3PTKA

The crystal structure of rice (oryza sativa l.) os4bglu12
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
478
structure length
478
Chain Sequence
PVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of rice (Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-glucosidase with significant thioglucohydrolase activity
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
molecule keywords Beta-glucosidase Os4BGlu12
total genus 193
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ptkA00
3OG2A 3SCOA 5A8OA 3ALFA 1QI3A 4OJYA 1WZLA 4YPJA 3TP4A 4JHZA 2E3ZA 1ZL1A 2XVGA 3TTYA 1W2VA 4H04A 4M82A 1MFUA 3IJ9A 3AMDA 2X8RA 5EFFA 1QBAA 5CSUA 1VF8A 4PMYA 4LYRA 2ZUWA 3ARXA 1U2YA 3MO4A 2W61A 3T2OA 3WNLA 1HF6A 3PZIA 2C0HA 2JF6A 4W7VA 1JD9A 1WB0A 3UERA 2ZXAA 3NDYA 4W8AA 1W32A 5AC5A 2EQDA 1NOWA 4XUYA 1EO7A 2CITA 2WCGA 4TTUA 1B30A 1EHAA 2D23A 2V5DA 1DWHM 5ABFB 5BXRA 2GDVA 3BAJA 3WD0A 4OUEA 4JHOA 2BY0A 4WSKA 3PHAA 4TVDA 4CN4A 4KGLA 1KQZA 3O2LA 1TVNA 3VIIA 1VFUA 1C93A 1QOXA 4J27A 3WNNA 1GVYA 2WC7A 1DWFM 1RP9A 1E15A 4W5UA 3BMWA 2QF8A 1FHDA 1WAWA 1YQ2A 1OSEA 4A3YA 1WE5A 3QOMA 2GJPA 3T2QA 1H1NA 1E6NA 2D0HA 1RD6A 1NM9A 1BYCA 1KXQA 5IHRA 3VU2A 1HJSA 3WIJA 4JL1A 1LG1A 2ZX9A 1W9PA 4D6JA 3T0BA 2BY2A 2DIJA 2ZWZA 4IISA 2XM1A 3L4YA 2V3DA 2XSAA 2PWFA 3ZM8A 4CU6A 1UWSA 2G3NA 3EDEA 3OGRA 3CTTA 3AQUA 1VB9A 1E0VA 3DYPA 2J4GA 2VTFA 3VIKA 2BFGA 3A4WA 3SUVA 1J11A 2ZUTA 1SMDA 2EPKX 5A95A 3N18A 1JIBA 1JL8A 3VMOA 3UR7A 3U5YA 1EXPA 1MWOA 4GI8A 1PJ9A 3SCTA 3MANA 1NOFA 1ZB5A 1E4NA 1SYTA 4XB3A 4BA0A 2W5FA 4ZEPA 1PEZA 1PAMA 1VEMA 4CCCA 3ZIZA 3WN6A 1CXIA 3OGVA 2E9LA 3GYCA 1GORA 3HMCA 3O6AA 3CMJA 4FLSA 1XV8A 5FIPA 5E6YA 1FOBA 2WLZA 3F5LA 4BQ5A 3QHNA 3VILA 2QMKA 4U33A 4D6GA 5I0DA 2PBOA 5KZ6A 2Y4SA 3OLGA 1PX8A 2GK1B 2XG9A 4MAVA 5D9PA 1HKJA 4QLJA 1GQIA 1JDDA 1C91A 4A4AA 3ZR6A 4PMDA 2J8FA 2UY3A 1TA3A 1UG6A 2W91A 2VX6A 4AZCB 1H0GA 4NI3A 1JD7A 2WWDA 1B3ZA 5E09A 5BROA 4CU8A 3DYMA 2Y8KA 2YA1A 3OZPA 1E6PA 3RM4A 4HA3A 5AYIA 3LPPA 1BVZA 2BXYA 1E5JA 4J3UA 3WQVA 1V3LA 1GUVA 2E0PA 1RPKA 2CYGA 4FLOA 3AYRA 1H0IA 1W3KA 1JXKA 2ZX6A 4PSRA 1H2JA 5ABGA 3N11A 4N0RA 2G8ZA 3VIFA 1Q4NX 1QW9A 4M1RA 2WVSA 4V28A 3IJ8A 2DT2A 4HOZA 1CGVA 1H5VA 4PTWA 3VD4A 5JUVA 1M7XA 1K6AA 3SCWA 5BYWA 5E70A 1OB0A 3WBEA 1JDAA 3WL0A 4P8VA 2VL4A 3L4TA 3WH5A 4URIA 3RM8A 3VOCA 3VVGA 3U7BA 1GJUA 3VMNA 4AD0A 1W3JA 3W24A 4QLLA 