3PTBA

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptbA02
1BRUP 4NWLA 1E34B 2FOMB 3PMBB 4B73A 2XBYA 4AFUA 5FPTA 1TABE 4BNRA 1UTQA 1TMBH 2FYQA 1P3EA 2YOLA 3DUXH 4UFEH 1HCGA 1FXYA 3SQEE 2FOHA 1JOUB 3A80A 2B0FA 2GV7A 4BAMB 3Q3KA 3RXRA 5DPAA 1FIZA 5SGAE 2CHAC 3N7OA 3HKJB 2CGAA 1RGQA 2AH4X 2G4TA 3GCTG 2F83A 2BLVA 3L3TA 2VWLA 1DOJA 1DVAH 2NU2E 1IQMA 3RMLH 1SHHB 3NUMA 4INKA 2JETC 2ANKH 4NIWA 1P12E 4X2VA 1OWEA 1K1JA 2O8TA 1ELCA 1TX7A 5GJ4B 4O9VA 2H9HA 1O2QA 2PGBB 4DURA 6CHAC 2EI8A 5K7RA 5TCCA 3UR9A 3F9FA 4RSPA 1HAVB 3H7OA 3MU0A 1GJCB 1WUNH 4DG4A 3SW2B 1SFIA 4JZ1A 1QB1A 1FY3A 3BEFB 1WBGB 3OY6U 2BDHA 1O5BB 1C9TA 4YT6H 1XXDA 4CRCA 1EAIA 1GBBA 1O2PA 2WPLS 2BOKA 2ZI2H 3UWIA 1AIXH 1K1MA 2W3KA 2ZHDA 3QN7A 1O2MA 3BEIB 3BTME 1ZSJA 1O2GH 3IITA 5F8ZA 3TVJB 4K2YA 1BTWA 1KIGH 1RTKA 4FU8A 3SQHE 4UD9H 1SPJA 2UUYA 1MKXK 1S5SA 3GYMA 1KXDA 1FV9A 1O31A 3HK6B 1EX3A 1ZR0A 3VB6A 2AS9A 1IAUA 4NSVA 1O3NA 3MH7A 2ZU3A 2HPQH 1TPSA 1EXFA 5HGGA 5IYTA 3S9CA 3FP6E 1SGYE 1HNEE 3TH2H 5FX5A 3U1JB 3TJVA 2D1JA 1HRTH 2BXUH 3RXIA 1CT4E 2VIOA 3K2UA 3LGTA 4KTCA 2BX3A 4YT7H 1CA8B 2JH0D 3TPIZ 3S69A 1CSOE 5A2MH 2VNTA 1ZZZA 4CH8B 1YPHC 2BD2A 2J2UA 2EC9H 2W7UA 3DHKH 1GBLA 4IBLH 3AASA 1AVXA 2WPHS 2BLOA 3TGJE 2PHBA 1HAYB 5DJ7A 1A3BH 3QDZB 2Y6TA 1AVWA 5EW2H 1P2JA 1XKAC 2GDEH 1DWCH 3RXOA 1C2FA 1DS2E 4I33A 2VWNA 1V2LT 1LHEH 3BF6H 3Q3YA 1OOKB 1A0JA 4OS1A 2Y82A 5AFZH 1AQ7A 4FUCA 1ANBA 1C5MD 3E0PB 3PO1B 1UTJA 2PTCE 4UE7H 1DUEA 1LQDB 3A88A 1YPEH 4NIYA 5EPYA 3OYPA 1V2NT 3QLPH 1SQTA 2VIDA 1O39A 2B8OH 3GY2A 2ALPA 4FVDA 3M5LA 2ZPRA 1ESAA 1AUTC 2QGRA 1M9UA 1CHOF 1LKBA 2BOHB 5C67A 1IQEA 3K6ZA 5DGJA 1FIWA 3NWUA 1ANEA 4AYVB 1G37A 2QA9E 2ZDKA 1HAXB 1HDTH 3ATIA 1HLTH 1MCVA 4AGKA 4JYTA 1OYQA 3BTFE 2GX4A 1V2PT 4FUJA 1GHBG 3QTOH 3SGBE 3MU1A 3TGKE 1TLDA 3GCTF 1P2MA 1IQGA 4U32A 3GY7A 3LGIA 3SUDA 1CGHA 1SOTA 1ZPCA 1QBVH 1EAUA 3URDA 3O8RA 1G32B 1MKWH 4ABJA 1QB6A 1SFQB 3A84A 2B7DH 1GJ4H 1QY6A 2BD8A 4JMYA 3ZV9A 1YPKH 1H9LB 2QF3A 2AIQA 3RUOA 1CGJE 4HGCA 1Y3VA 2ZGBH 3MU8A 1UTPA 1BTZA 4H6SB 3PLBA 1SHYA 3PWBA 3ODFA 1KLIH 3T26A 3MWIU 4MPWA 3ZYDA 1T8LA 3BN9A 3M61U 1C2DA 4JZFH 2UWOA 4WMEA 1H4WA 2WYJA 2OXSA 8ESTE 3H5CB 4JYVH 2ZDLA 1O3EA 4RN6A 1QGFA 5E2OA 1H9HE 1VCPA 4ISIH 1AHTH 1CGIE 2R0KA 1K2I1 4MVNA 4ZROA 2ZFRH 1PJPA 1F2SE 4Y79A 1KXBA 4BAHB 4ESTE 2ZCKP 2BX4A 3NCLA 2A4GA 3RXHA 1HJAB 1QBNA 5FHTA 1HAOH 2BQ6B 3EQ0H 4ISHH 1PQ7A 1TPPA 1UTMA 3OTJE 2GKVE 2QCYA 3SJ9A 1BRBE 3RC5A 3V7TA 3LDXH 3FANA 5AF9H 1C5WB 3PMJA 4DIHH 2GGVB 2ASUB 1TQ0B 4K5ZA 3AW1A 1P57B 2DE8A 2PUQH 2XYAA 1WYKA 3UIRA 1Z6JH 2FX6A 4MPVA 3SV6A 1JRTA 3A89A 9LPRA 2ALVA 2A31A 2OBOA 3UOPA 3P8OA 1ESBA 3RXSA 1SG8B 2NWNA 2ZHEH 3E1XB 1O5EH 4E7NA 5A0AE 1HV7A 1ELAA 2GMTC 1G30B 2WUBA 1F5LA 4X6MA 4ZHAA 1S0QA 2FI4E 2OQ5A 1O3PB 2SGPE 4A1XA 4FXGH 1VITH 1T31A 1A0HB 1E36B 2Z9KA 1CT2E 3RXFA 1D9IA 1EJAA 1C2KA 4AOQA 4NIXA 1LHDH 1W14U 3M3SA 1DLKB 1BRCE 2PUXB 3T28A 2CJIA 2FM2A 4JYUH 1IQFA 3A7WA 3RXGA 3A7YA 3S9BA 3ATWA 1X7AC 2P8OC 5F8XA 2XBWA 3PTNA 3RC6A 1LQEA 1FJSA 3OU0A 5DP9A 1O2VA 5C20A 1SGRE 4YESB 3ZZDA 1KSNA 2PGQB 2P3UB 4Z6AH 5JDUB 1EUFA 1O5AB 2ZTYA 2F91A 4TPIZ 4B71A 1A46H 4AYYB 2R9PA 1GHXH 1PPZA 1QRZA 2BQ7B 3IG6B 2EA3A 3GY4A 1EOJA 4GHQA 1MTNC 4O03A 1KYNA 1BZXE 4WMFA 2PKAA 1A7SA 2AERH 2A32A 1BB0B 1D6WA 1TNGA 2AMDA 1VGCB 4IS5A 1YPLH 4TWWA 1NTPA 1EZQA 1LPGB 3GYLB 4THNH 2FX4A 1UK2A 1B7XB 1J15A 1O3GA 2G5NA 1B0EA 1LVMA 3FFGA 2KAIA 3UNRA 1H8IH 1THPB 1TMUH 3VXFH 2O8LA 2GP9B 2OD3B 4NFEA 4Y7AA 2HALA 2ZU4A 2DE9A 6ESTA 8GCHF 1F92A 3MO6A 1TGSZ 1C2GA 2BD9A 3A85A 5EOKA 1A4WH 3TJNA 4X1SU 3RU4E 4Q80A 1XUJA 1JXPA 1LPKB 1XVMA 3TJOA 2Y5HA 1F7ZA 3FP7E 3BTQE 3MHWU 4KKDA 3L33A 2VJ1A 2W5EA 1GMDG 5L2ZH 1EAXA 2O8UA 3W94A 5GCHF 2F9BH 1FZZA 4HFPB 5I46H 4FUGA 1SGCA 3DFJA 4ABBA 1UVTH 3S0NA 2FOBA 1ZHMA 3M7UA 3S7HB 1TBQH 4ABHA 5J4QA 4INLA 2TGTA 1FAKH 4GAWA 3PLKA 3RXBA 1Z8RA 4OS6A 1A5HA 5LPRA 3URCA 1AVGH 4CR9A 1HIAA 1RIWB 1MU8B 2H6MA 1Y3XA 3E6PH 2K1QA 1EZXC 4X2XA 1BRAA 4DY7B 1BTPA 1O3KA 3RU4T 1JRSA 2EEKA 4HI3A 4ZHMU 1OS8A 3ATMA 1BBRK 2F3CE 1IQJA 1WOFA 1BDAA 4Y8ZA 1PPEE 1O2XA 2Y7ZA 1AKSB 3GDSA 1GBAA 1V2MT 2SGAA 1C2LA 3FVFB 2NU4E 3QGNB 1H9IE 4M7GA 1DE7H 3GDUA 1GBMA 2BDGA 1YPMH 5EQSA 4Y76A 3EA7A 3B23B 1Y5UT 1FI8A 4NGAH 2Z9IA 1Y59T 1DUAA 2ZFQH 3RXLA 1VCQA 4X0WU 3SUEA 1P10A 5HM2A 4A5TS 4HTCH 2ZECA 3I78A 1V2RT 1ELDE 4CBNA 3PLPA 4J2YB 1FPHH 3VGCB 1O3IA 2FOEA 1O38A 3Q00A 5HM9A 2FLBH 1LTOA 1PPBH 2RCEA 5HMAA 1O3DA 1NPMA 4CREA 4A1VA 4X2WA 2F9NA 3KHVA 1YYY1 5C1YA 2Z9LA 1O2JA 1HGTH 1QHRB 4U2WA 2Z3CA 3LKWA 2BD5A 1V3XA 1TPAE 1H1BA 3MO9A 2A5KA 1GG6B 1EPTC 2BY8X 3UREA 2D26C 3RXKA 2UUFB 3BG8A 2Z9GA 1QNJA 4I31A 4SGBE 1OP2A 2AEIH 2C8WB 1UHBA 2XWBI 1LHCH 3BIUH 3ITIA 4R0IA 5F03A 7ESTE 2H5DA 1P3CA 4DJZB 4MPXA 5GPIB 1FY1A 1ACBE 4Y8XA 1MUEB 4ZKRU 4YOJA 2BDBA 2CMYA 5LPFA 1GBJA 1GI4A 4WF8A 5C1XA 1C5ZB 1FNIA 3U98H 2FDAA 1FQ3A 5FCKA 4AB9A 3KQCA 4NG9H 1MD8A 1XUGA 1PPGE 2ZHFH 4Y71A 2GD4B 3MO3A 3NPSA 2BDCA 1ANDA 1GJ9B 2H9EH 1IQIA 3UPEA 4CRGA 4ZKNU 3A7VA 1LDTT 2QF0A 1ZYOA 4BANB 