3PTKA

The crystal structure of rice (oryza sativa l.) os4bglu12
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
478
structure length
478
Chain Sequence
PVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of rice (Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-glucosidase with significant thioglucohydrolase activity
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
molecule keywords Beta-glucosidase Os4BGlu12
total genus 193
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ptkA00
4F79A 2ZWZA 1WZAA 2X2YA 2D24A 5A6JA 3WH9A 4QLKA 4B9YA 2BVTA 3MV01 1BYCA 3KZSA 4WK9A 1KBBA 1IT0A 1FH7A 1DHKA 4P7RA 3LMYA 2C0HA 1BG4A 1BVNP 3RMEA 2VZSA 2ZX9A 1CNVA 2A3HA 4GZJA 1UKPA 4RE3A 3AIEA 1O6IA 1H4PA 4D6JA 4KMQA 3A4XA 4UNIA 1VFFA 2D0FA 2VCBA 3RO8A 3L4UA 3VUPA 3WDPP 4W5ZA 3BMVA 3MO4A 1UQYA 1PX3A 2BXZA 3WMSA 1M7XA 1HX0A 1V0LA 1W3JA 1GVIA 3WNOA 3OA5A 2WWDA 4H2CA 2GJXA 1H2JA 3WDQA 4MTVA 3HU7A 1CXHA 3BH4A 4D72A 3LPOA 1E5NA 1XH2A 2YL5A 2CBUA 4C7GA 4XX6A 1X6NA 1WDSA 2CKSA 1YHTA 1ITCA 4M29A 4F66A 4ML4A 2JIEA 2BY3A 2OSYA 3W24A 3B8SA 3APGA 3OGRA 1NQ6A 3EDJA 2XTKA 4IM4A 4CCEA 3GNPA 1V0NA 1J12A 4BZYA 2YL6A 1MW3A 3ZT7A 3KWXA 1PZ2A 2ZUWA 4P8VA 2BVDA 3PBGA 4XV0A 3AHZA 4GPNA 1VRXA 1EQCA 4GKLA 1ZBVA 3ARTA 4ATLA 3NYDA 4AZCA 5HPCA 4H8HA 1AMYA 1EHAA 5LYRA 2DSVA 2DT3A 4WKAA 1EOKA 1JFXA 3MUAA 4PTVA 3CBWA 4FLSA 2GSJA 4HP5A 5FCZA 1UOKA 3K1DA 3TTQA 4AY1A 4YHEA 1HJVA 4M1RA 4U5KA 1V3LA 4AIEA 2ZX8A 4A4AA 1PZ3A 4DM1A 1E6QM 1BHGA 1R85A 3SUUA 3CUHA 3PZVA 2E9LA 3VO0A 1G1YA 5A8QA 3VGHA 4AISA 1EO7A 2W67A 3VIGA 1OINA 2WSKA 1E1EA 4Q22A 2VCAA 3POCA 4RE2A 3WQ6A 1GZJA 4PMZA 1W1PA 1MFUA 1B1YA 2WCGA 2GUYA 3S2CA 2WM0A 3CLWA 5ECUA 4UOJA 1Q6GA 4PMDA 4ATDA 1CXLA 1TE1A 1QBBA 4HMEA 4QFUA 3ZT6A 3UETA 4OUEA 3PZMA 2J8GA 5A69A 7CGTA 4KRTA 3W4RA 2ZX6A 1K6AA 5BWFA 1TCMA 1NH6A 1M04A 3T2OA 3VKKA 1LLOA 3AIRA 1E40A 4NRSA 4MJ4A 1KQZA 1UQZA 3SEPA 1U2YA 2CBIA 3I3BA 2ZOXA 3DHPA 1J0ZA 1TA3A 5DEZA 3BLKA 4D6HA 3E1F1 4H8UA 2WCSA 2MANA 1BG9A 1E9LA 2G4FA 3OLDA 2JALA 3SIMA 2Z1SA 2OWXA 3VDCA 4HOZA 5ABHA 1IZJA 2YDSA 1W32A 2CHOA 2Y5EA 4B3LA 1JD7A 1I1XA 2D3LA 2YA1A 2YBUA 4UQEA 2E8YA 5A8OA 3G6MA 3QGVA 1C3FA 4H8VA 4UFIA 4U31A 4LXFA 3VGBA 5HBFA 1LWHA 3GH7A 3VD3A 2WSPA 1GOKA 3AS0A 1D7FA 3FHAA 5A6BD 3GTNA 5CZKA 1P6WA 1V0KA 3CHEA 2YIHA 1HJSA 3WD3A 5I6SA 1E43A 2ZUSA 2AMGA 2X8RA 1UWIA 2VX5A 2VQTA 2WK2A 3LPGA 3AYSA 2Q8XA 1UR2A 3WD2A 3AMGA 3ARPA 3CH9A 1W1TA 4W8BA 3ZQ9A 2Z1KA 1QI0A 3EBVA 2BY2A 3B9AA 3WQ5A 3AMDA 1JG9A 4EAMA 4PMVA 5E0FA 3WL0A 3AQUA 4PMUA 3EDDA 3CZGA 2G8ZA 4OKDA 1MW1A 5A8MA 1XSIA 4JKMA 3VIIA 3WSUA 3L4WA 1JYXA 1H0GA 1J0JA 3WNKA 3FN9A 3MUIA 1B31A 2DSKA 2VL4A 3QHNA 4LYRA 4PCSA 1GOIA 3GXIA 1BF2A 2O9RA 5FL0A 4UFMA 3CHFA 1JNDA 5CGTA 4X9YA 2CXGA 3DYOA 1C91A 1JZ8A 1XGZA 5A6AA 3KL3A 3WNNA 7A3HA 1E1FA 3F5LA 2UY2A 2DT0A 1AQHA 1FOBA 4PUEA 3NDYA 3IAPA 2ZX7A 4R5EA 4JFWA 3WH8A 4AZIA 4U33A 2WBKA 2XM2A 3M7SA 4LX4A 1GOMA 4EANA 2J8FA 1B2YA 2CBVA 3VD4A 5EB8A 2BY1A 2EO7A 4TX8A 5DMYA 3WEOA 2JEQA 1V3IA 2YKKA 4QLLA 4AMCA 1C93A 2J7HA 2XFRA 4P7NA 2GJPA 2XWEA 4BQ3A 2OWCA 2RGMA 3WNMA 5E6ZA 2WHMA 3G6LA 2BS9A 3WDRA 2V3FA 1WO2A 1WP6A 2ZXBA 1GNXA 3BCFA 2QF8A 2ZXDA 3FHQA 1HL8A 5DT5A 3SCWA 4FLRA 2X0YA 3WF0A 4UQAA 1GHSA 4J3WA 3VGGA 1QBAA 1RP9A 4CCCA 3SCSA 1QVBA 3DECA 3DYPA 3NCOA 2CESA 3RM4A 1WE5A 2EJ1A 4FF5A 1W1YA 3BC9A 1XSJA 4ACZA 4AD3A 3PTQA 2WHJA 4OOZA 1EQPA 4PSRA 5EFDA 3ZM8A 4M8UA 1BTCA 1B30A 3L4ZA 1JGIA 1CPUA 3WH6A 1UWQA 2ZXQA 1K9DA 1UUQA 5A8PA 2JEPA 1C92A 2BHUA 3AIWA 4OBSA 3NSXA 3PZQA 4AZ7A 4CCDA 3WFZA 5I23A 2J78A 4GIAA 3WF2A 1NOFA 2OSWA 3GBDA 3AZRA 3N9KA 4CD6A 5IHRA 4PCTA 1E4MM 1H3GA 4QAWA 1VEMA 4M81A 5BXTA 3ZO9A 3OGSA 1NARA 3POHA 3RJXA 3WQ8A 4ZENA 1F4AA 1BSIA 3AMKA 1V3JA 1MW2A 4IPNB 3CUFA 1E6XM 2YDQA 1VEPA 2DQXA 2VVSA 3PZOA 1GQIA 2CITA 1DWAM 3QHOA 1L8NA 2J74A 1C8QA 1OT2A 3A4WA 1JDAA 1KR0A 1FH8A 4CU8A 3WKZA 3AMCA 3WMBA 4AZCB 2PBGA 3FY1A 4AZ5A 3WMCA 1LL6A 3WENA 1OWQA 4PMOA 1E55A 1WPCA 4W86A 4HOWA 1ZS2A 4H04A 5HDRA 1H11A 3U7BA 3VINA 4DWSD 4V2XA 1E6ZA 2ZUNA 9CGTA 5M17A 1M03A 1UR4A 1F4HA 2DPEA 3VOCA 4OJYA 1Z32X 2ZIDA 4AC1X 1CBGA 1G9HA 4UOQA 1UKTA 1JAKA 3CGTA 4CU6A 1FFRA 1J0IA 3CMJA 2BVYA 3W38A 3UG3A 4JZ5A 1E56A 3WY1A 3T0BA 4XUYA 5E9AA 3CMGA 1Q4NX 4DUWA 1US3A 1KBKA 1B90A 2WZEA 4GXPA 4X0NA 2JIWA 2VX4A 4W85A 4JHZA 5ABGA 3ZR5A 2QLYA 3VIFA 4MB5A 3AZTA 3N11A 1ZU8A 4W7WA 5GQBA 2J79A 2VZVA 4F8XA 1HJXA 4PEEA 2YOCA 4W8AA 3GXFA 3SCNA 3BAYA 3GH4A 2DT1A 3ARUA 4W88A 1MQQA 1H41A 4D6EA 1ZBKA 3UERA 3W53A 1ISXA 2PI6A 1ESWA 2WLYA 2WVSA 3THDA 1FP8A 1J11A 1TR1A 1XHGA 3T0DA 5BRPA 4W93A 1TA3B 2XM1A 4PMXA 4TX6A 3VNYA 2X1IA 4LYPA 4UQ9A 1MVYA 3AMLA 2EQDA 4JFUA 2J4GA 1QHPA 4EK7A 1ZB5A 4TOQA 5BXSA 1CZ1A 3A6OA 4QLJA 1JD9A 1VIWA 2VRQA 1QW9A 4CKQA 1ZBWA 4AZGA 2D23A 5FKYA 3L2MA 1QOXA 1CGUA 1WDRA 4FLOA 2JE8A 4E8CA 3N1AA 1HJUA 2W63A 1VBRA 1G0CA 1BPLB 1VBUA 3ZIZA 1OBAA 1B0IA 2J7EA 2YL9A 4CVUA 2PWGA 1V6WA 2VCCA 4LPCA 1NOWA 4W7UA 4LGXA 3AHTA 2CEQA 1C7TA 1E71M 1QI5A 1MFVA 4ATWA 3A47A 2WVTA 3VPLA 3SUTA 5LA1A 1V6VA 1QI3A 3VDHA 5A6KA 4GI6A 4ZFMA 4B15A 2J7GA 1JAEA 2BY0A 