3SCPA 1XD0A 1F4AA 3B9DA 2D0FA 3CZEA 4PMNA 1E3ZA 1QBBA 2Q8XA 4CD7A 2JF7A 5CPTA 3FXYA 2BVTA 1AQ0A 2B31A 1GQLA 1UWQA 3PZMA 3WMBA 3A4AA 2DSKA 2JEPA 4PMXA 3BAXA 3VIJA 2VX5A 1OM0A 4AEEA 2Z1SA 5M3WA 4D71A 4W7WA 5I6SA 4GO9A 1HVQA 1MW1A 1MQPA 2X2YA 3ARZA 4OOZA 4Z2LA 3CH9A 2XIIA 4CD5A 2TAAA 5M03A 3CHCA 2OSYA 2XGBA 3WUBA 1RH9A 3IK2A 2VRJA 5HXMA 3WD1A 1CGWA 3WNKA 1QI0A 4DM2A 1WZAA 1BYDA 1ISXA 1FHLA 1E73M 2WPGA 4RE3A 1UKTA 4Y7EA 2Y8VA 3K4DA 1ZBCA 3MMWA 1VFOA 1HNYA 1JZ6A 3W0KA 4TOQA 3AHTA 1V3KA 4V2XA 3EDKA 5FD0A 1J0KA 4E2OA 2WC3A 3L4XA 1KWGA 3VD5A 1EHNA 2X1IA 2E8ZA 5FL0A 4L4OA 4GZJA 4JKLA 1VRXA 5EFDA 3WQ4A 2ZX8A 1QI4A 3HU7A 3CUFA 5AYBA 1FFRA 2ZUMA 3CIVA 1WDRA 1BVNP 4H41A 4IPLA 3WDPP 1HJVA 3B9AA 2OLHA 4NRRA 2BNJA 4AZ7A 2J8GA 4JKMA 1UOKA 4KRTA 5FKYA 4GKLA 4HOXA 1FH7A 1WP6A 3BAIA 4JFWA 1IZKA 2WHJA 2VZOA 3GNOA 1HX0A 2ZX7A 1JZ7A 5D9MA 1FH9A 3WKZA 1HJUA 1PIGA 4LYQA 1V3JA 2WSKA 1ZU8A 4TVCA 4B3KA 3VX1A 2VOTA 1UKPA 4M80A 1W2PA 4ZXLA 4Q22A 2DIEA 1M53A 4PTXA 1QNPA 1UR9A 1OINA 3NJ3A 3W6MA 1UWRA 5FL1A 3WUEA 2XVPA 1BF2A 4WK9A 5CGMA 3PN8A 2UWFA 5LA1A 3BLKA 2FHCA 3WDIA 1CXFA 2WMIB 2UY5A 3EDDA 1NOUA 4JAWA 3WSUA 3T08A 2WZEA 2V38A 1C7SA 1WCGA 3OIHA 1ZJAA 1V3HA 4H7VA 2CCRA 2WK2A 1B2YA 1VEOA 4ATLA 1DWAM 1QNSA 3WDHA 3VO0A 4M81A 4CCDA 1E5NA 1HKMA 1R85A 3VGBA 3APGA 2Y2WA 1BSIA 1SMAA 4JFSA 2WZHA 2NSXA 1R87A 1ISWA 3FHAA 1KXVA 2G3JA 4MNJA 3U5UA 3EBVA 5C8BB 5LA0A 1CGXA 3NYDA 1KBBA 3N15A 1D2KA 4OBRA 1WZMA 4B3LA 4W89A 1CIUA 3MS8A 2J77A 1CPUA 5AY7A 5A6KA 2OYKA 2WVVB 4MJ4A 2VX4A 4X0NA 5HNNA 4BQ2A 1V08A 4CGTA 5CJ5A 1UWUA 1CECA 2J47A 5IHSA 4U31A 5CGTA 3OLEA 2WXDM 1VJZA 1UQYA 2ZXQA 3ZJ8A 1VENA 4EANA 1C92A 4J7RA 5I3DA 3AJ7A 4MDPA 4DWSB 4PYSA 1GJWA 3THCA 1JF6A 2XFYA 3GZAA 1E43A 4BF7A 2W67A 3SCQA 2WVTA 2CIPA 3L4ZA 3ZO9A 2VNCA 1AQHA 3E1F1 4TUFA 1JGIA 4J3VA 1UH3A 1OIFA 4KRUA 4D72A 8A3HA 4KGJA 3GXDA 3AHZA 3WY1A 2AAAA 3OB8A 4TXEA 3CHDA 4D1IA 1DEDA 1UHVA 3VIGA 3AIWA 1NWRA 4NF7A 3S6TA 1JYWA 2FH6A 1LF1A 3TTSA 2VMFA 1ITXA 1B9ZA 1B1YA 5JBDA 2VC9A 1PX4A 4MNKA 1MFVA 3KE0A 4WKAA 5D8WA 1KQYA 2QPSA 2BVDA 2C8NA 2FDMA 4MNLA 2VCAA 3BXWA 4M29A 1IZJA 3GXIA 5D9NA 4B9YA 4HA1A 1J18A 3NCOA 1UD8A 4TTGA 4D6DA 1JZ8A 3CPUA 3KWXA 3WDJA 3AHXA 4NRSA 3W28A 4LYPA 4P7LA 1ESWA 2CESA 3K46A 4XZWA 2MANA 4UOJA 4PMOA 2W63A 1EDTA 4U5IA 1KGUA 1QI2A 3N9KA 3CZ8A 3GNRA 1OCQA 1KXTA 4PN2A 3LPOA 2J7HA 3IANA 1TCMA 3VDHA 1H4PA 2YDRA 3WDRA 