3PTBA

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptbA02
2A45B 2PUQH 2ZPQA 1M9UA 1S81A 2AIQA 2G52A 3MOCA 3U8OH 1OSSA 1FIZA 1NRSH 3RDZA 2WPMS 3E8LA 3U98H 1J17T 4K1TA 2PKSC 1FMGA 4FXGH 3TJNA 2ZI2H 3KGPA 3KHVA 2ILNA 1B5GH 1GMDF 4OS1A 2AGEX 1E36B 8GCHF 2JH5D 1XUGA 2FTLE 2P94A 3NZIA 2VIVA 1LCYA 3M5MA 1O2MA 4JK6A 2PSYA 1P2MA 2H9HA 2VNTA 1PJPA 4MPVA 1KTTB 2ZU5A 4NGAH 5GWZA 3UNRA 3E0PB 1O5DH 1CGHA 1XXDA 4YOJA 3F9EA 3SNBA 3HKIB 3LT3A 4GUXA 3BG8A 3LGWA 1Z7KA 4MLFB 1OYTH 1AUTC 2O8MA 4MPUA 4SGAE 3R0FA 1TMTH 5DG6A 1C2JA 3RXEA 2ZP0H 1CGJE 4MDSA 5DP4A 2BQ7B 1CBWC 1DY9A 1QRZA 2ZGBH 1C5XB 1HNEE 1HJAC 2VH0A 3RMLH 1C5NH 1DOJA 1O31A 2NU3E 1TB6H 4ABFA 1AWFH 1TAWA 1BHXF 2TGDA 3ENSB 3MHWU 1JOUB 2R2MB 2BLWA 2H9TH 1O5BB 4WH6A 2FPZA 1KXEA 2WPIS 5L6NH 1VZQH 1BIOA 1DICA 4R8TB 4D9RA 1E37B 1G3DA 2BDBA 1DT2A 3RXLA 1GHAG 3MWIU 4MVNA 4INKA 1NFUA 2SNVA 3DFLA 1KSNA 3QTVH 5GIBA 5FX5A 1EB2A 1AE5A 2QCYA 3LPRA 4CRFA 3M36A 1FZZA 2OQ5A 5I46H 3ZVFA 5PTPA 1C2IA 1WTGH 1KXDA 1VITF 2FYQA 2BD9A 1UTJA 1GJCB 1GI6A 3SI4H 1BA8B 2HGTH 3SUEA 1HFDA 2Y7ZA 1HB0B 1P04A 1P10A 2G5NA 5HM9A 3TGKE 1ETRH 5T6GA 4GHQA 1SLVB 2O8TA 5A0BA 3TGIE 1O3CA 3M3VA 1MKWK 5GPIB 2J94A 4DJZB 4DY7B 4BXSA 6LPRA 1FXYA 1A7SA 1RTKA 1GBJA 1MCVA 3QO6A 3M35A 2HRVA 2H2ZA 3MNXA 1CQQA 1VCWA 2QIQA 3OX7U 1V2NT 3HK3B 5L2ZH 2AMQA 2ASUB 2XW9A 5T3HA 3PYHA 2VVVA 1EQ9A 1MBMA 3RMNH 3TH2H 2BVSH 1P02A 1HAYB 5DP5A 1EZQA 1SBWA 3N7OA 2RA0A 2G8TA 3QTOH 4Q7ZA 4XSKU 3RC4A 1C1OA 1K1PA 4RKOB 2ZDMA 1OWHA 4XDEA 3ZYEA 1AFQC 1H1BA 1ZHMA 2HLCA 2P8OB 2FEQH 4K2YA 1CHOF 1GBEA 1CT4E 3DT0H 3ZVGA 1DXWA 4INLA 1GJ6A 3QDZB 1GJDB 1AB9B 3S7KB 1EAIA 4JZIA 3T2NA 2ZDAH 1Y5BT 2FOBA 4B74A 1UTPA 7KMEH 1AMHA 4UEHH 1GMCF 4CHAC 1JRSA 3UR9A 2B8OH 1C4Y2 1NESE 2Z9LA 3LKWA 3BTME 3UWIA 5BPEA 1TGCA 1HV7A 4I8GA 5JB9S 1A0HB 1C5ZB 2R2WU 3PTBA 3RXCA 4IGDA 5H4IB 1QL7A 1A2CH 3SU0A 2G55A 4MNXA 1F0SA 1C5RA 3P8NA 3RXRA 4NSVA 5DP8A 4NA8A 2OINA 2I6QA 1KXFA 1W12U 2BY7X 1ZGIA 3VGCC 4AFZA 2O9QA 3EA7A 4XBBA 6CHAB 4Y7AA 2BX3A 2FESH 2VH6A 1SGPE 3GY7A 3UUZA 4K1EA 2AFQB 3M5NA 1OXGA 3PMBB 1BTWA 1NRQH 2J9NA 3I29A 1KXAA 2ZHEH 4FUEA 4K1SA 1AKSA 1ELFA 5A0AE 3K6ZA 4FUCA 3KQCA 1QJ6B 1HIAB 1K1OA 4ISLA 1WBGB 1BQYA 2PGQB 1L0ZA 2PWXA 2FWWA 3TNTA 2ANWA 1TRYA 2D1JA 1O3AA 3A8CA 1C1SA 3MO9A 4QT8C 5C2ZA 1C2LA 4YTAA 3SI3H 1TE0A 2FTMA 3RU4T 2Z7FE 1K28D 3A7TA 1GBHA 1BTPA 2VWLA 1NN6A 2QA9E 2ZPSA 4I31A 1UMAH 3LGIA 5C3NA 4K5ZA 2F91A 1BMNH 2ZU3A 5DO4H 3LOXA 2ZFTA 3D23A 3L6PA 4Y10E 2W5EA 1IQEA 1QB9A 1VR1H 3CP7A 1D3TB 1DWCH 1GHBG 3BTGE 3UNQA 3P92A 1K21H 2BDHA 3I77A 1TX7A 2QY0B 1AVXA 2BLOA 4X2YA 4AFQA 5GXPA 1E35B 2F9PA 3UR6A 3ZV8A 4YLQH 3B8JA 4UDWH 2Y5FA 4X8VH 3RM2H 1H4WA 1HUTH 2UUYA 2H9EH 3MYWA 1GBCA 2VJ1A 1UCYK 3A89A 3BG4C 2V35A 3V12A 1UTOA 4ABAA 3MU4A 3TNSA 1C1NA 3A8BA 3RC5A 2JETC 2ODYB 1BMAA 4BAQB 1TRNA 1LHDH 4TY6A 4YLUA 4DIIH 1ZRKA 2F9VA 2Y7XA 1GJ4H 2BTCE 4I32A 4Y11E 8GCHG 4HI3A 4BANB 1Z8JB 2ULLA 2VWMA 2TRMA 1UTKA 1C5PA 1MMJN 1BDAA 3Q3XA 3ATIA 1A1RA 1IQFA 1O3EA 1ID5H 4MQAA 3KN2A 1W10U 1IQNA 4X8TH 4X6PA 3E90B 3A7XA 1V2RT 1OYQA 3UQOA 3A8AA 3MO6A 4FUJA 1C1MA 1PQAA 2XWAA 1PQ7A 2YNBA 4YO9A 1ABJH 3GICB 1E34B 2GX4A 2B0FA 2HNTC 5JBBS 3PO1C 2BY6X 4AB8A 4ZKRU 2AS9A 3GDUA 4ABEA 3TU7H 1CVWH 1ETTH 1TPSA 1QJ1B 1P3CA 1BRUP 1THPB 4FU7A 1H8IH 1DDJA 2VIDA 5EOKA 1SGTA 4IMQA 1GHAF 1GMHF 1ZPBA 1W0YH 5HMAA 1GDQA 3GCNA 4NA9H 3FP7E 4BTUB 2XWBI 4E06H 2FX4A 3KNXA 1MU8B 2HNTF 1BHXB 3RXTA 1O3HA 3HK6B 3LC3A 4B1TA 3IWMA 1JIRA 3PWCA 2VWNA 4AGKA 1RGQA 3UNSA 4J2YB 3ESTA 1A5GH 1TNIA 2P93A 1IQHA 3BTEE 3A8DA 3GOVB 1IAUA 1OS8A 4B71A 3A80A 2G51A 1XX9A 4MNYA 1ZRBA 4DW2U 1BTZA 3GY6A 1ESTA 2GMTC 3SU5A 4GSOA 5TCAA 4DGJA 1CT0E 1LO6A 4AFUA 2VIWA 3BSQA 1BTUA 4O3UA 2V6NA 3SW2B 2BD8A 2BMGB 3ODDA 1WQSA 2ANKH 2BDIA 1ZPCA 1SGIB 3E0NB 4BTTB 2ZTXA 3T5FH 2WUBA 1TGBA 4GAWA 1GBDA 2OUAA 5LPFA 2A32A 1NC6A 1YPMH 1MAXA 1HAIH 4A1VA 1ZMNA 3FP6E 3O8CA 1YC0A 1RJXB 3SV2H 1GG6C 4TWWA 5T6DA 2A2XH 1PYTD 3HKJB 2OBOA 2ANMH 3RXUA 2PUXB 2SGPE 2BHGA 1PQ8A 2UUFB 3BV9B 4KKDA 4YOGA 4AYVB 4Y0ZE 3KQDA 3L3TA 3ZZ7A 2V0BA 3Q3KA 1CHGA 1XUJA 2XBWA 4UONA 1JIMA 1LMWB 2F9BH 3T29A 1UK2A 5A8YA 1VCQA 1O3BA 2WUCA 1EAXA 3A87A 3BN9A 3E3TA 1HAHH 1SOZA 2QF0A 1ANDA 2Z3EA 4A92A 5DP7A 1WCZA 4IC5A 1C1RA 4B2AA 2XNIA 4JK5A 4D7GA 2P3UB 5HXFA 1C2DA 1KIGH 1TPOA 2DUCA 2ZDVH 9ESTA 2BD5A 3UFAA 3ATLA 4CRAA 1GBAA 2GDEH 3AVZA 1FY3A 1HAVA 1P3EA 4KP0A 2WPKS 4CBOA 5L30H 4ZROA 2FO9A 4OS6A 3A7YA 1O0DH 4IN2A 2FLBH 4Q7YA 3A86A 1AO5A 2P3FH 2FS8A 1LVMA 2WV4A 1W8BH 1C2HA 2A5IA 3TPIZ 1O2LA 3K9XB 1C5QA 1DS2E 1LKAA 1T32A 3MNBA 1IHTH 2QGRA 1TGTA 1P57B 1EZUC 1F0UA 4OS2A 1Q2WA 2QXHA 4IW4E 3RXDA 3SU6A 3SQEE 1EKBB 1GJ8B 4WWYA 5DP3A 3O8RA 4K60A 1JRTA 1K1IA 1SL3A 1O2UA 2XXLA 3CS0A 1PPHE 4JZFH 4JYUH 2QXGA 4MNWA 5DGJA 2G4UA 2AMDA 1ZJKA 2PW8H 2CJIA 3RP2A 3F9FA 2F9UA 1CO7E 1P09A 3ZZ5A 2J92A 1P12E 1NT1A 3SUDA 1O32A 3SJ9A 5JBTA 2VWOA 2C8XB 2H6MA 2JH6D 4CH2B 1IQGA 5FBIA 2ZC9H 3PV4A 3VPKA 5F03A 2VIQA 1MAYA 2GT7A 2SFAA 1GI2A 1BBRK 2Y80A 5F8XA 1O2ZA 1S0RA 1TX6A 3DUXH 1MZAA 1MBQA 