5I78A 3ARVA 1VJZA 4J3SA 1E0VA 5GPRA 1V3MA 3CTTA 2CYGA 2WYSA 1K9FA 5JIPA 3VIMA 3WD0A 1R7AA 2VTFA 3VIHA 3CO4A 3GYCA 5I2UA 3PTMA 2D1ZA 1WB0A 3AHVA 4U2YA 2J62A 2V3EA 4HMDA 1M53A 2WWCA 3GNOA 1JFHA 1WKYA 3UG5A 1V6YA 3SCTA 2OLHA 2WC7A 3K46A 2EBNA 4KGJA 1E15A 3SUVA 3OBAA 5JIWA 1R86A 5LA2A 3WF1A 2G41A 4W89A 2D22A 3BAXA 2Y8VA 1MQPA 4UQBA 5IFTA 2J47A 3CIVA 5E70A 3CPUA 4H7VA 2Y24A 4YN5A 2Y4SA 3T08A 4V28A 5M03A 1XD1A 1OIMA 2E9MA 4D71A 1UKOA 1NWTA 5BROA 1DWJM 1W9XA 4RL3A 3TTOA 1CXFA 2XSBA 1HXJA 1KXQA 3DYMA 3MUZ1 1KGUA 2ESCA 1VF8A 3N12A 3TONA 1QPKA 4CD5A 1WDPA 3OLEA 2ZXAA 2OYMA 3WUGA 1DP0A 4MJ2A 1EDTA 1YQ2A 2J75A 2WHLA 3ARXA 4MB1A 3VDBA 1US2A 1BYAA 4M82A 4NZCA 1H1NA 1V03A 1CGWA 3QOMA 1QI4A 4JL2A 3VM7A 4PBGA 1Q6DA 1R7OA 1E4IA 3K8MA 4AZHA 1M01A 5EMYA 1GOWA 4C7FA 4HZ6A 1GQKA 4U5IA 7TAAA 1NM9A 3ZSSA 1I75A 3AIBA 4UFLA 1FHLA 3IANA 3AIQA 4R27A 4OZOA 1JZ2A 3VGEA 3GZAA 3W29A 1XH0A 2NT1A 5CXPA 1UKSA 2HISA 2WPGA 1LL7A 2XSAA 3THCA 2WVUA 1ZJAA 1QNRA 3WN6A 5A8NA 2AAAA 2G3NA 2XIBA 3AHXA 2FDMA 4BA0A 1GJUA 2FHFA 2EPKX 1NWSA 4BQ5A 3U7VA 3VVGA 3W6LA 1B3YA 4C7DA 1GCYA 2C8NA 2YJQA 4AWEA 3WDJA 2E40A 3VIJA 2WKLA 3BSGA 2X05A 4HOXA 4JKLA 1B3VA 5KEZA 1VFMA 5LA0A 3U5YA 2W61A 3LPFA 1E6RA 1N82A 1B9ZA 2J7BA 3VDAA 1UZ4A 5BXRA 4B9ZA 3HN3A 2YA2A 1KR1A 1V3HA 2WVVB 1LJYA 5FL1A 1HVQA 5CLTA 4HA1A 3OLIA 4PRWA 4WSKA 1PPIA 1CENA 3TOPA 5CG0A 1JF6A 3L2LA 2E9BA 1XD0A 4JCMA 2O9TA 5A2AA 4AZBA 1AVAA 1OD8A 3VGDA 1UH2A 3PZNA 1W91A 1E4LA 1KXVA 2PWFA 2WHKA 3AXXA 4JFSA 4AIUA 1EOMA 2G3IA 5JBDA 2X09A 3II1A 3K8KA 2CIPA 3WF3A 2V5DA 3AICA 1A3HA 1B3XA 1W2PA 5A3HA 2A3CA 1SR0A 4FLQA 2DT2A 3VM5A 4HZ7A 4UCFA 2A3AA 1EDQA 4XZWA 1PIFA 4AD1A 3AI0A 1ISYA 1CECA 3AOFA 3TP4A 4DWSB 1EGZA 4MPKA 3RJYA 3L4VA 3U57A 5EFFA 2IXVA 4MAZA 3SCVA 1SFSA 4KRUA 3N17A 1E0XA 3S6TA 5IDIA 4GZEA 1LF1A 5FOOA 3CZKA 3D3AA 3BAKA 5ABFB 4CN6A 2VR5A 4JAWA 3SUSA 3WEZA 2XVGA 5M3WA 1XCXA 3B9DA 1JI2A 2YDRA 3IJ7A 1E3ZA 4ZXLA 3RCNA 1HNYA 3A3HA 3BAWA 2WLZA 1UA7A 2PC8A 2BNJA 5CPTA 4N0RA 1MWOA 1VEOA 1XH1A 3IJ9A 2VX6A 5BYWA 1J10A 2XWDA 1UD4A 4W87A 1AQMA 1H09A 1OD0A 3ZJKA 3VX0A 1C8XA 1L0PA 1JF5A 4IUGA 1HVXA 1HKIA 3W26A 3CUGA 3O6AA 1UHVA 5E0CA 3RIKA 1UD8A 4CD7A 1TFVA 2VX7A 3PTKA 5FD0A 1DWHM 4E2OA 2CCRA 1JZ4A 2WC4A 4Z2LA 3PZIA 4K68A 1BFNA 4J3VA 1UH4A 2DGAA 5ABEA 1VENA 3DHUA 1JYVA 1CGVA 4U2ZA 1NOUA 4HPGA 4OBRA 2D0GA 4AD5A 5D9OA 2OYKA 1BYBA 4DWSC 4BCEA 3GDBA 4WSJA 2WKGA 4MNMA 1UWUA 4D6CA 1V02E 4PTXA 4CU7A 1KXHA 2XUCA 1D2KA 1E0WA 1UD2A 2ZUMA 2DIEA 2WNWA 4AD0A 4TTGA 2EPMX 8A3HA 3WD1A 4U3AA 4M24A 3W25A 3W37A 3SUWA 1KWGA 3L4XA 2VZTA 3MKKA 3GH5A 1SYTA 5CJ5A 4CUCA 5C8BB 3M07A 5I79A 3BAJA 3WQ4A 1ISWA 1KWKA 2V5CA 4XZBA 1QHZA 1EDGA 1ISVA 2PB1A 4TVCA 2GJRA 2E3ZA 3WFLA 1DWFM 3RM8A 4N42A 2FHBA 3VMNA 1NWUA 5D9PA 1EO5A 4S3JA 3CHCA 2IUZA 1W9DM 1W3HA 3QHMA 4JIEA 3OIHA 2G3JA 2VVNA 3MMUA 4X0VA 2VR4A 3PZTA 1HJWA 4PTMA 5D4YA 1G01A 4ACZB 1JDDA 5ABFA 2HVMA 3CZEA 1JIBA 2GFTA 2J7FA 4MB4A 1XYZA 1NWRA 2QPUA 1UWTA 2D0HA 3AJ7A 4GQRA 1JYWA 3N18A 1E5JA 3HMCA 1JZ6A 2QMKA 1JYNA 2EEXA 3LPPA 5AC5A 5JBFA 5HNNA 4D6GA 1JXJA 3OZOA 5A6LA 1GORA 2ZUUA 2F2HA 4B3KA 1V08A 4GO9A 1BQCA 2FGZA 5I3DA 4ZE4A 4P8UA 2VRJA 3EDFA 4J7RA 3J7HA 4U3CA 1OGBA 3SCRA 4Z2JA 3MMWA 3SCUA 2WAGA 4UR9A 1ZBCA 4D6DA 1FA2A 4L4PA 2W91A 3WQWA 1LG1A 4ZE5A 1G5AA 1AQ0A 2VT0A 1UWSA 2PF0A 4HU0A 1NP2A 5HOSA 2CHNA 3CZLA 1QW8A 6TAAA 3WUEA 2XYLA 5BXPA 1IV8A 3EDEA 3MUY1 2CERA 1QNQA 1LQ0A 1OCQA 2GDVA 1U33A 1HKJA 5CPSA 2RGLA 1LL4A 2FH6A 4PUDA 3K4DA 1QHOA 4UZSA 1J0KA 1UD5A 4GINA 4MDPA 3NIYA 3F5JA 4JL1A 2VO5A 4AD2A 4TVUA 3RDKA 3W6MA 1MXGA 1UR9A 2WMKA 1GUVA 1E73M 3OG2A 2QPSA 4P7OA 2VUYA 4UZUA 3AISA 3KL0A 2WZIA 1C7SA 2YA0A 2DIJA 5A2BA 4GZIA 2ZX5A 3VMPA 3BSHA 3MSDA 3I3DA 1WZMA 1CDGA 2D3NA 2YLLA 1VB9A 5A94A 2D20A 4UOZA 1A47A 1CTNA 2O9PA 1HT6A 4AD4A 1RD6A 5AYBA 3AXHA 1JDCA 1W9UA 4OOUA 1PIGA 2JF7A 4WJXA 1J9YA 2GK1A 5GNXA 1HKMA 1XSKA 1OT1A 4PMRA 1K9EA 3W0KA 4PSPA 5CLWA 3ZMRA 2FH8A 1EA9C 4HPHA 4RE4A 1ECEA 1VJSA 1E70M 4CN4A 5DT7A 4BF7A 3F4VA 1UYQA 3SURA 5JUVA 2O9OA 3CUIA 3WNPA 3IK2A 3AIUA 3FAWA 4PMQA 2BV9A 1NP0A 2V3GA 1KXTA 2F8QA 1WAWA 4IISA 1ODUA 5IFPA 2DSWA 4D1JA 3AZSA 4MDOA 1MYRA 2XVKA 3WUFA 5A6SA 3JUGA 1W9VA 5A2CA 1MW0A 3EDKA 4J3TA 3EMZA 1CXKA 3NDZA 1O7AA 5GNZA 3K4AA 1R8LA 6CGTA 1X1NA 1UA3A 2E0PA 1E72M 2XVPA 1WZLA 1E3XA 1FHDA 2B31A 5D8WA 1OM0A 3BLPX 4HZ8A 2OSXA 1IZKA 5A95A 3PZUA 1PAMA 1SMDA 1CEOA 4JCLA 5C71A 3VIPA 2QV4A 1CXEA 4GI8A 2X0HA 3WD4A 1KCKA 4HU8A 3GM8A 3QR3A 1V02A 1UR1A 1E6NA 2XVNA 4AEFA 4YPJA 1KB3A 4ZEPA 3WDHA 3AS2A 3N04A 2WANA 1KGWA 3O9NA 2UY5A 2GDUA 3PZ9A 2BFGA 4URIA 3ZOAA 1JZ5A 2WCAA 4HA4A 4HTYA 4UQDA 2XGBA 4ZXOA 2DH2A 2J77A 2VZUA 1RP8A 4J28A 1H49A 4P7LA 4QDMA 1WZKA 1ZL1A 5CPQA 3VNZA 2W66A 1JZ7A 3BAIA 2Y2WA 3VIOA 4JFTA 2DEPA 4F9JA 1DTUA 1Q6EA 2ZUTA 1OGGA 1V6UA 3GXMA 4EKJA 1Y7VA 2CPUA 1QNSA 1HP4A 1EXPA 1XV8A 4CD4A 3CZ8A 3ZT5A 1KQYA 4FMVA 3ZSTA 3EYPA 2VOTA 4CGTA 1VFUA 3SCQA 3PN8A 1MXDA 4JKKA 4D1IA 2F61A 1UG6A 1V0MA 1ODZA 3OLGA 2W92A 4E4PA 5I0DA 2WMJA 1H0IA 2WBGA 3BMWA 2CBJA 2VMFA 2D2OA 3I3EA 1UR0A 2XFFA 4J3UA 1BYDA 3MSGA 3NJ3A 1E4NA 