3DHPA 3UETA 1VFFA 4UFMA 3A3HA 3CLWA 4IUGA 3M07A 3GBEA 1O6IA 2WAGA 3POHA 3WDQA 3WH7A 1V6XA 4D6FA 3RIKA 3DHUA 3PZUA 3WFLA 4LQ1A 1VFMA 1CGTA 2OSWA 3D5HA 5D8ZA 1V0NA 4AIOA 3RM9A 4ZENA 2E9MA 2ZX5A 3AIQA 4B9ZA 4UTFA 1BLIA 3RJXA 4GQRA 1QHPA 3F5KA 4CD8A 1V0MA 4ZE4A 4DWSA 1XYFA 3IAPA 5I78A 2VZTA 4HA4A 2YLAA 4JCLA 1E6SM 1EO5A 4UQBA 4GXPA 1DP0A 5CLWA 1JG9A 1QHOA 3DECA 3MV01 1OGGA 5A6LA 4PMVA 4H8UA 2E9BA 1M04A 1JAEA 3BGAA 3OLDA 2QPUA 4BS0A 1CGYA 2X0HA 2YA0A 4AWEA 3AICA 3N04A 3W37A 5GQBA 1L0PA 1UKQA 1WKYA 2XFFA 5C71A 1JZ2A 1VAHA 3FNDA 1DWIM 3NUKA 1GHRA 3I3DA 2WMIA 4F9JA 1JYXA 4XV0A 2RGLA 1KFWA 1D7FA 1HL9A 4BQ4A 4HMDA 2YL9A 1HKIA 2V3FA 2EPLX 2PWGA 1EQPA 2ZOXA 3WD2A 4PCTA 4UNIA 2J62A 1K9TA 4HTYA 2EEXA 1CTNA 2D20A 2WMKA 3GBDA 1C8XA 4R27A 1C3FA 3MU7A 4ATWA 5ABFA 4ACZB 1E6ZA 2V3GA 2BXZA 1W3LA 2EPOA 3RDKA 1VBRA 4WJXA 4M56A 4AYSA 4XZBA 4PBGA 4P7OA 3QHOA 1E72M 3W53A 2BHZA 5CPQA 1ODZA 1MQQA 5DT5A 3BH4A 3AISA 2J25A 1Q6CA 5IFPA 1BHGA 3WF4A 5CZKA 4UFIA 1V3MA 4QP0A 2ZUSA 3ARQA 1GOWA 1JYNA 1GVIA 3VMPA 5CQ1A 1Q6EA 4AZ6A 4Z2JA 1W9DM 3AXIA 3ZJ6A 2OWWA 4MPKA 3CUGA 3NSMA 1UR1A 4UQEA 3ARTA 5A1AA 4TX6A 4B16A 3AS0A 5CXPA 4UOQA 2YBTA 3O9NA 1DWGM 2GFTA 1C7TA 1J0YA 3F4VA 3AYSA 4HPHA 1JYVA 4S3KA 4P7QA 4C7GA 1KXHA 1BGGA 2DPEA 1XSIA 2XJ7A 3KZSA 4PSPA 3AS2A 3CUJA 1JAKA 1M01A 1MYRA 1DTUA 2ZUUA 5A6MA 2BS9A 2XGIA 3WUGA 1V02E 4CUCA 4AXNA 2XWEA 3VDBA 2DGAA 3A6OA 1V03A 3UEQA 3CZLA 3KL0A 5A6JA 4C7DA 4W87A 4BCEA 2VVNA 4K68A 2YIHA 5C70A 2DSUA 2DT3A 3AMKA 3JUGA 4FMVA 2VCCA 1HP4A 2X09A 3WBAA 3L4UA 1BPLB 1KR1A 1UZ1A 2GVYA 3I3EA 1ISZA 5IDIA 4OZOA 1I75A 3TOPA 3ARPA 3W82A 1H3GA 3RO8A 3G6LA 3F5JA 2WANA 1HN1A 3RJYA 2VR5A 2VZSA 1IV8A 2FHBA 3VM5A 1A3HA 2QV4A 4GPNA 2EPMX 3AIBA 1YHTA 1V0LA 2ZXBA 3UCQA 5JIWA 4W86A 4JFUA 1XCXA 4NSBA 3VIMA 2JIEA 2YDQA 5A2AA 1B3VA 2EBNA 4U2YA 1US3A 3ALGA 1P6WA 3WD4A 4FLQA 3VGEA 5BWFA 1EOMA 3AHYA 4YN5A 2J7BA 5HBFA 1QHZA 2GDUA 5A94A 4EKJA 4MB5A 5A3HA 4P8XA 1E40A 3BCFA 5I79A 5A6AA 4WIWA 3ZT5A 3WNMA 2BHUA 1UQZA 3WEOA 4WLCA 2Y5EA 2A3AA 3SEPA 4UQ9A 3KL3A 5I24A 3AMLA 2WMGA 4P8WA 1TR1A 3N17A 2IXUA 1CBGA 3PZQA 4UFHA 3D3AA 2YJQA 1GW1A 1W3HA 1JFXA 1KCKA 3SURA 3AMGA 1EGZA 1Y7VA 2J79A 4HZ7A 1N82A 3WNPA 4AZGA 4DM1A 4UQDA 4F9DA 2CBVA 5LYRA 1JI1A 1G1YA 3MUAA 4J3SA 3WL1A 4FF5A 3NSXA 2ESCA 1PZ2A 3WMSA 3EYPA 1W1PA 2A3CA 4PTVA 4H2CA 4CN1A 1FH8A 3GDBA 4J3WA 2J74A 1GPFA 4CD4A 2F2HA 2PI6A 5A2CA 1TA3B 