4ZHLU 3VB7A 1CBWC 3U8TH 5DP7A 4U01A 1VJAU 3TLOA 1Z6EA 1AZ8A 1S81A 1D3TB 2OC1A 4AFSA 1F0SA 1TRNA 3RXQA 2RA3A 5GCHG 1TMTH 3P8NA 1LMWB 1PPFE 5F6MA 1GBCA 2A4OA 4I8GA 3KQDA 2PR3A 2VVVA 4I8JA 4I8KA 1P09A 5DKMA 2THFB 3A7XA 1GJ7B 2ZFSA 1GI7B 1UTOA 4I8HA 3UTUH 1SGTA 3F6UH 1AFEH 1EZSC 1KY9A 1OP0A 1K9OE 2O8WA 1V2OT 3VB5A 1NM6A 4CHAC 1TB6H 1TGNA 4Y0YE 3F9HA 1IQNA 1GBFA 1MTSA 2FZZA 2QXIA 3B9FH 2TIOA 4ABEA 1DWDH 2SGEE 5G4BA 1DY8A 1ZSKA 1FONA 1QRWA 1AE5A 3SJKA 3QZRA 2JH5D 2CF8H 3GCOA 3MU4A 3EE0B 1YLCA 1TGTA 2BDAA 2IN2A 3ZVAA 1SGEE 4GVUA 4HZHA 4LK4A 3LC3A 1BHXF 4Y7BA 1ZPZA 1CBWB 4IC6A 3GISB 5B6OA 1MKWK 1TWXB 2AMPA 1F0RA 1S6HA 1SGPE 3H7TA 1RFNA 1VZQH 4F4OC 1NROH 5A09A 1BJUA 1UO6A 5L2YH 2BD4A 4AGJA 3TNTA 2SNWA 2ANMH 1BIOA 5TJXA 3GOVB 1GHYH 3V0XA 2BQWB 1ETRH 1Y5BT 2UWLA 1ABJH 3ENSB 1HXEH 1TQ7B 2WPJS 4I32A 1SGFG 1ETTH 1OX1A 1SMFE 1HXFH 4BXSA 5DO4H 1ELGA 2P3TB 4X6OA 1G3EA 3CS7A 5H4IB 1GJBB 2VVUA 5GIBA 3SHAH 1L0ZA 4Y6DA 3OX7U 2ZTXA 1UK3A 4TY7A 3SUGA 3LPRA 4WJG2 4YO9A 2J92A 3ZZAA 4AB8A 4FUEA 2J38A 2C4FH 1YBWA 3PO1C 1ELBA 2ZHWH 2D2DA 4K1EA 4UEHH 1G9IE 1QCPA 5C5OA 1TOCB 5GXPA 1V2KT 3B8JA 4AZ2B 1SOZA 1XKBC 1GI8B 2OUAA 1C5YB 3SU4A 2BY7X 5FBIA 2C8XB 2BDYA 5BRRE 1DXPA 3LJOA 5JBAS 1FN8A 3BSQA 4BAKB 1O2RA 2ZGJA 3K9XB 4K69A 1KXEA 1LVOA 2QV1A 2KAIB 3RMMH 1F0TA 1AWFH 2ZKSA 2O8MA 1VCWA 1C1UH 1P9UA 3RXAA 2GDDA 4WWYA 4A92A 1NU9A 2GCTB 3CENA 2BXTH 1C2IA 2XBXA 2WUCA 2C8ZB 5CHAC 3R0FA 5A0CA 1SSXA 1EAWA 2PKAB 3RXCA 1O3AA 1GJ5H 1QB9A 1BMNH 1GL0E 2R2MB 1AMHA 1FAXA 1G2MA 1KLJH 3A83A 3RXJA 2ODQA 2FYRA 1YP9A 1Y3YA 3PTBA 2NU1E 4WVPE 3BIVH 1DT2A 4IMZA 1XUFA 2BY5X 3BTEE 1TGCA 3U1IB 2G81E 1ZMJA 3LONA 3SZNA 1K1PA 1EKBB 2F9VA 2VIQA 3SNDA 1HFDA 3FP8E 4OS4A 1JMOH 4TPYA 4GCHG 1XVOA 4NA7A 1BBRE 2FESH 2GZ7A 2VGCB 3ZVCA 3SHCH 1WTHD 1ZSLA 2Z6BD 4IGDA 4UFGH 1T8OA 2VIPA 1WCZA 2A2QH 2R3UA 1J8AA 1FDPA 4IMQA 1MH0A 3UY9A 2B9LA 1OP8A 2BMGB 2V35A 2I6QA 1BTUA 2FPZA 4FUDA 2OINA 1YC0A 3MU5A 1O3JA 1PYTD 1SL3A 3O8BA 3ZVGA 4WXIA 1PQ8A 5F8TA 2QAAA 3K65B 1GG6C 2BLWA 3SN8A 3SJOA 5JBTA 1DFPA 1SR5C 3LGUA 4AORA 2BHGA 4JCNA 1EB1H 4MPUA 4OS2A 1UVSH 2VGCC 5IDKA 2VINA 1ZRBA 3QGJA 4UONA 2ZTZA 1C1RA 4FUBA 2RA0A 2P93A 4WH6A 2ZDMA 1KDQA 4NSYA 4YZUA 1GJDB 2GV6A 5EXLA 1UHBB 4I8LA 2XC0A 2P94A 4UDWH 3VGCC 1P06A 3UQVA 3SI4H 2XNIA 1MTNB 3D62A 3RP2A 4ABGA 1AWHB 3SU1A 1CA0C 2VH0A 4O97A 4CRDA 1T4UH 1WAYB 2SNVA 4Q7ZA 3K6YA 1J14A 5CHAB 1V2WT 2H2ZA 1GDUA 1SGIB 1NRPH 1GI1A 2GCTC 4BTIB 1PYTC 1GHBF 1QA0A 5EODA 1SGNE 1O0DH 2ZFPH 1WV7H 4SGAE 1C2JA 4ABFA 1DICA 3DD2H 3I77A 1DLEA 1C5OH 3BTHE 1PPHE 1OWHA 3HGNA 2FS9A 3NXPA 3ZZ7A 5DP8A 2ZF0H 1QQ4A 1TX8A 1O3MA 2GCHF 5K0HA 5FAHA 4YTAA 2QY0B 1ANCA 3MMGA 4K60A 2H9TH 1WSSH 1ELVA 4X8UH 1JBUH 1AY6H 1MD7A 3Q3XA 4OS7A 4CH2B 1J16A 2BYAX 4H6TA 3OSYA 1Z8GA 4DIIH 2ZDAH 1C2MA 4VGCC 1GJAB 2ZG0H 1OWJA 3UNSA 2ZO3H 3TK5A 1L4DA 2ZEBA 1N6XA 1XUHA 2OLGA 4XBCA 3KF2A 1UVPA 1GJ6A 2Y80A 1P03A 5GDSH 1YCPM 4MNVA 1SGQE 1D4PB 1W13U 4ISOA 1O36A 2HLCA 4X1RU 4O3TA 1CVWH 1P05A 1T4VH 5A0BA 1EB2A 4A7IB 5JB8S 3TH4H 1W7GH 5LH8A 3GY8A 1HIAB 1P8VC 3SI3H 1EATA 3A8BA 3RC4A 2LNCA 2XXLA 4BAQB 4CHAB 1A5IA 1GGDB 2FODA 4A6LA 3V3MA 1GHWH 1O3CA 1A61H 1P01A 1GBTA 1HAIH 3GDVA 5DP3A 3ODDA 4I7YH 1EZUC 4K8BA 1HB0B 2O9QA 1UTLM 4LZ4B 1HAZB 4GHTA 2W26A 4MTBA 1BMAA 4Y0ZE 1SLXB 1D3QB 3SV9A 3LGYA 2ZQ2A 3QK1A 1TGBA 3ZZ9A 2F9UA 3D65E 3RXVA 4AX9H 4IN2A 2GMTB 2WPIS 3IWMA 5FCRA 1NRQH 3PM3A 1B0FA 1K1NA 4ABIA 5LPEA 4ISLA 2GT7A 1IQKA 1A3EH 1C5SA 2G5VA 3NKKA 4FUHA 1K28D 2FTLE 1WQVH 4B2CA 4A1TA 7LPRA 3ZVBA 1C1TA 1NT1A 1ID5H 4ASHA 2YNBA 2A1DB 1ZMLA 4NFFA 1D6RA 2A0QB 3SNEA 2HWLB 3VPKA 2XWAA 2P8OB 1ZHPA 1HJ8A 1S6FA 3QTVH 2V3HH 5EGMA 2WV5A 2ODYB 2ZDVH 1ZRKA 2F9PA 2ZQ1A 2FO9A 3FZZA 3MNXA 5J4SA 1MKXH 2BZAA 2Z7FE 1TE0A 1LHGH 1V6DA 3M5OA 5TCAA 1K1LA 3M3VA 1GMHG 1HAVA 1OWKA 3U8RH 3MH6A 2QXHA 1DDJA 2GT8A 1AN1E 1PQ5A 1MTWA 2A7CA 1C1VH 1V2ST 1P02A 1ZOMA 1Z7KA 3F9GA 3CS0A 2A5AA 3ATKA 1W11U 2HVXA 3TK6A 1AO5A 1TNKA 1GI6A 1DITH 3M36A 1ARBA 1GI0A 2PWXA 3MYWA 2BB4A 1C5TA 2HOBA 2ILNA 5EQQA 1UJ1A 5EXNA 1S85A 5C1UA 2A7JA 3SV2H 1Y3WA 2FTMA 2UWPA 2FI3E 3PB1E 2Z94A 4AG2A 3ZVFA 5E0HA 3VB4A 4B76A 3A81A 3A7TA 3DT0H 3I29A 4NA8A 5L30H 1A5GH 1YKTA 3BTDE 4YLQH 1GI3A 2H5CA 1NESE 1D3PB 3M7QA 2BVRH 1ZJKA 4MNWA 1BQYA 2G52A 1EQ9A 1L1GA 2GZ9A 1A0LA 1G36A 1F5RA 2DUCA 1MCTA 5FXLA 2V6NA 1KDQB 5JPMH 1A1RA 1FMGA 1O5GH 1L1NA 1O5DH 1EASA 1BMMH 1GDQA 1W0YH 2ESTE 1C5XB 3BTGE 3M37A 2ZDNA 1ORFA 2VB0A 1AU8A 2ZHQH 3RMOH 1AFQB 1D3DB 2FOFA 2PSXA 3G01A 1AUJA 3SGQE 1SC8U 2AFQB 1PQAA 1DX5M 2C90B 3TJUA 1GVLA 1NZQH 3FZDA 2FS8A 2FWWA 1N8OB 1INCA 3M5NA 2ZPSA 1MAYA 3RDZA 2ZPQA 1P2OA 2D8WA 1J17T 1FY4A 5E8EH 4ZH8A 4ABAA 4JZEH 2ZA5A 2PTNA 4NIVA 2AYWA 3UR6A 1HUTH 2ZP0H 1GL1A 1KXAA 4K3JA 4Z0KA 2TPIZ 1MZDA 5HXFA 4XBBA 1FN6A 1AFQC 1ZLRA 2JKHA 2Z9JA 3VFEA 1O3OA 5A8ZA 2ZU1A 5CE1A 7KMEH 3M35A 4E7RG 2P59A 2TGAA 2VU8E 1ARCA 5EU8A 4J1YA 1NFYA 3M5MA 1P2KA 1RXPA 3C1KA 4E05H 1XMNB 3QX5H 1CT0E 1EJMA 3RLYH 3D23A 1GBHA 3QUMP 3BV9B 1GJ8B 1TA2A 1SLVB 2RDLA 3UQOA 2P3FH 4JK5A 2ZCHP 