1UZ1A 1B3ZA 4PN2A 4BQ2A 1QI2A 2C7FA 2V38A 1WNOA 3VMOA 4MNJA 2NSXA 1TVNA 2EPNA 1TG7A 3WBAA 2A3BA 1CLVA 1HN1A 2DSZA 5F7UA 4JFVA 4CD8A 1XCWA 3QOKA 3IAQA 1KGXA 2JF6A 3W27A 2EPOA 4YHGA 4P8XA 1W3LA 3GNRA 1R87A 4UQCA 1SMAA 2J7DA 1V3KA 1JI1A 1GPFA 2XG9A 4WLCA 1WCGA 4AYSA 2VJXA 1KFWA 5TD4A 3UR8A 1FFQA 2DDXA 1W2VA 5E6YA 4E8DA 1OIFA 2OYLA 3K8LA 4Z2HA 1ITXA 3UR7A 1GQJA 1GHRA 1D3CA 4ACYA 1UWRA 2NT0A 1BLIA 3AFBA 1FH9A 3T2QA 3U5UA 2A3EA 3ALGA 3AS3A 3ARRA 4V27A 1JNEA 1Q6FA 3WF4A 1HL9A 3F5KA 3W82A 4Z2KA 1TUXA 4GI9A 3PZGA 3ARQA 1EH9A 8CGTA 2VNCA 3EMQA 3UG4A 4TVDA 3VU2A 4NF7A 4A3HA 1V6XA 1G94A 1CLXA 4WKFA 2VZOA 3RPMA 3UEQA 3D5HA 3SCPA 5AC4A 2WMHA 4BQ4A 3CUJA 4P7QA 3WQVA 4PMYA 1W9PA 4TXEA 5CSYA 1B3WA 2W5FA 2FGLA 3W81A 2J25A 1U30A 1CGYA 1VAHA 1UR8A 1W9BM 4TUFA 4B16A 4P8WA 2BHYA 4NRRA 3ALFA 3EMCA 1H5VA 1X6LA 5I24A 1W3KA 3OZPA 3FW6A 4Z2GA 2W62A 4QP0A 4D6FA 4MAVA 1I1WA 4AZ6A 3ARWA 2BHZA 3W28A 5A6BA 1J0HA 3AROA 1E6SM 3RM9A 1UH3A 1K9TA 3AIVA 1C8YA 2WXDM 2XVLA 5HXMA 2ZE0A 1OB0A 1XC6A 5HPOA 1VFOA 4F9DA 4A3YA 5M5DA 1JZ3A 1GW1A 2DH3A 1JXKA 2TAAA 1XRVA 1BGGA 4UTFA 2G3MA 1W1VA 3N15A 1CGTA 1UKQA 2WMIB 4NI3A 1Q6CA 5DO8A 3WH7A 1KCLA 3WNLA 5AYIA 3ZJ7A 2WVVA 2XIIA 1BGAA 3VD5A 3CZJA 1TZ7A 4BS0A 2VQUA 4MNLA 3GBEA 3WBEA 1FP9A 5E09A 4MADA 2W4XA 3UESA 4W8LA 1EHNA 3L4TA 4WKHA 1HJQA 1CXIA 1CGXA 4W7VA 5FIPA 1UD3A 2FHCA 4KWUA 3NUKA 3KE0A 2ZUVA 1HIZA 4H41A 3ZJ8A 2PBOA 2UWFA 2XFYA 3KEHA 3BCDA 4M80A 3RILA 3M6DA 3T09A 4M56A 3BGAA 4AW7A 3ZR6A 3L4YA 3OGVA 3FNDA 2EXOA 2ZWYA 4J27A 4DUXA 2EPLX 2WB5A 3AXIA 5DFAA 3UCQA 1DWGM 3FXYA 5CGMA 1GVYA 1XYFA 3MU7A 4GQQA 5C70A 2E4TA 3TTSA 3FAXA 1MQRA 4DUVA 4LQ1A 3VD9A 3DC0A 3IJ8A 5D9NA 3WDIA 4GO8A 4PYSA 2VURA 4AXNA 2ZICA 2WW5A 5IXEA 1E6PA 5D9MA 1ISZA 2IXUA 4W5UA 2BXYA 3AS1A 2UY3A 5JBEA 2J7CA 2WC3A 1HKKA 3T2PA 1HP5A 2VI0A 2XPKA 4EE9A 4J3XA 2AOSA 2CNCA 3ECQA 1HF6A 1GOQA 5BRQA 1JL8A 2YLAA 5CQ1A 2UY4A 3WUBA 1J0YA 1PX4A 3WEMA 3VILA 1C90A 4HA3A 1DWIM 4Y7EA 5DF0A 2O92A 2PWEA 4QCEA 4W84A 1DEDA 4JHOA 3TA9A 5A6MA 2CETA 1CYGA 1J01A 3NSNA 3SCOA 3ARSA 5EBAA 4XB3A 2VRKA 2GJXB 4S3KA 3ZJ6A 1EIBA 4UFKA 4AEEA 1GJWA 2PWDA 3MANA 3B9EA 1BVZA 3VGFA 3VTRA 4CVWA 4AIOA 3T0AA 3ARYA 4LYQA 4KH2A 5I77A 1TMQA 3M46A 4Q7NA 4TTUA 1OGSA 3ARZA 3OB8A 4L4OA 1CWYA 2WMFA 2V3DA 1QNPA 4OIFA 3MMDA 4HMCA 3NSMA 2VC9A 3GXDA 2Y8KA 1S46A 2XGIA 2XHYA 3WIJA 4NSBA 3O2LA 4QCFA 2GVYA 4MNKA 4PMNA 1RH9A 1GQLA 5BCAA 1QNOA 2CKRA 3AHYA 5CSUA 1LG2A 2E8ZA 4UFJA 3VX1A 5I5RA 5AY7A 4IPLA 4UFHA 3KL5A 3WL1A 5KZ6A 4MB3A 4DM2A 2QHAA 3WH5A 4CN1A 2GK1B 3AYRA 2DSUA 5IHSA 1GOOA 3N13A 1WDQA 3MV11 1J18A 1PJ9A 3WELA 4KGLA 2QMJA 1PX8A 2YBTA 2WMGA 2OWWA 3TTYA 2JFEX 3PHAA 6A3HA 4PTWA 1ZJBA 5A1AA 1UD6A 1OSEA 2YL8A 5D8ZA 4DWSA 1RPKA 4FK9A 3HJEA 2PWHA 1GONA 2WMIA 4D6IA 1CIUA 1PEZA 1TVPA 2WZHA 2NW0A 3VIKA 3BXWA 4WF7A 4Z2IA 3CHDA 5GNYA 1BAGA 1PBGA 1LWJA 3MS8A 3VD7A 4WIWA 2XJ7A 3A4AA
chains in the Genus database with same CATH superfamily
4F79A 3UZWA 5GJMA 1KBBA 3WMLA 3WBYA 3KBSA 4UWMA 3N9RA 2V9DA 3LMYA 4JS3A 1CNVA 2A3HA 1GKQA 1G4SA 3WLPA 3GAYA 3M64A 4A8LA 1OADA 4Y2WA 4D6JA 4KMQA 2C1HA 4UNIA 2PGEA 3S5OA 2D0FA 4W5ZA 1QFEA 2ONEA 1UQYA 2A4AA 2BXZA 3WMSA 3W7JA 1VCVA 1VZWA 1GVIA 1CI1A 3OA5A 4HPNA 5AFDA 1H2JA 3GC2A 1NQKA 4H2HA 4MTVA 4MZ8A 4I6KA 1Y5XA 4D72A 3LERA 2Z1XA 3LPOA 4D8LA 3HQPA 4C7GA 2GZXA 4XX6A 2ZZ4A 5CJNA 4ROPA 1BXNA 3G18A 4LAUA 3T78A 4HHHA 1H62A 2NWRA 3LYEA 3OGRA 4IM4A 4K6AA 4BK9A 2QCCA 5HWJA 5AHIA 1MW3A 2NQZA 1AA1B 2PP1A 3KWXA 1PZ2A 4P8VA 2POTA 3VZZA 1VRXA 1EQCA 1YDNA 4ATLA 3NYDA 5HPCA 2DSVA 3C0LA 3RU6A 2DT3A 1EOKA 1JFXA 3MUAA 4PTVA 3SN0A 2GSJA 4RE0A 1XFBA 2Z1BA 5FCZA 1LUCA 4C6FA 5GJNA 3N2BA 4QHRA 3PF3A 1AJ2A 4YHEA 2EKCA 1HJVA 2P0OA 3QGAC 4YWIA 4QE1A 4N9DA 1E6QM 2FJUB 4NZ4A 1I9CB 3PZVA 3BMXA 4LUTA 3WQDA 1LOLA 3VGHA 5JVLA 3IIXA 4AISA 2FJKA 1EO7A 1VBJA 3NQVA 4DJFA 4WZHA 3D3FA 3N73A 1XINA 3VIGA 2FFIA 3G2GA 3E74A 3POCA 1GZJA 1FHUA 2R1KA 2VFFA 2GUYA 3OODA 5I3IA 3CLWA 2HEJA 1F7BA 2Y70A 4MY9A 4AY8A 1QBBA 2GVJA 1FCVA 1OFPA 3LBMA 1ZY9A 4E2DA 4S38A 2QQ6A 1T6MA 1M04A 4X2PA 3KS6A 1LLOA 3LCIA 2OKTA 3C61A 1TREA 4O50A 4NRSA 4MJ4A 5FJRA 1UQZA 4FX7A 3SEPA 4NZJA 2CBIA 4BI6A 5AECA 1ICSA 2ZOXA 1J0ZA 3LCGA 3O1NA 4Y9NA 2I9UA 1R46A 3B06A 3K4WA 1EP2A 2VDIA 3T6CA 1RJRA 2Z1SA 4HOZA 4LC8A 2B4GA 2F6UA 2YDSA 2ON3A 1W32A 3QKZA 1SSGA 1XYBA 3A23A 1RV8A 1VCGA 3G6MA 3QGVA 4J3ZA 3VGBA 2WSPA 3UVIA 3A24A 3AS0A 3BLEA 3FHAA 1P6WA 2DZUA 4HT3A 1HJSA 3WD3A 1E43A 2AL2A 2Z25A 2X8RA 1UWIA 3RUBL 1L6GA 3AYSA 2Q8XA 4ICNA 3I6EA 1U1UA 3CH9A 2Z1KA 1PKNA 1KW1A 2VEPA 3WQ5A 1JG9A 3WL0A 5E0FA 4PMJA 3EDDA 4DY1A 1XSIA 3TFXA 2Z1VA 2F6XA 3P60A 3WNKA 5EKYA 1B31A 2XIQA 5G4EA 2PDIA 3GWQA 2O9RA 3CHFA 3ABSA 3TQPA 4MPQA 2R24A 1XGZA 3HB9A 2OODA 3NPVA 2JBMA 1Q6QA 2QPXA 1W5OA 5C7VA 3KL3A 3P82A 3WNNA 4KT2A 1FCBA 4GC3A 4DO6A 2R1LA 1FOBA 1VGAA 2QS8A 2A6NA 1OEPA 1FXPA 4R5EA 4JFWA 1TX0A 2Q6ZA 3UXDA 1FWHC 3UZXA 3TTEA 3OEXA 3C86A 3VNIA 1GOMA 3NQFA 3NZ1A 1X39A 2GJLA 5FSEC 3VD4A 5EB8A 5HMSA 4N6FA 4XO7A 1R3VA 3NZGA 3BGGA 2JEQA 1V3IA 3QPYA 2PEVA 2GDQA 5CBJA 2OWCA 2RGMA 3HF3A 3N9SA 1XYLA 2V3FA 3CAVA 