1AVWA 1MKXK 3GYMA 1LKBA 2UWPA 1F0RA 4INHA 5TJXA 2IJOB 1ZR0A 5DK1A 2FLRH 1O2QA 1FI8A 1G2MA 4LZ4B 1BB0B 1SG8B 4OGXA 4XBCA 1P0SH 3RU4E 4UD9H 1EPTB 3AASA 1QL8A 4Y71A 1A5HA 5HGGA 3RXVA 1XUKA 3BF6H 3A7VA 4NIXA 1ORFA 3UIRA 5J4QA 3A7WA 4UFEH 1EXFA 1GMDG 1MQ6A 1SHYA 1OWIA 3FVFB 1O35A 1J9CH 4UFDH 4BAMB 1CE5A 4CR9A 1Z6JH 4UFFH 1ZPZA 1DM4B 3TJUA 1TNLA 1ELBA 1KTSB 2ZGCA 3P8GA 2HPQH 1ABIH 2ZDKA 2BLQA 3M5OA 1W7GH 4OS4A 4PROA 2BVRH 1LHEH 1XUHA 3M37A 4GCHF 5DP6A 3TK5A 3U69H 2FX6A 1GVZA 1GL1A 2ZCLP 3A81A 3V3MA 2IOTA 3IG6B 4DVAU 4O9VA 1DY8A 1SQTA 4XBDA 5FCRA 4A1TA 1HPGA 1ZTKA 1DX5M 3RM0H 1EJNA 1GMCG 4X8SH 3S7HB 1GL0E 2GD4B 3SU3A 1TNHA 1SLXB 2GCHG 1AWHB 3C27B 2BYAX 2P3TB 3MU5A 1AY6H 1UK4A 2NU4E 3TLOA 2BQWB 1HAZB 1QIXB 2OTVA 7GCHF 2A1DB 2TGTA 4Q80A 1HRTH 2ZO3H 1XM1A 3HGNA 4IN1A 2FI3E 1EZXC 3W94A 4ABHA 4FUDA 4ZHAA 1K1JA 5BRRE 5A09A 1WTHD 1H8DH 3QN7A 2ZTZA 3ZZ4A 1O38A 3H5CB 4I33A 3ELAH 4AORA 2Q6FA 2BDCA 1FAXA 1P06A 1YPHE 2OC7A 1ANEA 1A3BH 1AIXH 1HXEH 1SGFG 1CA0C 3D62A 2QV1A 1SLWB 3F9GA 3O8BA 1QQ4A 1A46H 1N6YA 3K65B 1BZXE 2KAIA 1FJSA 4RKJB 5EPYA 1AVGH 1MD8A 2NU1E 4AN7A 4AGJA 5LPRA 1O5GH 1O2JA 1WQVH 1P05A 1GCTB 1AU8A 4E05H 3H7OA 4Y76A 2FOEA 2Q1JA 1C5YB 2RG3A 1VGCB 2Z9GA 1L4ZA 1MCTA 1V2UT 1C1WH 2H1UA 1C1QA 2R0LA 1FIWA 2FP7B 1OX1A 1K22H 1MQ5A 1OWKA 1AUJA 1YPKH 4HFPB 3A84A 4BOHA 3GDVA 3BG4B 1E38B 2A31A 2WPLS 2AYWA 3OY6U 3SHCH 1GPZA 2NWNA 3S69A 1IQIA 2BVXH 1F5RA 2ZEBA 3SU1A 1AZ8A 1V3XA 2FM2A 3SJKA 5T6FA 1YLDA 4KTUA 1G30B 3NXPA 1V2VT 1O5CB 2FS9A 3SV6A 2DE9A 2EI8A 2ALPA 1O3JA 3T26A 3BTHE 5F8ZA 2FYRA 2SGDE 3A85A 2WYJA 1TGSZ 5C1UA 1VITG 1AKSB 2XBYA 3MO3A 1GJAB 1Y3WA 3VFEA 4D8NA 1CSOE 1T7CA 4DURA 3ZZ6A 2ZHQH 1NFWA 1Y3VA 2ZQ2A 4X6MA 1C5SA 2G4TA 1EATA 4HTCH 2VB0A 4UE7H 5FAHA 1W11U 2BM2A 1BUIA 1TONA 2UUJB 3RXBA 1ELDE 1FAKH 4THNH 3F9HA 4X1NU 1D6RA 1G32B 1HJ8A 5EQQA 2BX4A 1ZZZA 3Q77A 3DA9B 1ZSJA 1AHTH 3MTYA 2PGBB 2ZWLH 3MH5A 3MH6A 4WH8A 1GBKA 4AOQA 1QNJA 1GI8B 3ITIA 2R0KA 1VCPA 4ISIH 5GCHF 3AAUA 1P2JA 4IS5A 1G36A 2A4QA 3BTQE 1BCUH 2QXIA 3AW0A 3STIA 3P17H 3SUFA 3SO3A 3Q3YA 1S82A 1DITH 2AGIX 2H5DA 3P8OA 3V7TA 1ZHRA 1CBWB 1QBVH 3GY5A 3K6YA 5C5NA 2BD4A 1O2OA 1SGCA 5E0GA 2A2QH 2GDDA 4WXVA 2JKHA 2Z9KA 3QZQA 1TPPA 3RXAA 1O30A 1SGYE 3F6UH 4Q7XA 1SVPA 1P01A 1TGNA 3SGBE 1SI5H 3GY3A 4U01A 2PFEA 1TX8A 2VINA 4FUIA 4WXIA 1DSUA 1F5KU 1YPJH 1ZYOA 1SHHB 1PPCE 2A4RA 2BD3A 2TGAA 1GI5A 2O8WA 1W3CA 1ANCA 4X2VA 3P95A 1P03A 1TQ7B 5EW2H 1HGTH 1QL9A 1PFXC 4RN6A 1SGNE 5FPYA 1TNGA 1KLIH 3TVJB 3VGCB 4E7RG 4YOIA 1V2WT 3RU4D 4U32A 1DANH 3BEFB 2B7DH 1SC8U 1ZGVA 3E6PH 4Y8ZA 6ESTA 2W3KA 5AF9H 5ESTE 3SV8A 3U8TH 1QA0A 1O3PB 4D76A 1UJ1A 3PLKA 2Y6TA 1RIWC 4FU8A 3EQ0H 3BTFE 1WYKA 1SPJA 2ZIQH 5F8TA 2ZECA 3M5LA 4I8LA 1ANBA 1TNKA 3ZZ3A 4ZUHA 3ZVEA 3GY2A 1JWTA 4XOJA 1MD7A 1B0EA 2ZFQH 1NFXA 3SV9A 3GY8A 1MTWA 1WAYB 5AVDA 1HIAA 1DSTA 1YKTA 2Z3CA 5IYTA 3U8RH 2GKVE 1NU7B 2FI5E 5CMXH 2M5TA 1FQ3A 2ZDNA 3D49H 1W14U 1DUAA 1MTSA 3KQEA 3RXFA 1J16A 1W0ZU 4K8YA 4ABGA 1MU6B 5JYIA 2BY5X 1NS3A 1XKBC 1K1MA 2P8OC 1AN1E 1JXPA 3NWUA 1TBQH 3LH1A 3QGNB 2C8ZB 3E1XB 1V2MT 3ATKA 1MUEB 1KLTA 1O3FA 2BLVA 2SGEE 3A82A 4FUFA 1GBIA 4WMEA 1T4VH 3MH4A 2A4GA 2BD7A 4I8HA 1QBOA 4MG3A 4TY7A 3RXKA 5IDKA 1XMNB 2OLGA 1LVOA 3TIUA 1F7ZA 1OPHB 1PPEE 1P2NA 1LQDB 5JDUB 1LVBA 4ISHH 3KCGH 3OTJE 1FONA 1GGDB 1RXPA 4K69A 3M7QA 2ZA5A 1QHRB 1O5AB 2V3HH 4NSYA 1F2SE 3FZZA 5DP9A 3FZDA 2I6SA 4CRGA 1GI1A 3ZVCA 2XC5A 5K7RA 1PPGE 1GVLA 1QY6A 1RD3B 3ZZCA 1GBBA 5FX6A 1FY8E 1HAOH 1TA2A 1T8OA 4LZ1H 3JZ2B 5E2PA 4A7IB 2BDAA 5FHTA 4VGCB 3SBKA 1QB6A 2ZU2A 3ZYDA 2QC2A 2ESTE 8KME2 3A88A 3MU8A 3U1IB 1J8AA 1CGIE 2HVXA 5FBEA 2PKAA 1GHYH 2AERH 2CF8H 1O3IA 1Q31A 2QN5T 4DT7B 5A0CA 1TABE 1J14A 1TBRH 2PLXA 3S0NA 1RIWB 1T31A 3PTNA 3LDXH 4ZAEA 4ZKNU 1CA8B 2HALA 5CHAB 2PR3A 5EG4A 1AZZA 1IOEA 1OP8A 1BTHH 3PWBA 1O39A 1LHCH 4OS7A 1OWDA 1PQ5A 4F49A 2BDYA 4FVBA 1O2YA 1Y5UT 1TA6A 3EA9A 1O2NA 3TJVA 1C2MA 1NTPA 4IMZA 2ZFRH 1G3EA 5DKMA 3B23B 1V6DA 2G00A 3SGAE 2VGCB 5JPMH 3T62A 1SGQE 2XCNA 7ESTE 5C5OA 4CHAB 2R3UA 1MH0A 4DOQA 3MI4A 3FANA 1D3DB 1YYY1 1Y5AT 3RLWH 4X0WU 2FODA 1H9IE 1CU1A 1V2PT 1Y8TA 4JYTA 1SR5C 4XFQA 2RA3A 1A5IA 3UY9A 4X1QU 3EE0B 1SOTA 2CMYA 3ZVBA 1NROH 2PHBA 4JMYA 4Y6DA 3OY5U 1QURH 1JMOH 5L2YH 4YM9A 1QA7A 4NIYA 1D3PB 1ACBE 2J4IA 1HLTH 4A1XA 3FP8E 2O8LA 1GGDC 1HYLA 1KDQA 2ZFPH 1SGDE 2Z6BD 3SQHE 1O2TA 2HWLB 5HM2A 2CN0H 1YM0A 3GISB 1Y3UA 4NFEA 2XTTB 2FOGA 2BOKA 1C1PA 1Z8RA 3VB6A 3P6ZB 1C5TA 3GCTG 1GBMA 1Z8IB 2OCVB 4LK4A 2ZGHA 3SU2A 1V2KT 2BZ6H 4D9QA 5EPNA 3MU1A 1W7XH 2BOHB 3ZZBA 4LOYH 1THRH 3DFJA 3ZVDA 2GZ9A 3GCOA 1O2HA 1S6FA 3T27A 1N6XA 4CR5A 4CREA 1C2EA 3TITA 2NU0E 1D4PB 1YCPH 3A7ZA 4B2BA 2VU8E 1NRNH 1HJ9A 2B5TB 2ZU4A 2AEIH 4WF8A 1K2I1 1VJAU 3TJOA 3CS7A 1TWXB 1OKXA 1SB1H 4AG2A 1O2XA 2A7JA 2KAIB 3GYLB 2H5CA 3NK8A 4IC6A 2HOBA 1NY22 1GBLA 2C8WB 2P95A 3RXIA 1QTFA 2ZCKP 1DLEA 1NRRH 2G5VA 2UUKB 2WINI 2BXUH 1TYNA 1UVTH 1TNJA 4X1SU 1ZLRA 3UTUH 2OP9A 2GV6A 2Y5GA 4JZEH 3M7UA 5A8ZA 3M7TA 1IQMA 3RUOA 1NU9A 2K1QA 2C93B 2ZFFH 5EQSA 1EAUA 3T28A 