2ZIDA 2EO7A 1UD3A 4D1JA 1GZJA 1X6NA 3W4RA 1XSKA 4UZUA 2ZUNA 5HPOA 3OLIA 1GQKA 3AFBA 4LPCA 4AZIA 2PF0A 2Y24A 4MDOA 1W9XA 3ARSA 1XCWA 3ZT6A 3VD9A 4UOZA 3GH7A 3UG4A 5KEZA 2RGMA 5IXEA 1IT0A 1XGZA 1DWJM 3A47A 4Z2IA 2CBJA 1BGAA 2ZICA 5GPRA 4RE2A 2WWCA 3AZSA 1E3XA 3ECQA 1HL8A 1UYQA 2G3IA 3VIOA 4PMQA 2J7EA 5A8MA 1E4LA 1WDSA 2VX7A 4J28A 1BG4A 4JIEA 4HU8A 2WNWA 3PTKA 3DYOA 3QR3A 4DWSC 3I3BA 1V6WA 3WQ6A 3WH9A 1LL6A 1G94A 3MUZ1 4D6HA 4LGXA 4J3XA 3SUUA 2W4XA 4PUEA 4MTVA 1KB3A 4OOUA 1GCYA 1C90A 1CXHA 1WPCA 1ISVA 2DSZA 3WH8A 3AOFA 2JIWA 4W8LA 1UKSA 3ZR5A 1R7AA 1D3CA 4QCEA 2CETA 4PTMA 1MW3A 2PWEA 1JZ3A 2WYSA 2WKGA 2WZIA 2WW5A 1EDGA 1WNOA 3IJ7A 1HJQA 2JEQA 2WCSA 3BLPX 1TVPA 1UD4A 2CNCA 3ARYA 3THDA 3VIHA 3WEMA 1E0XA 2UY4A 3BMVA 3EDFA 4JKKA 4D6CA 1X6LA 4A3HA 3PZOA 1E4MM 1NQ6A 1UD5A 5GNXA 1J9YA 2V5CA 4YHEA 1NWSA 4LX4A 3L4VA 2O9TA 1EH9A 1NWUA 2OWCA 3WMCA 1XC6A 3VDCA 1CENA 2YA2A 3VGFA 1V02A 2J7FA 1KCLA 8CGTA 1XH1A 5I2UA 5CPSA 4EK7A 4GQQA 2WCAA 1SR0A 4HZ6A 3PZVA 4HMEA 2G3MA 2WVUA 4RL3A 1ECEA 3ZJKA 4HP5A 4NZCA 3POCA 7TAAA 1XH0A 1Q6DA 1HIZA 2G41A 5JIPA 3MSGA 4QDMA 1BG9A 1VBUA 1K9EA 1V0KA 1TZ7A 4F8XA 3ARWA 3L4WA 4U3AA 5DO8A 3RMEA 5D9OA 1L8NA 1JZ4A 1MQRA 4PRWA 2PBGA 4XX6A 2G4FA 5CG0A 2UY2A 3VM7A 3SUSA 2WBGA 1JNDA 3SCNA 1C8YA 1Z32X 1JI2A 2A3HA 3SUTA 1EIBA 4FK9A 1E6RA 2GJRA 2IXVA 4ML4A 2CKSA 2XSBA 2VURA 4BZYA 2WVVA 5A6BD 4CVWA 1OD8A 5D4YA 3BCDA 4Z2HA 4AD4A 3AI0A 2CHNA 2DH3A 1B0IA 3T2PA 2ZE0A 5A8NA 5EB8A 4H8VA 3W6LA 4UFKA 1M03A 1B3WA 4ATDA 2C7FA 3W29A 3SUWA 1C8QA 1PIFA 3SCSA 4MB3A 1QW8A 2DSWA 4CVUA 1OGSA 2PB1A 3WNOA 2VQUA 4D6EA 3EDJA 3WEZA 4AD5A 1BFNA 4CD6A 1ODUA 1LL4A 2IUZA 2YL5A 6CGTA 1EDQA 2DT1A 1PPIA 2A3EA 3WENA 3MUY1 3GM8A 2O9RA 3NSNA 3T09A 3L2LA 2YL8A 1CGUA 2BV9A 1UZ4A 1FA2A 4WKFA 4F66A 3WQWA 1CWYA 2GK1A 3AROA 1OT1A 2JE8A 2J78A 2NT0A 1XH2A 3WQ5A 1E6XM 3OZOA 1ZBVA 4PCSA 1F4HA 4AZHA 1WZKA 1I1XA 4AZBA 4UQCA 1BTCA 1Q6GA 5M5DA 1KGXA 1FP9A 2VO5A 1UR4A 2PWDA 4E4PA 1V6UA 2D2OA 4LXFA 4H8HA 2E8YA 3SCUA 2ZWYA 2CERA 3U57A 4HPGA 2HVMA 1CZ1A 3L2MA 1XSJA 1CLVA 3W38A 1CNVA 2QLYA 1MVYA 1EA9C 1OIMA 2GJXA 1E9LA 2EXOA 3ZQ9A 4ACZA 3UR8A 1G0CA 2YBUA 1G01A 2DQXA 3BAWA 5DEZA 4MAZA 2J7GA 2PC8A 1MXDA 4W7UA 3KL5A 1OWQA 1G9HA 5F7UA 1QVBA 2YKKA 4KH2A 3S2CA 5BCAA 3ZJ7A 3K4AA 3CZKA 5BXPA 4F79A 4OBSA 3EMZA 3WFZA 4GIAA 1KR0A 1JF5A 3AIUA 2JALA 3VGHA 1XYZA 2CKRA 4AW7A 2PWHA 3BSHA 1GOOA 3SIMA 2A3BA 