 4ASUD 1LHDH 2RDLA 1DVAH 2QXGA 5EODA 2STAE 1XKBC 3UWIA 1S82A 4I8LA 1GI0A 1P11E 1FUJA 2CV3A 4X6OA 2GZ9A 1RTLA 3MYWA 2RG3A 3H7OA 1JOUB 1LO6A 4GUXA 1SQAA 1QB6A 2VIOA 2XC0A 2XRCA 2W7UA 4AFZA 1GJ7B 1O2XA 2TPIZ 1M9UA 1OHHD 2FO9A 1JIMA 3PWCA 4OGYA 2PUQH 3K6ZA 3SJIA 2VJ1A 1S81A 3F9FA 4AGJA 3R0FA 2ZFSA 4WH6A 2QV1A 2BDGA 3TIUA 1ABIH 1GMDF 3UB0A 2P8OB 1B7XB 1QBOA 3SV6A 7KMEH 3OE7D 4NIXA 5C5OA 1FZZA 1MU6B 2ALPA 2FXRA 2ZIQH 2ANYA 2K8IA 5HM9A 1O2PA 4XSKU 1WSSH 4BAQB 2ANMH 1GBJA 1KY9A 3TK6A 3BTGE 1YCPM 3AAVA 1O2IA 1TQ7B 1LHGH 3TPIZ 4ABJA 1GDUA 4DT4A 2ZPSA 1O3KA 2FS8A 3O8CA 3BF6H 3T28A 1ANCA 3OTPA 5I25A 4WH8A 3RMMH 1IQIA 3M36A 1GJCB 5DN6D 1O2GH 2JKHA 1TB6H 1WQSA 4ZROA 3SO3A 1PPEE 1NTPA 5FXLA 2A5IA 5C1YA 2OC0A 1K1LA 5C2ZA 3RXDA 4XDEA 1FONA 3NKKA 3SU2A 1YLDA 1A46H 4Y6DA 4XBCA 3EGKH 5LPRA 1MTUA 2C93B 4XBBA 3B23B 2OUAA 1E35B 2ZO3H 5AF9H 1CHOF 2BDIA 2FOCA 1W0ZU 2Q6GA 1A5HA 5J4QA 3TGKE 3QUMP 1K0HA 2V3OH 3T5FH 4IW4E 3S9AA 3TH3H 1K21H 3FN8A 1QBVH 3CS0A 5C0UA 1TMTH 2PKSC 1O2QA 3BEFB 1C1TA 1LVMA 1C5TA 2STBE 2ZP0H 2ZGHA 1TBQH 5EJZA 3O8RA 1NRSH 4BAMB 1QA7A 4RT1A 2SGPE 4FVDA 4FUJA 1XUIA 1JRSA 2PGQB 2L6OA 1MZAA 2P93A 2ZDNA 1TNIA 2GP9B 2H2ZA 2Q6DA 2BZ6H 2EI7A 1PPZA 1Z1JA 1MTSA 2KFWA 5DP6A 2Q1JA 1P2MA 1H8IH 4ZHLU 1ZSLA 2IPQX 2BD5A 1VZQH 5C0TA 1AWHB 2CMYA 1FAKH 1GMHG 4ZUHA 2YMSD 3DFLA 4JYVH 2G81E 3RXPA 3TJUA 4FOUC 3TGJE 1HV7A 4A7IB 1QQ4A 3EE7A 3MHWU 2ZDMA 2I6QA 5ESTE 3OAAD 1ELTA 1ELCA 3NWUA 1SGFG 3HKIB 1MZDA 1O2UA 1ELVA 1RS0A 3F9HA 4J2YB 2BD8A 5A0BA 3LGWA 1F5KU 1NU9A 2AMPA 3SI3H 1P12E 2PKAB 2ZA5A 1C2HA 7GCHG 4ACBA 2ODPA 1QJ1B 3PV4A 3RXBA 1A5GH 1EPTB 2FI4E 3U8TH 1KLIH 1O3OA 2PTNA 1CGIE 4M9FA 1E1QD 3LKWA 3GY2A 4BANB 2ZHQH 1SGDE 1UTQA 1CA0C 1LDTT 4AB9A 4DIIH 2PSYA 3URDA 1O2OA 1KDQB 4A1VA 3M5NA 2Y82A 3T62A 4AG1A 2V3MA 4D9QA 1O3FA 1PQ5A 2A7JA 3GOVB 4R8TB 1SHYA 1L1GA 1TNLA 1HAVB 2P3FH 1ZMJA 3A7YA 3LOXA 4X1RU 2J9NA 4ISIH 4NWLA 4ZH8A 1KMHB 3GS9A 2LNCA 1VKYA 4X2XA 4X0WU 1YPJH 1CVWH 5E0JA 1FLEE 3SHCH 4XBDA 2IN2A 3ITIA 4VGCB 1ZHMA 2NU1E 4R0IA 3T2NA 3GY5A 3HK3B 5EQSA 1XM1A 4E7RG 5DPAA 4AOQA 1HAPH 2VBCA 3NPSA 2G55A 3M7QA 2OXSA 2WUCA 1T8NA 1TNJA 2B8OH 4E7NA 2OCVB 1FJSA 5AFYH 3S9CA 3RMLH 2F3CE 3GY7A 1GVLA 3A7ZA 1J17T 1H8ED 1C2MA 2Z6BD 4BAKB 1C9TA 3D23A 1P0SH 1G3CA 4Y0YE 5EIYA 3PWBA 2FMJA 1BTXA 3QGNB 1GMCF 4TYDA 4Q63A 