4NNCA 1WP6A 1POJA 3GTIA 4G9PA 1NFPA 4WX2A 3BCFA 3CLMA 4ML9A 4HNNA 4M19A 5AVHA 1VPXA 1UASA 4HN4A 2X0YA 1B5TA 3CPGA 3O06A 3E2QA 2QUNA 1RP9A 4CCCA 3SCSA 1VBHA 3DECA 1EJSC 2CESA 2EJ1A 1M68A 4PR4A 2A7RA 2O56A 3SQMA 4AD3A 4DB7A 2C15A 2BLEA 2OMAA 1TTQA 4M8UA 1B30A 3WBWA 3L4ZA 1JGIA 4B90A 2VEKA 4WXYA 5MKGB 1UWQA 5I3KA 1K9DA 1UUQA 8XIAA 4ZVJA 9RUBA 3IPWA 4AZ7A 4MWAA 4S3BA 4PULA 2J78A 2JGYA 3CV2A 2OSWA 4IP4A 2SFPA 5IHRA 4PCTA 4RW3A 1M6JA 1JCNA 3I4EA 3GS6A 3VKJA 2VR2A 3ZO9A 1OFAA 3DDMA 1V3JA 4IPNB 1O60A 1KBJA 1E6XM 1Z8AA 4A8IA 4DX3A 1PTAA 4WCJA 2QDHA 1IEIA 4CU8A 4UMAA 4L61A 3ONCA 2BOFX 3WMBA 2P88A 4G7EB 2IKIA 4Q8NA 3V4BA 3WJSA 4M51A 3PJWA 3NR0A 3ZLGA 1ONRA 1ZS2A 1H11A 1EJVC 2ATSA 4DWSD 2PGFA 9CGTA 1M03A 5LNVA 4IFRA 2BOEX 2I16A 3LV6A 2A0NA 4AC1X 2PDKA 3S1UA 1FFRA 3UYIA 3THQA 3UG3A 2ZA1A 1W1A1 1Y0EA 1AUSL 3G24A 1B90A 4BF9A 2DUAA 5E93A 4X0NA 5D2TA 3N14A 3O6CA 2VX4A 3GC5A 4W85A 2QCEA 3H2EA 3KHDA 2QLYA 4IP7A 3UR2A 4W7WA 5GQBA 2J79A 2TODA 4O10A 4F8XA 3Q94A 2YOCA 4W8AA 1BEUA 3TYUA 3ORWA 1QPQA 1G4TA 3SRKA 1KFCA 3A64A 5JMUA 1H41A 4NZ1A 1OC5A 3W53A 2PI6A 2WVSA 2WLYA 1FP8A 4LRSA 3S2JA 1XIIA 1F9CA 4D2JA 2PCEA 1XHGA 5BRPA 2CLMA 4W93A 2XM1A 2IQ0A 3QRHA 2GWNA 2TSYA 1T8QA 4UQ9A 5KINA 4PGLA 1J5SA 4EK7A 6ALDA 1RQEA 4B2DA 1CZ1A 3FK4A 1VQTA 3IEBA 1JD9A 1VIWA 4PL2A 4CKQA 5D32A 4H9XA 4AZGA 1QOXA 1CGUA 3WJWA 3LHWA 5LKYA 3FSTA 4FLOA 4K37A 4O28A 3HZ3A 1PE1A 4NZ3A 1HJUA 4FI4A 3DENA 1RBAA 2E67A 3L23A 7TIMA 3ZIZA 3W6YA 1OBAA 4C1NB 1B0IA 1R6WA 2NLYA 2VCCA 3UXKA 1H7NA 3UYCA 3C52A 1NOWA 4MYAA 4GVHA 3R8HA 2CEQA 1C7TA 3CPRA 2PAJA 3PBVA 1YE4A 3S9ZA 3UA4A 2HS8A 4ATWA 4DNMA 2W9MA 3ITLA 2WVTA 4O0KA 1TZ9A 5LA1A 1FWNA 1QI3A 5A6KA 4GI6A 4ZFMA 5I78A 1K8CA 2OKOA 3ARVA 1VJZA 1E0VA 4O54A 3CTTA 2PZNA 3VFCA 2WYSA 2VENA 1YXDA 1PDYA 1QPNA 3BOLA 4LBSA 3S47A 1R7AA 2VTFA 5I2UA 3EB2A 4ICMA 5JH1A 3HO8A 2PODA 2J62A 1KFJA 1D8CA 5G1TA 7XIMA 4HMDA 1M53A 4WHBA 3W83A 4BWLA 1TQJA 2OLHA 2A3LA 2WC7A 2EBNA 3QZAA 2WNZA 3NO1A 1YPXA 4TMBA 2RDWA 4RK8A 2Y85A 3OBAA 1WKEA 3G1AA 1SO5A 4W89A 3F2BA 3BAXA 1A0EA 4JICA 4UQBA 2OGYA 2J47A 4AWTA 3CPUA 4YN5A 4N2YA 3T08A 3ICJA 4ZCWA 2INFA 3A12A 3M0XA 3G3DA 4QJ3B 3W2MA 3ZVHB 2QEZA 1EZ2A 1NWTA 1U5HA 3RNDA 4ZTXA 3IGHX 2HMCA 2C1GA 3DH7A 3TTOA 4C1KA 2XSBA 4ZB5A 3G1DA 1X97A 1AZ2A 3FJLA 3B3DA 2CZDA 2ESCA 2F38A 4MFDA 3FJ6A 1R9ZA 3IGUA 1XM3A 1JR1A 4CD5A 3N2OA 1C29A 1XIJA 4OUIA 1YQ2A 4MB1A 2J75A 3ARXA 3TJ4A 3FYYA 4NZCA 1CGWA 3JW7A 1QI4A 4JL2A 3VM7A 3M0IA 4R7JA 5FJUA 4F0SA 1R7OA 1E4IA 1DVJA 4LBRA 3TXZA 4C7FA 3N2CA 5IBXC 3ZSSA 1KTCA 3AIQA 2ZZ2A 4R27A 2DV0A 1JZ2A 3GZAA 1XH0A 3FSUA 4A8NA 5CXPA 2CZ5A 1SJCA 2AAAA 1POKA 1RR2A 2FDMA 4PBFA 4ROQA 2EPKX 1I2OA 1KM0A 1SZNA 1TV8A 3W6LA 1MRQA 1B3YA 2C8NA 4AWEA 2HQAA 1VCFA 4JIPA 2E40A 3MHGA 1LLWA 2Z6IA 3WJYA 3FJ4A 4WDTA 3V18A 1VFMA 4MUPA 2J7BA 4AEOA 1UZ4A 4LAKA 1YIXA 3TAKA 4WQ6A 2J13A 1WBJA 3W2LA 2WVVB 3SY5A 1LJYA 3S6OA 1HVQA 1EP1A 3IRSA 4JQ2A 4PRWA 6TIMA 2QCDB 2E9BA 1XD0A 4JCMA 1R3WA 1Q7MA 1UH2A 1W91A 1KXVA 5J5RA 3C6CA 4DIAA 4JFSA 2QULA 2G3IA 1IR2A 5JBDA 4YIWA 3K8KA 4H1ZA 1PCWA 3MMTA 2ZC8A 1KNWA 1A3HA 3T4CA 1OZMA 4TO8A 2OB3A 2DZTA 3FXGA 3XISA 1R3TA 2A3AA 4AD1A 4JN8A 1XPYA 4KRZA 3DFHA 3C2OA 4DWSB 2IKHA 3L4VA 3UY8A 3U57A 4PFMA 3FGCA 4MAZA 3SCVA 1SFSA 4O18A 3OBKA 4UCGA 3TAOA 1E0XA 1LF1A 8RUCA 3MW7A 3BAKA 2P3ZA 4CN6A 3WEZA 2XVGA 1XCXA 4XUGA 4NHVA 3B9DA 1DE5A 3FYPA 3IJ7A 4ORMA 1E3ZA 3WK2A 3SRFA 2WLZA 3EB3A 1MMFA 2NZLA 2PC8A 2BNJA 1KRBC 1VEOA 4I9TA 1CLKA 3MWCA 4PTDA 3E0IA 2VX6A 4AHPA 4DZ5A 4US6A 1DXEA 2ZRZA 3E0WA 1J10A 3TYBA 1EJXC 4W87A 1H09A 2V30A 4GUGA 1L0PA 1HKIA 4KEUA 5DN1A 5HWMA 1R3YA 3L65A 3OYZA 3H4WA 3PY2A 3QYQA 3HPFA 1SJAA 1OFOA 2R6OA 5DMMA 3DKLA 2ZDRA 3OW1A 4E2OA 1ONWA 3QV9A 2ZVRA 4MFEA 4K68A 1BFNA 3GU9A 3M0ZA 4F0RA 4LWWA 5CC3A 1KM2A 3SB0A 5JU6A 4U2ZA 4OBRA 2OT1A 1M3UA 4NQ1A 2BOGX 1BYBA 1RCQA 4WSJA 2OZ3A 3UZZA 2WKGA 4PUMA 4UTUA 2AQWA 3M0LA 1S5NA 7ODCA 4PTXA 2PP3A 5I3FA 2J9YA 1D2KA 4NXKA 5HMFA 2ZUMA 3G1XA 4R9XA 2WNWA 1IWBA 2XGZA 2EPMX 3EB4A 3VA8A 3WD1A 4U3AA 4PB5A 3SUWA 3H2NA 3L4XA 3FS2A 3OVRA 1XPGA 3MKKA 3GH5A 4DYJA 1XIEA 2VHLA 4H9UA 5I79A 3BAJA 1E1CB 1EDGA 2PB1A 3U2CA 3W85A 2GJRA 2QW5A 2A7PA 4K8HA 2X7WA 1FWWA 4FXRA 1EO5A 5CGQA 4ZMGA 3CHCA 1W3HA 1GVFA 2QKFA 1G4EA 3OIHA 2G3JA 3W76A 4HGXA 1EF2A 3BQ6A 4X0VA 3C3NA 3MP5A 1Q4WA 3LS9A 2HVMA 3UXLA 1XYZA 4E0CA 3DFOA 1NWRA 2QPUA 3IUHA 1JYWA 3DFPA 4KS0A 5D2XA 4I7WA 3HMCA 3PJTA 2J6XA 4D6GA 3W87A 4XKYA 3GVGA 1GORA 5I07A 4Q6XA 4IQJA 4LUSA 4WOZA 1BQCA 3AUOA 4AIBA 2VRJA 3G0SA 1DIKA 2VFIA 2PLKA 1IIHA 4Z2JA 5LNWA 1XBXA 1FWDC 2QUMA 3SCUA 1Y5VA 3R2GA 1XYMA 1ZBCA 1FA2A 4L4PA 4ZQMA 1ZJIA 1LG1A 2NVAA 4ZE5A 4JHMA 1H7XA 3EA2A 2POZA 4IGMA 1NP2A 1L9WA 4C91A 5HOSA 2CHNA 5BXPA 3OHIA 3MUY1 2XISA 4EX4A 2GVLA 1LQ0A 1U22A 3TN5A 2RGLA 3TXVA 2OX4A 2E6FA 2CLEA 1J0KA 1UD5A 4MDPA 4ZB2A 1D9EA 1KRMA 3PM6A 2VO5A 3SQSA 2AL2B 3RDKA 4E2VA 4E8GA 5FF7A 1OYCA 3DFNA 3PSWA 2WMKA 4JTKA 2YXOA 1E73M 3ZWTA 2XN1A 1AW1A 1DORA 3GZ3A 2YA0A 1IEXA 1ZPTA 4QX4A 2AMXA 5A2BA 1ZHAA 4G1NA 4UIOA 6ENLA 4ZZ9A 1FWGC 3I3DA 1G7UA 1N55A 1IWAA 1FVPA 2YLLA 2CZVA 3UVAA 