2FGLA 1CLXA 2VUYA 2WMHA 2QHAA 1ZBWA 2WB5A 1JNEA 3CHEA 3CO4A 1QI5A 3K1DA 3WF2A 1OD0A 2EPNA 1B3YA 4DWSD 2W66A 3FY1A 2WKLA 1UD6A 5IFTA 1EQCA 4QCFA 1UUQA 3WQ8A 3N1AA 2O92A 2F8QA 3NIYA 4UZSA 1X1NA 3AZRA 1E70M 1B90A 1E1FA 1XRVA 4Z2GA 4GZEA 4E8DA 1AVAA 2GUYA 3VD7A 4N42A 4W8BA 3M6DA 1J0HA 1U33A 4Q7NA 1BQCA 4X9YA 3W25A 1V3IA 1CEOA 1QNRA 5ECUA 4CU7A 3TONA 4IM4A 1E6QM 4UFJA 3VPLA 4AD3A 1CXLA 2X0YA 3UG5A 3MKKA 3A4XA 1LL7A 4IPNB 2VR4A 1FP8A 2OYMA 5BRPA 3AS3A 3OBAA 1TG7A 9CGTA 1VJSA 1BAGA 4MJ2A 4AZCA 3OA5A 4ACYA 1TUXA 2AOSA 7A3HA 2XWDA 1W9UA 2XIBA 1V6VA 4JCMA 2CBUA 5EBAA 3VNYA 3TTOA 3CUHA 1EOKA 3WH6A 3FHQA 5DF0A 1NWTA 3VIPA 1S46A 1UH4A 3VUPA 5AC4A 4U3CA 3VDAA 2F61A 3EMCA 3PZ9A 1XD1A 3WF0A 2WMFA 2Z1KA 3CMGA 4L4PA 1J12A 3WD3A 5A6BA 2XPKA 3AS1A 3TTQA 1AQMA 1BYBA 2D3LA 2YDSA 3ZMRA 2WSPA 2XVNA 5BXSA 5DFAA 5ABHA 2OYLA 2O9PA 5I77A 3ARUA 1HXJA 2XVKA 2DH2A 4TX8A 4ZFMA 2GSJA 4AEFA 3GH5A 2VZUA 3PZTA 4QLKA 2E40A 3M46A 4DUXA 1US2A 5A8QA 1LQ0A 4UQAA 2CHOA 2DDXA 3J7HA 1LG2A 1W9VA 2WM0A 3GXFA 3SCVA 3W81A 4AC1X 2VI0A 3MMDA 1TE1A 4DUWA 3PTQA 2JFEX 1HKKA 3T0DA 3PTMA 4X0VA 2VT0A 2D24A 2VQTA 1GONA 2ZUVA 1H49A 5GNYA 1ISYA 2QMJA 1QNOA 5CSYA 3AIVA 1MXGA 5A2BA 1ZS2A 5HOSA 2AMGA 3BAYA 1JXJA 4JZ5A 1SFSA 4MB4A 3CZGA 4CN6A 3VINA 1HP5A 4GZIA 2D3NA 3B9EA 1MW2A 2D22A 4HZ8A 3QHMA 4QFUA 4E8CA 2VVSA 2WHLA 2CPUA 1TMQA 2GJXB 4HU0A 2DT0A 5E0FA 4PMZA 1HJXA 1HT6A 2XYLA 1UR0A 2VRQA 4GO8A 3WUFA 1W1TA 3AZTA 4Z2KA 3U7VA 3AHVA 4EE9A 5A6SA 2BVYA 1RP8A 1W91A 3VGDA 4PUDA 1LWJA 4JFTA 3WF1A 4WF7A 5FOOA 2XUCA 6A3HA 3FN9A 4AY1A 1UR8A 4PMRA 1VIWA 1OT2A 3GTNA 4CKQA 3TA9A 4AIEA 2O9OA 4JFVA 1GHSA 1BYAA 5DT7A 3N13A 1UH2A 2YOCA 2CBIA 4HOWA 1JDCA 4AISA 4UFLA 1J0IA 2WHMA 2FGZA 3KEHA 3M7SA 4R5EA 3RCNA 1CDGA 7CGTA 2VZVA 1U30A 1Q6FA 3MUIA 2YLLA 1J0ZA 3ZT7A 4AIUA 4AD2A 4OIFA 2CEQA 4MNMA 4W93A 2BHYA 1NP2A 2D1ZA 1WDPA 4HMCA 3FW6A 1KBKA 4AMCA 2W62A 5HPCA 1PZ3A 1E71M 4WSJA 4C7FA 2XHYA 3CUIA 3RILA 1LWHA 3II1A 4M8UA 1CXEA 1H11A 3VNZA 2WBKA 3LPFA 3W27A 3ARVA 1PBGA 1UA3A 1WO2A 2WC4A 1R86A 4W88A 3B8SA 4QAWA 1DHKA 5FCZA 1TFVA 3BC9A 3CHFA 3AXHA 3MMUA 3CBWA 2NT1A 5BXTA 1E0WA 1XHGA 4YHGA 1J0JA 1PX3A 4EAMA 4AZ5A 1K9FA 1GNXA 5EMYA 4GI9A 1E4IA 2DSVA 3VGGA 1HJWA 1QPKA 5JBEA 3AMCA 1ITCA 4P8UA 3MV11 4ZXOA 1UWIA 4OKDA 4FLRA 1JFHA 5A8PA 3FAWA 1E56A 4CCEA 1B3XA 1NARA 3CZJA 4UCFA 1WDQA 2CXGA 4DUVA 5BRQA 3NDZA 1O7AA 2FHFA 3WF3A 1NP0A 4KWUA 