1H8HD 2F9OA 1QQUA 1MD7A 2ODQA 4K3JA 1CBWC 1O3LA 1C2DA 2FOAA 2ZTYA 7LPRA 1HUTH 1DANH 8KME2 1C2JA 4AFUA 2VWMA 1SLUB 4HG6A 1SGNE 1SG8B 5LGOA 4AB8A 1GG6B 4NSYA 4J1YA 3F68H 2Y81A 5DGJA 3UAIC 1H9LB 1L4ZA 1SLWB 4GHQA 2ZWLH 1MKXH 2A4GA 1BDAA 1IHTH 4O03A 2JIZD 3RXVA 1P2NA 2THFB 3HK6B 1C2LA 2CXVA 1K28D 1WCZA 1YPKH 4K5ZA 1O3NA 4X1NU 2IJOB 3MU8A 3JZ2B 1EUFA 1O3PB 1GPZA 8GCHF 1K1OA 1V2QT 1QY6A 2PTCE 3RXKA 4U30A 1F2SE 2H9HA 1N1LA 1ZLRA 2AIQA 3UNQA 2K0QA 9ESTA 1C2KA 4XE4A 3M3TA 1W14U 3SU0A 1H9HE 1VR1H 2IJD1 3T25A 1ARBA 1BTPA 2AIPA 3PO1C 4YT6H 5SGAE 2AFQB 2ILNA 2W6ID 1SLVB 3DSPA 2SFAA 5ESBA 3A7VA 1GI7B 3E1XB 2R2WU 1MCVA 4ZKSU 3PM3A 4D8NA 1EQ9A 2RA3A 3UPEA 1EJMA 5FX5A 1DT2A 2Y80A 2OC1A 3ZVDA 4Y79A 1L2EA 2F9VA 5LH8A 1SI5H 4NFEA 5A09A 1HAXB 4RI0A 1SPJA 1IQHA 4A92A 4D7FA 3FP7E 1W7GH 4I33A 1UVSH 2ZFFH 2G52A 1C5VA 2PKAA 2GCHF 2OBQA 1YPLH 3E16B 4JZ1A 2J34A 3LJOA 1ZYOA 5EG4A 3ESTA 2KAIB 3RM2H 1O31A 5FPYA 1EPTA 1NZQH 5DJ7A 3WY8A 1QJ7B 2BY9X 1JBUH 1V2OT 2A5AA 1W8BH 2R9PA 4Y76A 5HYOA 2OTVA 3TJNA 3QTOH 4AGKA 3SNBA 3WW7A 2QF5A 2H9EH 1A7SA 2G4UA 2Z9GA 5HIYA 1C4U2 1F5RA 1HAVA 1WOFA 3RC6A 4U32A 5EW1H 3QLPH 1LKAA 2FWWA 1PQ7A 2XCFA 2UUJB 1MU8B 1N6XA 3FVFB 1HFDA 3ZVGA 3STIA 3DUXH 4BOHA 1KXBA 1BA8B 1NFUA 1TLDA 2KX4A 5FX6A 1K2I1 1OYQA 3D49H 4X1PU 4AN7A 3O8DA 2VNTA 1WUNH 1INCA 2O8TA 2FYRA 1Z8IB 3KQBA 1EFRD 2AERH 3LGTA 1BTYA 1T4UH 2UUYA 1MBMA 1XKAC 1ZMNA 1BBRH 1C1MA 1LCYA 1V2ST 4HGCA 3BEUA 1V2TT 3OEED 3VXEH 3PV2A 2A1DB 2PP6A 1ELGA 4MPWA 1Z8RA 3GISB 1DWEH 2J2UA 1B0EA 2RCEA 1EJNA 1FNIA 2QYIA 5L30H 2AGIX 1GJBB 3N7OA 4K69A 4RKJB 5TCCA 3UREA 1C5MD 3CNRA 1ZGIA 1EZUC 1YPEH 2FM2A 2FPZA 2Y5FA 3RXOA 4DT7B 2OQ5A 2SGEE 2JH5D 1O5AB 2C4FH 2BDCA 3M5OA 1C5NH 4KGAA 4YESB 3GCTG 3LGUA 1QB1A 1UCYK 3LH1A 1YPMH 1QURH 1O5CB 4Y8XA 3UNSA 1VCPA 3WWBA 4ZMAH 1GI9B 3P8GA 1DUAA 1RJXB 1SOZA 3S7HB 2WPHS 1U6QA 2O8LA 1QB9A 1YY3A 2A2QH 2BDYA 4A1TA 3K2UA 1N8OC 2R2MB 4NA7A 2P94A 4JK5A 3ZVBA 1N8OB 1D6WA 5A0CA 2ZGBH 2SGAA 1YLCA 3AW0A 1LMWB 1TMBH 3D65E 2GT7A 3A8BA 3SNAA 3SU1A 3EDXB 2KCOA 4WXIA 1CGHA 1VGCB 1NS3A 3GCHC 3DSGA 1ZHPA 3U28C 5F6MA 1O3HA 1DOJA 2OK5A 4BTIB 1HJ8A 4X6PA 1C5SA 1P03A 4UFEH 3SBKA 3RXSA 2FX4A 4CR9A 1KLTA 1P9SA 3HGPA 2VIQA 1NBME 1G9IE 2O8MA 3LGIA 2VIPA 5EOKA 2GD4B 2PWXA 4YOGA 1P57B 1O3DA 3SQHE 2BY6X 3QWCH 3BTKE 3UOUA 1RTFB 2A5KA 