4UOZA 1A47A 5E9XA 1CTNA 4X3ZA 4JN6A 1FXQA 1VLWA 5AYBA 1W9UA 3KRBA 2FDSA 1PIGA 3NYZA 2OO0A 5GNXA 1HKMA 4XVDA 1K9EA 3W0KA 1US0A 2H3DA 1OQFA 3CIXA 5CLWA 5KETA 5DBTA 3VKAA 2GVEA 4HPHA 1VJSA 5FAGA 2PWVA 4U4MA 4CN4A 5DLCA 2OEJA 3PSVA 2X40A 4WDUA 3WLMA 5JUVA 4O0QA 3CUIA 3R0KA 1AODA 1XS2A 3AIUA 3FAWA 3Q65A 4PMQA 3RO6A 3GYEA 4HQVA 1XF0A 3T81A 3V5CA 2BV9A 1WAWA 4IISA 2DSWA 5D37A 3Q67A 3L9CA 1VHCA 4MDOA 2C19A 1FDYA 3WUFA 1O68A 3JUGA 1F3XA 4C6LA 5C6MA 3EDKA 4J3TA 3NDZA 1EEXA 3H2OA 4IT1A 4FA3A 1UA3A 3KP1A 1XUZA 2BZNA 3RCMA 1WZLA 4UBPC 4KCWA 3M47A 1ADSA 4HZ8A 3BOFA 2OSXA 5BWAA 5A95A 3PZUA 1KTNA 5C71A 3VIPA 2QV4A 5FJPA 3WD4A 3KRSA 3GM8A 2GGGA 3MP3A 1V02A 1HZYA 5CBIA 2OOGA 4M6VA 1NDWA 4ZEPA 3JZEA 1AW5A 4XAZA 4OV9A 4QG8A 3PZ9A 2BFGA 1YW1A 4URIA 3IGSA 3H24A 1WKDA 1U5VA 1W54A 4UR8A 2DH2A 2PC4A 4IMAA 2Q09A 3DG6A 4AY7A 5CPQA 2W66A 4LVDA 3NQ7A 4HPJA 2ZUTA 3KHJA 1V6UA 4O16A 4O19A 4EKJA 1Y7VA 1Z89A 1HP4A 3GXNA 4LJ3A 4EXBA 4FMVA 2VOTA 1PTDA 3SCQA 7ENLA 1LRNA 2VWTA 3KX6A 2HNHA 4JKKA 4NAFA 3EA1A 5BMWA 4KWVA 3MVTA 1UG6A 3FA4A 5CKSA 3R7MA 3QFEA 3N29A 4AF0A 2W92A 5BMXA 1A5OC 1UBPC 2QGHA 4MYXA 3VABA 1OG0A 3DIPA 1XIGA 2CBJA 2OCZA 4ZO7A 4LF1A 2XFFA 1BYDA 3MSGA 3FOKA 4PN2A 3VMOA 4DBSA 3HV8A 3XIMA 1TVNA 2EPNA 5D33A 4BI5A 2A3BA 1HN1A 3QV6A 4YTQA 5DCEA 3EX2A 4YHGA 4P8XA 5L9FA 1R87A 1GPWA 1SMAA 3K5XA 3DBNA 3KBVA 2WZMA 2FYMA 3QKEA 2FMNA 4O1BA 1GTHA 3NAVA 3TW7A 3THUA 1KFWA 4Z1BA 3UR8A 4JTGA 3ZVHA 2X0SA 3EWXA 2V5KA 3K8LA 3TWAA 1WV2A 1GHRA 1UWRA 3AFBA 1FH9A 2Y61A 1S2TA 5B7ZA 3AS3A 1TUXA 4GI9A 3ARQA 3VXGA 3DG3A 3E5BA 4NF7A 4GVGA 2NXIA 4Z1YA 3IACA 3VUSA 4A3HA 3IJDA 4DO4A 5EYWA 3OPSA 2BODX 5AC4A 2WMHA 3R25A 3PB2A 4BQ4A 4Q4KA 4E3TA 3LBOA 4TXEA 1ME9A 4MSSA 1Z3NA 1Y8BA 1BSLA 1UR8A 1W9BM 4EPEC 4TUFA 4B16A 1B57A 4P8WA 3S1GA 2OZTA 2NX9A 1X6LA 2H3BA 4ZBCA 3OZPA 4S3DA 4Z2GA 3CAKA 4NIRA 1ME8A 2AKZA 3H2AA 4K7YA 5DY3A 2OLAA 4D6FA 4MAVA 4HHPA 1I1WA 4AZ6A 3NXLA 2V2DA 3R79A 3AIVA 4LVBA 5AHMA 4GC4A 3APTA 1C8YA 2XVLA 2ZE0A 1L6FA 4JTRA 4GKTA 1RK5A 4A3YA 5J5DA 1JZ3A 2ZRYA 3E49A 2E5DA 4WY0B 4IMFA 2VD9A 1W56A 5I02A 2VFGA 1RA5A 3HIJA 3STPA 1XRTA 3ZJ7A 1JEZA 2V2HA 4W4QA 3CZJA 2YCJA 4P61A 1O5RA 4MNLA 3GBEA 2QAPA 3P6LA 1FP9A 5E09A 3UESA 1EHNA 4PC8A 3L4TA 3W7CA 4CCZA 1ZAHA 1UD3A 4HN8A 5AKQA 4G7EA 1XIHA 2XIMA 5EU9A 1YADA 4CQDA 4KWUA 3UWZA 4RZBA 2ZUVA 3KE0A 1EIXA 4H41A 3KCJA 4CNSA 1IHIA 3M44A 1RK6A 4B4FA 2OLSA 3ZLFA 3QR0A 1WX0A 3T09A 1NFGA 4HA0A 3RXZA 1WA3A 3ZR6A 5LNRA 1K3UA 4Y9AA 1KBLA 5DCBA 3OGVA 3RYSA 3FNDA 4JYFA 1H61A 1Q85A 4DUXA 4K8GA 2EPLX 3UCQA 3QFWA 1ICPA 1V51A 2R1MA 4FXJA 4GG9A 3MU7A 5M1TA 5T26A 2PP0A 2E4TA 3WLIA 1S5VA 3BOXA 3A5FA 3B03A 3FAXA 4LQ1A 3W2UA 6XIMA 5D9NA 4JOMA 4JEQA 2CZEA 3HGOA 5D9MA 3BG5A 4W5UA 1JULA 1Z44A 3BANA 3ME3A 3T2PA 1EP3A 4J3XA 2AOSA 2CNCA 3EWBX 3E12A 1KCXA 1D7KA 1Q66A 5BRQA 3GG7A 3Q2DA 4RJEA 3WUBA 3ZZ1A 2WM1A 4Y7EA 2O92A 2PWEA 1DEDA 4JHOA 1XICA 1PKYA 3UW6A 3L2IA 1QDSA 5FF2A 4M7TA 3BPWA 4UFKA 1XLJA 1THFD 3TE9A 3V7PA 2PWDA 4A35A 1FWFC 4PCPA 4I9MA 2I1OA 4LYQA 5I3GA 4KH2A 3N2TA 4Z0JA 4RV3A 4TTUA 1OGSA 3OB8A 3AXMA 4TU1A 1J8VA 3ABRA 2VC9A 1S46A 2XHYA 4C60A 3PPCA 3RHGA 3WIJA 1OVDA 3CQIA 1J93A 3P3BA 2GQ3A 4B5WA 4AFYA 5F4SA 5EBUA 1GQLA 3CMFA 1OX4B 4NILA 3RPDA 4ADTA 5FF4A 3PWAA 1D3GA 3NM1A 4N4QA 3ID7A 5I5RA 4O1EA 4HNCA 4IPLA 2YCLA 4LV9A 3KL5A 1K02A 2G97A 3TWBA 5F1UA 4DM2A 2QHAA 3B97A 4LVGA 3M5ZA 2GK1B 3N13A 3KTSA 3S2LA 1PJ9A 1V79A 4KGLA 2QMJA 4B92A 3TTYA 3RK8A 1XR2A 1P0EA 3S2NA 1ZJBA 2O7SA 4IMCA 5D8ZA 1GW9A 4KCUA 4B2DD 1TMLA 1DQUA 3HJEA 1GONA 1DOSA 2PUZA 4GE8A 1CIUA 1PEZA 1DV7A 4QR6A 2NW0A 3EXSA 3BXWA 3CHDA 4ZQNA 4OV4A 4EXQA 3V5OA 3MS8A 3VD7A 4RZ4A 4WIWA 4O13A 3DU0A 2XJ7A 1SSDA 3CWOX 4L5ZA 2HS6A 1WZAA 2I5GA 5A6JA 3WH9A 3A3XA 4B9YA 3W00A 4WK9A 1BYCA 3GNDA 3N6HA 1GG0A 1DHKA 3GHRA 3VYLA 7REQB 2IKJA 3RMEA 4FHAA 2ZZ5A 4GZJA 1UKPA 4RE3A 4AVNA 1O6IA 2VYOA 4JX5A 1H4PA 1TRIA 5KZDA 2VCBA 3L4UA 2WV8A 3MO4A 3DHDA 3FV9A 1RJQA 3LY0A 2ISVA 2WWDA 1MRAA 2FZNA 2GJXA 4GRSA 1NVMA 3WK0A 2HRWA 1A5SA 5CPNA 1E5NA 3P8IA 1XH2A 2CBUA 2H8ZA 1WDSA 2BY3A 2OSYA 3W24A 4H6EA 3B8SA 1XYAA 3L0KA 1NQ6A 4CCEA 3GNPA 2A7NA 3EKLA 1PWLA 4MUZA 2PDGA 2YCIX 1J12A 4X61A 1ZP3A 2DZWA 1ZNNA 4ERIA 3M0KA 4MWAE 2ZUWA 2BVDA 4GPNA 1QO5A 4GKLA 4MLJA 1ZBVA 2WKJA 3ARTA 4H8HA 1AMYA 5LYRA 4RUBA 4IIGA 1VPYA 2YCLB 3CBWA 4QAIA 2QJMA 2XN2A 2NV2A 3TYCA 3LDVA 3K1DA 3TTQA 2OOFA 3WQPA 1YNQA 4AY1A 2JK2A 2AGTA 4M1RA 3TZNA 4DM1A 3NPUA 1LQ2A 2Z2BA 3CUHA 1J6PA 4P2VA 3SY1A 4C6MA 4DJDD 3IGXA 5A8QA 4NT0A 3PS7A 1I0BA 4R88A 4MG4A 1FKXA 4J40A 4JN7A 2W67A 3U8GA 2ISFA 4YU1A 1OINA 3KBWA 1E1EA 4IMEA 4RE2A 4PMZA 1JRBA 1W1PA 2WCGA 1W37A 2WM0A 5ECUA 3W07A 4DRSA 5TQLA 1TE1A 1Z48A 5LGZA 3UETA 4OUEA 3PZMA 5A69A 2ZX6A 5BWFA 4ICCX 3W7IA 4AAJA 2OELA 3ANVA 5I3HA 5F2LA 4V1YA 4IZGA 2QDGA 1OK6A 3FCPA 4GQBA 5AC8A 1XLHA 3GIPA 1U2YA 5BOFA 1RQBA 1FWEC 3ITTA 4QROA 1BXCA 1OFRA 2C18A 4ORIA 2V63A 1SQ7A 4Q4OA 5HANA 2TYSA 4Q33A 1F6PA 3QMSA 1ADDA 1BVWA 4ILSA 2PWUA 2ZRXA 4QE4A 2CHOA 1QW7A 2DORA 2B7QA 2D3LA 2YBUA 4UQEA 1RSCA 2E8YA 3O0KA 4LYKA 4AHQA 4ADSA 1ZGDA 4U31A 1TVLA 4LXFA 1UUMA 