2V3EA 1CXKA 1G5AA 3AIEA 4BQ3A 5E6ZA 2VRKA 2X05A 4W5ZA 1W9BM 3EMQA 1GOMA 4AD1A 3VD3A 3CGTA 3PZNA 3G6MA 3GH4A 5ABEA 1UD2A 2BY3A 4MADA 3T0AA 3ZSSA 2OWXA 1I1WA 2VJXA 1GQJA 1GOQA 5LA2A 3ZSTA 2J7DA 3LMYA 1W1YA 1V6YA 5DMYA 3PZGA 3W26A 5E0CA 1OGBA 2J7CA 3HN3A 2VCBA 1KGWA 3AXXA 5I23A 2WHKA 2BY1A 3BAKA 3FAXA 1MW0A 1UWTA 4UR9A 4ZE5A 2DEPA 2ZXDA 1HVXA 3N12A 3VKKA 3UG3A 1LJYA 3MSDA 5TD4A 3IAQA 2XTKA 6TAAA 1R8LA 1UKOA 4S3JA 4D6IA 3OGSA 1GOKA 5CLTA 1NH6A 1QNQA 3GNPA 5GNZA 3HJEA 4P7RA 4B15A 2D0GA 5I5RA 2WLYA 4U2ZA 1J10A 2YL6A 5M17A 1FFQA 3WELA 4JL2A 4TVUA 5E9AA 4PEEA 2XFRA 2XVLA 4M24A 3ARRA 1VEPA 1A47A 2EJ1A 5A69A 4GINA 4W84A 1H09A 1R7OA 4V27A 1JZ5A 2J75A 3ZOAA 3QGVA 1CYGA 4RE4A 4KMQA 1KWKA 1B31A 3QOKA 2OSXA 2E4TA 1W1VA 2NW0A 4GI6A 4J3TA 3LPGA 1AMYA 4P7NA 3PBGA 2W92A 3DC0A 1E55A 3UESA 1ZJBA 3VX0A 3GXMA 1UR2A 4PMUA 4MB1A 1OBAA 2WMJA 1J01A 1LLOA 2HISA 3BSGA 4WKHA 5JBFA 1K9DA 3K8MA 1UA7A 3K8KA 3RPMA 5HDRA 2FH8A 1ZBKA 1GOIA 1H41A 2XM2A 3SCRA 3VTRA 3K8LA 4W85A 4U5KA 1E1EA 3AIRA
chains in the Genus database with same CATH superfamily
3W7EA 3SCOA 3T1GA 5LZLA 1QI3A 3KLKA 4YPJA 3TP4A 1EYEA 2CLEA 1FWNA 4KQNA 4C5YA 4MUPA 4HT3A 2E3ZA 1W2VA 3IJ9A 3IARA 1KV8A 5EFFA 1WV2A 1VF8A 4PMYA 4LYRA 2ZUWA 3ARXA 2HTMA 3MO4A 2OZ3A 4UTHA 4FA3A 4JHMA 3SQSA 4XAZA 3TEVA 4FNQA 4W7VA 1JD9A 3TC7A 4W8AA 3RGTA 4XUYA 1XI3A 2CITA 4R9XA 4PA8A 3LCXA 2D23A 4WXYA 1REQB 3TAKA 4JN7A 1UOZA 1SFTA 2IW0A 2GDVA 4J2PA 4ZQMA 2OXNA 3PHAA 4TVDA 4CN4A 4KGLA 1KQZA 2Z2AA 3VIIA 3LLFA 7REQB 4JD4A 2ACUA 2I5GA 1GVYA 3XIMA 3APTA 3TN4A 1DWFM 5D2VA 1HO4A 1DQUA 1FHDA 1OSEA 2AAMA 2IS7A 1WE5A 1H1NA 3G0UA 1E6NA 3IWPA 2ZADA 2P0IA 3FEMA 4JL1A 4RDVA 1TO3A 1FWGC 4B5XA 2Z2UA 4JYFA 4MGGA 1N7KA 1ONRA 1NAL1 2RDTA 1HW6A 3OGRA 4LVBA 3AQUA 1E0VA 2J4GA 5B7YA 1LM1A 3GD6A 3A4WA 3SUVA 3FX4A 4GBUA 2H9AA 2PDHA 3N18A 2X0SA 3R7MA 1Q6OA 2PMQA 3LERA 5EMLA 5IDZA 3KXQA 4GI8A 1PJ9A 4GGHA 2WV8A 2QNEA 4QG9A 4OGZA 1SYTA 5D04C 3SM0A 4HGXA 5U7SA 3MDUA 4WDWA 2W5FA 3QVQA 4JEQA 1PEZA 2X16A 5A5WA 1L9WA 2PA6A 4EF8A 3M0KA 3OGVA 4NKCA 1FHVA 5F4SA 3HMCA 3HFYA 4ADSA 3O6AA 3VA8A 4FI4A 5FIPA 4RZ4A 5E6YA 3QHNA 2QMKA 4LUSB 3W7MA 4CEUC 2Y4SA 4GABA 2XG9A 3DZ1A 2H3BA 3URBA 5D9PA 2ZZ5A 4QLJA 1GQIA 1A4LA 1JDDA 1C91A 3Q4DA 4EPEC 1TA3A 3W2NA 2VX6A 4CQBA 2UBPC 3OYZA 4QXIA 4S1FA 1B3ZA 5E09A 4CU8A 5AYYA 4TQTA 2IKJA 3OZPA 1GYNA 9XIMA 4MWAE 2QJJA 3LPPA 4GD0A 1E5JA 3WQVA 2F9RA 