1GI5A 2CHAB 2J95A 2GTBA 4AN7A 1C1MA 1CQQA 4D7FA 1UK4A 3EAJA 1W12U 1W7XH 4X8TH 2FOGA 1UTKA 3MNBA 1O5CB 2OTVA 1SVPA 3BTWE 2Y5GA 2IOTA 3RXDA 1TRMA 1VGCC 2VIVA 1C5VA 2OC7A 1HAPH 1MBMA 4X6NA 5A8YA 2R0LA 4X1NU 1O30A 1GMDF 3EGKH 5E0JA 3KEEA 3PYHA 5CMXH 2BM2A 4NCYA 3LGWA 1TNLA 4ZXXH 1YPHE 4WMDA 3A87A 6CHAB 2CV3A 3ZVDA 1FY8E 1JIMA 1P9SA 4JZDH 1TYNA 2WYGA 4B2AA 1O2KA 3A8CA 1YPJH 3W95A 5T6FA 2BY9X 2AGIX 2JETB 1LHFH 1BCUH 4FVBA 2ZFFH 3HATH 1C5UA 2STBE 1GCTB 2J4IA 1V2QT 3UUZA 1BOQA 1T7CA 1C2HA 1RRKA 4XSKU 1JWTA 4GUXA 3Q77A 2HNTF 1UCYK 3LIWA 5EG4A 3SU2A 5JBCS 3A8DA 1TOMH 1QL9A 2ZNKH 3JZ2B 5FBEA 2QYIA 1NO9H 1WU1A 4ZAEA 4Q7XA 1O3HA 6GCHG 3BEUA 3E3TA 1Y8TA 4TYDA 1C1OA 2BVXH 2CXVA 1O2HA 1MTVA 1E35B 1YGCH 3A86A 1THRH 2VIWA 1G3BA 3WY8A 1MU6B 1QR3E 3KN2A 1NRNH 2NU3E 2Y81A 1IHSH 1N6YA 4BTUB 1S83A 5JYIA 4D9RA 1Z71A 4IW4E 1TNJA 1GHAF 5JB9S 2PV9B 1O3LA 1NN6A 2R2WU 4ZMAH 1BTYA 1ELTA 1MQ5A 1L4ZA 1HAGE 1SLWB 3ZZ6A 2FIRH 3TGIE 2HRVA 2ULLA 2XCFA 4ISNA 4D9QA 3AVZA 3ATLA 1C1NA 3VB3A 5EQRA 3SU0A 2GCHG 4H4FA 5FPSA 1NRRH 3VEQB 3CP7A 2J94A 1UVOA 1HYLA 1SBWA 3LJJA 5DP6A 5AHGH 3ZZ3A 1S0RA 3ZZBA 1MQ6A 4BOHA 4DGJA 4B74A 5AFYH 3SJ8A 3EYDA 2AMQA 1TALA 1BTHH 1GMCF 3STJA 3T29A 1MAXA 1O2NA 1DM4B 1QQUA 1DWEH 1W10U 1O2IA 1Q3XA 3KIDU 1Y3UA 1O37A 1E38B 4B2BA 2G51A 1O2LA 2W7SA 5E0GA 4ZKSU 1O32A 3KL6A 4Y8YA 1SB1H 4XE4A 2XTTB 2ZGHA 3NZIA 3LOXA 1BUIA 1L1JA 1T8NA 3P6ZB 1HAHH 3PROA 4OGYA 3SJIA 1ELFA 1SQOA 5ESTE 1K1IA 1QA7A 5ABWA 1WTGH 1QL7A 3RLWH 3JZ1B 3GCHC 3O8DA 3A7ZA 1GVZA 2R3YA 1AB9B 1ZGVA 1Q31A 3ZZCA 4CRFA 2BDIA 2Z3DA 1G3CA 3P70B 2Y5FA 2LPRA 2XBVA 4OS5A 1GHZA 1GGDC 1ESTA 4AFQA 2A5IA 5ESBA 4UFDH 1P2NA 1AD8H 3BG4B 3EA9A 1O2WA 1OWIA 3MTYA 1THSH 3TH3H 3TK9A 1NC6A 2FLRH 2F9OA 1VR1H 3RXTA 3FAOA 3U9AH 4YLUA 1KTTB 2AGGX 1N1LA 1NRSH 1EPTB 4X6PA 8LPRA 1W8BH 1TRYA 1ELEE 2BD3A 2BY6X 2VH6A 1NFUA 3F9EA 3SU6A 3SO3A 1BTXA 1GI9B 4TY6A 3RXUA 1AB9C 2BZ6H 5EXMA 1MMJN 9ESTA 1UCYE 1ZMNA 3OY5U 1BITA 2HGTH 2H1UA 3HKIB 1QBOA 2SGFE 2UUKB 3TNSA 4XFQA 2I6SA 4FUFA 5L6NH 4GCHF 2G00A 2WPKS 1AI8H 1Q2WA 4YOGA 5LGOA 2XRCA 1LKAA 3MFJA 4B1TA 5FX6A 1XM1A 2UUJB 1UCYH 1UVUH 4CR5A 1HBTH 1O3FA 4MDSA 1TBRH 2VWMA 1Z1IA 1S82A 2TGDA 2FEQH 2VWOA 3SORA 1OKXA 2FOCA 5EPNA 1QL8A 3SV8A 4LXBH 1GMCG 2WPMS 1ZTKA 5A8XA 2IJOB 1YM0A 5EW1H 4MQAA 4CRBA 1ZTJA 4Y10E 3SOSA 2FXRA 5T3HA 3AW0A 3E0NB 3UNQA 1LVBA 1C1WH 2ZGXH 5T6DA 4JZIA 4DW2U 2ZZUH 2SFAA 1TNIA 4BAOB 1BJVA 1QJ6B 2OQUA 3P8FA 1ZTLA 4XOJA 2PFEA 1DSTA 4PROA 4X2YA 2Q6GA 2QXGA 4CBOA 4E06H 1XX9A 1TIOA 1RIWC 2HPPH 2TGPZ 3V12A 1ABIH 1GPZA 3E16B 4K1SA 1EP6A 1AKSA 1IQHA 5AVDA 1FUJA 2Q6FA 1C2EA 1ZJDA 1C5NH 1AE8H 2QIQA 4B75A 1SGFA 2AGEX 1Z8JB 3P8GA 4FU9A 2BTCE 1S84A 4X1QU 2GZ8A 3P17H 2XCNA 5BPEA 3T5FH 2A7HA 2C3SA 1V2VT 3UWJH 2J34A 4XDEA 3MNSA 1TX6A 1LCYA 3KCGH 3RXPA 1AZZA 2FOAA 1C5LH 1DXWA 3ZYEA 2P95A 2STAE 3NK8A 1DY9A 1U6QA 1YCPH 5C3NA 4Q7YA 3SUFA 3KGPA 4NZLA 2FMJA 4ZXYH 2Q1JA 1XXFA 3E90B 1V2TT 1GCTC 3MI4A 4LZ1H 1NFWA 3A82A 1NY22 2OC8A 1EPTA 1RTFB 4R8TB 1C1SA 3QO6A 2SGDE 3MOCA 1K22H 1F0UA 3U8OH 3E8LA 3STIA 1N8OC 4FU7A 1TNHA 1GBDA 2IPHA 5GWZA 4K8YA 1ZPBA 1NU7B 3LT3A 2A4RA 1T32A 3R3GB 3RU4D 1C4U2 1C4V2 1G3DA 1YCPK 1C5RA 4D8NA 1L2EA 4MNXA 1TAWA 1OSSA 1O2OA 1YPGH 4D76A 1JIRA 1B5GH 1IOEA 1QFKH 4O3UA 2V3OH 2RG3A 4UFFH 1C5PA 1J9CH 4MLFB 3DFLA 3ZZ5A 7GCHG 4LOYH 7GCHF 1BT7A 1W3CA 2A2XH 1W2KH 4NA9H 3SBKA 1MBQA 2TRMA 3SU3A 1QURH 1GHAG 1O2TA 1KTSB 1W0ZU 1BBRH 1GI2A 2WINI 1GBIA 1CU1A 3O8CA 2QC2A 1QRXA 3LH1A 4Y11E 2ZU5A 1DSUA 2VVCA 1C9PA 2PW8H 1C1PA 1YLDA 1MZAA 2CF9H 1O2YA 4K1TA 4ZKOU 1CHOG 3T2NA 3C27B 4XBDA 1QJ1B 3GICB 4ABDA 1FPCH 1H8DH 4BXWA 2PLXA 8GCHG 3MH5A 4KTUA 1GHVH 1BHXB 2SGQE 1GVKB 1EP5A 5T6GA 2PKSB 1RJXB 3ZZ8A 1WQSA 4DOQA 5ETXA 3L6PA 1A2CH 1UTNA 3GY6A 1FLEE 5I25A 1O2ZA 1BMLA 4DVAU 1EJNA 3RXEA 3SU5A 3PV4A 1YF4A 1OWDA 1Y5AT 3UOUA 1OYTH 1PFXC 3D49H 1LVYA 1K1OA 4TWYA 3EA8A 6LPRA 3SNBA 2BLQA 4AG1A 2ZC9H 1E0FD 2C93B 1O3BA 3SNAA 1IHTH 3RXMA 1T8MA 4RKOB 6GCHF 3MNCA 3P95A 1GBKA 3BTTE 1O2UA 2NU0E 4GLYA 2HNTC 1C4Y2 1E37B 1LO6A 1OXGA 4AFZA 1XUIA 1EOLA 3TITA 3T27A 1O34A 2OP9A 1GMHF 2W3IA 5PTPA 3ZV8A 2ZCLP 1HPGA 4NWKA 1P11E 3LH3A 1VITF 3GY3A 4X8VH 1SGDE 1SI5H 2A4QA 4F49A 4WH8A 1XUKA 1ETSH 3V13A 3M3TA 3GCHB 3SGAE 2Z3EA 1NS3A 1TONA 1TPOA 1IQLA 2HNTE 2FI5E 4H42U 3DA9B 2CN0H 2EI6A 3ESTA 3F68H 1KXCA 3PMHB 1P0SH 4YOIA 4BTTB 4KELA 3VXEH 1RD3B 4GSOA 1SLUB 1PPCE 2OCVB 4X1PU 1UMAH 5DP4A 1FY5A 2Q6DA 2TBSA 3QZQA 2PSYA 1OPHB 3ZZ4A 1TBZH 5DP5A 3SV7A 1RTLA 1HJ9A 3GY5A 1O35A 1ZHRA 3LGVA 3HPTB 2V0BA 1O5FH 1BA8B 2J9NA 2EI7A 1Z1JA 3ELAH 1HJAC 3KQEA 1AGJA 1QIXB 5C5NA 8KME2 4IC5A 3RMNH 2ODPA 4INHA 2ZIQH 1P04A 3LU9B 2GVFA 1Z8IB 1QTFA 2QXJA 2M5TA 3GCNA 3HK3B 4Q2KA 2ANWA 4MG3A 3RM0H 3S9AA 4DT7B 3KQBA 1KLTA 3ZVEA 1O2SA 2C8YB 4QT8C 1P2IA 2AIPA 1F5KU 1GBEA 3KNXA 3UFAA 3SNCA 1C5QA 1VITG 1C1QA 4X8SH 2PKSC 1CHGA 4CRAA 4VGCB 5HYOA 3P92A 3Q76A 3TU7H 2ANYA 4DCDA 3MH4A 2JH6D 4WXVA 5FPYA 3RM2H 4RKJB 3QWCH 4JK6A 3F1SB 2ZU2A 4MNYA 3U69H 5C2ZA 1DANH 2ZWLH 4KGAA 2ZFTA 3BTKE 1G2LA 1VJ9U 1RS0A 2A45B 1CE5A 3T62A 2G55A 2G8TA 2P16A 3BG4C 2WV4A 5JBBS 3EDXB 1LPZB 1QJ7B 1TA6A 1TFXA 2FP7B 2XW9A 1O33A 2XC4A 4YM9A 3HGPA 1KXFA 4U30A 1SQAA 3PMAB 4IN1A 1DWBH 3E91A 3PWCA 5DK1A 4KP0A 1GWAA 2Y7XA 1GCDA 1V2JT 4FUIA 2OC0A 2G4UA 3AAVA 3T25A 1K21H 2BD7A 2OBQA 1CO7E 2XC5A 2B5TB 2BVSH 2ZGCA 3A8AA 3M7TA 3S7KB 3AAUA 4GPGA 1P2QA 1CA0B 3TIUA 4D7GA 1DPOA 4ZUHA 1MTUA 4KTSA 3LC5A 1ZGIA 1NFXA 4NZQA 1GDNA 4WY3A 5DG6A 1V2UT 5E2PA 2YNAA 2QN5T 4OGXA