1J15A 2BXUH 4ZXYH 5T6FA 2GMTC 1C5PA 2D1JA 4Q80A 4ZHAA 2BQ7B 4WY3A 3M5MA 2YMSC 3BEIB 1SQOA 1NU7B 1DY8A 2WPMS 1GI2A 2F43B 5E0GA 3FOAA 1UVPA 3KYFA 2GMTB 4X8SH 1ELDE 2W3IA 2ZFTA 2LPRA 1W2KH 4K60A 3A81A 1UVOA 2H5DA 2KAIA 2YMSB 3R3GB 2BM2A 3ELAH 2FTMA 4ZHMU 3VPKA 2SGDE 1LTOA 2QC2A 1MABB 3ZZ5A 1TPSA 3TJVA 1F5LA 1P06A 4UEHH 4B73A 2GVFA 4BTUB 1OKXA 1JIRA 1QRWA 2R0KA 3Q00A 2F4LA 4I7YH 2C8WB 1TGSZ 2Z3DA 1P9UA 5GNDA 1F0SA 3IG6B 3E91A 3U8OH 1Z6JH 3MH4A 4DOQA 2A4RA 4INHA 4CRAA 4CRDA 1BHXF 1GJ4H 2WV9A 5HIZA 1SGPE 1Q3XA 4FVBA 3TNSA 5FL7D 6LPRA 1LQDB 4O9VA 5IK2D 1N6YA 1NC6A 1ZJKA 4LOYH 5A2MH 2RDEA 3A7TA 3GICB 4K8YA 4BNRA 1PPBH 2ZQ2A 3U9AH 2ZFQH 3E6PH 3MNSA 3BG8A 2TBSA 4ABAA 1O5FH 4JMYA 1ZTKA 3V3MA 2BDAA 3QX5H 5JB8S 2BDBA 3MQKC 3TK9A 8LPRA 1O2RA 2EEKA 3FZZA 2OLGA 3UFAA 4Y10E 4LK4A 1GHXH 2FESH 3LJJA 2M5TA 1O5EH 4YTAA 2GJGA 5DP3A 1ESTA 4RN6A 3NRLA 3S9BA 1C1QA 4OS2A 1O2LA 1L0ZA 1TGNA 2XXLA 5JB9S 1BOQA 2XNDD 3V7TA 3A82A 3TU7H 3U98H 4F48B 1QA0A 3PTBA 3SV2H 1FDPA 1TFXA 2ZDVH 2Z9IA 3SUEA 3F2HA 2BMGB 1C5WB 2OD3B 1FV9A 5KGOA 3F9GA 4X1SU 4E06H 1DLKB 1W11U 1T7CA 3MU1A 3RP2A 4AX9H 4NA8A 4NZQA 5AFZH 4B71A 2VH6A 3BV9B 4OS5A 5GJ4B 1Z8JB 3UQVA 5AHGH 3TK5A 3KYGA 1C5ZB 5DP5A 5BPEA 4KTSA 1BIOA 1EKBB 1L1JA 1CT0E 5KEDA 1GBFA 4CRBA 1LPGB 2FLBH 3F0OA 2A2XH 4JZFH 1GVZA 1UW7A 1BMNH 1VJ9U 3S0NA 2WZQA 1HAIH 2WSSD 3TLOA 1F7ZA 1T4VH 3ZYEA 1Z8GA 1ZR0A 1FIZA 4OS7A 4UD9H 2O8UA 4B1TA 1GDNA 1TBZH 2Q6FA 5DO4H 3RMNH 4HI3A 4CREA 4ISLA 3OSYA 5I46H 2ZNKH 1DICA 4NZLA 1G32B 4XOJA 4DURA 1C1WH 1AN1E 1LKBA 3NZIA 4Q2KA 1HAZB 1GMDG 2OP9A 1FY5A 1HDTH 2W6JD 3TITA 1O3EA 3E3TA 1TOCB 4MNXA 2TIOA 3QDZB 2WYGA 3H7TA 3PLBA 3E0PB 1T32A 5JBCS 1CA8B 2B5TB 3LIWA 4DJZB 1OWJA 2J97A 2FLRH 3PLPA 1BTZA 1QL9A 3OTJE 4CRFA 1NBMD 1K1JA 4X1QU 4F55A 4AYVB 4CHAC 2A7CA 2F9BH 1VITH 3BTQE 1P01A 3TJOA 4WWYA 1L4DA 3BTHE 5JYIA 2LELA 4CHAB 1BJUA 2GV7A 4LXBH 1KYNA 3KQCA 1C5YB 3MNCA 2BYAX 4GHTA 2BHGA 5E2OA 1COWD 4D76A 1BTHH 1Q2WA 1XUGA 2VIDA 2AEIH 1TPPA 1UTPA 1C5UA 1QFKH 4D7GA 1AIXH 1UVUH 1SGEE 2XTTB 3KL6A 1CHOG 2J38A 1Y3VA 4YXWD 2UUKB 1Q31A 4H6SB 1SGIB 4IS5A 1BQYA 1DX5M 1PQ8A 4FUEA 4WJG2 2WPKS 1SBWA 2A4OA 2PKSB 1GGDC 2BX3A 2XC5A 3P95A 4B76A 3URCA 1O2HA 3RXFA 1G36A 2HLCA 4Y8YA 1SGQE 1GGDB 4NSVA 4FU8A 4SGBE 1C1VH 3T29A 3LDXH 1GI1A 2JDID 1FMGA 2VVUA 4JZIA 1SGCA 2AHME 