1OOKB 2CXVA 1IQLA 3EGKH 1S5SA 3NPSA 1C4V2 2YOLA 2Z9JA 4ASHA 1TOMH 2W7UA 1THSH 2OC0A 5C20A 2F9NA 3BIVH 1ZJDA 1DUEA 4Z6AH 4ESTE 2XC0A 1G37A 2BQ6B 4GPGA 4NG9H 3PLBA 4X1PU 4FUHA 4MPXA 5FCKA 3ZVAA 4WJG2 1CHOG 1EB1H 3BTKE 1DWEH 3Q76A 1SGEE 3VXFH 2D26C 1O2RA 1K9OE 5AFYH 2FMJA 1P9UA 1T8MA 5C67A 3LGTA 1YPEH 3RC6A 1O2VA 4IBLH 4OS5A 3VEQB 4B76A 3SNEA 4CRBA 1LHFH 1C2FA 3B9FH 1C5OH 2C3SA 3BEUA 3EDXB 2SGQE 5GCHG 3PROA 1NZQH 2EI6A 3LU9B 5E2OA 5FPSA 2STAE 3KF2A 2WV5A 3MNSA 1C1VH 3PMHB 1QCPA 1YBWA 2YNAA 7LPRA 1ELVA 2GV7A 1PPFE 1Z1JA 1S84A 1KXCA 1TLDA 3GCHC 1J15A 4GHTA 4NZLA 4GLYA 4K3JA 1OP0A 2GP9B 1YPLH 3UQVA 5LPEA 4JZ1A 1BRCE 2ZZUH 3S9CA 1C5WB 1LDTT 1HJAB 4WY3A 1ZMJA 1GDUA 1Q3XA 1P2IA 2TIOA 1BBRH 1QGFA 1P9SA 2GGVB 2W26A 1ELCA 8ESTE 1C5LH 4JZDH 1QR3E 5A8XA 1W2KH 1FLEE 1EPTC 1FY4A 1S85A 3PB1E 4YZUA 4ZXYH 1GJ9B 5GDSH 1C1UH 3ATWA 1XVMA 1GI7B 1MZDA 1P2KA 1Z1IA 3ODFA 3TK6A 2SNWA 3RLYH 4DIHH 1QJ7B 1QFKH 2BXTH 5ETXA 1AFQB 1O2PA 2ZG0H 1C5MD 1MKXH 2ZGJA 3VB5A 2J34A 3WY8A 1MTNB 1HAPH 1WOFA 4Y79A 2ZF0H 1GI4A 1WUNH 4Y8XA 1CT2E 2Z94A 3PMJA 5AFZH 1UTNA 3MMGA 4GVUA 1QB1A 1GI9B 4NZQA 4NFFA 3V13A 1XXFA 3QGJA 1B0FA 1XKAC 2AIPA 1GJ5H 1S83A 3RMOH 1GHZA 1OWEA 1L2EA 2ZHWH 2ZHDA 2XCFA 3LIWA 2IN2A 4ZXXH 4UFGH 1L1JA 1SMFE 1EP6A 4X6OA 5CE1A 1UHBB 2FXRA 1SQOA 5ABWA 1GG6B 1UTQA 1VGCC 1KDQB 2EC9H 2R9PA 4H42U 3FFGA 3TGJE 1C5UA 2OD3B 2FI4E 2FDAA 1BMMH 4WMFA 1H9HE 1A3EH 3LC5A 3AW1A 1TFXA 4CH8B 4MNVA 3BTTE 2G81E 1YLCA 3E16B 1HDTH 1O3OA 1C9PA 1O37A 4MTBA 1QRWA 4NIVA 4XE4A 1RFNA 3I78A 2OC8A 2GMTB 1PPBH 4U2WA 1Z71A 2STBE 3RMMH 1EUFA 3UREA 1ZOMA 1DVAH 2OQUA 1GI3A 3RXSA 1O3LA 3K2UA 3QX5H 2C8YB 3ZZ8A 2A5KA 2C90B 2EI7A 2THFB 1GCDA 2ZDLA 5EU8A 1P8VC 2VIPA 2Q6GA 1T8LA 3UPEA 7GCHG 4TPYA 1ETSH 1BT7A 1B7XB 4BNRA 4O97A 3RXMA 3UOPA 2OC1A 4B73A 1BMLA 4JYVH 1LQEA 2ZNKH 1YP9A 2ZFSA 2AMPA 1C2KA 3LJOA 1GJ7B 2GCHF 3URDA 4A6LA 3BIUH 2F9OA 2ZGXH 1EP5A 1EZSC 2ZQ1A 1C5VA 1SSXA 2A4OA 3SHAH 3LGYA 1EX3A 5ESBA 5GJ4B 3SN8A 1O3GA 1ELTA 4CBNA 2Z9IA 4J1YA 1AI8H 3RXGA 4AG1A 4KTCA 1QBNA 3EA8A 4RSPA 1FN6A 3RXQA 1ELGA 3U1JB 1G3CA 4GCHG 4TWYA 1OWJA 3ATMA 2A0QB 1EJMA 3V0XA 1BITA 4ZH8A 3PMAB 2CF9H 5A2MH 3RXOA 1ZTJA 2ODPA 1TRMA 3RXHA 1TQ0B 1MTUA 2ZU1A 4KTSA 1F0TA 3TK9A 1O34A 2ZCHP 4D7FA 1YPGH 1L1NA 1UTLM 1YCPK 2P16A 2ANYA 2EEKA 1HAXB 2PV9B 3H7TA 4Z0KA 2CHAC 4BAKB 1AGJA 1FY5A 1YCPM 4LXBH 4BAOB 2GZ7A 3M3SA 3O8DA 3URCA 1GHBF 3IITA 1EOJA 1S0QA 2FOFA 4X2WA 4B75A 1YF4A 1HAGE 3VB4A 5DPAA 3W95A 2JH0D 1NRPH 1ZMLA 1DPOA 1WSSH 2Y5HA 3KQBA 4ABJA 1KLJH 4E7NA 4U30A 4NCYA 3SZNA 1GBFA 1O2GH 2ZKSA 4FU9A 1DE7H 1LTOA 2ZHFH 4H4FA 5JBCS 1GBTA 1GHXH 3E91A 2AGGX 1PPZA 1ARBA 2HNTE 1P11E 3MH7A 4AB9A 2J2UA 4ZHLU 3EYDA 2Y82A 3DHKH 4M7GA 4I8KA 5LGOA 1UK3A 2IPHA 2TBSA 4O03A 4X1RU 1FNIA 1YGCH 5J4SA 1V2LT 1Y59T 1NFYA 1BJUA 1ELEE 3S9BA 3KEEA 3R3GB 1TMBH 3QK1A 3ZZDA 3OU0A 1K1LA 4OGYA 1UVOA 2CV3A 2GCTB 4KGAA 1T8NA 3LH3A 1UCYH 2GZ8A 3CENA 5LH8A 1QQUA 5EODA 3PLPA 1ESAA 4CRDA 2PKSB 1DWBH 5C1YA 4MPWA 4DCDA 1ELAA 1K1NA 3SUGA 1BRAA 2XRCA 2Q6DA 4JCNA 1IHSH 2BB4A 1XUIA 2BY9X 1L1GA 2LNCA 5JBAS 1DFPA 1O5EH 3P70B 3UWJH 1N8OC 3S9AA 1VJ9U 1WU1A 3RXPA 3ZZ9A 1NM6A 5JB8S 5EXMA 2PTNA 4X2XA 1P2OA 2OBQA 1D3QB 1OP2A 1A0JA 3VB3A 3QUMP 4ABIA 4HGCA 1V2ST 2LPRA 5FPTA 3MFJA 1Y3YA 2XC4A 4I7YH 2W3IA 4BXWA 4F4OC 4Q2KA 3F1SB 1MTVA 2GTBA 1D6WA 2AH4X 4X6NA 1O3NA 2BY8X 2PKAB 1SQAA 1O5FH 1ZSLA 1G2LA 4TYDA 3BTWE 1FN8A 1Z8GA 3SV7A 4AFSA 1V2JT 1PYTC 2SGAA 1O3MA 3OYPA 1LPKB 1GMHG 2WPJS 3GCTF 1NO9H 2XYAA 2BDGA 1SGRE 2VGCC 1FUJA 5FXLA 1BRBE 1ESBA 3ZZAA 1BOQA 3HGPA 3DD2H 3SOSA 1KXBA 1TALA 3GY4A 3F68H 1Z6EA 2A7HA 1V2OT 5EW1H 3G01A 3C1KA 1HBTH 1O2KA 1BJVA 1E0FD 4ZMAH 1LVYA 2FIRH 1XVOA 3HPTB 3M3TA 1O2SA 3SNAA 2P59A 4ISNA 4H6SB 4H6TA 3SU4A 4AX9H 1MTNC 1F5LA 3MNCA 3PM3A 2ALVA 1AB9C 1IQKA 2W7SA 1DXPA 1ARCA 3STJA 1O3KA 2TPIZ 1DLKB 3LGUA 5CHAC 3EAJA 1TBZH 5EXLA 2R3YA 2RDLA 3QZRA 1TMUH 3VXEH 2XBVA 4BAHB 1G9IE 3GCHB 3P8FA 1RRKA 5B6OA 2VVCA 3SJ8A 3VB7A 2FOMB 1FY1A 1AD8H 4BTIB 2GCTC 6GCHF 1N8OB 4ZKOU 3AAVA 1BTXA 1EAWA 1C4U2 2Y81A 2QYIA 4I8JA 3GDSA 4KELA 1N1LA 3M61U 3LONA 5SGAE 4FUGA 1TIOA 1UVPA 5E0HA 3SJOA 6CHAC 2C4FH 2ODQA 1LHGH 1HXFH 1C2GA 4AZ2B 1O2WA 2QXJA 3LJJA 2VIOA 1EOLA 1VITH 2TGPZ 2WPHS 2WYGA 5F6MA 1LPGB 1H9LB 4O3TA 5EGMA 2OXSA 1ZSKA 4YESB 1FPCH 5I25A 1Y3XA 3RXJA 1C9TA 1C1TA 1INCA 3Q00A 1YPHC 1V2TT 2NU2E 3NKKA 1FDPA 1A61H 2ZTYA 1L4DA 4Y7BA 1A4WH 1AQ7A 2GT8A 3OSYA 1O33A 2Z3DA 1QRXA 5AHGH 1O36A 4ISOA 4WMDA 3KL6A 1GDNA 2HPPH 3BEIB 3L33A 2B9LA 1GJBB 2F3CE 3TH4H 5C1XA 2EA3A 1XUFA 1ZHPA 2D2DA 1KY9A 1GI0A 4ZKSU 5EXNA 3SJIA 4NWLA 4SGBE 2A5AA 2BZAA 1P2QA 1ZTLA 1GWAA 4A5TS 2SGFE 5G4BA 1T4UH 2QF3A 2PSXA 2F83A 1GHVH 3QWCH 1SGFA 1GVKB 4AYYB 4NWKA 2CHAB 4TPIZ 3SNDA 2XBXA 2GVFA 2ZPRA 3NUMA 4CRCA 1DWDH 1BBRE 2DE8A 1CA0B 1AE8H 1X7AC 3A83A 3SNCA 1FPHH 4DG4A 1EASA 1TOCB 4NIWA 3MU0A 1IQJA 5HYOA 3FAOA 2FZZA 2PTCE 3SORA 3ZV9A 1HAVB 2CGAA 2FOAA 3KIDU 1F92A 1SLUB 1UTMA 1GCTC 6GCHG 1HCGA 1EPTA 2JETB 2FOHA 1SFQB 3HATH 4Y0YE 2VVUA 1S6HA 1AFEH 1WV7H 1UO6A 5DJ7A 1BTYA 4FUBA 5E0JA 2FOCA 3BTDE 4ZHMU 3T25A 1V2QT 5E8EH 1UHBA 9LPRA 1LPZB 2O8UA 1FV9A 1W13U 1SFIA 1MKWH 1RTLA 4HZHA 3QLPH 2QAAA 8LPRA 1RTFB 2BD2A 4K8BA 5K0HA 2UWOA 2D8WA 3U9AH 1EJAA 4FVDA 1D9IA 2V3OH 2A7CA 4Y8YA 3SGQE 4WVPE 2UWLA 1UVUH 2RCEA 3TH3H 4YT7H 4NA7A 1A0LA 4ABBA 5TCCA 1UCYE 4YT6H 1O3DA 4VGCC 4R0IA 4X8UH 3JZ1B 3D65E 2J38A 3UOUA 5EQRA 4B2CA 1GHWH 1NPMA 3PO1B 1UVSH 1TPAE 1O2IA 3LGVA 4ABDA 1KYNA 1G3BA 1JBUH 1RS0A 2J95A 1U6QA 3NCLA