chains in the Genus database with same CATH superfamily
1BRUP 4NWLA 1E34B 2FOMB 3PMBB 4B73A 2XBYA 4AFUA 5FPTA 1TABE 4BNRA 1UTQA 1TMBH 2FYQA 1P3EA 2YOLA 3DUXH 4UFEH 1HCGA 1FXYA 3SQEE 2FOHA 1JOUB 5HIYA 3A80A 2B0FA 2GV7A 4BAMB 3WW7A 3Q3KA 3RXRA 5DPAA 1FIZA 5SGAE 2CHAC 3N7OA 3HKJB 2CGAA 1RGQA 2AH4X 2G4TA 2K0QA 3GCTG 2F83A 3UB0A 2BLVA 3F2HA 3L3TA 2VWLA 1DOJA 1DVAH 2NU2E 1IQMA 3RMLH 1SHHB 3NUMA 4INKA 2JETC 2ANKH 4NIWA 1P12E 4X2VA 1OWEA 1K1JA 2O8TA 1ELCA 1TX7A 5GJ4B 4O9VA 2H9HA 1O2QA 2PGBB 4DURA 6CHAC 2EI8A 5K7RA 5TCCA 3UR9A 3F9FA 4RSPA 1HAVB 2LELA 3H7OA 3MU0A 1GJCB 1WUNH 2QE7D 4DG4A 3SW2B 1SFIA 4JZ1A 1QB1A 5B6LA 1FY3A 3BEFB 3DSPA 1WBGB 3OY6U 2BDHA 1O5BB 1C9TA 4YT6H 1XXDA 4CRCA 1EAIA 1GBBA 1O2PA 2WPLS 2BOKA 2ZI2H 3UWIA 1AIXH 1K1MA 2W3KA 1KMHB 1WDIA 2HVYB 2ZHDA 3QN7A 1O2MA 3BEIB 3BTME 1ZSJA 1O2GH 3IITA 5F8ZA 3TVJB 4K2YA 1BTWA 1KIGH 1RTKA 4FU8A 3SQHE 4UD9H 1SPJA 2UUYA 1MKXK 1S5SA 3GYMA 1KXDA 1FV9A 1O31A 3HK6B 1EX3A 1ZR0A 3VB6A 2AS9A 1IAUA 2VBCA 4NSVA 1O3NA 3MH7A 2ZU3A 2HPQH 1TPSA 1EXFA 5HGGA 5IYTA 3DCLA 3S9CA 3FP6E 3OTPA 1SGYE 1HNEE 3TH2H 2XOKD 5FX5A 3U1JB 3TJVA 2D1JA 1HRTH 2BXUH 3RXIA 1CT4E 2VIOA 3K2UA 3LGTA 4KTCA 2BX3A 4YT7H 1CA8B 2JH0D 3TPIZ 3S69A 1CSOE 5A2MH 2VNTA 1ZZZA 4CH8B 1YPHC 2BD2A 2J2UA 2EC9H 2W7UA 3DHKH 4RT1A 1GBLA 4IBLH 3AASA 1AVXA 2WPHS 2BLOA 3TGJE 2PHBA 1HAYB 5DJ7A 1A3BH 3QDZB 2Y6TA 1AVWA 5EW2H 1P2JA 1XKAC 2GDEH 1DWCH 3RXOA 1C2FA 1DS2E 4I33A 2VWNA 1V2LT 1LHEH 3BF6H 3Q3YA 1OOKB 1A0JA 4OS1A 2Y82A 5AFZH 1AQ7A 4FUCA 1ANBA 1C5MD 3E0PB 3PO1B 4DT4A 1UTJA 2PTCE 4UE7H 1DUEA 1LQDB 3A88A 1YPEH 4NIYA 5EPYA 3OYPA 1V2NT 3QLPH 1SQTA 1O39A 2VIDA 2B8OH 3GY2A 2ALPA 2LP6A 4FVDA 3M5LA 2ZPRA 1ESAA 1AUTC 2QGRA 1M9UA 1CHOF 1LKBA 2BOHB 5C67A 1IQEA 3K6ZA 5DGJA 1FIWA 3NWUA 1ANEA 4AYVB 1G37A 2QA9E 2ZDKA 1HAXB 1HDTH 3ATIA 1HLTH 1MCVA 4AGKA 4JYTA 1OYQA 3BTFE 2GX4A 1V2PT 4FUJA 1GHBG 3QTOH 3SGBE 3MU1A 3TGKE 2WHXA 1TLDA 3GCTF 1P2MA 1IQGA 4U32A 3GY7A 3LGIA 3SUDA 1CGHA 1SOTA 1ZPCA 1QBVH 1EAUA 3URDA 3O8RA 1G32B 1MKWH 4ABJA 1QB6A 1SFQB 3A84A 4HG6A 2B7DH 1GJ4H 1QY6A 2BD8A 4JMYA 3ZV9A 1YPKH 1H9LB 2CK3D 2QF3A 2AIQA 3RUOA 1CGJE 4HGCA 1Y3VA 2ZGBH 3MU8A 1UTPA 1BTZA 4H6SB 3PLBA 1SHYA 3PWBA 3ODFA 1KLIH 3T26A 1E79D 3MWIU 4MPWA 3ZYDA 3PV2A 1T8LA 3BN9A 3M61U 1C2DA 4JZFH 2UWOA 4WMEA 4AC9A 1H4WA 2WYJA 2OXSA 8ESTE 3H5CB 4JYVH 2ZDLA 1O3EA 4RN6A 1QGFA 5E2OA 1BMFD 1H9HE 1VCPA 4ISIH 1AHTH 1CGIE 2R0KA 1K2I1 4MVNA 4ZROA 2ZFRH 1PJPA 1F2SE 4Y79A 1KXBA 4BAHB 4ESTE 2ZCKP 2BX4A 3NCLA 2A4GA 3RXHA 1HJAB 1QBNA 5FHTA 1HAOH 2BQ6B 4RI0A 3EQ0H 4ISHH 1PQ7A 1TPPA 1UTMA 3OTJE 2GKVE 2QCYA 4M9FA 1BRBE 3SJ9A 3RC5A 3V7TA 3LDXH 3FANA 5AF9H 1C5WB 3PMJA 4DIHH 2GGVB 2ASUB 1TQ0B 4K5ZA 3AW1A 1P57B 2DE8A 2PUQH 2XYAA 1WYKA 3UIRA 2PP6A 1Z6JH 2FX6A 4MPVA 3SV6A 1JRTA 3A89A 9LPRA 2ALVA 2A31A 2OBOA 3UOPA 3P8OA 1ESBA 3RXSA 1SG8B 2NWNA 2ZHEH 3E1XB 1O5EH 3VG8A 4E7NA 1HV7A 5A0AE 1ELAA 2GMTC 1G30B 2WUBA 1F5LA 4X6MA 4ZHAA 1S0QA 3OE7D 2FI4E 3FN8A 2OQ5A 1O3PB 2SGPE 4A1XA 4FXGH 1VITH 1T31A 1A0HB 1E36B 2KCPA 2Z9KA 1CT2E 3RXFA 1D9IA 1EJAA 1C2KA 4AOQA 4NIXA 1LHDH 1W14U 3M3SA 1DLKB 1BRCE 2PUXB 3T28A 1QZ8A 2CJIA 2FM2A 4JYUH 1IQFA 3A7WA 3RXGA 3A7YA 3S9BA 3ATWA 1X7AC 2P8OC 5F8XA 2XBWA 3PTNA 3RC6A 1LQEA 1FJSA 3OU0A 5DP9A 1O2VA 5C20A 1SGRE 4YESB 5KEDA 2HLDD 1KSNA 3ZZDA 2PGQB 2P3UB 4Z6AH 5JDUB 1EUFA 1O5AB 2ZTYA 2F91A 4TPIZ 4B71A 1A46H 4AYYB 1H8ED 1GHXH 1PPZA 1QRZA 2BQ7B 2R9PA 3IG6B 2EA3A 3GY4A 1EOJA 4GHQA 2KFWA 1MTNC 5C0UA 4O03A 3MQKC 1KYNA 1BZXE 4WMFA 2PKAA 1A7SA 2AERH 2A32A 1BB0B 1D6WA 1TNGA 2AMDA 1VGCB 4IS5A 1YPLH 4TWWA 1NTPA 1EZQA 1LPGB 3GYLB 4THNH 2FX4A 1UK2A 1B7XB 1J15A 1O3GA 2G5NA 1B0EA 1LVMA 3FFGA 2KAIA 2KZ4A 1H8IH 3UNRA 1THPB 1TMUH 3VXFH 2O8LA 2GP9B 2OD3B 4NFEA 4Y7AA 2HALA 2ZU4A 2DE9A 6ESTA 8GCHF 1F92A 3MO6A 5HIZA 5CDFE 1TGSZ 1C2GA 2BD9A 3A85A 5EOKA 1A4WH 3TJNA 5KECA 4X1SU 3RU4E 4Q80A 1XUJA 1JXPA 2L6OA 1LPKB 1XVMA 5CHBA 3TJOA 2Y5HA 1F7ZA 3FP7E 3BTQE 3MHWU 4KKDA 3L33A 2VJ1A 2W5EA 1GMDG 3F0OA 5L2ZH 1EAXA 2O8UA 3W94A 5GCHF 2F9BH 1FZZA 4HFPB 5I46H 4FUGA 1SGCA 3DFJA 4ABBA 1UVTH 3S0NA 2FOBA 1ZHMA 3M7UA 3S7HB 1TBQH 4ABHA 5J4QA 4INLA 2TGTA 1FAKH 4GAWA 3PLKA 2KCYA 3RXBA 1Z8RA 4OS6A 1A5HA 5LPRA 3URCA 2WPDD 1AVGH 4CR9A 1HIAA 1RIWB 1MU8B 2H6MA 1Y3XA 3E6PH 2K1QA 1EZXC 4X2XA 1BRAA 4DY7B 1BTPA 1O3KA 3RU4T 1JRSA 2EEKA 4HI3A 4ZHMU 1OS8A 3ATMA 1BBRK 2F3CE 1IQJA 1WOFA 1BDAA 4Y8ZA 1PPEE 1O2XA 2Y7ZA 1AKSB 3GDSA 1GBAA 2EQNA 1V2MT 2SGAA 1C2LA 3FVFB 2NU4E 3QGNB 1H9IE 4M7GA 1DE7H 3GDUA 1GBMA 2BDGA 1YPMH 5EQSA 4Y76A 3EA7A 3B23B 1Y5UT 1FI8A 4NGAH 3PRBA 2Z9IA 1Y59T 