2C8ZB 1IAUA 4GLYA 1C4V2 1TE0A 2NU0E 1G3DA 1YC0A 2F9PA 3A88A 3A87A 3SJKA 3QN7A 3RLWH 3D62A 2QIQA 2VH0A 1PPFE 1CHGA 3FP6E 4RKOB 1AD8H 2SNWA 1KXEA 1YPHE 1YF4A 2A31A 1UTJA 4I8KA 1P05A 2GT8A 1F0TA 3CP7A 1GBLA 3F3BA 4WMEA 3SV9A 1HNEE 3W1EA 2YOLA 1BTWA 5EJ1A 2TGAA 1LVOA 2CK3D 1EOLA 4TT3D 3SJ9A 1O2WA 1J14A 3A84A 1TX7A 4O3UA 1C1NA 2ZTXA 4ABFA 5FCKA 3IITA 5HMAA 4MPVA 1MQ5A 2ZU1A 1ID5H 1CA0B 1S84A 2ZDAH 2AS9A 1AU8A 2HVXA 2XBVA 2G5VA 1TPAE 4NFFA 2ZU3A 2VVCA 1GI8B 3W95A 2JETC 1S6FA 2Y6TA 1OWDA 4E05H 2P3UB 2ZHDA 2JETB 3NCLA 5GPIB 3M61U 1UTOA 1THPB 2L74A 4BAHB 1TRYA 4I8HA 1AE5A 3ENSB 1MKWK 1FY3A 2XCNA 4ACAA 3ATMA 1H1BA 2ZHFH 4ZAEA 1JWTA 1E1RD 4IC6A 3HKJB 4GAWA 1WBGB 3S7KB 4OGXA 1A61H 3VGCC 1WDIA 2C8YB 1H4WA 1PQAA 1BMLA 1O3IA 5A8YA 1T31A 1AVGH 2ZGCA 3MO9A 3C27B 2EQNA 3PMHB 2D26C 4X2YA 3AVZA 1HJAC 1QBNA 1S6HA 1OSSA 5FPTA 3SGBE 2AMQA 2FI5E 3EAJA 5DG6A 1SMFE 1CU1A 4ABGA 1BBRE 1CBWB 1MAYA 3LC5A 1HJAB 1GJ5H 1A0JA 2HWLB 2XC4A 1C5RA 1O2ZA 2BQWB 5K7RA 3EYDA 1ESAA 3P8OA 3SZEA 1HYLA 2G4TA 1KIGH 1ZRBA 1GBCA 1EOJA 1HLTH 4IN1A 2QXJA 2PV9B 1TBRH 1Y5BT 1PJPA 1G2MA 1MMJN 1GL1A 1V3XA 1NFYA 2ANKH 4Q7ZA 5FPSA 3BTTE 1A0LA 2IOTA 2ANWA 3LPRA 4Y7BA 1HJ9A 2CHAC 2TRMA 1FIWA 3SNCA 1A1RA 4INKA 1LHEH 4ABEA 1HRTH 3EA8A 2G51A 1GI3A 1GDQA 4PROA 1HGTH 2C90B 1RTKA 1J16A 3GYLB 1EX3A 2QF4A 1L1NA 1UK3A 2ZHWH 1MTNC 1SGFA 1G37A 3I78A 4TY6A 8GCHG 2HNTF 1TABE 1YLNA 1XUKA 1O2NA 1P2OA 3PO1B 5FAHA 3M5LA 1V2WT 2QE7D 3NK8A 2GZ7A 1BITA 1MTNB 5C5NA 4X2VA 2F83A 1C1RA 3FKSD 5EU8A 3HATH 1PFXC 3VB6A 1AFQC 4CRCA 3SU6A 1GBBA 4MDSA 2JH6D 4Y8ZA 2BD3A 1W0YH 1P2JA 3RXLA 4O97A 1O37A 4MLFB 3A7XA 2XYAA 4JK6A 3DHKH 3G01A 2ZCKP 1BRCE 4YLUA 2LP6A 4OS6A 3STJA 1AMHA 3JZ1B 5E0HA 1MAXA 1K9OE 1BJVA 4FUCA 3H5CB 5DP9A 2HNTE 3NXPA 1YPGH 3SQEE 1C4Y2 1WAYB 1P2IA 2TGTA 2AYWA 1BZXE 2GCTC 2QXIA 1G3BA 1D4PB 3DT0H 2VWOA 3QGJA 1F92A 1TIOA 2WPIS 2FOEA 2TGDA 4GPGA 3V12A 1QZ8A 5EQQA 3VB4A 1K1MA 1Y5UT 3VEQB 4Z0KA 3EE0B 2Y5HA 2GKVE 1O2JA 3FAOA 4B75A 1OP0A 3VB5A 1DM4B 1TPOA 1B0FA 3KGPA 1GHBF 1O5GH 1FAXA 2QF3A 2AGEX 1YYY1 3HPTB 3UIRA 1QTFA 3FO8D 3Q3XA 4WMFA 2FX6A 3BTFE 5TCAA 3DD2H 3QTVH 1OS8A 3ZZ6A 2ZCHP 3MH6A 1ZSKA 2Z3EA 3U1IB 1HIAB 2ZPRA 1SGYE 3ZVCA 1IQJA 2ZFRH 1W13U 1Y3YA 3VG8A 1P04A 3MNXA 4ZKRU 4U2WA 3V13A 1YBWA 5E8EH 3BTME 1K1PA 1ETTH 3M37A 3KN2A 2NU3E 1Y3XA 1AI8H 