4O1AA 5HBFA 3GH7A 3KDOA 3VD3A 1I2QA 3EGJA 5FI8A 4M0XA 2GL5A 5CH9A 2O55A 1V0KA 3CHEA 1S3TC 1EC8A 3HG2A 5I6SA 3G0XA 3UCCA 2E5BA 2VQTA 4XSLA 4Z1CA 4H8NA 4LTSA 1ICQA 3WD2A 3ATYA 1O1HA 3EBVA 3G1HA 2BY2A 2E68A 3B9AA 3L7RA 1AH0A 3M41A 4PMVA 1XDJA 4OKDA 1PKLA 3HV9A 3STFA 3UBPC 1L8PA 4H19A 4EAYA 1PZ1A 3VIIA 1RD5A 1LQAA 3B8WA 4YTUA 4JX6A 3GR8A 4Q32A 5BW6A 5L6UA 2VL4A 3GD6A 4PCSA 1H63A 3IK4A 3LMZA 4GH3A 3AXKA 3V1PA 1W6TA 4UFMA 1S2CA 4J2PA 3DYOA 1W5MA 3ENLA 3HMJG 3H7RA 1FWAC 1P1MA 1P5BA 3BDKA 4HYVA 2PZ0A 3GIYA 5G2IA 1E1FA 3F5LA 1AQHA 2DT0A 1E9ZB 3NDYA 2PPGA 3OVQA 4AZIA 4U33A 2OT0A 3VE7A 4EWND 1FCQA 3M7SA 4LX4A 1GVRA 4EANA 1I0DA 3DFTA 4S2CA 2OPJA 4TX8A 4IL0A 5DMYA 3SZ8A 5AN7A 4WVXA 3WEOA 5EMMA 1LOSA 4HSOA 2XFRA 4P7NA 1JCLA 2GJPA 4BQ3A 3WNMA 1QOPA 2WHMA 3ONBA 3WDRA 2Y7DA 3E0VA 2ZXDA 2XH0A 1M41A 5DT5A 4ALDA 4ZA0A 2XZ9A 3EX3A 4CQ8A 2ACRA 1GHSA 2PGWA 1GKPA 1QVBA 1XQKA 2OEMA 3NCOA 3AWOA 1P4CA 4FF5A 1VFSA 1H51A 3BC9A 2YW3A 3DERA 3G0UA 4NVTA 3PTQA 2WHJA 4KIEA 1LORA 1A5AA 3T0TA 2EAWA 3E2RA 4OHQA 3UR5A 4MJMA 3O8AA 1TPB1 1CPUA 3DESA 3NO5A 4GACA 2ZQ0A 3OOQA 2EHHA 2JEPA 1C92A 1TTPA 4OBSA 5D30A 3MHUA 5I23A 1P7TB 5IOBA 3WF2A 1NOFA 3GBDA 3AZRA 4G7FA 3KRZA 4CD6A 3KCOA 1E4MM 1H3GA 2J24A 1D8WA 1VEMA 4M81A 4UTIA 1DJIA 3POHA 4ZENA 1BSIA 1REQB 3WQCA 3T1GA 4GD0A 3TYEA 1Q7ZA 1DQWA 2YDQA 1EFZA 1XISA 4EPDC 1W17A 2FTPA 1XWYA 3UP8A 4XAGA 1OT2A 4S3CA 1I2NA 1KR0A 3AMCA 4C6NA 4AZCB 2PBGA 3GRIA 3WMCA 4WD0A 3RX3A 4PMOA 3GTFA 4W86A 3I7SA 4XTDA 3URAA 1LUCB 4KBXA 4H04A 2YCEA 3SGUA 4ZTYA 2PD9A 4KETA 4QSFA 5LGXA 3VINA 1QJWA 4DELA 2VFDA 3MVIA 3EXTA 2FTWA 3LBCA 4R33A 4X60A 5EY5A 5M17A 1F4HA 4GFIA 3PUEA 1ZJHA 3PPHA 2DPEA 4PCFA 4OJYA 1H7RA 3R89A 1VP5A 1DIEA 5AHEA 1NELA 3E0LA 1JAKA 3CGTA 3W1AA 2UBPC 4OECA 3CQ0A 4OGZA 1QMLA 3CMJA 1TWSA 2C13A 4QEHA 1AZ1A 3WY1A 4XUYA 3L5AA 5E9AA 1Q4NX 1K77A 4HZMA 1KBKA 4DAFA 3FYOA 1ELSA 2VELA 2JIWA 4JHZA 3VIFA 3CQKA 3A4JA 3N6JA 3LCWA 4G5DA 1ZQ5A 1YBQA 1DJWA 3SCNA 4AX7A 4EPBC 3GH4A 2DT1A 4D6EA 1OC7A 3UERA 1ISXA 3ITGA 3QN3A 2WJFA 4KFPA 1KKOA 1TA3B 3R8RA 3VNYA 1FKWA 2FPYA 4MMWA 4C5YA 3QPEA 4AVOA 3AMLA 1HG3A 2NQ5A 1SFJA 1QHPA 1V77A 2BGSA 2WJDA 1ZB5A 5BXSA 3LG3A 2GSEA 2XSXA 2JKAA 3HPAA 3KUMA 2D23A 5A5WA 1IQ8A 4DF2A 4HKPA 1KKRA 4N9BA 3H6OA 2IPFA 4HTBA 1GTEA 3N1AA 3EKZA 1EGMA 3F2CA 2J7EA 3AAMA 2HJPA 2I7GA 1AH4A 1QRQA 3STEA 3NL6A 4NU7A 3TN3A 1AJZA 3AHTA 3AU2A 3WJZA 3G77A 1NEYA 1TX2A 5DANA 1MFVA 3A47A 4BEQA 2HTMA 4R85A 3SUTA 5H6HA 1V6VA 3VDHA 3NQBA 4B15A 2BY0A 3I6TA 4GUFA 1W5QA 3GY1A 3P5ZA 1LBFA 1V3MA 5TIMA 2CYGA 2DIKA 3VNDA 1K9FA 3TUUA 1I6NA 2WQDA 3WD0A 3VOJA 3GYCA 3I7RA 3SDOA 1WB0A 4U2YA 1EPVA 1RALA 3OHMB 1N8FA 4C1LA 2NQ9A 4H9TA 4LANA 1A5MC 3P93A 3JZUA 4E3VA 4JTTA 3K46A 3W02A 3QV7A 3GU1A 1UC4A 3T8LA 3S2MA 4M6UA 3ABZA 5JIWA 3EX4A 1R86A 2X42A 1SO4A 1HL2A 3WF1A 2G41A 1V8EA 2D22A 4N6EA 1TV3A 2Y8VA 1MQPA 4H7VA 4IL2A 3V35A 2Y4SA 5HJYA 4XD4A 1AL8A 4B5UA 3C2VA 3LSCA 2DQWA 1W31A 2X1SA 5BROA 3R8GA 4QG6A 1W9XA 3XINA 1CXFA 4JR5A 1WQ5A 3UWYA 3MUZ1 3LX9A 1KGUA 1L6YA 4OT7A 1XW8A 4KEMA 4X22A 2YXXA 4IP5A 3TONA 1MEHA 1OFBA 2DFAA 2VKZG 2ZXAA 3OLEA 4N7QA 1YE6A 3WUGA 1TWWA 3CT2A 1RCXB 1BYAA 4M82A 1A0CA 5HJLA 3PFRA 1H1NA 3QOMA 5CPMA 1XIFA 2YZRA 1Q6DA 2V0TA 3E02A 3W7GA 3K8MA 1CT5A 4RR4A 1GOWA 1Q2RA 1GQKA 7TAAA 1QNVA 3AIBA 1YRRA 4OZOA 3LHVA 3H2MA 4ADUA 3VGEA 3BZGA 3LRMA 5LXEA 1XLKA 3IUIA 4J1OA 1D3HA 3GC4A 3O15A 1P7TA 2G3NA 3R10A 1YTEA 3AHXA 4BA0A 1UB3A 3BK0A 3U7VA 3REQA 1XLIA 3VVGA 3WQGA 4LFYA 2Z4GA 3BSGA 3H7UA 2X05A 4JKLA 1WXZA 5LA0A 3IJIA 3LZ5A 3U5YA 3ZLHA 2W61A 3LPFA 5HNTA 4K38A 1E6RA 1N82A 4J2MA 4AWUA 3VDAA 2PCQA 3KP0A 5BXRA 4B9ZA 3HN3A 4I6VA 2YXGA 1IT7A 4FOUA 2F9RA 2KZHA 4FSAA 3COTA 4YVXA 5BRBA 4OVXA 4HA1A 1UP3A 3MI3A 4WSKA 3W7PA 3GHUA 4DLFA 1PPIA 1CENA 3TOPA 4TMCA 1XXXA 3L2LA 3BTNA 4A3QA 2O9TA 4CNOA 4AZBA 3VGDA 5G2HA 2PWFA 3AXXA 4UTMA 2I5QA 4UTTA 1OX4A 4LB4A 4JTAA 3NQ6A 2HE5A 2X09A 3GX9A 1Q3NA 1TPVA 3QZEA 3IIPA 1QASA 1HGWA 4WSHA 2A3CA 2A5HA 1NTHA 2YZ5A 4DLMA 1S2UA 4QM1A 3R13A 4KWSA 4HZ7A 4UCFA 3QW4B 2V6AA 4K3ZA 1UCWA 4UC5A 2BWGA 2VFEA 1CECA 4H01A 3AOFA 6PTDA 2O0TA 3MO7A 3TP4A 4GVIA 3S5NA 2G37A 4XD3A 3G1YA 3N17A 4CNNA 2BGQA 3H54A 1XP3A 1JPHA 5IDIA 4DXKA 2QUUA 4GZEA 1W0MA 3KRUA 3GHTA 3D3AA 2VR5A 3USBA 1JI2A 2YDRA 1Q5MA 3O16A 1HNYA 3CXOA 1EUNA 1KCZA 4N0RA 1MWOA 2IKGA 3LCHA 2PF8A 1P1XA 1RQHA 2VM8A 4IJBA 4QITA 3TU9A 1CCWB 3P67A 4IPPA 5LZLA 4QG9A 4CQ9A 1UD4A 3ZJKA 1KLZA 5K9XA 3VX0A 4DAIA 4IUGA 1HVXA 2OZ0A 3DFSA 3W84A 5CG7A 1UHVA 5E0CA 1Q13A 2IPWA 3OQEA 2V67A 1PV8A 4CD7A 2ZTJA 1TFVA 2VX7A 3C8NA 2PU1A 5FSDC 2WC4A 3G8RA 4Z2LA 1VENA 3DHUA 3G1VA 3MI6A 4KCTA 4MY1A 3EAUA 3G1RA 4FIQA 1KRAC 3P74A 2P0IA 5D9OA 2BMBA 2JKEA 4DWSC 2Z24A 3GDBA 3BSMA 5AHLA 4GFSA 2ZDSA 2XUCA 4A3UA 4FR1A 2NX3A 3EX6A 1OF8A 2Y89A 2R82A 2DIEA 4V33A 2QCFA 4WDWA 4R3UA 1I4NA 4AD0A 3LCXA 3OU8A 3LZ3A 1OX6A 5CJ5A 4QIUA 2B7OA 3KW3A 3RLGA 5LIYX 2FPVA 1ISWA 1KWKA 4XZBA 3O7UA 1ISVA 1O66A 3KVJA 1GZGA 3HGJA 3WFLA 1UBSA 2QR6A 3QMTA 3U3HA 2CLFA 2FHBA 3VMNA 3MYOA 1NWUA 4S3JA 1E1CA 1YTKA 3QHMA 4JIEA 3S6DA 4FNRA 5CAHA 2VVNA 3MMUA 2VR4A 1L2UA 