1DUAA 2ZFQH 3RXLA 1VCQA 4X0WU 3SUEA 1P10A 5HM2A 4A5TS 4HTCH 4TSFD 2ZECA 3I78A 1V2RT 1ELDE 4CBNA 3PLPA 4J2YB 1FPHH 3VGCB 1O3IA 2FOEA 1O38A 3Q00A 5HM9A 2FLBH 1LTOA 1PPBH 2RCEA 5HMAA 1O3DA 3F2GA 1NPMA 4CREA 2K8IA 4A1VA 5HKKD 4X2WA 2F9NA 3KHVA 1YYY1 3PRDA 5C1YA 5IK2D 2Z9LA 1O2JA 1HGTH 1OHHD 1QHRB 4U2WA 2Z3CA 3LKWA 2BD5A 1V3XA 1TPAE 1H1BA 3MO9A 2A5KA 1GG6B 1EPTC 2BY8X 3UREA 2D26C 3RXKA 2UUFB 3BG8A 2Z9GA 1QNJA 4I31A 4SGBE 1OP2A 2AEIH 3OEED 2C8WB 1FX0B 1UHBA 2V7QD 2XWBI 1LHCH 3BIUH 3ITIA 4R0IA 2W6ID 3F2FA 5F03A 7ESTE 2H5DA 1P3CA 4DJZB 4MPXA 5GPIB 3SYJA 1FY1A 1ACBE 4Y8XA 1MUEB 4ZKRU 4YOJA 2BDBA 2CMYA 5LPFA 1GBJA 1GI4A 4WF8A 5C1XA 1C5ZB 1FNIA 3U98H 2FDAA 1FQ3A 5FCKA 4AB9A 3KQCA 4NG9H 1MD8A 1XUGA 1PPGE 2ZHFH 4Y71A 2GD4B 3MO3A 3NPSA 2BDCA 1ANDA 1GJ9B 2H9EH 1IQIA 3UPEA 4CRGA 4ZKNU 3A7VA 1LDTT 2QF0A 1ZYOA 4BANB 4ZHLU 3VB7A 1CBWC 3U8TH 5DP7A 4U01A 1VJAU 3TLOA 1Z6EA 4F55A 2J98B 1AZ8A 1S81A 1D3TB 2OC1A 4AFSA 1F0SA 1TRNA 3RXQA 2RA3A 5GCHG 1TMTH 3P8NA 1LMWB 1PPFE 5F6MA 1GBCA 2A4OA 4I8GA 3KQDA 2PR3A 2VVVA 4I8JA 4I8KA 1P09A 5DKMA 2THFB 3A7XA 1GJ7B 2ZFSA 3CNRA 1GI7B 1UTOA 4I8HA 3UTUH 1SGTA 3F6UH 1AFEH 1EZSC 1KY9A 1OP0A 1K9OE 2O8WA 1V2OT 3VB5A 3OEHD 1NM6A 4CHAC 1TB6H 1TGNA 4Y0YE 3F9HA 1IQNA 1GBFA 1MTSA 2FZZA 1W0JD 2QXIA 3B9FH 5GNDA 2TIOA 4Q63A 1DWDH 4ABEA 2SGEE 2IPQX 5G4BA 1DY8A 1ZSKA 1FONA 1QRWA 1AE5A 3SJKA 3QZRA 2JH5D 2CF8H 3GCOA 3MU4A 4XD7D 3EE0B 1YLCA 1TGTA 2BDAA 2IN2A 3ZVAA 1SGEE 4GVUA 4HZHA 4LK4A 3LC3A 1BHXF 3NRLA 4Y7BA 1ZPZA 1CBWB 4IC6A 3GISB 5B6OA 3H09A 1MKWK 1TWXB 2AMPA 1F0RA 1S6HA 1SGPE 3H7TA 1RFNA 1VZQH 4F4OC 1NROH 5A09A 1BJUA 1UO6A 5L2YH 2BD4A 4AGJA 3TNTA 2SNWA 2ANMH 1BIOA 1EFRD 1NBME 5TJXA 3GOVB 1GHYH 3V0XA 2BQWB 1ETRH 1Y5BT 2UWLA 1ABJH 3ENSB 1HXEH 1TQ7B 2WPJS 4I32A 1SGFG 2AHME 1ETTH 1OX1A 1SMFE 1HXFH 4BXSA 3FO8D 5DO4H 1ELGA 2P3TB 4X6OA 1G3EA 3CS7A 5H4IB 1GJBB 2VVUA 5GIBA 3SHAH 2RDEA 1L0ZA 4Y6DA 3OX7U 2ZTXA 1UK3A 4TY7A 3SUGA 3LPRA 4WJG2 2YMSD 2J92A 4YO9A 3ZZAA 4AB8A 5EJLA 4FUEA 2J38A 2C4FH 1YBWA 3PO1C 1ELBA 2ZHWH 2D2DA 4K1EA 4UEHH 1G9IE 1QCPA 5C5OA 1TOCB 5GXPA 1V2KT 3B8JA 4AZ2B 1SOZA 1XKBC 1GI8B 2OUAA 1C5YB 3SU4A 2BY7X 5FBIA 1WXRA 2C8XB 2JDID 2BDYA 5BRRE 1DXPA 3LJOA 5JBAS 2KR7A 1FN8A 3BSQA 4BAKB 1O2RA 2ZGJA 3K9XB 4K69A 1KXEA 1LVOA 2QV1A 2KAIB 3N7EA 3RMMH 1F0TA 1AWFH 2ZKSA 2O8MA 1VCWA 1C1UH 1P9UA 3RXAA 2GDDA 4WWYA 4A92A 1NU9A 5T1VA 2GCTB 3CENA 2BXTH 1C2IA 2XBXA 2WUCA 2C8ZB 5CHAC 3R0FA 5A0CA 1SSXA 1EAWA 2PKAB 3RXCA 1O3AA 1GJ5H 1QB9A 1BMNH 1GL0E 3KYGA 2R2MB 1AMHA 1FAXA 1G2MA 1KLJH 3A83A 3RXJA 2ODQA 2FYRA 1YP9A 1Y3YA 3PTBA 2NU1E 4WVPE 3BIVH 1DT2A 4IMZA 1XUFA 2BY5X 3BTEE 1TGCA 3U1IB 2G81E 1ZMJA 3LONA 3SZNA 1K1PA 1EKBB 2F9VA 2VIQA 3SNDA 1HFDA 3FP8E 4OS4A 1JMOH 4TPYA 4GCHG 1XVOA 4NA7A 1BBRE 2FESH 4OM9A 2GJGA 2GZ7A 2VGCB 3ZVCA 5EIYA 3SHCH 1WTHD 1ZSLA 2Z6BD 4IGDA 4UFGH 1T8OA 2VIPA 1WCZA 2YMSC 2A2QH 2R3UA 1J8AA 1FDPA 3F3BA 4IMQA 1MH0A 3UY9A 2B9LA 1OP8A 2BMGB 2V35A 1COWD 2I6QA 1BTUA 2FPZA 4FUDA 2OINA 1YC0A 3MU5A 1O3JA 2JJ2D 1PYTD 1SL3A 3O8BA 3ZVGA 4WXIA 1PQ8A 5F8TA 4I86A 2QAAA 4TT3D 3K65B 1GG6C 2BLWA 3SN8A 3SJOA 5JBTA 1DFPA 2F4LA 1SR5C 3LGUA 4AORA 2BHGA 4JCNA 1EB1H 4MPUA 4OS2A 1UVSH 2VGCC 5IDKA 2VINA 1ZRBA 3QGJA 4UONA 2ZTZA 2L74A 2YMSB 1C1RA 4FUBA 2RA0A 2P93A 4WH6A 2ZDMA 1KDQA 4NSYA 4YZUA 1GJDB 2GV6A 5EXLA 1UHBB 4I8LA 2XC0A 3WWFA 2P94A 4UDWH 3VGCC 1P06A 3UQVA 3SI4H 2XNIA 1MTNB 3D62A 3RP2A 4ABGA 1AWHB 3SU1A 1CA0C 2VH0A 4O97A 4CRDA 1T4UH 1WAYB 2SNVA 4Q7ZA 3K6YA 1J14A 5CHAB 1V2WT 2H2ZA 1GDUA 1SGIB 1NRPH 1GI1A 2GCTC 4BTIB 1PYTC 1GHBF 1QA0A 5EODA 1SGNE 1O0DH 2J97A 3OAAD 2ZFPH 1WV7H 4SGAE 1C2JA 4ABFA 1DICA 3DD2H 3I77A 1DLEA 1C5OH 3BTHE 1PPHE 1OWHA 3HGNA 2FS9A 3NXPA 3ZZ7A 5DP8A 2ZF0H 1QQ4A 1TX8A 1O3MA 2GCHF 5K0HA 5FAHA 4YTAA 1E1QD 1ANCA 2QY0B 3MMGA 4K60A 2H9TH 1WSSH 1ELVA 4X8UH 1JBUH 1AY6H 1MD7A 3Q3XA 4OS7A 4CH2B 1J16A 2BYAX 4H6TA 3OSYA 1Z8GA 4DIIH 2ZDAH 1C2MA 2KCAA 4VGCC 2IJD1 1GJAB 2ZG0H 1OWJA 3UNSA 2ZO3H 3TK5A 1L4DA 2ZEBA 1N6XA 1XUHA 2OLGA 4XBCA 3KF2A 1UVPA 1GJ6A 2Y80A 1P03A 5GDSH 1YCPM 4MNVA 1SGQE 1D4PB 1W13U 4ISOA 1O36A 2HLCA 4X1RU 4O3TA 1SKYE 1CVWH 1P05A 1T4VH 5A0BA 1MABB 1EB2A 4A7IB 5JB8S 3TH4H 1W7GH 5LH8A 3GY8A 1HIAB 1P8VC 3SI3H 1EATA 3A8BA 3RC4A 2LNCA 2XXLA 4BAQB 4CHAB 1A5IA 1GGDB 2FODA 4A6LA 3V3MA 1GHWH 1O3CA 1A61H 1P01A 1GBTA 1HAIH 3GDVA 5DP3A 3ODDA 4I7YH 1EZUC 4K8BA 1HB0B 2O9QA 1UTLM 4LZ4B 1HAZB 4GHTA 2W26A 4MTBA 1BMAA 4Y0ZE 1SLXB 1D3QB 3SV9A 3LGYA 2ZQ2A 3QK1A 1TGBA 3ZZ9A 2F9UA 3D65E 3RXVA 4AX9H 4IN2A 2GMTB 2WPIS 3IWMA 5FCRA 1NRQH 3PM3A 1B0FA 1K1NA 4ABIA 5LPEA 4ISLA 2GT7A 1IQKA 1A3EH 1C5SA 2G5VA 3NKKA 4FUHA 1K28D 2FTLE 1WQVH 4B2CA 4A1TA 7LPRA 3ZVBA 1C1TA 1NT1A 1ID5H 4ASHA 2YNBA 2A1DB 1ZMLA 4NFFA 1D6RA 2A0QB 3SNEA 2HWLB 3VPKA 2XWAA 2P8OB 1ZHPA 1HJ8A 1S6FA 3QTVH 2V3HH 5EGMA 2WV5A 2ODYB 2ZDVH 1ZRKA 2F9PA 2ZQ1A 2FO9A 3FZZA 3MNXA 5J4SA 1MKXH 2BZAA 2Z7FE 1TE0A 1LHGH 1V6DA 3M5OA 5TCAA 1K1LA 3M3VA 1GMHG 1HAVA 1OWKA 3U8RH 3MH6A 2QXHA 1DDJA 2GT8A 4ACAA 1AN1E 1PQ5A 1MTWA 2A7CA 1C1VH 1V2ST 1P02A 1ZOMA 