3ATKA 3M7UA 1EASA 4IN2A 1O34A 1GBEA 3OY6U 5FHTA 1IQEA 4B6FA 2XBXA 5LPFA 1Y3UA 5F53A 3MMGA 3SYJA 2WV4A 2G8TA 2CF8H 2WUBA 3KEEA 4K2YA 4HZHA 4JZDH 1V6DA 1SVPA 5C3NA 3MU4A 3ZZBA 1D3PB 3F1SB 4LZ1H 1O2VA 4CR5A 1BUIA 1HBTH 2F91A 2ZU4A 4DVAU 1BRAA 1TGBA 4P00A 1C1OA 1E36B 1LPZB 2ZU2A 2ZI2H 1A3EH 2R0LA 4P02A 5DKMA 1TQ0B 2BVXH 3RU4T 3RXTA 3TH2H 3L33A 1O2TA 3ZIAD 1UVTH 1O3BA 2ZGXH 1BCUH 1QNJA 1EAXA 2B0FA 2W26A 2QY0B 4YLQH 4Y0ZE 1G30B 1ANEA 3RXUA 2CF9H 3ODDA 3OY5U 1FQ3A 1SQTA 3W94A 1SQRA 3M3VA 4K8BA 3SUGA 1SC8U 1C1PA 4F49A 3ZVAA 3ZV8A 2BOKA 1K22H 3LC3A 2GZ8A 3FFGA 3RXAA 4NG9H 1KLJH 3FP8E 3BIUH 2QA9E 3GCHB 3SUFA 2PFEA 4IGDA 1SGTA 5DK1A 2A7HA 2HLDD 1ORFA 1MQ6A 1DDJA 4UE7H 2G00A 1DXPA 1UTLM 2OINA 3GYMA 4H42U 2BZAA 1W0KD 4UFDH 4WXVA 1DFPA 4DIHH 1ESBA 3C1KA 6GCHF 1TA6A 1ZMLA 1KXFA 1KXAA 1JRTA 3A7WA 5GCHG 2ZPQA 3LT3A 1TALA 1VITF 1XVOA 4TPYA 3PV5A 4TWYA 4NCYA 1W10U 3MNBA 3P92A 2EI8A 2A32A 4AFQA 5DP7A 1BMFD 2JJ1D 3SW2B 2D8WA 1NROH 2ZKSA 3RXHA 5EXMA 3LU9B 5B6LA 4ZXXH 2J95A 4BAOB 3RXIA 2PUXB 2R3YA 4GCHF 5PTPA 4LZ4B 3T27A 1C1SA 1ZJDA 1YCPK 2OQUA 1BHXB 1GBAA 1F0UA 1HB0B 3ATLA 3U1JB 1GHAG 2FYQA 1AFEH 1NM6A 3RXJA 1ZPBA 5T3HA 4X2WA 1XXFA 1ETSH 1S0RA 3RMOH 5A8ZA 4Y71A 2V7QD 1IQKA 2ZZUH 2A45B 4TWWA 2WPJS 2ZFPH 4MNYA 1V2JT 2R3UA 1A5IA 2WYJA 1HIAA 3EA9A 3SORA 2RA0A 1GJ9B 1S83A 2PGBB 5DP8A 2UWOA
chains in the Genus database with same CATH topology
1Y5AT 3I77A 6ESTA 3ATWA 4FU9A 4OS4A 1GWAA 1P3CA 1MBQA 1ANDA 4MG3A 3L6PA 3MU0A 5G4BA 2FOHA 3KQDA 2B9LA 4CRGA 1QIXB 4YOIA 3PLKA 3SOSA 1O39A 2C3SA 3F6UH 1UTMA 4AZ2B 5EXLA 1C5QA 2BY5X 1OXGA 1TGCA 2GTBA 1G2LA 3OX7U 5A8XA 1CGJE 3Q3YA 1TX6A 2ZHEH 3A8AA 1DY9A 3K6YA 4ASHA 4B2AA 1GHZA 1W3CA 1MKXK 1DSTA 1BTUA 4THNH 1GBIA 4UDWH 3AW1A 1E34B 4JYUH 1H9IE 3KQEA 1GJDB 2Z9LA 3M7TA 3A86A 2F9UA 1GBMA 2FOFA 2W7SA 1QHRB 1OYTH 3LGVA 2BTCE 1D6RA 1AQ7A 1LPKB 3LONA 5CHAC 5LPEA 2W5EA 2ZC9H 1P10A 1T8MA 2V0BA 3PTNA 4ESTE 5C1XA 3RXGA 5CHAB 4KTUA 4YT7H 2SGFE 1CQQA 1GI5A 2BD9A 4CBOA 3ZZAA 1IQGA 1LQEA 1O5DH 1S0QA 1ZZZA 5T6GA 2YNAA 2VINA 3A83A 3E90B 1O3GA 1X7AC 4DW2U 1A4WH 1GI4A 3UTUH 1GVKB 2P16A 4KELA 2QN5T 4ABHA 2W3KA 2P8OC 4H6TA 4I32A 2HOBA 3B8JA 1C2IA 2ZF0H 3BTWE 1SFQB 5FBIA 1IQFA 3Q76A 4D9RA 4FUHA 2ZEBA 4KP0A 4MPXA 1HAGE 1FY1A 3Q77A 2ZU5A 4ISHH 1UTKA 4MVNA 1XUHA 2ESTE 2ZGJA 1D3DB 1ELBA 