3GU2A 3PZTA 2QIIA 1DKWA 1G01A 3PC0A 1JDDA 5ABFA 3U9IA 1R5YA 2ALRA 5BOEA 4MB4A 2J66A 4GQRA 1GEHA 3GVQA 5JH2A 3URBA 2C1IA 1E5JA 1OFDA 2QMKA 1JZ6A 1JYNA 4NAEA 2QF7A 4HK7A 5HNNA 3IVSA 1QOQA 5HK4A 4OE7A 1PXGA 3GTXA 3C5QA 4DVOA 2EG7A 4DJDA 2ASHA 2VDGA 3PUOA 3LI1A 4HYWA 1AFSA 3UZYA 1BWVA 1R3RA 4J7RA 2ZADA 1OF6A 3MA8A 3J7HA 4U3CA 3NXFA 3KBNA 4LH8A 4QGCA 2HPMA 2P53A 4UR9A 3LHUA 1WUEA 4C5ZA 1AQ0A 1K7XA 5HJXA 1QPOA 1B4KA 1QWGA 2HK1A 3CZLA 1X38A 4KEVA 1IV8A 3EDEA 3EEGA 3GE7A 2CERA 3L68A 3UWEA 3KOWA 1Y65A 4IJRA 4FZIA 4O53A 1TSIA 1RAKA 2FH6A 3RR4A 3K4DA 3REQB 4RZ5A 4GINA 1H50A 5DMLA 4AD2A 1EX5A 3DC8A 3IS4A 1HKWA 1WKFA 3W6MA 3QSRA 4LEQA 3GO2A 1Q6LA 3BQ5A 3QY8A 1T0OA 1NDZA 5LHEA 2DIJA 4RNFA 3DXIA 3ANYA 2DVTA 1PWMA 1WZMA 1K6WA 1E0TA 4GK8A 3CIWA 1WOAA 3CEPA 4UTLA 1R47A 3AC0A 2O9PA 4AD4A 1EC7A 1RD6A 4K7VA 3AXHA 1JDCA 2JF7A 1XYCA 3BVJA 3EOOA 1XSKA 1OT1A 1OFEA 2YR1A 4PSPA 3ZMRA 3GG0A 2CXEA 2CLOA 1HO1A 5LNSA 3CWHA 1RHCA 3PPFA 4BF7A 3T9PA 3DI0A 1UYQA 2O9OA 3SIZA 4GUJA 3W72A 1K70A 3IWPA 4Q4QA 3IK2A 4A8RA 4GNKB 3C0JA 1R2TA 3ITYA 3PPGA 1NP0A 2RKXA 4H9VA 1KXTA 3UWQA 1O95A 5D05A 1ODUA 2A6LA 2E5CA 2HBVA 3B0UX 1MYRA 4H6KA 2XVKA 5A6SA 2GJNA 4B3ZA 4PH6A 1M5WA 3EMZA 2PDHA 4A29A 3TEVA 3WZ0E 4F2UA 1YBQB 3OIXA 4GBDA 2RHGA 3NZRA 2XVPA 2WNNA 5D8WA 1OM0A 3BG9A 3WQFA 3GSMA 1SMDA 1CEOA 4JCLA 2YB1A 2EPHA 4NL1A 2X0HA 4O57A 4HU8A 1SW3A 2F2KA 3QR3A 4K39A 4UUIA 1DXIA 2VGFA 4R9OA 2XVNA 3HPSA 2FZ9A 3N04A 3OVGA 2Y62A 1KGWA 2VUNA 3I68A 1MDRA 3ZOAA 1O5XA 2WCAA 1U1JA 1Y5WA 3BO9A 1TPWA 4RXGA 1R30A 2XGBA 2R14A 4ZXOA 2J77A 2VZUA 3A13A 4J28A 4CQCA 1H49A 3GXTA 2H8XA 1JZ7A 3BAIA 4ZB0A 2Y2WA 3VIOA 4JFTA 1QO2A 3TC7A 3M4HA 4TV6A 4LS0A 3GXMA 2CPUA 3CJPA 1SR9A 3U4FA 4CD4A 1LRTA 3EWDA 1IGWA 2O4MA 4AHOA 6XIAA 5DBUA 3PN8A 4FNUA 1E9IA 2PMQA 4NJHA 2V5BA 1V0MA 1TELA 3W7QA 4E4PA 5I0DA 4WR3A 5FESA 1Q2SA 1NY1A 1W5PA 3M0VA 3P2VA 3W1MA 3I3EA 4F2TA 2GOKA 1UZ1A 1B3ZA 1MNZA 1R9XA 4R53A 3RITA 1QI2A 4MNJA 1BF6A 2E77A 1TG7A 3WBAA 2X2GA 8TIMA 1CLVA 2PDFA 5F7UA 4FALA 1XCWA 1P0NA 3QOKA 4HU3A 3W27A 2EPOA 3TR9A 4C6EA 2XH7A 3W86A 1W3LA 3TSDA 3LRKA 4IQLA 4CEXC 1GPFA 3KTCA 1ECQA 4NAEB 2ZRUA 2VJXA 3QJAA 2CLKA 4LOCA 1W2VA 2G3FA 3IRDA 2R94A 2OYLA 3UQNA 4CQBA 4Z2HA 4L1GA 4UMCA 1D3CA 4DPPA 2QNEA 3U5UA 1B9BA 2A3EA 4V27A 1Q6FA 3R11A 3LM7A 4GJJA 4MY8A 3NPWA 4GYPC 3MWAA 4Z2KA 4IIDA 3PZGA 4S3FA 4DHGA 2RH9A 4AB4A 8CGTA 3VU2A 3N2MA 4D8AA 1TJPA 4CEUC 1FWBC 4M6PA 1V6XA 1G94A 4WKFA 2YSWA 3MJMA 4E4FA 3SCPA 3WQVA 4BI7A 2WPBA 2OVLA 2FGLA 3WFAA 1DBTA 3LD5A 1G67A 3ZS4A 2BASA 3M5YA 1WDWA 4YXGA 2KX9A 3SR7A 2BHYA 2WOQA 3BG3A 4NRRA 3ALFA 2ZVIA 3IUDA 3K13A 1H5VA 3L0NA 2Z00A 3TV8A 4YWSA 4AWSA 1PDZA 5FEZA 2W62A 4IGNA 3RLVA 1RBOB 3GQYA 1F5ZA 2D2GA 2C79A 4DYEA 5A6BA 3S42A 4LUJA 3RM9A 1UH3A 1UW9A 2IW0A 3U2ZA 1VFTA 2ZZ7A 1AK5A 2V81A 5HXMA 4HSHA 2HXUA 1XC6A 4GABA 4F9DA 5M5DA 3W75A 4IPIA 4EPKA 2DH3A 1XDMA 1BGGA 2W79A 1W1VA 1CGTA 2WMIB 3CL8A 4HNTA 4CNTA 3WNLA 3Q58A 2AKMA 5G1YA 2WVVA 3BL3A 2OU4A 3VD5A 1Q6RA 3PBWA 2VQUA 5DELA 4MADA 1L2QA 1F3TA 4WKHA 1HJQA 1CXIA 3KAOA 5FIPA 2Z7KA 1QK0A 1DQXA 3ZJ8A 3M0HA 2ZZ6A 2XFYA 2GQ9A 4TR9A 3FEQA 1NF0A 4M56A 4F0KA 3BGAA 1XLEA 4AW7A 2DP3A 3L4YA 1SGJA 2QT3A 2EXOA 3KLLA 3VCCA 2PDPA 2WB5A 4GUIA 3G1FA 3MBDA 3W7EA 3TMLA 3WK1A 5LIKX 1X7FA 3FXYA 4HMNA 3UJRA 4ZGYA 1VRDA 4R7OA 1K8ZA 4I5UA 5HMDA 3S0CA 1K03A 4Q8PA 4Q4SA 3M6YA 3R12A 4HD5A 3DC0A 3WDIA 2VURA 2Y7GA 2WW5A 1IEWA 5IXEA 1E6PA 1HGYA 2IXUA 2J7CA 2C91A 1PS9A 2WC3A 1HP5A 2XPKA 4EE9A 1HW6A 3DEQA 1N2VA 1J4EA 4FOKA 4QNWA 3A9IA 3HURA 3M5VA 5CQ1A 2UY4A 3TSMA 3GNXA 2O4QA 3QGKC 1PX4A 3VILA 1RBLA 1Q63A 4QCEA 4W84A 3W71A 2CETA 1LT7A 4GYFA 1J01A 3NSNA 3SCOA 1JCTA 4ONVA 1QXLA 5FF0A 5DXXA 4S3KA 3E2VA 3A5VA 2OEKA 2Y63A 3OVPA 4GIYA 4H6RA 4S2BA 3B9EA 1BVZA 2VDHA 4AIOA 1NF7A 4EWJA 3T0AA 4ZOAA 1TMQA 2C14A 3JR2A 4FEZA 3RFAA 4RX0A 5D38A 3VC5A 4L4OA 2X16A 3S4TA 4DJFC 3HBLA 3UJFA 4AMAA 4KFOA 4QCFA 3P0WA 5M2FX 5BCAA 3S9YA 1EBHA 1GWJA 2E8ZA 2VXNA 3EOLA 4QE5A 1LOQA 4UFHA 5KZ6A 1DIDA 5HR7A 4CN1A 3W7MA 3QQWA 3UJ2A 5IHSA 3HM7A 1GOOA 2NXGA 4S3EA 3WELA 1PX8A 1XL9A 2YBTA 2WMGA 2OWWA 2R1NA 3P80A 4JTFA 4PTWA 4LT9A 1WDDA 1UD6A 3FA3A 4K1GA 4NJIA 4I90A 4LSBA 1RLDA 4IGHA 2PWHA 4C6DA 4D6IA 4AYGA 3KTXA 1TVPA 2WZHA 4Z2IA 1WXJA 3RAOA 3B4UA 1B4EA 5GNYA 3H26A 1BAGA 2X2YA 1OZQA 2D24A 3DAQA 2R8WA 2BVTA 3KZSA 4L6HA 4IFKB 1FH7A 2HPIA 4P7RA 1BG4A 1VYRA 4JYEA 4YVVA 2VZSA 4MM1A 3KCLA 4R34A 4OBTA 4NNAA 3UXAA 3AIEA 1JUKA 1RVKA 3A4XA 4IFKA 1VFFA 4REQA 3WLHA 2B0MA 3WDPP 3BW4A 3E96A 1PX3A 4Q8VA 1HX0A 1W3JA 3WNOA 4IQEA 4NP7A 4L80A 3WLOA 3JVAA 1N7KA 2VEGA 3WDQA 1FTXA 5DX7A 1G69A 5AC6A 5TAOA 3LB0A 1FHVA 1JVNA 1X6NA 8XIMA 2VC7A 2CKSA 1ITCA 1ZZMA 4F66A 2JIEA 4QISA 1DE6A 4XZNX 5LNUA 2NVCA 2DJXA 4PE8A 1V0NA 1OY0A 5I06A 3TYDA 1KM6A 4BZYA 2R9RA 2YL6A 1YEYA 3B05A 2Q3RA 3ZT7A 3P84A 2DUXA 4JTHA 3PBGA 4XV0A 4YNGA 3AHZA 3DI1A 1ADOA 1XLGA 2HNEA 4AZCA 4JIIX 3CU2A 2REQB 3AWNA 3W1RA 3PP7A 3B8VA 4WKAA 3TCSA 3TQKA 5CAKA 2D2HA 3CT7A 3EZ4A 5D2WA 3GDRA 3SGGA 3NGJA 4HP5A 3VK5A 5T8GA 1UOKA 4F3HA 1FBAA 3WCZA 2AL1A 1W1B1 3QR1A 4QJ5B 1V3LA 4AIEA 1PZ3A 