1Z7KA 3F9GA 3CS0A 2A5AA 3ATKA 1W11U 2HVXA 3TK6A 1AO5A 1TNKA 1GI6A 1DITH 3M36A 1ARBA 1GI0A 2PWXA 1UW7A 3MYWA 2BB4A 1C5TA 2HOBA 2ILNA 5EQQA 1UJ1A 5EXNA 2KX4A 1S85A 5C1UA 2A7JA 3SV2H 1Y3WA 2FTMA 2J5UA 2UWPA 2FI3E 3PB1E 2Z94A 4AG2A 3ZVFA 5E0HA 3VB4A 4B76A 3A81A 3A7TA 3DT0H 3I29A 4NA8A 5L30H 1A5GH 1YKTA 3BTDE 4YLQH 1GI3A 2H5CA 1NESE 1D3PB 3M7QA 2BVRH 1ZJKA 4MNWA 1BQYA 2G52A 1EQ9A 1L1GA 2GZ9A 1A0LA 1G36A 1F5RA 2DUCA 1MCTA 5FXLA 2V6NA 1KDQB 5JPMH 1A1RA 1FMGA 1O5GH 1L1NA 1O5DH 1EASA 1GDQA 1BMMH 1W0YH 2ESTE 1C5XB 3BTGE 3M37A 2ZDNA 1ORFA 2VB0A 1AU8A 2ZHQH 3RMOH 1AFQB 1D3DB 2FOFA 2PSXA 3G01A 1AUJA 4F48B 3SGQE 1SC8U 2AFQB 1PQAA 1DX5M 2C90B 3TJUA 1GVLA 1NZQH 3FZDA 2FS8A 2FWWA 1N8OB 1INCA 3M5NA 2ZPSA 1MAYA 3RDZA 2ZPQA 1P2OA 2D8WA 1J17T 1FY4A 3F0PA 5E8EH 4ZH8A 4ABAA 4JZEH 2ZA5A 2PTNA 4NIVA 2AYWA 3UR6A 1HUTH 2ZP0H 1GL1A 2WZQA 1KXAA 4ACBA 4K3JA 4Z0KA 2TPIZ 1MZDA 5HXFA 4XBBA 1FN6A 1AFQC 1ZLRA 2JKHA 2Z9JA 3VFEA 1O3OA 5A8ZA 2ZU1A 5CE1A 7KMEH 3M35A 4E7RG 2P59A 2TGAA 2VU8E 1ARCA 5EU8A 4J1YA 1NFYA 3M5MA 1P2KA 3W1EA 1RXPA 3C1KA 4E05H 1XMNB 3QX5H 1CT0E 1EJMA 3RLYH 3D23A 1GBHA 3QUMP 3BV9B 1GJ8B 1TA2A 1SLVB 2RDLA 3UQOA 2P3FH 4JK5A 2ZCHP 1GI5A 2CHAB 2J95A 2GTBA 4AN7A 1C1MA 1CQQA 4D7FA 1UK4A 3EAJA 1W12U 1W7XH 4X8TH 2FOGA 1UTKA 3MNBA 1O5CB 2OTVA 1SVPA 4ZCNA 3BTWE 2Y5GA 2IOTA 3PV5A 3RXDA 1H8HD 1TRMA 1VGCC 2VIVA 1C5VA 2OC7A 1HAPH 1MBMA 4X6NA 5A8YA 2R0LA 4X1NU 1O30A 1GMDF 3EGKH 2XNDD 5E0JA 3KEEA 3PYHA 5CMXH 2BM2A 4NCYA 3LGWA 1TNLA 4ZXXH 4Z1MD 1YPHE 4WMDA 3A87A 6CHAB 2CV3A 3ZVDA 1FY8E 1JIMA 1P9SA 4JZDH 1TYNA 2WYGA 4B2AA 1O2KA 3A8CA 1YPJH 3W95A 5T6FA 2BY9X 2AGIX 2JETB 1LHFH 2WV9A 1BCUH 4FVBA 2ZFFH 3HATH 1C5UA 2STBE 1GCTB 2J4IA 1V2QT 3UUZA 1BOQA 1T7CA 1C2HA 1RRKA 4XSKU 1JWTA 4GUXA 3Q77A 2HNTF 1UCYK 4P00A 5FL7D 3LIWA 5EG4A 3SU2A 5JBCS 3A8DA 2JIZD 1TOMH 1QL9A 2ZNKH 3JZ2B 5FBEA 2QYIA 5C0TA 1NO9H 1WU1A 4ZAEA 4Q7XA 1O3HA 6GCHG 3BEUA 3E3TA 1Y8TA 2RFKC 4TYDA 1C1OA 2BVXH 2CXVA 1O2HA 1MTVA 1E35B 2EY4C 1YGCH 3A86A 2F43B 1THRH 2VIWA 1G3BA 3WY8A 1MU6B 1QR3E 3KN2A 1NRNH 2NU3E 2Y81A 1IHSH 1N6YA 4BTUB 1S83A 5JYIA 4D9RA 1Z71A 4IW4E 1TNJA 1GHAF 5JB9S 2PV9B 1O3LA 1NN6A 2R2WU 4ZMAH 1BTYA 1ELTA 1MQ5A 1L4ZA 1HAGE 1SLWB 3ZZ6A 2FIRH 4B6FA 3TGIE 2HRVA 2ULLA 1NBMD 2XCFA 4ISNA 4D9QA 3AVZA 3ATLA 1C1NA 3VB3A 5EQRA 3SU0A 2GCHG 4H4FA 2OK5A 5FPSA 1NRRH 3VEQB 3CP7A 2J94A 1UVOA 1HYLA 1SBWA 3LJJA 5DP6A 5AHGH 3ZZ3A 1S0RA 3ZZBA 1MQ6A 4BOHA 4DGJA 4B74A 5AFYH 3SJ8A 3EYDA 2AMQA 1TALA 1BTHH 1GMCF 3STJA 3T29A 1MAXA 1O2NA 1DM4B 1QQUA 1DWEH 1W10U 1O2IA 1Q3XA 3KIDU 1Y3UA 1O37A 1E38B 4B2BA 2G51A 1O2LA 4P02A 2W7SA 5E0GA 4ZKSU 1O32A 3KL6A 4Y8YA 1SB1H 4XE4A 2XTTB 2ZGHA 3NZIA 3LOXA 1BUIA 1L1JA 1T8NA 3P6ZB 1HAHH 5KGOA 3PROA 4OGYA 3SJIA 1ELFA 1SQOA 5ESTE 1K1IA 1QA7A 5ABWA 1YY3A 1WTGH 1QL7A 3RLWH 3JZ1B 3GCHC 3O8DA 3A7ZA 1GVZA 2R3YA 1AB9B 1ZGVA 1Q31A 3ZZCA 4CRFA 2BDIA 2Z3DA 1G3CA 3P70B 2Y5FA 2LPRA 3FKSD 2XBVA 4OS5A 1GHZA 1GGDC 1ESTA 4AFQA 2A5IA 1SQRA 5ESBA 4UFDH 1P2NA 1AD8H 3BG4B 3EA9A 1O2WA 1OWIA 3MTYA 1THSH 3TH3H 3TK9A 1NC6A 2FLRH 2F9OA 1VR1H 3RXTA 3FAOA 3U9AH 4YLUA 1KTTB 2AGGX 1N1LA 1NRSH 1EPTB 4X6PA 8LPRA 1W8BH 1TRYA 1ELEE 2BD3A 2BY6X 2VH6A 1NFUA 3F9EA 3SU6A 3SO3A 1BTXA 1GI9B 4TY6A 3RXUA 4FOUC 1AB9C 2BZ6H 5EXMA 1MMJN 4RT0A 9ESTA 1UCYE 1ZMNA 3OY5U 1BITA 3OFND 2HGTH 2H1UA 3HKIB 1QBOA 2SGFE 2UUKB 3TNSA 4XFQA 2I6SA 4FUFA 5L6NH 4GCHF 2G00A 2WPKS 1AI8H 1Q2WA 3U28C 4YOGA 5LGOA 2JJ1D 2XRCA 1LKAA 3MFJA 4B1TA 5FX6A 1XM1A 2UUJB 1UCYH 1UVUH 4CR5A 1HBTH 1O3FA 2WSSD 4MDSA 3EE7A 1TBRH 2VWMA 1Z1IA 1S82A 2TGDA 2FEQH 5EJ1A 1K0HA 2VWOA 3SORA 1OKXA 2FOCA 5EPNA 1QL8A 3SV8A 4B6EA 4LXBH 1GMCG 2WPMS 1ZTKA 5A8XA 2IJOB 1YM0A 5EW1H 4MQAA 4CRBA 1ZTJA 4Y10E 3SOSA 2FXRA 5T3HA 3AW0A 3E0NB 3UNQA 1LVBA 1C1WH 2ZGXH 5T6DA 4JZIA 4DW2U 2ZZUH 2SFAA 1TNIA 4BAOB 1BJVA 1QJ6B 2OQUA 3P8FA 1ZTLA 4XOJA 3SZEA 2PFEA 1DSTA 4PROA 4X2YA 2Q6GA 2QXGA 4CBOA 4E06H 1XX9A 1TIOA 1RIWC 2HPPH 2TGPZ 3V12A 1ABIH 1GPZA 3E16B 4K1SA 1EP6A 1AKSA 1IQHA 5AVDA 1FUJA 2Q6FA 1C2EA 1ZJDA 1C5NH 1AE8H 2QIQA 4B75A 1SGFA 2AGEX 1Z8JB 3P8GA 4FU9A 2BTCE 1S84A 3WWBA 4X1QU 2GZ8A 3P17H 2XCNA 5BPEA 3T5FH 2A7HA 2C3SA 1V2VT 5C94A 3UWJH 2J34A 4XDEA 3MNSA 1TX6A 1LCYA 3KCGH 3RXPA 1AZZA 2FOAA 1C5LH 1DXWA 3ZYEA 2P95A 2STAE 3NK8A 1DY9A 1U6QA 1YCPH 5C3NA 4Q7YA 3SUFA 3DSGA 3KGPA 4NZLA 2FMJA 4ZXYH 2Q1JA 1XXFA 5DSFA 3E90B 1V2TT 1GCTC 3MI4A 4LZ1H 1NFWA 4YXWD 3A82A 1NY22 2OC8A 1EPTA 1RTFB 4R8TB 1C1SA 3QO6A 2SGDE 3DSOA 1K22H 1F0UA 3MOCA 3U8OH 3E8LA 3STIA 4ASUD 1N8OC 4FU7A 1TNHA 1GBDA 2IPHA 1W0KD 5GWZA 4K8YA 1ZPBA 1NU7B 3LT3A 2A4RA 1T32A 3R3GB 3RU4D 1C4U2 2KM0A 1C4V2 1G3DA 1YCPK 1C5RA 4D8NA 1L2EA 4MNXA 1TAWA 1OSSA 1O2OA 1YPGH 4D76A 1JIRA 1B5GH 1IOEA 1QFKH 4O3UA 2V3OH 2RG3A 4UFFH 1S6LA 1C5PA 1J9CH 4MLFB 3DFLA 3ZZ5A 7GCHG 4LOYH 7GCHF 1BT7A 1W3CA 2A2XH 1W2KH 4NA9H 3KQ5A 3SBKA 1MBQA 2TRMA 3SU3A 1QURH 1GHAG 1O2TA 1KTSB 1W0ZU 1BBRH 1GI2A 2KCOA 2WINI 1GBIA 1CU1A 3O8CA 2QC2A 1QRXA 3LH1A 4Y11E 2ZU5A 5DN6D 1DSUA 2VVCA 1C9PA 2PW8H 1C1PA 1YLDA 1MZAA 2CF9H 1O2YA 4K1TA 