4IC5A 3ZVFA 2PLXA 2Z94A 3SU4A 1EZXC 1AHTH 1UMAH 3P17H 4NIVA 3SGAE 1J8AA 1O0DH 4Q7YA 3KIDU 5C1UA 1W12U 2ZECA 1AKSA 2BB4A 3UNRA 1HAYB 1O2YA 1ELAA 3P8FA 1ZPZA 5F8XA 4B2CA 1BMAA 4ZKOU 1GHYH 1DWCH 4SGAE 3RU4E 2BOHB 5EXNA 3SNDA 3RC5A 2Z9KA 1UHBB 3UWJH 2BY7X 1Z6EA 3V0XA 1C5XB 1EJAA 1QCPA 1VCQA 3ZV9A 1AY6H 1YPHC 4Y11E 5JDUB 3ZVEA 3GDUA 1QL8A 3PMBB 1C2FA 5JBBS 1NRNH 2VWLA 5GWZA 4Y7AA 3RXRA 3PYHA 4JYTA 1IQMA 4TPIZ 3FZDA 1DXWA 1SR5C 2HGTH 3P8NA 4ABBA 5ETXA 1AVXA 4X6NA 1O2KA 2A4QA 1LHCH 1UCYH 1BBRK 3ZZDA 1GCTC 1O2SA 1MH0A 3RUOA 1BMMH 2DE9A 2XBYA 1OP2A 1PYTD 1EXFA 2O9QA 1GCTB 3SJ8A 1O30A 2ZQ1A 4AG2A 1GMHF 1Y59T 1ANBA 4TY7A 3VFEA 3MO3A 1S85A 3GCOA 3O8BA 1AUJA 1AVWA 2ZDLA 3SUDA 2WV5A 2FI3E 3SV8A 2FOBA 1P8VC 3VB7A 1ZHRA 3S69A 2FS9A 4X8UH 3T26A 1NO9H 3ZYDA 4I8GA 3ATIA 3BTEE 2ZTZA 1ETRH 1DUEA 4MNVA 3MTYA 4IMQA 5F8ZA 1XUJA 4WF8A 4K1EA 5TJXA 5EPNA 7GCHF 2FEQH 4X6MA 1C5LH 2FIRH 1T8OA 2WPLS 1IOEA 1THSH 3TH4H 1K1NA 4O3TA 2PR3A 1CE5A 1Y8TA 3SJOA 4NIYA 1EATA 1JXPA 1RXPA 1SGRE 1LVYA 5IDKA 1RFNA 1EP6A 4BXSA 1EPTC 1ARCA 1NESE 5IYTA 2QAAA 1V2UT 1AE8H 1BT7A 3BIVH 4KTCA 1FPCH 2A0QB 3GDVA 2V35A 1H8DH 2K1QA 1IHSH 3K65B 3DA9B 2Z7FE 3EA7A 3MOCA 5JBTA 1FY4A 2QF0A 1OWHA 1BB0B 1CO7E 2FZZA 3I29A 2J4IA 1QL7A 1PPGE 3LGYA 2CJIA 2HRVA 2V3HH 3HGNA 5CE1A 1V2KT 3U69H 2ASUB 1RIWC 3PMJA 3AASA 3MI4A 3M3SA 4VGCC 1J9CH 3RDZA 1EAUA 3ZZCA 1FN6A 3VXFH 2EI6A 1AZ8A 1RIWB 2VIWA 3F9EA 1YCPH 1NY22 4FUFA 1YP9A 4XFQA 4A5TS 9LPRA 2BXTH 1D9IA 4DG4A 3ZZ3A 1W7XH 2GX4A 6CHAC 1A2CH 1HPGA 1P2KA 3QK1A 3ODFA 1ABJH 3RLYH 1PPHE 2AH4X 4UONA 1V2VT 2Y7ZA 4FU7A 3VGCB 2B7DH 2CGAA 2SNVA 2BQ6B 1V2PT 1YM0A 3PB1E 2OC7A 6CHAB 1XX9A 4FUIA 4FXGH 1O36A 1O5BB 1AGJA 5B6OA 5K0HA 1THRH 3ZZ7A 2DUCA 2ULLA 3GY6A 1MD8A 3M35A 1SSXA 5H4IB 1OPHB 1NRQH 1YKTA 1GHVH 4HTCH 4AORA 1GMCG 4UFFH 2O8WA 2BVSH 4A6LA 2GDDA 1EB1H 1GG6C 1UHBA 2BLQA 1DPOA 1UO6A 2F9NA 3BN9A 5E2PA 1KSNA 1AUTC 1UTNA 1HAHH 5EGMA 2ODYB 5CMXH 3IWMA 3RU4D 1D3TB 1FXYA 2HPQH 1O2MA 3MFJA 1XVMA 4IBLH 1WTHD 1F0RA 1MUEB 1GJ8B 5BRRE 2VB0A 5L6NH 3L3TA 4YM9A 1SLXB 2HNTC 1MCTA 1OWIA 1WTGH 2CHAB 1C2EA 3SHAH 1O3MA 1SFIA 3SV7A 3RXCA 5L2YH 2XNIA 2XBWA 1EP5A 2VGCC 1D3QB 1E0FD 5C20A 1GHWH 4DY7B 1C1UH 1HAOH 1LHFH 3KF2A 3MWIU 5DP4A 5GXPA 1B5GH 1OX1A 1WV7H 2VGCB 3UY9A 1LVBA 1G3EA 3KCGH 3CENA 3PROA 4BXWA 1TNGA 4AYYB 3LH3A 