chains in the Genus database with same CATH superfamily
2A45B 2PUQH 2ZPQA 1M9UA 1S81A 2AIQA 2G52A 3MOCA 3U8OH 1OSSA 1FIZA 1NRSH 3RDZA 4ACBA 2WPMS 3E8LA 3U98H 1J17T 4K1TA 2PKSC 1FMGA 4FXGH 3TJNA 2ZI2H 3KGPA 3KHVA 2ILNA 1B5GH 1GMDF 4OS1A 2AGEX 1E36B 8GCHF 2JH5D 1XUGA 2FTLE 2P94A 3NZIA 2VIVA 1LCYA 3M5MA 1O2MA 4JK6A 2PSYA 1P2MA 2H9HA 2IJD1 2VNTA 1PJPA 4MPVA 1KTTB 2LP6A 2ZU5A 4NGAH 5GWZA 3UNRA 3E0PB 1O5DH 1CGHA 1XXDA 4YOJA 3F9EA 3SNBA 3HKIB 3LT3A 4GUXA 3BG8A 3LGWA 1Z7KA 4MLFB 1OYTH 1AUTC 2O8MA 4MPUA 4SGAE 3R0FA 1TMTH 5DG6A 1C2JA 3RXEA 2ZP0H 1CGJE 4MDSA 1E79D 5DP4A 2BQ7B 1CBWC 1DY9A 1QRZA 2ZGBH 1C5XB 1HNEE 1HJAC 2VH0A 3RMLH 1C5NH 1DOJA 1O31A 2NU3E 1TB6H 4ABFA 1AWFH 1TAWA 1BHXF 2TGDA 3ENSB 3EE7A 3MHWU 1JOUB 2R2MB 2BLWA 2H9TH 1O5BB 4WH6A 2FPZA 1KXEA 1OHHD 2WPIS 5L6NH 1VZQH 1BIOA 1DICA 4R8TB 5EJ1A 1COWD 4D9RA 1E37B 1G3DA 2BDBA 1DT2A 3RXLA 1GHAG 3MWIU 4MVNA 3FKSD 4INKA 1NFUA 2SNVA 3DFLA 1KSNA 3QTVH 5GIBA 5FX5A 1EB2A 1AE5A 2QCYA 3LPRA 4CRFA 3M36A 1FZZA 2OQ5A 5I46H 3ZVFA 5PTPA 1C2IA 1WTGH 1KXDA 1VITF 2FYQA 2BD9A 1UTJA 1GJCB 1GI6A 3SI4H 1BA8B 2HGTH 3SUEA 1HFDA 2Y7ZA 1HB0B 1P04A 1P10A 2G5NA 5HM9A 3TGKE 1ETRH 5T6GA 4GHQA 1SLVB 2O8TA 5A0BA 3TGIE 1O3CA 3M3VA 1MKWK 5GPIB 2J94A 4DJZB 3ZIAD 4BXSA 4DY7B 1FXYA 6LPRA 1A7SA 1RTKA 1GBJA 1MCVA 2EY4C 2HLDD 2HRVA 2H2ZA 3M35A 3MNXA 3QO6A 2HVYB 1CQQA 1VCWA 2QIQA 3OX7U 1V2NT 3HK3B 5L2ZH 2AMQA 2ASUB 2XW9A 5T3HA 5KECA 3PYHA 2VVVA 1EQ9A 2V3MA 1MBMA 3RMNH 3TH2H 2BVSH 1P02A 1HAYB 5DP5A 1EZQA 1SBWA 3N7OA 2RA0A 2G8TA 3QTOH 4Q7ZA 4XSKU 3RC4A 3WWBA 1C1OA 1K1PA 3FN8A 4RKOB 2ZDMA 1OWHA 4XDEA 3ZYEA 1AFQC 1H1BA 4HG6A 1ZHMA 2HLCA 2P8OB 2FEQH 2L74A 4K2YA 1CHOF 1GBEA 1CT4E 3DT0H 3ZVGA 1DXWA 4INLA 1GJ6A 3QDZB 1GJDB 1AB9B 3S7KB 1H8ED 1EAIA 4JZIA 3T2NA 2ZDAH 1Y5BT 2FOBA 4B74A 1UTPA 7KMEH 4Q63A 1AMHA 4UEHH 1GMCF 4CHAC 1JRSA 3UR9A 2B8OH 1C4Y2 1NESE 2Z9LA 3LKWA 3BTME 3UWIA 5BPEA 1TGCA 2WV9A 1HV7A 4I8GA 5JB9S 1A0HB 1C5ZB 2R2WU 3PTBA 3RXCA 4IGDA 5H4IB 1QL7A 1A2CH 3SU0A 2G55A 4MNXA 1F0SA 1C5RA 3P8NA 3RXRA 4NSVA 5DP8A 4NA8A 2OINA 2I6QA 1KXFA 1W12U 2BY7X 1ZGIA 3VGCC 4AFZA 2O9QA 3EA7A 4XBBA 6CHAB 4Y7AA 2BX3A 2FESH 2VH6A 1SGPE 3GY7A 3UUZA 4K1EA 2AFQB 3M5NA 1OXGA 3PMBB 1BTWA 1NRQH 2J9NA 3I29A 1KXAA 2ZHEH 4FUEA 4K1SA 1AKSA 1ELFA 5A0AE 3K6ZA 4FUCA 3KQCA 1QJ6B 1HIAB 1K1OA 4ISLA 1WBGB 1BQYA 2PGQB 1L0ZA 2PWXA 2FWWA 3TNTA 2W6ID 2ANWA 1TRYA 2D1JA 1O3AA 3A8CA 1C1SA 3MO9A 4QT8C 5C2ZA 1C2LA 4YTAA 3SI3H 1TE0A 2FTMA 3RU4T 2Z7FE 1K28D 3A7TA 1GBHA 1BTPA 2VWLA 1NN6A 2QA9E 2ZPSA 4I31A 1UMAH 3LGIA 1H8HD 3VG8A 5C3NA 4K5ZA 2F91A 1BMNH 2ZU3A 5DO4H 3OEED 3LOXA 2ZFTA 3D23A 3L6PA 4Y10E 2W5EA 1IQEA 1QB9A 1YWUA 1VR1H 3CP7A 1D3TB 1DWCH 1GHBG 3BTGE 3UNQA 3P92A 1K21H 2BDHA 3I77A 1TX7A 2QY0B 1AVXA 3N7DA 2BLOA 4X2YA 4AFQA 5GXPA 1E35B 2F9PA 3UR6A 3ZV8A 4YLQH 3B8JA 4UDWH 2Y5FA 4X8VH 3RM2H 5KEDA 1H4WA 1HUTH 2UUYA 2H9EH 3MYWA 1GBCA 2VJ1A 1UCYK 3A89A 3BG4C 2V35A 3V12A 1UTOA 4ABAA 3MU4A 3TNSA 1C1NA 3A8BA 3RC5A 2JETC 2ODYB 1BMAA 4BAQB 2PP6A 1TRNA 1LHDH 4TY6A 3F2FA 4YLUA 4DIIH 1ZRKA 2F9VA 2Y7XA 1GJ4H 2BTCE 4I32A 4Y11E 8GCHG 4HI3A 4BANB 1Z8JB 2ULLA 2VWMA 2TRMA 1UTKA 1C5PA 1MMJN 1BDAA 3Q3XA 3ATIA 1A1RA 1IQFA 1O3EA 5HIYA 1ID5H 4MQAA 3KN2A 1W10U 1IQNA 4X8TH 4X6PA 2KZ4A 3E90B 3A7XA 1V2RT 1OYQA 2QF5A 4XRNA 3UQOA 3A8AA 3MO6A 4FUJA 1C1MA 1PQAA 2XWAA 1PQ7A 2YNBA 4YO9A 1ABJH 3GICB 1E34B 2GX4A 2B0FA 2HNTC 5JBBS 2JDID 3PO1C 2BY6X 4AB8A 4ZKRU 2AS9A 3GDUA 4ABEA 3TU7H 5F53A 1CVWH 1ETTH 1TPSA 1QJ1B 1P3CA 1BRUP 1THPB 3F0PA 4FU7A 1H8IH 1DDJA 2VIDA 5EOKA 1SGTA 4IMQA 1GHAF 1GMHF 1ZPBA 1W0YH 5HMAA 1GDQA 3GCNA 4NA9H 3FP7E 3UAIC 4BTUB 2XWBI 4E06H 2FX4A 3KNXA 1MU8B 2HNTF 1BHXB 3OAAD 1O3HA 3HK6B 3RXTA 3LC3A 4B1TA 3IWMA 1JIRA 3PWCA 2VWNA 4AGKA 1RGQA 3UNSA 4J2YB 3ESTA 1A5GH 1TNIA 2P93A 1IQHA 3BTEE 3A8DA 3GOVB 1IAUA 1OS8A 4B71A 2RDEA 3A80A 2G51A 4F48B 1XX9A 4MNYA 1UW7A 1ZRBA 4DW2U 1BTZA 3GY6A 1ESTA 2GMTC 3SU5A 4GSOA 5TCAA 4DGJA 1CT0E 1LO6A 4AFUA 2VIWA 3BSQA 1BTUA 4O3UA 2V6NA 3SW2B 4YXWD 2BD8A 2BMGB 3ODDA 4XD7D 1WQSA 2ANKH 2BDIA 1ZPCA 1SGIB 3E0NB 2QF4A 4BTTB 2ZTXA 3T5FH 2WUBA 1TGBA 4GAWA 1GBDA 2OUAA 5LPFA 2A32A 1NC6A 1YPMH 1MAXA 1HAIH 4A1VA 1ZMNA 3FP6E 3O8CA 1YC0A 1RJXB 3SV2H 1GG6C 4TWWA 5T6DA 2A2XH 1PYTD 5DSFA 3HKJB 2OBOA 2ANMH 3RXUA 2PUXB 2SGPE 2BHGA 1PQ8A 2UUFB 3BV9B 4KKDA 4YOGA 4AYVB 4Y0ZE 3KQDA 3L3TA 3ZZ7A 2V0BA 3Q3KA 1CHGA 1XUJA 2XBWA 4UONA 1JIMA 1LMWB 2F9BH 3T29A 1UK2A 5A8YA 1VCQA 1O3BA 2WUCA 1EAXA 3A87A 3BN9A 3E3TA 1HAHH 1SOZA 2QF0A 1ANDA 2Z3EA 4A92A 5DP7A 1WCZA 4IC5A 1C1RA 4B2AA 2XNIA 4JK5A 4D7GA 1W0JD 2P3UB 5HXFA 