1VKYA 4ZKOU 3UAIC 1CHOG 3T2NA 3C27B 4XBDA 1QJ1B 3GICB 4ABDA 1FPCH 1H8DH 4BXWA 3N7DA 2PLXA 8GCHG 3MH5A 4KTUA 1GHVH 1BHXB 2SGQE 1GVKB 1EP5A 5T6GA 2PKSB 1RJXB 3ZZ8A 1WQSA 4DOQA 5ETXA 3L6PA 1A2CH 1UTNA 3GY6A 1FLEE 5I25A 1O2ZA 1BMLA 4DVAU 1EJNA 3RXEA 3SU5A 3PV4A 1YF4A 3ZIAD 1OWDA 1Y5AT 3UOUA 1OYTH 1PFXC 3D49H 1LVYA 1K1OA 4TWYA 3EA8A 2J98A 2QF5A 6LPRA 3SNBA 2BLQA 4AG1A 5C17A 2ZC9H 1E0FD 2C93B 1O3BA 3SNAA 1IHTH 3RXMA 1T8MA 4RKOB 6GCHF 3MNCA 3P95A 1GBKA 3BTTE 1O2UA 2NU0E 4GLYA 2HNTC 1C4Y2 1E37B 1LO6A 1OXGA 4AFZA 1XUIA 1EOLA 3TITA 3T27A 1O34A 2OP9A 1GMHF 2W3IA 5PTPA 3ZV8A 2ZCLP 5EJZA 1HPGA 4NWKA 1P11E 3LH3A 1VITF 3GY3A 4X8VH 1SGDE 1SI5H 2A4QA 4F49A 4WH8A 1XUKA 1ETSH 3V13A 3M3TA 3GCHB 3SGAE 2Z3EA 1NS3A 1TONA 1TPOA 1IQLA 2HNTE 2FI5E 4H42U 3DA9B 2CN0H 5F53A 2EI6A 3ESTA 3F68H 1KXCA 2W6JD 3PMHB 1P0SH 4YOIA 4BTTB 4KELA 3VXEH 1RD3B 4GSOA 1YLNA 1SLUB 1PPCE 2OCVB 4X1PU 1UMAH 5DP4A 1FY5A 2Q6DA 2TBSA 3QZQA 2PSYA 1OPHB 3ZZ4A 1TBZH 5DP5A 3GS9A 3SV7A 1RTLA 1HJ9A 3GY5A 1O35A 1ZHRA 3LGVA 3HPTB 2V0BA 1O5FH 1BA8B 2J9NA 2EI7A 1Z1JA 3ELAH 1HJAC 3KQEA 1AGJA 1QIXB 5C5NA 8KME2 4IC5A 3RMNH 2ODPA 4INHA 2ZIQH 1P04A 3LU9B 2GVFA 4FETA 1Z8IB 4Q4LA 1QTFA 2QXJA 2M5TA 2M2AA 3GCNA 3HK3B 4Q2KA 4XRNA 2ANWA 4MG3A 3RM0H 3S9AA 3AK5A 4DT7B 3KQBA 1KLTA 3ZVEA 1O2SA 2C8YB 4QT8C 1P2IA 2AIPA 1F5KU 1E1RD 1GBEA 3KNXA 3UFAA 3FOAA 3SNCA 1C5QA 1VITG 1C1QA 4X8SH 2PKSC 1CHGA 4CRAA 4VGCB 5HYOA 3P92A 3Q76A 3TU7H 2ANYA 4DCDA 3MH4A 2JH6D 4WXVA 3N99A 5FPYA 3RM2H 4RKJB 3QWCH 4JK6A 3F1SB 2ZU2A 4MNYA 3U69H 5C2ZA 1DANH 2ZWLH 4KGAA 2ZFTA 3BTKE 1G2LA 1YWUA 1VJ9U 1RS0A 2A45B 1CE5A 3T62A 2G55A 2G8TA 2P16A 3BG4C 2WV4A 5JBBS 2V3MA 3EDXB 1LPZB 1QJ7B 1TA6A 1TFXA 2FP7B 2XW9A 1O33A 2XC4A 4YM9A 3HGPA 1KXFA 4U30A 1SQAA 3PMAB 4IN1A 1DWBH 3E91A 3PWCA 5DK1A 4KP0A 1GWAA 2Y7XA 1GCDA 1V2JT 4FUIA 2OC0A 2G4UA 3AAVA 3T25A 1K21H 2BD7A 2OBQA 1CO7E 2XC5A 2B5TB 2BVSH 2ZGCA 3A8AA 3M7TA 3S7KB 3AAUA 4GPGA 1P2QA 1CA0B 3TIUA 4D7GA 1DPOA 3KYFA 4ZUHA 1MTUA 4KTSA 3LC5A 1ZGIA 2QF4A 1NFXA 4NZQA 1GDNA 4WY3A 5DG6A 1V2UT 5E2PA 2YNAA 2QN5T 4OGXA
chains in the Genus database with same CATH topology
1BRUP 4NWLA 1E34B 2FOMB 3PMBB 4B73A 2XBYA 4AFUA 5FPTA 1TABE 4BNRA 1UTQA 1TMBH 2FYQA 1P3EA 2YOLA 3DUXH 4UFEH 1HCGA 1FXYA 3SQEE 2FOHA 1JOUB 3A80A 2B0FA 2GV7A 4BAMB 3Q3KA 3RXRA 5DPAA 1FIZA 5SGAE 2CHAC 3N7OA 3HKJB 2CGAA 1RGQA 2AH4X 2G4TA 3GCTG 2F83A 2BLVA 3L3TA 2VWLA 1DOJA 1DVAH 2NU2E 1IQMA 3RMLH 1SHHB 3NUMA 4INKA 2JETC 2ANKH 4NIWA 1P12E 4X2VA 1OWEA 1K1JA 2O8TA 1ELCA 1TX7A 5GJ4B 4O9VA 2H9HA 1O2QA 2PGBB 4DURA 6CHAC 2EI8A 5K7RA 5TCCA 3UR9A 3F9FA 4RSPA 1HAVB 3H7OA 3MU0A 1GJCB 1WUNH 4DG4A 3SW2B 1SFIA 4JZ1A 1QB1A 1FY3A 3BEFB 1WBGB 3OY6U 2BDHA 1O5BB 1C9TA 4YT6H 1XXDA 4CRCA 1EAIA 1GBBA 1O2PA 2WPLS 2BOKA 2ZI2H 3UWIA 1AIXH 1K1MA 2W3KA 2ZHDA 3QN7A 1O2MA 3BEIB 3BTME 1ZSJA 1O2GH 3IITA 5F8ZA 3TVJB 4K2YA 1BTWA 1KIGH 1RTKA 4FU8A 3SQHE 4UD9H 1SPJA 2UUYA 1MKXK 1S5SA 3GYMA 1KXDA 1FV9A 1O31A 3HK6B 1EX3A 1ZR0A 3VB6A 2AS9A 1IAUA 4NSVA 1O3NA 3MH7A 2ZU3A 2HPQH 1TPSA 1EXFA 5HGGA 5IYTA 3S9CA 3FP6E 1SGYE 1HNEE 3TH2H 5FX5A 3U1JB 3TJVA 2D1JA 1HRTH 2BXUH 3RXIA 1CT4E 2VIOA 3K2UA 3LGTA 4KTCA 2BX3A 4YT7H 1CA8B 2JH0D 3TPIZ 3S69A 1CSOE 5A2MH 2VNTA 1ZZZA 4CH8B 1YPHC 2BD2A 2J2UA 2EC9H 2W7UA 3DHKH 1GBLA 4IBLH 3AASA 1AVXA 2WPHS 2BLOA 3TGJE 2PHBA 1HAYB 5DJ7A 1A3BH 3QDZB 2Y6TA 1AVWA 5EW2H 1P2JA 1XKAC 2GDEH 1DWCH 3RXOA 1C2FA 1DS2E 4I33A 2VWNA 1V2LT 1LHEH 3BF6H 3Q3YA 1OOKB 1A0JA 4OS1A 2Y82A 5AFZH 1AQ7A 4FUCA 1ANBA 1C5MD 3E0PB 3PO1B 1UTJA 2PTCE 4UE7H 1DUEA 1LQDB 3A88A 1YPEH 4NIYA 5EPYA 3OYPA 1V2NT 3QLPH 1SQTA 2VIDA 1O39A 2B8OH 3GY2A 2ALPA 4FVDA 3M5LA 2ZPRA 1ESAA 1AUTC 2QGRA 1M9UA 1CHOF 1LKBA 2BOHB 5C67A 1IQEA 3K6ZA 5DGJA 1FIWA 3NWUA 1ANEA 4AYVB 1G37A 2QA9E 2ZDKA 1HAXB 1HDTH 3ATIA 1HLTH 1MCVA 4AGKA 4JYTA 1OYQA 3BTFE 2GX4A 1V2PT 4FUJA 1GHBG 3QTOH 3SGBE 3MU1A 3TGKE 1TLDA 3GCTF 1P2MA 1IQGA 4U32A 3GY7A 3LGIA 3SUDA 1CGHA 1SOTA 1ZPCA 1QBVH 1EAUA 3URDA 3O8RA 1G32B 1MKWH 4ABJA 1QB6A 1SFQB 3A84A 2B7DH 1GJ4H 1QY6A 2BD8A 4JMYA 3ZV9A 1YPKH 1H9LB 2QF3A 2AIQA 3RUOA 1CGJE 4HGCA 1Y3VA 2ZGBH 3MU8A 1UTPA 1BTZA 4H6SB 3PLBA 1SHYA 3PWBA 3ODFA 1KLIH 3T26A 3MWIU 4MPWA 3ZYDA 1T8LA 3BN9A 3M61U 1C2DA 4JZFH 2UWOA 4WMEA 1H4WA 2WYJA 2OXSA 8ESTE 3H5CB 4JYVH 2ZDLA 1O3EA 4RN6A 1QGFA 5E2OA 1H9HE 1VCPA 4ISIH 1AHTH 1CGIE 2R0KA 1K2I1 4MVNA 4ZROA 2ZFRH 1PJPA 1F2SE 4Y79A 1KXBA 4BAHB 4ESTE 2ZCKP 2BX4A 3NCLA 2A4GA 3RXHA 1HJAB 1QBNA 5FHTA 1HAOH 2BQ6B 3EQ0H 4ISHH 1PQ7A 1TPPA 1UTMA 3OTJE 2GKVE 2QCYA 3SJ9A 1BRBE 3RC5A 3V7TA 3LDXH 3FANA 5AF9H 1C5WB 3PMJA 4DIHH 2GGVB 2ASUB 1TQ0B 4K5ZA 3AW1A 1P57B 2DE8A 2PUQH 2XYAA 1WYKA 3UIRA 1Z6JH 2FX6A 4MPVA 3SV6A 1JRTA 3A89A 9LPRA 2ALVA 2A31A 2OBOA 3UOPA 3P8OA 1ESBA 3RXSA 1SG8B 2NWNA 2ZHEH 3E1XB 1O5EH 4E7NA 5A0AE 1HV7A 1ELAA 2GMTC 1G30B 2WUBA 1F5LA 4X6MA 4ZHAA 1S0QA 2FI4E 2OQ5A 1O3PB 2SGPE 4A1XA 4FXGH 1VITH 1T31A 1A0HB 1E36B 2Z9KA 1CT2E 3RXFA 1D9IA 1EJAA 1C2KA 4AOQA 4NIXA 1LHDH 1W14U 3M3SA 1DLKB 1BRCE 2PUXB 3T28A 2CJIA 2FM2A 4JYUH 1IQFA 3A7WA 