1NFXA 1RD3B 4NWKA 3RM0H 2P95A 1C5OH 2XWAA 3RXEA 3GCNA 1NFWA 5L2ZH 1SOTA 1AFQB 2UUFB 2FOMB 2BVRH 4GSOA 3E8LA 2EC9H 1DS2E 1V2MT 4IMZA 4B74A 5T6DA 1E38B 3TGIE 5HM2A 4AFSA 1TNHA 3AAUA 2G5NA 3SNEA 1RRKA 1ZOMA 1CT4E 2UWLA 1A0HB 2Y7XA 5HXFA 1EB2A 5F8TA 5GDSH 2BY8X 1TRMA 2XWBI 2BD2A 2GCTB 2GCHG 1GI6A 5C67A 4OS1A 2NWNA 2QXHA 1DE7H 1TWXB 5FCRA 4FUBA 1SL3A 3B9FH 3SN8A 3ZZ8A 1O32A 2ALVA 1P02A 2C8XB 1ZTLA 1KDQA 1ZPCA 5EPYA 1GBTA 2BD7A 4NA9H 5EQRA 3KHVA 3P6ZB 3KNXA 2HALA 1EZQA 3A80A 1IQNA 1KTSB 1A3BH 2H5CA 1C2GA 5GIBA 1GHBG 2XW9A 4WMDA 4ISOA 2IPHA 1O33A 3RXMA 1PPCE 4HFPB 2GDEH 2EA3A 1BRUP 3A85A 4GVUA 2NU4E 3QZRA 2J92A 2SGQE 2VWNA 2YNBA 1UK4A 4RSPA 1V2LT 2CN0H 4X8TH 4JCNA 1NPMA 4MTBA 3SGQE 3UOPA 1C9PA 1TX8A 4WVPE 1OOKB 2PHBA 1EZSC 1ELEE 1KTTB 4MPUA 5JPMH 1FN8A 2Z3CA 1DSUA 2Z9JA 4B2BA 2DE8A 2BLWA 2V6NA 1Z7KA 4YO9A 4YZUA 1VJAU 4DGJA 2OC8A 4NIWA 2FOGA 1O3CA 2P59A 4K1SA 2BD4A 3GCTF 1HXFH 2FTLE 3NUMA 2TGPZ 3GDSA 4ABDA 1QJ6B 3PMAB 3RXQA 5EW2H 2P3TB 2PSXA 1HXEH 1NN6A 1WU1A 4ZKNU 1MTVA 1NRRH 4F4OC 4KKDA 5HGGA 2VIVA 5A0AE 1AO5A 1QR3E 2FDAA 1T8LA 1KXCA 4UFGH 4U01A 2NU2E 4YOJA 2H1UA 1XMNB 2HPPH 1O3AA 1FPHH 1GBKA 1TONA 1RGQA 1O35A 1IQLA 3SZNA 4Z6AH 1BRBE 4CH2B 3QZQA 4X8VH 1QRXA 1UJ1A 1Y3WA 4NGAH 1JMOH 3OYPA 2BX4A 3CS7A 1CSOE 1QRZA 1OWEA 1EAIA 2OBOA 1VGCC 4A1XA 3A8CA 4K1TA 3TVJB 2UWPA 5J4SA 4INLA 3K9XB 4MNWA 1XXDA 1TRNA 4QT8C 1TA2A 1TOMH 1DWDH 3GY3A 3TNTA 2D2DA 1PYTC 1WYKA 2ZG0H 1ELFA 3BSQA 3Q3KA 1GJAB 1O38A 7ESTE 3ZZ9A 5GCHF 1ZTJA 3MH7A 5ABWA 1SHHB 1AWFH 1AKSB 3UR9A 4DCDA 3MO6A 2QCYA 1FY8E 1MKWH 2GV6A 3U8RH 1TGTA 5AVDA 2ZDKA 1OWKA 6GCHG 3MH5A 3A8DA 4MQAA 1SB1H 1ZSJA 3BTDE 1CT2E 1WQVH 2FP7B 1UK2A 2BDHA 1TMUH 1VITG 3QO6A 2VU8E 3MU5A 1E37B 1NT1A 4I31A 2H9TH 1V2RT 3DFJA 3EQ0H 1V2NT 3VB3A 1FI8A 3BG4C 1XUFA 4H4FA 1GHAF 1GBHA 1P09A 1YGCH 4BTTB 5JBAS 3UQOA 5FBEA 3ZZ4A 1ACBE 4CBNA 1GCDA 1TAWA 2VVVA 5F03A 3BG4B 1O3JA 1KXDA 3E0NB 4GCHG 2JH0D 2BLOA 2H6MA 1QGFA 3RC4A 2I6SA 3GY8A 2GGVB 3SU5A 2BLVA 1AZZA 1GBDA 2J94A 4JZEH 4ISNA 1ZRKA 3GY4A 1AB9C 3SU3A 1P2QA 4I8JA 2AGGX 4FUGA 2ZCLP 1DITH 1NRPH 4ABIA 4CH8B 3UUZA 1TNKA 3FANA 1AB9B 1DWBH 3UR6A 1Z71A 1GL0E 1MTWA 1VCWA 1TYNA 1OP8A 2Y5GA 4M7GA 8ESTE 1UCYE 1DLEA 4Q7XA 1HCGA 1GJ6A 3P70B 1EAWA 1S5SA 1K1IA 2PW8H 3A89A 1ZGVA 1P3EA 1Z1IA 4FUDA 3SI4H 3OU0A 2WINI 2QGRA 2AMDA 