1C2DA 1KIGH 1TPOA 3KYGA 2DUCA 2ZDVH 9ESTA 2BD5A 3UFAA 1S6LA 3ATLA 4CRAA 1GBAA 2GDEH 3AVZA 1FY3A 1HAVA 1P3EA 4KP0A 2WPKS 5GNDA 4B6FA 4CBOA 5L30H 2V7QD 4ZROA 2FO9A 4OS6A 3W1EA 1NBME 1O0DH 3A7YA 4IN2A 2FLBH 4Q7YA 3A86A 1AO5A 2P3FH 2FS8A 1LVMA 2WV4A 1W8BH 1C2HA 2A5IA 2WZQA 3TPIZ 1O2LA 3K9XB 1C5QA 1DS2E 1LKAA 1T32A 3MNBA 1IHTH 2QGRA 1TGTA 1P57B 1EZUC 1F0UA 4OS2A 1Q2WA 2QXHA 4IW4E 3RXDA 3SU6A 3SQEE 1EKBB 1GJ8B 4WWYA 5DP3A 3O8RA 3CNRA 4K60A 1JRTA 1K1IA 1SL3A 1O2UA 2XXLA 3CS0A 1PPHE 4JZFH 4JYUH 2QXGA 4MNWA 5DGJA 2G4UA 2AMDA 1FX0B 1ZJKA 2PW8H 2CJIA 3RP2A 3F9FA 2F9UA 1CO7E 1P09A 3ZZ5A 2J92A 1P12E 1NT1A 3SUDA 1O32A 3SJ9A 5JBTA 2VWOA 2C8XB 2H6MA 2JH6D 4CH2B 1IQGA 5FBIA 2ZC9H 3PV4A 3VPKA 5F03A 2VIQA 1MAYA 2GT7A 2SFAA 1GI2A 1BBRK 3PRDA 2Y80A 5F8XA 1O2ZA 1S0RA 1TX6A 3DUXH 1MZAA 1MBQA 4FOUC 1AVWA 1MKXK 3GYMA 1LKBA 2UWPA 1F0RA 4INHA 5TJXA 2IJOB 1ZR0A 5DK1A 2RFKC 2FLRH 1O2QA 1FI8A 1G2MA 4LZ4B 1BB0B 1SG8B 4OGXA 4XBCA 1P0SH 3RU4E 4UD9H 1EPTB 3AASA 4B6EA 1QL8A 4Y71A 1A5HA 5HGGA 3RXVA 1XUKA 3BF6H 3A7VA 4NIXA 1ORFA 3UIRA 5J4QA 3A7WA 4UFEH 1EXFA 1GMDG 1MQ6A 1SHYA 1OWIA 3FVFB 1O35A 1J9CH 4UFDH 4BAMB 5T1VA 1CE5A 4CR9A 1Z6JH 4UFFH 1ZPZA 1DM4B 3TJUA 1TNLA 1ELBA 1KTSB 2ZGCA 3P8GA 2HPQH 1ABIH 2ZDKA 2BLQA 3M5OA 1W7GH 4OS4A 4PROA 2BVRH 3DSPA 1LHEH 1XUHA 3M37A 4GCHF 5DP6A 3TK5A 3U69H 2FX6A 1GVZA 1GL1A 2ZCLP 3A81A 3V3MA 2IOTA 3IG6B 4DVAU 4O9VA 1DY8A 1SQTA 4XBDA 5FCRA 4A1TA 1HPGA 1ZTKA 1DX5M 3RM0H 1EJNA 1GMCG 4X8SH 3S7HB 1GL0E 2GD4B 3SU3A 1TNHA 1SLXB 2GCHG 1AWHB 3C27B 2BYAX 2P3TB 3MU5A 1AY6H 2XOKD 1UK4A 2NU4E 3TLOA 2BQWB 1HAZB 1QIXB 2OTVA 3OEHD 7GCHF 2A1DB 2TGTA 2M2AA 4Q80A 1HRTH 2ZO3H 1XM1A 3HGNA 4IN1A 2FI3E 1EZXC 3W94A 4ABHA 4FUDA 4ZHAA 1K1JA 5BRRE 5A09A 3F3BA 1WTHD 1H8DH 3QN7A 2ZTZA 3ZZ4A 1O38A 3H5CB 4I33A 3ELAH 4AORA 2Q6FA 2BDCA 1FAXA 1P06A 1YPHE 2OC7A 1ANEA 1A3BH 1AIXH 1HXEH 1SGFG 1CA0C 3D62A 2QV1A 1SLWB 2EQNA 3F9GA 3O8BA 1QQ4A 1A46H 1N6YA 3K65B 1BZXE 2KAIA 1FJSA 4RKJB 5EPYA 1AVGH 1MD8A 2NU1E 4AN7A 4AGJA 5LPRA 1O5GH 1O2JA 1WQVH 1P05A 1GCTB 1AU8A 4E05H 3H7OA 4Y76A 2FOEA 2Q1JA 1C5YB 2RG3A 1VGCB 2Z9GA 1L4ZA 1MCTA 1V2UT 1C1WH 2H1UA 1C1QA 2R0LA 4AC9A 1FIWA 2FP7B 1OX1A 1K22H 1MQ5A 1OWKA 1AUJA 1YPKH 4HFPB 3A84A 4BOHA 3GDVA 3BG4B 1E38B 2A31A 2WPLS 2AYWA 3OY6U 3SHCH 1GPZA 2NWNA 3S69A 1IQIA 2BVXH 1F5RA 2ZEBA 3SU1A 1AZ8A 1V3XA 2FM2A 3SJKA 5T6FA 1YLDA 5CDFE 4KTUA 1G30B 3NXPA 1V2VT 1O5CB 2FS9A 3SV6A 2DE9A 2EI8A 2ALPA 1O3JA 3T26A 3BTHE 4TSFD 2FYRA 5F8ZA 2SGDE 3A85A 2WYJA 1TGSZ 2WHXA 5C1UA 1VITG 1AKSB 2XBYA 3MO3A 1GJAB 1Y3WA 3VFEA 4D8NA 1CSOE 1T7CA 4DURA 3ZZ6A 2IPQX 2ZHQH 1NFWA 1Y3VA 2ZQ2A 4X6MA 1C5SA 2G4TA 1EATA 4HTCH 2VB0A 4UE7H 5FAHA 1W11U 1NBMD 2BM2A 1BUIA 1TONA 2UUJB 3PV5A 3RXBA 1ELDE 1FAKH 4THNH 3F9HA 4X1NU 1D6RA 1G32B 1HJ8A 5EQQA 2YMSC 2BX4A 1ZZZA 3Q77A 2WPDD 3DA9B 1ZSJA 1AHTH 3MTYA 2PGBB 2ZWLH 3MH5A 3MH6A 4WH8A 1GBKA 5HIZA 4AOQA 1QNJA 1GI8B 3ITIA 2R0KA 1VCPA 4ISIH 5GCHF 3AAUA 1P2JA 4IS5A 1G36A 1YLNA 2AHME 2A4QA 3BTQE 1BCUH 2QXIA 3AW0A 3STIA 3P17H 3SUFA 3SO3A 3Q3YA 1S82A 1DITH 2AGIX 2H5DA 3P8OA 3V7TA 1ZHRA 1CBWB 1QBVH 3GY5A 3K6YA 5C5NA 2BD4A 1O2OA 1SGCA 5E0GA 2A2QH 2GDDA 4WXVA 2JKHA 2Z9KA 3QZQA 1TPPA 3RXAA 1O30A 1SGYE 3F6UH 4Q7XA 1SVPA 1P01A 1TGNA 3SGBE 1SI5H 3GY3A 3WW7A 4U01A 3AK5A 2PFEA 1TX8A 2VINA 4FUIA 4WXIA 1DSUA 1F5KU 1YPJH 1ZYOA 1SHHB 1PPCE 2A4RA 2BD3A 2TGAA 1GI5A 2O8WA 1W3CA 1ANCA 2F4LA 4X2VA 3P95A 1P03A 1TQ7B 5EW2H 1HGTH 1QL9A 1PFXC 4RN6A 1SGNE 5FPYA 1TNGA 1KLIH 3TVJB 3VGCB 4E7RG 4YOIA 1V2WT 3RU4D 4U32A 1DANH 3BEFB 2B7DH 1SC8U 1ZGVA 2J5UA 3E6PH 4Y8ZA 6ESTA 2W3KA 5AF9H 5ESTE 3SV8A 3U8TH 1QA0A 1O3PB 4D76A 1UJ1A 3PLKA 5B6LA 2Y6TA 1RIWC 4FU8A 3EQ0H 3BTFE 1WYKA 1SPJA 2ZIQH 5F8TA 2ZECA 3M5LA 4I8LA 1ANBA 1TNKA 3ZZ3A 4ZUHA 3ZVEA 3GY2A 1JWTA 4XOJA 1MD7A 1B0EA 2ZFQH 1NFXA 3SV9A 3GY8A 1MTWA 1WAYB 5AVDA 1HIAA 1DSTA 1YKTA 2Z3CA 5IYTA 3U8RH 2GKVE 1NU7B 2FI5E 2KCOA 5CMXH 2M5TA 1FQ3A 2ZDNA 3D49H 1W14U 1DUAA 1MTSA 3KQEA 3RXFA 3N7EA 1J16A 1W0ZU 4K8YA 4ABGA 1MU6B 5JYIA 2BY5X 1NS3A 1XKBC 1K1MA 2P8OC 1AN1E 1JXPA 1KMHB 3NWUA 1TBQH 3LH1A 3QGNB 2C8ZB 3E1XB 1V2MT 3ATKA 1MUEB 1KLTA 1O3FA 2BLVA 2SGEE 3A82A 4FUFA 1GBIA 4WMEA 1T4VH 3MH4A 1QZ8A 2A4GA 3DSOA 2BD7A 4I8HA 1QBOA 4MG3A 4TY7A 3RXKA 5IDKA 1XMNB 2OLGA 1LVOA 3TIUA 1F7ZA 1OPHB 2L6OA 1PPEE 1P2NA 1LQDB 5JDUB 1LVBA 4ISHH 3KCGH 3OTJE 4P02A 1FONA 1GGDB 1RXPA 4K69A 3M7QA 2ZA5A 1QHRB 1O5AB 2V3HH 4NSYA 1F2SE 3FZZA 5DP9A 3FZDA 2I6SA 4CRGA 1GI1A 3ZVCA 2XC5A 5K7RA 1PPGE 1GVLA 1QY6A 1RD3B 3ZZCA 1GBBA 3SYJA 5FX6A 1FY8E 2XNDD 1HAOH 1TA2A 1T8OA 4LZ1H 3JZ2B 5E2PA 4A7IB 2J98B 2BDAA 5FHTA 4VGCB 3SBKA 1QB6A 2ZU2A 3ZYDA 4OM9A 2QC2A 2ESTE 8KME2 3A88A 3MU8A 3OFND 1J8AA 3U1IB 1CGIE 2HVXA 5FBEA 2PKAA 1GHYH 2AERH 2KCPA 2CF8H 1O3IA 1Q31A 2QN5T 4DT7B 5A0CA 1TABE 1J14A 1TBRH 2K0QA 2PLXA 3S0NA 1RIWB 1T31A 3PTNA 3LDXH 4ZAEA 4ZKNU 1CA8B 2HALA 5CHAB 2PR3A 5EG4A 1AZZA 1IOEA 1OP8A 1BTHH 2F43B 1SKYE 3PWBA 1O39A 1LHCH 4OS7A 1OWDA 1PQ5A 4F49A 2BDYA 4FVBA 1O2YA 5EIYA 1Y5UT 1TA6A 3EA9A 1O2NA 3TJVA 2VBCA 1C2MA 1NTPA 