3WLKX 3CUZA 1PE1A 4J35A 1W3KA 3UJ2A 2WZTA 2ZX6A 3GC2A 5ABGA 3HGOA 4KWWA 5K7JA 1QATA 1FVPA 4LVAA 1OFBA 3VIFA 1Q4NX 2E6DA 4LBRA 2DT2A 3H2FA 4HOZA 3VKBA 1EFZA 1ONEA 3WLRA 1ZQ5A 4FNUA 1WOAA 1NU5A 1K6AA 2VR2A 5BYWA 3UY7A 4CNUA 4P8VA 4UWMA 1J5SA 2VL4A 4M0XA 1TQJA 3WH5A 1T8QA 2C6QA 3DN5A 3VOCA 4CNPA 2PDNA 1PCWA 3E74A 5BU9A 3KX6A 4Z0JA 2Q71A 4GOAA 4QLLA 1Z3NA 3SCPA 4LCRA 1F4AA 1XLFA 3NGFA 1RA0A 1GQLA 3WMBA 3I7QA 3VIJA 2VX5A 3EA3A 4AEEA 4Q4QA 4W7WA 4GIEA 4XBJA 2GJNA 4PULA 1R47A 1TWWA 4I6VA 2XIIA 3CHCA 3W7KA 2E28A 2OQLA 4Q8WA 4ORMA 3E0LA 3IK2A 3H6OA 4FHAA 2OMAA 4O4VA 3WD1A 4FXSA 3AWOA 4H00A 1KM3A 5AZ0A 1FHLA 1KFKA 3BSMA 3K4DA 1VFOA 3DCPA 3P0WA 3QW3A 1L6YA 2QAPA 5G4HC 1UCWA 2MNRA 4E2OA 1GT8A 1KWGA 1I2PA 1EHNA 3RK8A 5FL0A 2YZRA 3IVSA 3FJNA 4GMEA 5CZJA 5EFDA 3W87A 3TMLA 4QG6A 1HKWA 1QI4A 3HU7A 1OX4A 5AYBA 2NVAA 2ZUMA 2Y5SA 4RE0A 1WDRA 4JIHA 4IPLA 3EOLA 2OLHA 4NRRA 2V2DA 3WJXA 3S9YA 1T8XA 1TIMA 4KRTA 3EXTA 3S5ZA 4HOXA 1YDOA 4Z1DA 3BAIA 1IZKA 3SRHA 2RKXA 2WHJA 2VZOA 3REQA 3ZLHA 3WLPA 4JBRA 2VGFA 2QCEA 2ZX7A 4JX5A 1JPMA 1XLCA 3WKZA 3ABSA 3LTYA 4LYQA 1V3JA 4C6QA 4GFSA 4KPLA 3P5ZA 3VX1A 4AU0A 5HQMA 4KKXA 2A6NA 3I4KA 4UNLA 4M80A 2AQOA 5D2TA 4BI5A 3DHDA 1UR9A 1QNPA 1GVOA 4ZO9A 3RG6A 4O19A 4M7TA 3WYZA 1LRQA 3S5YA 1SJAA 2FYMA 1UWRA 1AJZA 1P0KA 5T26A 5CGMA 3PN8A 2ATMA 3WDIA 3WSUA 2UY5A 3EDDA 1NOUA 4DX3A 3TFCA 3NQ6A 3L67A 2NUWA 3LBMA 4GI4A 2WJZA 3ME3A 2O55A 1ADDA 3E02A 4QDWA 4WUIA 4K39A 1UIOA 3RAOA 4ORIA 1HKMA 1R85A 1TWDA 1BSIA 2AGKA 2Y2WA 4JTCA 4YTQA 1SMAA 4JFSA 3H24A 4AHPA 4LAZA 4A8LA 1V77A 1CLKA 3FHAA 4QSFA 2G3JA 3EBVA 5LA0A 3E0VA 3NYDA 1J96A 3A5FA 3CV7A 4MLJA 1P5BA 3G1AA 5FAGA 1CIUA 2G5WA 4L6DA 1SFJA 5J5DA 1UP2A 2J77A 1CPUA 1SZFA 1X38A 3CYVA 1GG0A 1J2BA 2ZRZA 3W1AA 5I07A 2E68A 4TV6A 3N34A 4US5A 4XKMA 4CGTA 3W9ZA 5KZDA 4DPPA 5FEWA 4DO4A 1CECA 2J47A 5IHSA 1AJ2A 4U31A 1DQWA 5CGTA 3OLEA 2WXDM 5I3HA 4Q8MA 2ZXQA 4KS0A 1VENA 4EANA 3M5VA 2PDXA 1C92A 5I3DA 2OPJA 3AJ7A 4GFIA 4MDPA 3N2TA 1GJWA 4A3RA 4C6IA 5FI8A 2HK0A 3G24A 1OVDA 2WVTA 1I0BA 1AQHA 5I09A 4GJ1A 3E1F1 4TUFA 3ZR4A 1QXLA 4LBUA 1WXJA 2VDGA 1OIFA 4KRUA 4Q6XA 4NILA 4O0ZA 4O52A 5HQEA 2AAAA 3CJPA 3CHDA 1UHVA 3MP5A 3VIGA 3AIWA 3S6TA 1HFBA 1LF1A 2HV5A 3TTSA 3V3WA 2PGEA 2VMFA 1B9ZA 1LBMA 5C2GA 4UMBA 8XIAA 4ZL1A 2B0MA 2DY3A 3CQKA 1K4GA 4NNAA 3VXGA 2QIIA 3C6CA 3IGXA 3B40A 1S5TA 4K2SA 5TIMA 1IZJA 4NAEB 5D9NA 1YDVA 4V1YA 