3RXGA 3A7YA 3S9BA 3ATWA 1X7AC 2P8OC 5F8XA 2XBWA 3PTNA 3RC6A 1LQEA 1FJSA 3OU0A 5DP9A 1O2VA 5C20A 1SGRE 4YESB 3ZZDA 1KSNA 2PGQB 2P3UB 4Z6AH 5JDUB 1EUFA 1O5AB 2ZTYA 2F91A 4TPIZ 4B71A 1A46H 4AYYB 2R9PA 1GHXH 1PPZA 1QRZA 2BQ7B 3IG6B 2EA3A 3GY4A 1EOJA 4GHQA 1MTNC 4O03A 1KYNA 1BZXE 4WMFA 2PKAA 1A7SA 2AERH 2A32A 1BB0B 1D6WA 1TNGA 2AMDA 1VGCB 4IS5A 1YPLH 4TWWA 1NTPA 1EZQA 1LPGB 3GYLB 4THNH 2FX4A 1UK2A 1B7XB 1J15A 1O3GA 2G5NA 1B0EA 1LVMA 3FFGA 2KAIA 3UNRA 1H8IH 1THPB 1TMUH 3VXFH 2O8LA 2GP9B 2OD3B 4NFEA 4Y7AA 2HALA 2ZU4A 2DE9A 6ESTA 8GCHF 1F92A 3MO6A 1TGSZ 1C2GA 2BD9A 3A85A 5EOKA 1A4WH 3TJNA 4X1SU 3RU4E 4Q80A 1XUJA 1JXPA 1LPKB 1XVMA 3TJOA 2Y5HA 1F7ZA 3FP7E 3BTQE 3MHWU 4KKDA 3L33A 2VJ1A 2W5EA 1GMDG 5L2ZH 1EAXA 2O8UA 3W94A 5GCHF 2F9BH 1FZZA 4HFPB 5I46H 4FUGA 1SGCA 3DFJA 4ABBA 1UVTH 3S0NA 2FOBA 1ZHMA 3M7UA 3S7HB 1TBQH 4ABHA 5J4QA 4INLA 2TGTA 1FAKH 4GAWA 3PLKA 3RXBA 1Z8RA 4OS6A 1A5HA 5LPRA 3URCA 1AVGH 4CR9A 1HIAA 1RIWB 1MU8B 2H6MA 1Y3XA 3E6PH 2K1QA 1EZXC 4X2XA 1BRAA 4DY7B 1BTPA 1O3KA 3RU4T 1JRSA 2EEKA 4HI3A 4ZHMU 1OS8A 3ATMA 1BBRK 2F3CE 1IQJA 1WOFA 1BDAA 4Y8ZA 1PPEE 1O2XA 2Y7ZA 1AKSB 3GDSA 1GBAA 1V2MT 2SGAA 1C2LA 3FVFB 2NU4E 3QGNB 1H9IE 4M7GA 1DE7H 3GDUA 1GBMA 2BDGA 1YPMH 5EQSA 4Y76A 3EA7A 3B23B 1Y5UT 1FI8A 4NGAH 2Z9IA 1Y59T 1DUAA 2ZFQH 3RXLA 1VCQA 4X0WU 3SUEA 1P10A 5HM2A 4A5TS 4HTCH 2ZECA 3I78A 1V2RT 1ELDE 4CBNA 3PLPA 4J2YB 1FPHH 3VGCB 1O3IA 2FOEA 1O38A 3Q00A 5HM9A 2FLBH 1LTOA 1PPBH 2RCEA 5HMAA 1O3DA 1NPMA 4CREA 4A1VA 4X2WA 2F9NA 3KHVA 1YYY1 5C1YA 2Z9LA 1O2JA 1HGTH 1QHRB 4U2WA 2Z3CA 3LKWA 2BD5A 1V3XA 1TPAE 1H1BA 3MO9A 2A5KA 1GG6B 1EPTC 2BY8X 3UREA 2D26C 3RXKA 2UUFB 3BG8A 2Z9GA 1QNJA 4I31A 4SGBE 1OP2A 2AEIH 2C8WB 1UHBA 2XWBI 1LHCH 3BIUH 3ITIA 4R0IA 5F03A 7ESTE 2H5DA 1P3CA 4DJZB 4MPXA 5GPIB 1FY1A 1ACBE 4Y8XA 1MUEB 4ZKRU 4YOJA 2BDBA 2CMYA 5LPFA 1GBJA 1GI4A 4WF8A 5C1XA 1C5ZB 1FNIA 3U98H 2FDAA 1FQ3A 5FCKA 4AB9A 3KQCA 4NG9H 1MD8A 1XUGA 1PPGE 2ZHFH 4Y71A 2GD4B 3MO3A 3NPSA 2BDCA 1ANDA 1GJ9B 2H9EH 1IQIA 3UPEA 4CRGA 4ZKNU 3A7VA 1LDTT 2QF0A 1ZYOA 4BANB 4ZHLU 3VB7A 1CBWC 3U8TH 5DP7A 4U01A 1VJAU 3TLOA 1Z6EA 1AZ8A 1S81A 1D3TB 2OC1A 4AFSA 1F0SA 1TRNA 3RXQA 2RA3A 5GCHG 1TMTH 3P8NA 1LMWB 1PPFE 5F6MA 1GBCA 2A4OA 4I8GA 3KQDA 2PR3A 2VVVA 4I8JA 4I8KA 1P09A 5DKMA 2THFB 3A7XA 1GJ7B 2ZFSA 1GI7B 1UTOA 4I8HA 3UTUH 1SGTA 3F6UH 1AFEH 1EZSC 1KY9A 1OP0A 1K9OE 2O8WA 1V2OT 3VB5A 1NM6A 4CHAC 1TB6H 1TGNA 4Y0YE 3F9HA 1IQNA 1GBFA 1MTSA 2FZZA 2QXIA 3B9FH 2TIOA 4ABEA 1DWDH 2SGEE 5G4BA 1DY8A 1ZSKA 1FONA 1QRWA 1AE5A 3SJKA 3QZRA 2JH5D 2CF8H 3GCOA 3MU4A 3EE0B 1YLCA 1TGTA 2BDAA 2IN2A 3ZVAA 1SGEE 4GVUA 4HZHA 4LK4A 3LC3A 1BHXF 4Y7BA 1ZPZA 1CBWB 4IC6A 3GISB 5B6OA 1MKWK 1TWXB 2AMPA 1F0RA 1S6HA 1SGPE 3H7TA 1RFNA 1VZQH 4F4OC 1NROH 5A09A 1BJUA 1UO6A 5L2YH 2BD4A 4AGJA 3TNTA 2SNWA 2ANMH 1BIOA 5TJXA 3GOVB 1GHYH 3V0XA 2BQWB 1ETRH 1Y5BT 2UWLA 1ABJH 3ENSB 1HXEH 1TQ7B 2WPJS 4I32A 1SGFG 1ETTH 1OX1A 1SMFE 1HXFH 4BXSA 5DO4H 1ELGA 2P3TB 4X6OA 1G3EA 3CS7A 5H4IB 1GJBB 2VVUA 5GIBA 3SHAH 1L0ZA 4Y6DA 3OX7U 2ZTXA 1UK3A 4TY7A 3SUGA 3LPRA 4WJG2 4YO9A 2J92A 3ZZAA 4AB8A 4FUEA 2J38A 2C4FH 1YBWA 3PO1C 1ELBA 2ZHWH 2D2DA 4K1EA 4UEHH 1G9IE 1QCPA 5C5OA 1TOCB 5GXPA 1V2KT 3B8JA 4AZ2B 1SOZA 1XKBC 1GI8B 2OUAA 1C5YB 3SU4A 2BY7X 5FBIA 2C8XB 2BDYA 5BRRE 1DXPA 3LJOA 5JBAS 1FN8A 3BSQA 4BAKB 1O2RA 2ZGJA 3K9XB 4K69A 1KXEA 1LVOA 2QV1A 2KAIB 3RMMH 1F0TA 1AWFH 2ZKSA 2O8MA 1VCWA 1C1UH 1P9UA 3RXAA 2GDDA 4WWYA 4A92A 1NU9A 2GCTB 3CENA 2BXTH 1C2IA 2XBXA 2WUCA 2C8ZB 5CHAC 3R0FA 5A0CA 1SSXA 1EAWA 2PKAB 3RXCA 1O3AA 1GJ5H 1QB9A 1BMNH 1GL0E 2R2MB 1AMHA 1FAXA 1G2MA 1KLJH 3A83A 3RXJA 2ODQA 2FYRA 1YP9A 1Y3YA 3PTBA 2NU1E 4WVPE 3BIVH 1DT2A 4IMZA 1XUFA 2BY5X 3BTEE 1TGCA 3U1IB 2G81E 1ZMJA 3LONA 3SZNA 1K1PA 1EKBB 2F9VA 2VIQA 3SNDA 1HFDA 3FP8E 4OS4A 1JMOH 4TPYA 4GCHG 1XVOA 4NA7A 1BBRE 2FESH 2GZ7A 2VGCB 3ZVCA 3SHCH 1WTHD 1ZSLA 2Z6BD 4IGDA 4UFGH 1T8OA 2VIPA 1WCZA 2A2QH 2R3UA 1J8AA 1FDPA 4IMQA 1MH0A 3UY9A 2B9LA 1OP8A 2BMGB 2V35A 2I6QA 1BTUA 2FPZA 4FUDA 2OINA 1YC0A 3MU5A 1O3JA 1PYTD 1SL3A 3O8BA 3ZVGA 4WXIA 1PQ8A 5F8TA 2QAAA 3K65B 1GG6C 2BLWA 3SN8A 3SJOA 5JBTA 1DFPA 1SR5C 3LGUA 4AORA 2BHGA 4JCNA 1EB1H 4MPUA 4OS2A 1UVSH 2VGCC 5IDKA 2VINA 1ZRBA 3QGJA 4UONA 2ZTZA 1C1RA 4FUBA 2RA0A 2P93A 4WH6A 2ZDMA 1KDQA 4NSYA 4YZUA 1GJDB 2GV6A 5EXLA 1UHBB 4I8LA 2XC0A 2P94A 4UDWH 3VGCC 1P06A 3UQVA 3SI4H 2XNIA 1MTNB 3D62A 3RP2A 4ABGA 1AWHB 3SU1A 1CA0C 2VH0A 4O97A 4CRDA 1T4UH 1WAYB 2SNVA 4Q7ZA 3K6YA 1J14A 5CHAB 1V2WT 2H2ZA 1GDUA 1SGIB 1NRPH 1GI1A 2GCTC 4BTIB 1PYTC 1GHBF 1QA0A 5EODA 1SGNE 1O0DH 2ZFPH 1WV7H 4SGAE 1C2JA 4ABFA 1DICA 3DD2H 3I77A 1DLEA 1C5OH 3BTHE 1PPHE 1OWHA 3HGNA 2FS9A 3NXPA 3ZZ7A 5DP8A 2ZF0H 1QQ4A 1TX8A 1O3MA 2GCHF 5K0HA 5FAHA 4YTAA 2QY0B 1ANCA 3MMGA 4K60A 2H9TH 1WSSH 1ELVA 4X8UH 1JBUH 1AY6H 1MD7A 3Q3XA 4OS7A 4CH2B 1J16A 2BYAX 4H6TA 3OSYA 1Z8GA 4DIIH 2ZDAH 1C2MA 4VGCC 1GJAB 2ZG0H 1OWJA 3UNSA 2ZO3H 3TK5A 1L4DA 2ZEBA 1N6XA 1XUHA 2OLGA 4XBCA 3KF2A 1UVPA 1GJ6A 2Y80A 1P03A 5GDSH 1YCPM 4MNVA 1SGQE 1D4PB 1W13U 4ISOA