4IMZA 2ZFRH 1G3EA 5DKMA 3B23B 1V6DA 2G00A 3SGAE 2VGCB 5JPMH 3T62A 1SGQE 2XCNA 5KGOA 7ESTE 5C5OA 4CHAB 2R3UA 1MH0A 4DOQA 3MI4A 3FANA 1D3DB 1YYY1 3UB0A 1Y5AT 3RLWH 4X0WU 2FODA 1H9IE 5EJLA 1CU1A 1V2PT 1Y8TA 4JYTA 1MABB 1SR5C 4XFQA 2RA3A 5DN6D 1A5IA 3UY9A 4X1QU 3EE0B 1SOTA 2W6JD 2CMYA 3ZVBA 1NROH 2PHBA 4JMYA 4Y6DA 3OY5U 1SQRA 1QURH 2YMSB 1JMOH 5L2YH 4YM9A 1QA7A 4NIYA 1D3PB 1ACBE 2J4IA 1HLTH 4A1XA 3FP8E 2O8LA 1GGDC 1HYLA 1KDQA 2ZFPH 1SGDE 2Z6BD 3SQHE 1O2TA 2HWLB 5HM2A 2CN0H 1E1QD 1YM0A 3GISB 1Y3UA 4NFEA 2JJ2D 2XTTB 2FOGA 2BOKA 1C1PA 1Z8RA 3VB6A 3P6ZB 1C5TA 3GCTG 1GBMA 1Z8IB 2OCVB 4LK4A 2ZGHA 3SU2A 1V2KT 2BZ6H 4D9QA 5EPNA 3MU1A 1W7XH 2BOHB 3PV2A 3ZZBA 4LOYH 1THRH 3DFJA 3ZVDA 2GZ9A 3GCOA 2KX4A 1O2HA 1S6FA 3T27A 1N6XA 4CR5A 4CREA 1C2EA 3TITA 2NU0E 1D4PB 1YCPH 3A7ZA 4B2BA 2VU8E 1NRNH 1HJ9A 2B5TB 2ZU4A 2AEIH 4WF8A 1K2I1 1VJAU 3TJOA 3CS7A 5IK2D 1TWXB 1OKXA 1SB1H 4AG2A 1O2XA 3KQ5A 2A7JA 2KAIB 3GYLB 2H5CA 3NK8A 4IC6A 2HOBA 1NY22 1GBLA 2C8WB 2P95A 3RXIA 1QTFA 2ZCKP 1DLEA 1NRRH 2G5VA 2UUKB 2WINI 2BXUH 1TYNA 1UVTH 1TNJA 4X1SU 1ZLRA 3UTUH 2OP9A 3KYFA 2GV6A 2Y5GA 4JZEH 3M7UA 4TT3D 5A8ZA 3M7TA 1IQMA 3OE7D 3RUOA 1NU9A 2K1QA 2C93B 2ZFFH 5EQSA 1EAUA 3T28A 1OOKB 2CXVA 1IQLA 3EGKH 1S5SA 3NPSA 3F0OA 4Q4LA 1C4V2 2YOLA 2Z9JA 4ASHA 1TOMH 1VKYA 2W7UA 1THSH 2OC0A 5C20A 2F9NA 3BIVH 1ZJDA 1DUEA 4Z6AH 4ESTE 2XC0A 1G37A 2BQ6B 2OK5A 4GPGA 4NG9H 2CK3D 3PLBA 4X1PU 4FUHA 5FL7D 4MPXA 5FCKA 3ZVAA 4WJG2 1CHOG 1EB1H 3BTKE 1DWEH 3Q76A 1SGEE 3VXFH 2D26C 1O2RA 1K9OE 5AFYH 2FMJA 1P9UA 1T8MA 5C67A 3LGTA 1YPEH 3RC6A 1O2VA 4IBLH 4OS5A 3VEQB 4B76A 3SNEA 4CRBA 1LHFH 1C2FA 3B9FH 1C5OH 2C3SA 3BEUA 3EDXB 2SGQE 5GCHG 3PROA 1NZQH 2EI6A 3LU9B 5E2OA 5FPSA 2STAE 3KF2A 2WV5A 3MNSA 1C1VH 3PMHB 1QCPA 2KFWA 1YBWA 2YNAA 7LPRA 2KCYA 1ELVA 2GV7A 1PPFE 1Z1JA 1S84A 1KXCA 1TLDA 3GCHC 1J15A 4GHTA 4NZLA 4GLYA 4K3JA 1OP0A 2GP9B 1YPLH 3UQVA 5LPEA 4JZ1A 1BRCE 2ZZUH 3S9CA 1C5WB 1LDTT 1HJAB 4WY3A 1ZMJA 1GDUA 1Q3XA 1P2IA 2TIOA 1BBRH 1QGFA 1P9SA 2GGVB 2W26A 1ELCA 4RT0A 8ESTE 1C5LH 4JZDH 1QR3E 5A8XA 1W2KH 1FLEE 1EPTC 1FY4A 1S85A 3PB1E 4YZUA 4ZXYH 1GJ9B 5GDSH 1C1UH 3ATWA 1XVMA 1GI7B 1MZDA 1P2KA 1Z1IA 3ODFA 3TK6A 2SNWA 3RLYH 3F2GA 4DIHH 1QJ7B 1QFKH 2BXTH 5ETXA 1AFQB 1O2PA 2ZG0H 1C5MD 1MKXH 2ZGJA 3VB5A 2J34A 3WY8A 1MTNB 2YMSD 1HAPH 1WOFA 4Y79A 2ZF0H 1GI4A 1WUNH 4Y8XA 1CT2E 2Z94A 3PMJA 5EJZA 5AFZH 1UTNA 3MMGA 4GVUA 1QB1A 1GI9B 4NZQA 4NFFA 3V13A 1XXFA 3QGJA 5CHBA 1B0FA 1XKAC 2AIPA 1GJ5H 1S83A 3RMOH 1GHZA 1OWEA 1L2EA 2ZHWH 2ZHDA 2XCFA 3LIWA 2IN2A 4ZXXH 4UFGH 1L1JA 1SMFE 1EP6A 4X6OA 3OTPA 5CE1A 1UHBB 2FXRA 1SQOA 5ABWA 1GG6B 1UTQA 4F55A 5C17A 1VGCC 1KDQB 2EC9H 2R9PA 4H42U 3FFGA 3TGJE 1C5UA 2OD3B 1YY3A 2FI4E 2FDAA 1BMMH 4WMFA 1H9HE 1A3EH 3LC5A 3AW1A 1TFXA 4CH8B 4MNVA 3BTTE 2G81E 1YLCA 3E16B 1HDTH 1O3OA 1C9PA 1O37A 4MTBA 1QRWA 4NIVA 4XE4A 3PRBA 1RFNA 3I78A 2OC8A 2GMTB 3GS9A 2JIZD 1PPBH 4U2WA 4ZCNA 1Z71A 2STBE 3RMMH 3DSGA 1EUFA 3UREA 1ZOMA 1DVAH 2OQUA 1GI3A 3RXSA 1O3LA 3K2UA 3QX5H 2C8YB 3ZZ8A 2A5KA 2C90B 2EI7A 2THFB 1GCDA 2ZDLA 5EU8A 1P8VC 2VIPA 2Q6GA 1T8LA 3UPEA 7GCHG 4TPYA 1ETSH 1BT7A 1B7XB 4BNRA 4O97A 3RXMA 3UOPA 2OC1A 4B73A 2KM0A 1BMLA 4JYVH 1LQEA 2ZNKH 1YP9A 2ZFSA 2AMPA 1C2KA 3LJOA 1GJ7B 2GCHF 3URDA 4A6LA 3BIUH 2F9OA 2ZGXH 1EP5A 1EZSC 2ZQ1A 1C5VA 1SSXA 2A4OA 3SHAH 3LGYA 1EX3A 5ESBA 5GJ4B 3SN8A 1O3GA 1ELTA 4CBNA 2Z9IA 4J1YA 1AI8H 3RXGA 4AG1A 4KTCA 1QBNA 3EA8A 4RSPA 1FN6A 3RXQA 1ELGA 3U1JB 1G3CA 4GCHG 4TWYA 1OWJA 3ATMA 2A0QB 1EJMA 3V0XA 1BITA 4ZH8A 5HKKD 3PMAB 2CF9H 5A2MH 3RXOA 1ZTJA 2ODPA 1TRMA 3RXHA 1TQ0B 1MTUA 2ZU1A 4KTSA 1F0TA 3TK9A 1O34A 2ZCHP 4D7FA 1YPGH 1L1NA 1UTLM 1YCPK 4RI0A 2P16A 2ANYA 2EEKA 1HAXB 2PV9B 3H7TA 4Z0KA 2CHAC 4BAKB 1EFRD 1AGJA 1FY5A 1YCPM 4LXBH 4BAOB 2GZ7A 3M3SA 3O8DA 3URCA 1GHBF 3IITA 1EOJA 1S0QA 2FOFA 4X2WA 4B75A 1YF4A 1HAGE 3VB4A 5DPAA 3W95A 2JH0D 1NRPH 1ZMLA 1DPOA 1WSSH 2Y5HA 3KQBA 4ABJA 1KLJH 4E7NA 4U30A 1W0KD 4NCYA 3SZNA 1GBFA 1O2GH 2ZKSA 4FU9A 1DE7H 1LTOA 2ZHFH 4H4FA 5JBCS 1GBTA 1GHXH 3E91A 2AGGX 1PPZA 1ARBA 2HNTE 1P11E 3MH7A 4AB9A 2J2UA 4ZHLU 3EYDA 2Y82A 3DHKH 4M7GA 4I8KA 5LGOA 1UK3A 2IPHA 2TBSA 4O03A 4X1RU 1FNIA 1YGCH 5J4SA 1V2LT 1Y59T 1NFYA 1BJUA 1ELEE 3S9BA 3KEEA 3R3GB 1TMBH 3QK1A 3ZZDA 3OU0A 1K1LA 4OGYA 1UVOA 2CV3A 2GCTB 4KGAA 1T8NA 3LH3A 1UCYH 2GZ8A 3CENA 5LH8A 1QQUA 5EODA 3PLPA 1ESAA 4CRDA 2PKSB 1DWBH 5C1YA 4MPWA 4DCDA 1ELAA 1K1NA 3SUGA 1BRAA 2XRCA 2Q6DA 4JCNA 1IHSH 2BB4A 1XUIA 2BY9X 1L1GA 2LNCA 5JBAS 3F2HA 1DFPA 1O5EH 3P70B 3UWJH 1N8OC 3S9AA 1VJ9U 1WU1A 3RXPA 3ZZ9A 3WWFA 1NM6A 1WXRA 5JB8S 4ASUD 5EXMA 2PTNA 5C0UA 4X2XA 1P2OA 2OBQA 1D3QB 1OP2A 1A0JA 3VB3A 3QUMP 4ABIA 4HGCA 1V2ST 2LPRA 5FPTA 3MFJA 1Y3YA 2XC4A 4I7YH 2W3IA 4BXWA 4F4OC 4Q2KA 3F1SB 1MTVA 2GTBA 1D6WA 2AH4X 1WDIA 1O3NA 4X6NA 2BY8X 2PKAB 4DT4A 1SQAA 1O5FH 1ZSLA 1G2LA 4TYDA 3BTWE 3FOAA 1FN8A 1Z8GA 3SV7A 4AFSA 1V2JT 1PYTC 2J98A 2SGAA 1O3MA 3OYPA 1LPKB 1GMHG 2WPJS 3GCTF 1NO9H 2XYAA 2BDGA 1E1RD 1SGRE 2VGCC 1FUJA 5FXLA 1BRBE 1ESBA 2JJ1D 3ZZAA 1BOQA 3HGPA 3DD2H 3SOSA 1KXBA 