2FODA 1LHDH 2RDLA 1DVAH 2QXGA 5EODA 2STAE 1XKBC 3UWIA 1S82A 4I8LA 1GI0A 1P11E 1FUJA 2CV3A 4X6OA 2GZ9A 1RTLA 3MYWA 2RG3A 3H7OA 1JOUB 1LO6A 4GUXA 1SQAA 1QB6A 2VIOA 2XC0A 2XRCA 2W7UA 4AFZA 1GJ7B 1O2XA 2TPIZ 1M9UA 2FO9A 1JIMA 3PWCA 4OGYA 2PUQH 3K6ZA 3SJIA 2VJ1A 1S81A 3F9FA 4AGJA 3R0FA 2ZFSA 4WH6A 2QV1A 2BDGA 3TIUA 1ABIH 1GMDF 2P8OB 1B7XB 1QBOA 3SV6A 7KMEH 4NIXA 5C5OA 1FZZA 1MU6B 2ALPA 2FXRA 2ZIQH 2ANYA 5HM9A 1O2PA 4XSKU 1WSSH 4BAQB 2ANMH 1GBJA 1KY9A 3TK6A 3BTGE 1YCPM 3AAVA 1O2IA 1TQ7B 1LHGH 3TPIZ 4ABJA 1GDUA 2ZPSA 1O3KA 2FS8A 3O8CA 3BF6H 3T28A 1ANCA 5I25A 4WH8A 3RMMH 1IQIA 3M36A 1GJCB 1O2GH 2JKHA 1TB6H 1WQSA 4ZROA 3SO3A 1PPEE 1NTPA 5FXLA 2A5IA 5C1YA 2OC0A 1K1LA 5C2ZA 3RXDA 4XDEA 1FONA 3NKKA 3SU2A 1YLDA 1A46H 4Y6DA 4XBCA 3EGKH 5LPRA 1MTUA 2C93B 4XBBA 3B23B 2OUAA 1E35B 2ZO3H 5AF9H 1CHOF 2BDIA 2FOCA 1W0ZU 2Q6GA 1A5HA 5J4QA 3TGKE 3QUMP 2V3OH 3T5FH 4IW4E 3S9AA 3TH3H 1K21H 1QBVH 3CS0A 1TMTH 2PKSC 1O2QA 3BEFB 1C1TA 1LVMA 1C5TA 2STBE 2ZP0H 2ZGHA 1TBQH 3O8RA 1NRSH 4BAMB 1QA7A 2SGPE 4FVDA 4FUJA 1XUIA 1JRSA 2PGQB 1MZAA 2P93A 2ZDNA 1TNIA 2GP9B 2H2ZA 2Q6DA 2BZ6H 2EI7A 1PPZA 1Z1JA 1MTSA 5DP6A 2Q1JA 1P2MA 1H8IH 4ZHLU 1ZSLA 2BD5A 1VZQH 1AWHB 2CMYA 1FAKH 1GMHG 4ZUHA 3DFLA 4JYVH 2G81E 3RXPA 3TJUA 3TGJE 1HV7A 4A7IB 1QQ4A 3MHWU 2ZDMA 2I6QA 5ESTE 1ELTA 1ELCA 3NWUA 1SGFG 3HKIB 1MZDA 1O2UA 1ELVA 1RS0A 3F9HA 4J2YB 2BD8A 5A0BA 3LGWA 1F5KU 1NU9A 2AMPA 3SI3H 1P12E 2PKAB 2ZA5A 1C2HA 7GCHG 2ODPA 1QJ1B 3PV4A 3RXBA 1A5GH 1EPTB 2FI4E 3U8TH 1KLIH 1O3OA 2PTNA 1CGIE 3LKWA 4BANB 3GY2A 2ZHQH 1SGDE 1UTQA 1CA0C 1LDTT 4AB9A 4DIIH 2PSYA 3URDA 1O2OA 1KDQB 4A1VA 3M5NA 2Y82A 3T62A 4AG1A 4D9QA 1O3FA 1PQ5A 2A7JA 3GOVB 4R8TB 1SHYA 1L1GA 1TNLA 1HAVB 2P3FH 1ZMJA 3A7YA 3LOXA 4X1RU 2J9NA 4ISIH 4NWLA 4ZH8A 2LNCA 4X2XA 4X0WU 1YPJH 1CVWH 5E0JA 1FLEE 3SHCH 4XBDA 2IN2A 3ITIA 4VGCB 1ZHMA 2NU1E 4R0IA 3T2NA 3GY5A 3HK3B 5EQSA 1XM1A 4E7RG 5DPAA 4AOQA 1HAPH 3NPSA 2G55A 3M7QA 2OXSA 2WUCA 1T8NA 1TNJA 2B8OH 4E7NA 2OCVB 1FJSA 5AFYH 3S9CA 3RMLH 2F3CE 3GY7A 1GVLA 3A7ZA 1J17T 1C2MA 2Z6BD 4BAKB 1C9TA 3D23A 1P0SH 1G3CA 4Y0YE 3PWBA 2FMJA 1BTXA 3QGNB 1GMCF 4TYDA 2F9OA 1QQUA 1MD7A 2ODQA 4K3JA 1CBWC 1O3LA 1C2DA 2FOAA 2ZTYA 7LPRA 1HUTH 1DANH 8KME2 1C2JA 4AFUA 2VWMA 1SLUB 5LGOA 1SGNE 1SG8B 4AB8A 1GG6B 4NSYA 4J1YA 3F68H 2Y81A 5DGJA 1H9LB 1L4ZA 1SLWB