4S3AA 3JU2A 2H9AB 2CFFA 1R85A 2AAMA 3VO0A 5ECVA 2QVHA 1OHLA 1G1YA 2ALDA 4HNOA 3A3WA 3R5EA 4H83A 3VI2A 1YDOA 4RDZA 2RDUA 4UR7A 4Q22A 2VCAA 1ENUA 3FVMA 1MFUA 1B1YA 2BXVA 4DZIA 3LM3A 4UOJA 1Q6GA 4ATDA 1CXLA 3K30A 4MZ1A 2MNRA 4HMEA 1B54A 5FJIA 2YDAA 1FQ0A 2J8GA 4GYKA 4JDYA 7CGTA 4KRTA 4I8YA 3SRDA 4UB9A 1TCMA 3T2OA 3VKKA 2BX7A 3GLCA 1H60A 3PAJA 4Z0SA 1YDVA 2Y5JA 1F05A 1KQZA 4JY8A 3I3BA 3ZWSA 1FWCC 5XIMA 4D6HA 1TWDA 4H8UA 1L6SA 2WCSA 4FNSA 2MANA 1E9LA 2JALA 3OLDA 1EJWC 2OWXA 3VDCA 1NU5A 5ABHA 1IZJA 3TOYA 1YNPA 4QQUA 4HB7A 4G1KA 3ES7A 3S1VA 2Y5EA 1DJYA 3RF9A 1JD7A 1I1XA 4EVZA 2YA1A 4JPGA 3S1WA 3I10A 1GYMA 2VEIA 1MUWA 5A8OA 4UFIA 1C3FA 3ANUA 1XIMA 4H8VA 1S2VA 1GVSA 3LQGA 1SUXA 3N4FA 1LWHA 2BB0A 2IQDA 4DF0A 4PUUA 1D7FA 1TPH1 3GTNA 5G2WA 5CZKA 1PL9A 3Q37A 1GGOA 2YIHA 1A5BA 4GY0A 2ZUSA 2AMGA 2VX5A 2WK2A 3D6NA 3LPGA 3ERPA 3E6EA 4INFA 4O11A 3TYAA 4J9JA 1KM3A 3ARPA 1W1TA 3ZQ9A 5KZEA 2REQA 3C4UA 4F0MA 2A2IA 5EMLA 4DBUA 4HNVA 3AMDA 1EUAA 3UT0A 4EAMA 5ENLA 4PMUA 3ATZA 3CZGA 2G8ZA 1MW1A 5A8MA 3QMRA 1XLDA 4JKMA 3WSUA 1IZCA 1JYXA 3O0FA 3QLLA 2DSKA 1MZHA 4XAPA 3QHNA 3UU0A 5C2XA 3GXIA 1BF2A 3MDWA 3R94A 5CGTA 4X9YA 2UV8G 3SJ3A 2PDCA 4DO7A 1JZ8A 4C6PA 1EPXA 5TF0A 5JQ9A 5HAOA 5A6AA 4DXVA 4QTGA 3NA8A 7A3HA 2I14A 2UY2A 2Q3OA 1X96A 1OG6A 4C6IA 4PUEA 4Y9OA 3RG6A 4YL2A 3R6IA 4MKSA 1UP2A 1NSJA 2XM2A 4BR1A 4DO5A 1QTWA 3URQA 3VOFA 1B2YA 2CBVA 1R0MA 4GJ1A 2BY1A 1ZUAX 3NM3A 1XGDA 4KPLA 3DHFA 3LLXA 1L6WA 4LCSA 4QLLA 1C93A 4AMCA 1KFEA 4QS5A 3UWUA 3G6LA 1PYFA 3E0FA 2AQOA 2CHRA 2BTMA 2A85A 5AHFA 3SGZA 4LUTB 4A2RA 3GDMA 4EACA 3H2CA 4YYCA 5C0QA 2ISWA 5EMJA 3WF0A 1YXYA 4UQAA 4J3WA 3VGGA 1TIWA 4FIRA 3DYPA 3S5SA 2FLIA 3KOYA 1MI3A 1F3EA 1WE5A 1XSJA 4Z1DA 4GVFA 1Q65A 3QM3A 2G5WA 4PSRA 1TPEA 2X1RA 3DN5A 3CM4A 2I5IA 4XKMA 3WH6A 1IXQA 4B5TA 2ZXQA 3GR4A 2BHUA 3V0TA 3AIWA 4H9MA 3NSXA 4MJZA 3PZQA 1ME7A 1A49A 4F40A 3N9KA 3G1SA 3RCYA 1SZEA 4XK2A 5BXTA 3UNDA 2NLIA 2FVMA 3RJXA 2E28A 4BJHA 1TV4A 1MW2A 3NURA 1SM9A 3HFYA 5D2YA 2CITA 3D47A 4LS2A 1L8NA 3QHOA 1TJ0A 2J74A 2QCGA 2E25A 1JQXA 3TLLA 4JTJA 1FH8A 4DI9A 1T99A 5I3JA 3FY1A 1DYSA 4AZ5A 4Y9MA 3A9BA 2OG9A 4YVPA 3HPZA 1YDYA 1WPCA 2TMDA 5HDRA 4HYRA 3E38A 4V2XA 1E6ZA 2ZUNA 5FJOA 2HDJA 2EG6A 1EKOA 1UR4A 2PLJA 5C2CA 4RDWA 3VOCA 1Z32X 4WJEA 2EJAA 1G9HA 1C9WA 2P50A 1J0IA 3MUXA 4NX5A 1W8SA 1VS1A 4JZ5A 5HWNA 1E56A 4CNUA 3T0BA 4S3GA 1KM1A 2Y6ZA 3NQEA 1T7LA 4DUWA 1US3A 2WZEA 4GQ0A 1BKHA 5ABGA 3ZR5A 4XSMA 4ENLA 4MB5A 3N11A 3FDKA 3TJIA 1TJRA 4WEVX 3MB9A 2VZVA 1HJXA 4PEEA 5AC7A 2PDJA 3FGCB 3OZMA 3BAYA 1HQTA 2XZ7A 1ZRQA 2CWNA 3CV7A 4W88A 4HCLA 3SRHA 1ZBKA 1ESWA 3LGGA 3W73A 1J11A 3TQVA 1FRBA 4C6CA 3OYXA 1NIUA 1TB3A 4LUSB 3Q45A 4TX6A 2C71A 1R2SA 4IX0A 2X1IA 3N4EA 1V93A 1K1DA 1GT8A 3MHFA 2EQDA 4KESA 3MCOA 2J4GA 4DZHA 3UA3A 4PFHA 4MKNA 4XD5A 3HOJA 4PUNA 4HJWA 4LW7A 1PUDA 3GK0A 3EWWA 1ZBWA 3CUXA 4KEZA 2PRHA 1UMYA 4WOQA 4QQ3A 3V75A 1WDRA 1R3QA 3B40A 4PUWA 3DFQA 2L5HA 3BJSA 2W63A 1TO3A 1EWEA 1VBRA 1G0CA 1J2BA 1VBUA 3TA6A 3FA5A 3GR7A 3HA1A 3F4DA 1EJ7L 2ODOA 3SI9A 2PWGA 2ACSA 4I7UA 2DY3A 3DBPA 3ZR4A 3FKKA 3N19B 2FGBA 1S5MA 4E5TA 4JDBA 3E9AA 4FXFA 3HGSA 3TIMA 4MF4A 1GVEA 3M0MA 3W7RA 2PS2A 3VPLA 3CYVA 1RJPA 2Q01A 7PTDA 3LLDA 3P7YA 1BKSA 2J7GA 1JAEA 1YTDA 4XZ9A 4IHCA 3DGBA 3UFYA 5GPRA 1P6BA 5HULA 3S1XA 5HUPA 3W9ZA 3VOGA 1E0UA 3VIMA 4Q3MA 1LP6A 3UXIA 1ZSXA 4BKNA 1M7OA 1F8IA 4DJDC 3VIHA 4A21A 3PTMA 2Q02A 3AHVA 1Z42A 4HIBA 2GGHA 1MZRA 5C5YA 4WJ8A 1JGMA 4IXHA 3TJLA 2V3EA 1DXFA 3UG5A 2C3ZA 1DHPA 3SCTA 1XLCA 4BWLC 4KKXA 1IXNA 3SUVA 1JDFA 2E1WA 3W1LA 3SM0A 1IIGA 4B91A 4LB3A 4PTNA 4BEUA 3LTSA 2DUZA 1X8FA 3CIVA 2W6RA 5E70A 3NPXA 1EL3A 4V28A 1OIMA 3TC3A 4YTRA 1XBVA 1DWJM 3DYMA 4H3DA 2VFHA 3GFXA 1W1IE 1Q8JA 1CB7B 1XG4A 3PNUA 4N02A 1QPKA 2YBVA 2QYGA 1WDPA 2FZDA 3L0GA 2OYMA 4LVFA 4PA8A 4MJ2A 1EDTA 2WHLA 2ANUA 2HSAA 3QYSA 2RUSA 1VPQA 1J6OA 5EPDA 9XIAA 1V03A 3M9YA 4KIRA 1XUUA 5H8PA 2C16A 4PBGA 4ZL1A 3WO8A 3R58A 2ICSA 4FNTA 1TWIA 3DUGA 3AJXA 4AZHA 5EMYA 3QSTA 4HZ6A 4U5IA 2X41A 1K4HA 4UFLA 9XIMA 4JQ3A 3YPIA 3F2DA 4MVAA 5K2ZA 4H6QA 1IYXA 3NOEA 2QJIA 1A80A 3PWGA 2HISA 3RX4A 1LL7A 3THCA 4I9JA 3NGFA 1AMKA 2G95A 1QNRA 1AG1O 5A8NA 2F7FA 2VGGA 1GJUA 2FHFA 5HINA 2NWSA 3GDTA 4C7DA 1A3XA 2DU2A 2YJQA 5G1MA 1PHWA 1P0DA 1BTMA 1M1BA 4FF7A 2WKLA 2HCVA 4H4IA 5HR6A 1P0KA 5CZJA 3VZXA 3PJXA 2V82A 4NI8A 4HOXA 5KEZA 4L9YA 1AD4A 3TVAA 5LIUX 2OQHA 2GWGA 4PB4A 3P5YA 4R7WA 1KR1A 3TN4A 5FL1A 5CLTA 2NVDA 3NVTA 5G5IA 4H00A 3S3GA 1JF6A 3MC5A 4DI8A 3BJTA 3PZNA 4AXKA 2WHKA 1QWKA 5CEWA 2VOMA 3B8DA 3MSRA 4HNLA 4LUYA 5A8GA 4Y9PA 4UTTC 4W9TA 1NAL1 2I57A 2J27A 1LCOA 2CIPA 3BW3A 5ABTA 2JKPA 4JQAA 2V5DA 3AICA 3N3MA 3MPGA 1B3XA 5A3HA 4KW2A 1F61A 4FLQA 2PRLA 4YLWA 3VM5A 1RZMA 2NUWA 4XZWA 1PIFA 4BHYA 1ISYA 1W5NA 3ITCA 1LTDA 4I9AA 4MPKA 3PBYA 3RJYA 2GGIA 3O3RA 4GX8A 4WXZA 4QJ4B 3MKVA 5EFFA 2IXVA 5D09A 5KSWA 3S6TA 5HA7A 4XAFA 3CZKA 5FOOA 5ABFB 4JAWA 4DUOA 2BP1A 4CLMA 4UMBA 4XZIA 2B7PA 3F4CA 5DRCA 5HATA 3BAWA 1SU5A 2FPTA 5CPTA 1X1ZA 4O0ZA 3GG1A 1XH1A 1X8CA 4KWWA 4X2RA 3EWZA 1VHNA 1U1HA 3T40A 1C8XA 2PTXA 1R9YA 3PBMA 4PB3A 2PURA