1TALA 3GY4A 3F68H 1Z6EA 2A7HA 3H09A 1V2OT 4P00A 5EW1H 3G01A 3C1KA 1HBTH 1O2KA 1BJVA 1E0FD 4ZMAH 1LVYA 2FIRH 1XVOA 3HPTB 3M3TA 1O2SA 3SNAA 2P59A 4ISNA 4H6SB 4H6TA 3SU4A 4AX9H 1MTNC 1F5LA 3MQKC 3MNCA 3PM3A 2ALVA 1K0HA 1AB9C 1IQKA 2KCAA 2W7SA 3NRLA 1DXPA 1ARCA 3STJA 1O3KA 2TPIZ 1DLKB 3LGUA 5CHAC 3EAJA 2K8IA 1TBZH 5EXLA 2R3YA 2RDLA 3QZRA 1TMUH 3FO8D 3VXEH 2XBVA 4BAHB 1G9IE 3GCHB 3P8FA 1RRKA 5B6OA 2VVCA 3SJ8A 3VB7A 2FOMB 1FY1A 1AD8H 4BTIB 2GCTC 6GCHF 1N8OB 4ZKOU 3AAVA 1BTXA 1EAWA 1C4U2 2Y81A 2QYIA 4I8JA 3GDSA 4KELA 1N1LA 3M61U 3LONA 5SGAE 4FUGA 2QE7D 1TIOA 1UVPA 5E0HA 3SJOA 6CHAC 2C4FH 2ODQA 1LHGH 1HXFH 1C2GA 4ACAA 4AZ2B 1O2WA 2QXJA 3LJJA 2VIOA 1EOLA 1VITH 2TGPZ 1BMFD 2WPHS 2WYGA 5F6MA 1LPGB 1H9LB 4O3TA 5EGMA 2OXSA 1ZSKA 4YESB 1FPCH 5I25A 1Y3XA 3RXJA 1C9TA 1C1TA 1INCA 3Q00A 1YPHC 1V2TT 2NU2E 3NKKA 1FDPA 1A61H 2ZTYA 1L4DA 4Y7BA 1A4WH 1AQ7A 2GT8A 3OSYA 1O33A 2Z3DA 1QRXA 5AHGH 4Z1MD 1O36A 4ISOA 4WMDA 3KL6A 1GDNA 2HPPH 3BEIB 3L33A 2B9LA 1GJBB 2F3CE 3TH4H 5C1XA 2EA3A 1XUFA 1ZHPA 2D2DA 1KY9A 1GI0A 2LELA 4ZKSU 5EXNA 3SJIA 4NWLA 3SZEA 4SGBE 2A5AA 2BZAA 1P2QA 1ZTLA 1GWAA 4A5TS 2SGFE 5G4BA 1T4UH 2QF3A 2PSXA 2F83A 1GHVH 3QWCH 1SGFA 1GVKB 4AYYB 4RT1A 4NWKA 2CHAB 4TPIZ 3SNDA 2XBXA 2GVFA 2ZPRA 3NUMA 4CRCA 1DWDH 1BBRE 2DE8A 1CA0B 1AE8H 1X7AC 3A83A 3DCLA 3SNCA 1FPHH 4DG4A 1EASA 1TOCB 4NIWA 3MU0A 2WSSD 1IQJA 5HYOA 3FAOA 2FZZA 4I86A 2PTCE 3SORA 3ZV9A 1HAVB 2CGAA 2FOAA 3KIDU 1F92A 1SLUB 1UTMA 1GCTC 6GCHG 1HCGA 1EPTA 2JETB 2FOHA 1SFQB 3HATH 4Y0YE 2VVUA 1S6HA 3U28C 1AFEH 1WV7H 1UO6A 5DJ7A 1BTYA 4FUBA 5E0JA 2FOCA 3BTDE 4ZHMU 3T25A 1V2QT 5E8EH 1UHBA 9LPRA 1LPZB 2O8UA 1FV9A 1W13U 1SFIA 1MKWH 1RTLA 4HZHA 3QLPH 2QAAA 8LPRA 1RTFB 2BD2A 4K8BA 5K0HA 2UWOA 2D8WA 3U9AH 1EJAA 3N99A 4FETA 4FVDA 1D9IA 5C94A 2A7CA 2V3OH 2KR7A 4Y8YA 2J97A 3SGQE 4WVPE 2GJGA 5C0TA 2UWLA 1UVUH 2RCEA 3TH3H 4YT7H 4NA7A 1A0LA 4ABBA 5TCCA 1UCYE 4YT6H 1O3DA 4VGCC 4R0IA 4X8UH 3JZ1B 3D65E 2J38A 3UOUA 5EQRA 4B2CA 1GHWH 1NPMA 3PO1B 1UVSH 1TPAE 1O2IA 3LGVA 4ABDA 1KYNA 1G3BA 1JBUH 1RS0A 2J95A 1U6QA 3NCLA 4M9FA
chains in the Genus database with same CATH topology
2A45B 2PUQH 2ZPQA 1M9UA 1S81A 2AIQA 2G52A 3MOCA 3U8OH 1OSSA 1FIZA 1NRSH 3RDZA 2WPMS 3E8LA 3U98H 1J17T 4K1TA 2PKSC 1FMGA 4FXGH 3TJNA 2ZI2H 3KGPA 3KHVA 2ILNA 1B5GH 1GMDF 4OS1A 2AGEX 1E36B 8GCHF 2JH5D 1XUGA 2FTLE 2P94A 3NZIA 2VIVA 1LCYA 3M5MA 1O2MA 4JK6A 2PSYA 1P2MA 2H9HA 2VNTA 1PJPA 4MPVA 1KTTB 2ZU5A 4NGAH 5GWZA 3UNRA 3E0PB 1O5DH 1CGHA 1XXDA 4YOJA 3F9EA 3SNBA 3HKIB 3LT3A 4GUXA 3BG8A 3LGWA 1Z7KA 4MLFB 1OYTH 1AUTC 2O8MA 4MPUA 4SGAE 3R0FA 1TMTH 5DG6A 1C2JA 3RXEA 2ZP0H 1CGJE 4MDSA 5DP4A 2BQ7B 1CBWC 1DY9A 1QRZA 2ZGBH 1C5XB 1HNEE 1HJAC 2VH0A 3RMLH 1C5NH 1DOJA 1O31A 2NU3E 1TB6H 4ABFA 1AWFH 1TAWA 1BHXF 2TGDA 3ENSB 3MHWU 1JOUB 2R2MB 2BLWA 2H9TH 1O5BB 4WH6A 2FPZA 1KXEA 2WPIS 5L6NH 1VZQH 1BIOA 1DICA 4R8TB 4D9RA 1E37B 1G3DA 2BDBA 1DT2A 3RXLA 1GHAG 3MWIU 4MVNA 4INKA 1NFUA 2SNVA 3DFLA 1KSNA 3QTVH 5GIBA 5FX5A 1EB2A 1AE5A 2QCYA 3LPRA 4CRFA 3M36A 1FZZA 2OQ5A 5I46H 3ZVFA 5PTPA 1C2IA 1WTGH 1KXDA 1VITF 2FYQA 2BD9A 1UTJA 1GJCB 1GI6A 3SI4H 1BA8B 2HGTH 3SUEA 1HFDA 2Y7ZA 1HB0B 1P04A 1P10A 2G5NA 5HM9A 3TGKE 1ETRH 5T6GA 4GHQA 1SLVB 2O8TA 5A0BA 3TGIE 1O3CA 3M3VA 1MKWK 5GPIB 2J94A 4DJZB 4DY7B 4BXSA 6LPRA 1FXYA 1A7SA 1RTKA 1GBJA 1MCVA 3QO6A 3M35A 2HRVA 2H2ZA 3MNXA 1CQQA 1VCWA 2QIQA 3OX7U 1V2NT 3HK3B 5L2ZH 2AMQA 2ASUB 2XW9A 5T3HA 3PYHA 2VVVA 1EQ9A 1MBMA 3RMNH 3TH2H 2BVSH 1P02A 1HAYB 5DP5A 1EZQA 1SBWA 3N7OA 2RA0A 2G8TA 3QTOH 4Q7ZA 4XSKU 3RC4A 1C1OA 1K1PA 4RKOB 2ZDMA 1OWHA 4XDEA 3ZYEA 1AFQC 1H1BA 1ZHMA 2HLCA 2P8OB 2FEQH 4K2YA 1CHOF 1GBEA 1CT4E 3DT0H 3ZVGA 1DXWA 4INLA 1GJ6A 3QDZB 1GJDB 1AB9B 3S7KB 1EAIA 4JZIA 3T2NA 2ZDAH 1Y5BT 2FOBA 4B74A 1UTPA 7KMEH 1AMHA 4UEHH 1GMCF 4CHAC 1JRSA 3UR9A 2B8OH 1C4Y2 1NESE 2Z9LA 3LKWA 3BTME 3UWIA 5BPEA 1TGCA 1HV7A 4I8GA 5JB9S 1A0HB 1C5ZB 2R2WU 3PTBA 3RXCA 4IGDA 5H4IB 1QL7A 1A2CH 3SU0A 2G55A 4MNXA 1F0SA 1C5RA 3P8NA 3RXRA 4NSVA 5DP8A 4NA8A 2OINA 2I6QA 1KXFA 1W12U 2BY7X 1ZGIA 3VGCC 4AFZA 2O9QA 3EA7A 4XBBA 6CHAB 4Y7AA 2BX3A 2FESH 2VH6A 1SGPE 3GY7A 3UUZA 4K1EA 2AFQB 3M5NA 1OXGA 3PMBB 1BTWA 1NRQH 2J9NA 3I29A 1KXAA 2ZHEH 4FUEA 4K1SA 1AKSA 1ELFA 5A0AE 3K6ZA 4FUCA 3KQCA 1QJ6B 1HIAB 1K1OA 4ISLA 1WBGB 1BQYA 2PGQB 1L0ZA 2PWXA 2FWWA 3TNTA 2ANWA 1TRYA 2D1JA 1O3AA 3A8CA 1C1SA 3MO9A 4QT8C 5C2ZA 1C2LA 4YTAA 3SI3H 1TE0A 2FTMA 3RU4T 2Z7FE 1K28D 3A7TA 1GBHA 1BTPA 2VWLA 1NN6A 2QA9E 2ZPSA 4I31A 1UMAH 3LGIA 5C3NA 4K5ZA 2F91A 1BMNH 2ZU3A 5DO4H 3LOXA 2ZFTA 3D23A 3L6PA 4Y10E 2W5EA 1IQEA 1QB9A 1VR1H 3CP7A 1D3TB 1DWCH 1GHBG 3BTGE 3UNQA 3P92A 1K21H 2BDHA 3I77A 1TX7A 2QY0B 1AVXA 2BLOA 4X2YA 4AFQA 5GXPA 1E35B 2F9PA 3UR6A 3ZV8A 4YLQH 3B8JA 4UDWH 2Y5FA 4X8VH 3RM2H 1H4WA 1HUTH 2UUYA 2H9EH 3MYWA 1GBCA 2VJ1A 1UCYK 3A89A 3BG4C 2V35A 3V12A 1UTOA 4ABAA 3MU4A 3TNSA 1C1NA 3A8BA 3RC5A 2JETC 2ODYB 1BMAA 4BAQB 1TRNA 1LHDH 4TY6A 4YLUA 4DIIH 1ZRKA 2F9VA 2Y7XA 1GJ4H 2BTCE 4I32A 4Y11E 8GCHG 4HI3A 4BANB 1Z8JB 2ULLA 2VWMA 2TRMA 1UTKA 1C5PA 1MMJN 1BDAA 3Q3XA 3ATIA 1A1RA 1IQFA 1O3EA 1ID5H 4MQAA 3KN2A 1W10U 1IQNA 4X8TH 4X6PA 3E90B 3A7XA 1V2RT 1OYQA 3UQOA 3A8AA 3MO6A 4FUJA 1C1MA 1PQAA 2XWAA 1PQ7A 2YNBA 4YO9A 1ABJH 3GICB 1E34B 2GX4A 2B0FA 2HNTC 5JBBS 3PO1C 2BY6X 4AB8A 4ZKRU 2AS9A 3GDUA 4ABEA 3TU7H 1CVWH 1ETTH 1TPSA 1QJ1B 1P3CA 1BRUP 1THPB 4FU7A 1H8IH 1DDJA 2VIDA 5EOKA 1SGTA 4IMQA 1GHAF 1GMHF 1ZPBA 1W0YH 5HMAA 1GDQA 3GCNA 4NA9H 3FP7E 4BTUB 2XWBI 4E06H 2FX4A 3KNXA 1MU8B 2HNTF 1BHXB 3RXTA 1O3HA 3HK6B 3LC3A 4B1TA 3IWMA 1JIRA 3PWCA 2VWNA 4AGKA 1RGQA 3UNSA 4J2YB 3ESTA 1A5GH 1TNIA 2P93A 1IQHA 3BTEE 3A8DA 3GOVB 1IAUA 1OS8A 4B71A 3A80A 2G51A 1XX9A 4MNYA 1ZRBA 4DW2U 1BTZA 3GY6A 1ESTA 2GMTC 3SU5A 4GSOA 5TCAA 4DGJA 1CT0E 1LO6A 4AFUA 2VIWA 3BSQA 1BTUA 4O3UA 2V6NA 3SW2B 2BD8A 2BMGB 3ODDA 1WQSA 2ANKH 2BDIA 1ZPCA 1SGIB 3E0NB 4BTTB 2ZTXA 3T5FH 2WUBA 1TGBA 4GAWA 1GBDA 2OUAA 5LPFA 2A32A 1NC6A 1YPMH 1MAXA 1HAIH 4A1VA 1ZMNA 3FP6E 3O8CA 1YC0A 1RJXB 3SV2H 1GG6C 4TWWA 5T6DA 2A2XH 1PYTD 3HKJB 2OBOA 2ANMH 3RXUA 2PUXB 2SGPE 2BHGA 1PQ8A 2UUFB 3BV9B 4KKDA 4YOGA 4AYVB 4Y0ZE 3KQDA 3L3TA 3ZZ7A 2V0BA 3Q3KA 1CHGA 1XUJA 2XBWA 4UONA 1JIMA 1LMWB 2F9BH 3T29A 1UK2A 5A8YA 1VCQA 1O3BA 2WUCA 1EAXA 3A87A 3BN9A 3E3TA 1HAHH 1SOZA 2QF0A 1ANDA 2Z3EA 4A92A 5DP7A 1WCZA 4IC5A 1C1RA 4B2AA 2XNIA 4JK5A 4D7GA 2P3UB 5HXFA 1C2DA 1KIGH 1TPOA 2DUCA 2ZDVH 9ESTA 2BD5A 3UFAA 3ATLA 4CRAA 1GBAA 2GDEH 3AVZA 1FY3A 1HAVA 1P3EA 4KP0A 2WPKS 4CBOA 5L30H 4ZROA 2FO9A 4OS6A 3A7YA 1O0DH 4IN2A 2FLBH 4Q7YA 3A86A 1AO5A 2P3FH 2FS8A 1LVMA 2WV4A 1W8BH 1C2HA 2A5IA 3TPIZ 1O2LA 3K9XB 1C5QA 1DS2E 1LKAA 1T32A 3MNBA 1IHTH 2QGRA 1TGTA 1P57B 1EZUC 1F0UA 4OS2A 1Q2WA 2QXHA 4IW4E 3RXDA 3SU6A 3SQEE 1EKBB 1GJ8B 4WWYA 5DP3A 3O8RA 4K60A 1JRTA 1K1IA 1SL3A 1O2UA 2XXLA 3CS0A 1PPHE 4JZFH 4JYUH 2QXGA 4MNWA 5DGJA 2G4UA 2AMDA 1ZJKA 2PW8H 2CJIA 3RP2A 3F9FA 2F9UA 1CO7E 1P09A 3ZZ5A 2J92A 1P12E 1NT1A 3SUDA 1O32A 3SJ9A 5JBTA 2VWOA 2C8XB 2H6MA 2JH6D 4CH2B 1IQGA 5FBIA 2ZC9H 3PV4A 3VPKA 5F03A 2VIQA 1MAYA 2GT7A 2SFAA 1GI2A 1BBRK 2Y80A 5F8XA 1O2ZA 1S0RA 1TX6A 3DUXH 1MZAA 1MBQA 1AVWA 1MKXK 3GYMA 1LKBA 2UWPA 1F0RA 4INHA 5TJXA 2IJOB 1ZR0A 5DK1A 2FLRH 1O2QA 1FI8A 1G2MA 4LZ4B 1BB0B 1SG8B 4OGXA 4XBCA 1P0SH 3RU4E 4UD9H 1EPTB 3AASA 1QL8A 4Y71A 1A5HA 5HGGA 3RXVA 1XUKA 3BF6H 3A7VA 4NIXA 1ORFA 3UIRA 5J4QA 3A7WA 4UFEH 1EXFA 1GMDG 1MQ6A 1SHYA 1OWIA 3FVFB 1O35A 1J9CH 4UFDH 4BAMB 1CE5A 4CR9A 1Z6JH 4UFFH 1ZPZA 1DM4B 3TJUA 1TNLA 1ELBA 1KTSB 2ZGCA 3P8GA 2HPQH 1ABIH 2ZDKA 2BLQA 3M5OA 1W7GH 4OS4A 4PROA 2BVRH 1LHEH 1XUHA 3M37A 4GCHF 5DP6A 3TK5A 3U69H 2FX6A 1GVZA 1GL1A 2ZCLP 3A81A 3V3MA 2IOTA 3IG6B 4DVAU 4O9VA 1DY8A 1SQTA 4XBDA 5FCRA 4A1TA 1HPGA 1ZTKA 1DX5M 3RM0H 1EJNA 1GMCG 4X8SH 3S7HB 1GL0E 2GD4B 3SU3A 1TNHA 1SLXB 2GCHG 1AWHB 3C27B 2BYAX 2P3TB 3MU5A 1AY6H 1UK4A 2NU4E 3TLOA 2BQWB 1HAZB 1QIXB 2OTVA 7GCHF 2A1DB 2TGTA 4Q80A 1HRTH 2ZO3H 1XM1A 3HGNA 4IN1A 2FI3E 1EZXC 3W94A 4ABHA 4FUDA 4ZHAA 1K1JA 5BRRE 5A09A 1WTHD 1H8DH 3QN7A 2ZTZA 3ZZ4A 1O38A 3H5CB 4I33A 3ELAH 4AORA 2Q6FA 2BDCA 1FAXA 1P06A 1YPHE 2OC7A 1ANEA 1A3BH 1AIXH 1HXEH 1SGFG 1CA0C 3D62A 2QV1A 1SLWB 3F9GA 3O8BA 1QQ4A 1A46H 1N6YA 3K65B 1BZXE 2KAIA 1FJSA 4RKJB 5EPYA 1AVGH 1MD8A 2NU1E 4AN7A 4AGJA 5LPRA 1O5GH 1O2JA 1WQVH 1P05A 1GCTB 1AU8A 4E05H 3H7OA 4Y76A 2FOEA 2Q1JA 1C5YB 2RG3A 1VGCB 2Z9GA 1L4ZA 1MCTA 1V2UT 1C1WH 2H1UA 1C1QA 2R0LA 1FIWA 2FP7B 1OX1A 1K22H 1MQ5A 1OWKA 1AUJA 1YPKH 4HFPB 3A84A 4BOHA 3GDVA 3BG4B 1E38B 2A31A 2WPLS 2AYWA 3OY6U 3SHCH 1GPZA 2NWNA 3S69A 1IQIA 2BVXH 1F5RA 2ZEBA 3SU1A 1AZ8A 1V3XA 2FM2A 3SJKA 5T6FA 1YLDA 4KTUA 1G30B 3NXPA 1V2VT 1O5CB 2FS9A 3SV6A 2DE9A 2EI8A 2ALPA 1O3JA 3T26A 3BTHE 5F8ZA 2FYRA 2SGDE 3A85A 2WYJA 1TGSZ 5C1UA 1VITG 1AKSB 2XBYA 3MO3A 1GJAB 1Y3WA 3VFEA 4D8NA 1CSOE 1T7CA 4DURA 3ZZ6A 2ZHQH 1NFWA 1Y3VA 2ZQ2A 4X6MA 1C5SA 2G4TA 1EATA 4HTCH 2VB0A 4UE7H 5FAHA 1W11U 2BM2A 1BUIA 1TONA 2UUJB 3RXBA 1ELDE 1FAKH 4THNH 3F9HA 4X1NU 1D6RA 1G32B 1HJ8A 5EQQA 2BX4A 1ZZZA 3Q77A 3DA9B 1ZSJA 1AHTH 3MTYA 2PGBB 2ZWLH 3MH5A 3MH6A 4WH8A 1GBKA 4AOQA 1QNJA 1GI8B 3ITIA 2R0KA 1VCPA 4ISIH 5GCHF 3AAUA 1P2JA 4IS5A 1G36A 2A4QA 3BTQE 1BCUH 2QXIA 3AW0A 3STIA 3P17H 3SUFA 3SO3A 3Q3YA 1S82A 1DITH 2AGIX 2H5DA 3P8OA 3V7TA 1ZHRA 1CBWB 1QBVH 3GY5A 3K6YA 5C5NA 2BD4A 1O2OA 1SGCA 5E0GA 2A2QH 2GDDA 4WXVA 2JKHA 2Z9KA 3QZQA 1TPPA 3RXAA 1O30A 1SGYE 3F6UH 4Q7XA 1SVPA 1P01A 1TGNA 3SGBE 1SI5H 3GY3A 4U01A 2PFEA 1TX8A 2VINA 4FUIA 4WXIA 1DSUA 1F5KU 1YPJH 1ZYOA 1SHHB 1PPCE 2A4RA 2BD3A 2TGAA 1GI5A 2O8WA 1W3CA 1ANCA 4X2VA 3P95A 1P03A 1TQ7B 5EW2H 1HGTH 1QL9A 1PFXC 4RN6A 1SGNE 5FPYA 1TNGA 1KLIH 3TVJB 3VGCB 4E7RG 4YOIA 1V2WT 3RU4D 4U32A 1DANH 3BEFB 2B7DH 1SC8U 1ZGVA 3E6PH 4Y8ZA 6ESTA 2W3KA 5AF9H 5ESTE 3SV8A 3U8TH 1QA0A 1O3PB 4D76A 1UJ1A 3PLKA 2Y6TA 1RIWC 4FU8A 3EQ0H 3BTFE 1WYKA 1SPJA 2ZIQH 5F8TA 2ZECA 3M5LA 4I8LA 1ANBA 1TNKA 3ZZ3A 4ZUHA 3ZVEA 3GY2A 1JWTA 4XOJA 1MD7A 1B0EA 2ZFQH 1NFXA 3SV9A 3GY8A 1MTWA 1WAYB 5AVDA 1HIAA 1DSTA 1YKTA 2Z3CA 5IYTA 3U8RH 2GKVE 1NU7B 2FI5E 5CMXH 2M5TA 1FQ3A 2ZDNA 3D49H 1W14U 1DUAA 1MTSA 3KQEA 3RXFA