5BU6A 4BFAA 1ME8A 1UD8A 3KDNA 3NAVA 1JZ8A 1VCVA 1FDZA 4NRSA 4LYPA 3DXIA 4P7LA 4YLWA 1ESWA 4E2BA 3K46A 2FTPA 4F40A 2FIQA 4BEUA 1QI2A 3PBMA 3W85A 1W5MA 1KXTA 4PN2A 4HIBA 1MMFA 1Q45A 2PLCA 3IANA 3R6IA 3A4JA 1TCMA 1H4PA 2VOMA 2Z26A 5MKGB 3UETA 5D02A 3M07A 3FYOA 3MY9A 3NNTA 4D6FA 3ITLA 2CLKA 3S6DA 3WFLA 4LQ1A 3KOFA 3I6TA 4KBXA 3TJIA 1S39A 3D5HA 4G56A 3MP3A 4AIOA 3RM9A 2E9MA 3AIQA 4B9ZA 2HRWA 4KERA 1BLIA 1I60A 3GWQA 3W72A 4QROA 3V7PA 2VEKA 2J6XA 3A9IA 4C91A 3KAOA 3IV8A 3LYEA 4HA4A 4LUYA 5FF3A 4JCLA 1E6SM 2WJEA 4CQ9A 4LH8A 3AJXA 1JGMA 3I7SA 1JG9A 3DECA 3MV01 2XIQA 3QW4B 4PMVA 3GIPA 4ZSTA 3AXMA 1YEYA 4LC8A 4Q8PA 2QDDA 1H61A 2QPUA 1WAUA 4H6KA 1CGYA 2X0HA 5FACA 3AICA 1REQA 5GQBA 4FALA 4B4HA 1UKQA 4F2TA 4IP5A 1DPMA 2XFFA 3W83A 4JTUA 1W0MA 3CB3A 4HNNA 5HNTA 2YB4A 2OJPA 3SJNA 4HNTA 2PTDA 1VS1A 1L2UA 1R6WA 1JR1A 1L6GA 4F9JA 1JYXA 1D7FA 3U6WA 5CSRA 4HMDA 4E3VA 1R3SA 1F3XA 2PWGA 2XFWA 1EQPA 3U3HA 5CPLA 1K9TA 1E9ZB 2EEXA 2QT3A 3GBDA 3W76A 3VNMA 3MUCA 1C3FA 4R27A 1DJZA 1E6ZA 2V3GA 5AN7A 1W3LA 3LMZA 3LBCA 4KEUA 4WJXA 4E5TA 4M56A 3GG7A 3P6LA 1QK2A 4GUIA 3DG7A 4U28A 3JU2A 4P7OA 3CEUA 3QHOA 1I9CB 1ODZA 1MQQA 3QYQA 2PZ0A 3BH4A 4YL2A 2DVXA 3AISA 4MIMA 3UVAA 2BWGA 4NJJA 2BGQA 1V3MA 4QP0A 3RX3A 4IFRA 1XUZA 1GVIA 4Z2JA 3N3MA 2OWWA 4MPKA 3TIMA 1UR1A 5HINA 4UQEA 4REQB 1XFCA 2FZ9A 4IMGA 4GXMA 5A1AA 4QAIA 3BGGA 1ZLPA 2YBTA 2E5CA 2HQAA 4TMBA 1J0YA 4HPHA 1K4HA 2X1SA 4ZO8A 3SADA 4AY8A 1IF2A 3KZSA 4PSPA 1JAKA 4FS9A 2D2JA 3L5LA 4AXNA 3A6OA 3E0FA 4A8IA 4GWEA 1CW2A 2VVNA 4L1XA 4K68A 5C70A 1M68A 1SPQA 1KFEA 2PD9A 3CU2A 1IIHA 1UZ1A 3SBFA 3HOJA 2GVYA 2VEGA 5LGXA 4S39A 3EOOA 3TOPA 3ARPA 3W82A 1HN1A 1VH7A 4DI9A 1DJGA 3RJYA 2VR5A 3C0SA 2VZSA 4JTIA 3AIBA 4GNVA 4JR5A 3B8DA 3UP8A 4W86A 3TQPA 1XBYA 1Y5VA 2YCIX 4AVFA 1IR1A 5BWFA 1DQXA 4GQGA 1EOMA 3TVAA 3LS9A 2J7BA 2GDUA 3D3FA 2KZHA 2GQ8A 2FDSA 4MF4A 1E40A 5F1UA 1XLGA 3P14A 4NYUA 4ZTXA 3ZT5A 4RDZA 2CLOA 4XZHA 1UQZA 2PTYA 3LENA 1M7OA 2H90A 3KCLA 1GJPA 2OODA 3TUUA 4WLCA 1WUFA 1GVEA 3SEPA 5DCEA 5I24A 1TPDA 5F1VA 4QRNA 2WM1A 2WMGA 3AMLA 3E2RA 1TR1A 8RUCA 3N17A 2Y89A 3ZVIA 1UMLA 3NZRA 1JFXA 1KCKA 3AMGA 3CWNA 2E5BA 2HJPA 3N2CA 3QMSA 1EGZA 2J79A 3NZQA 3W3OA 4FR1A 1ZHAA 2ZZ2A 4AZGA 4DM1A 4QX4A 4IMDA 3NQCA 4IPIA 5DY3A 3F1QA 2ZTKA 1PZ2A 1SO3A 1VFTA 4XAPA 3T8LA 5LNRA 5FJPA 1FH8A 2FPTA 3TYUA 2I7GA 2ZIDA 3DDMA 3QC3A 3LSCA 1F6YA 3JR2A 1US0A 2PP1A 3UGVA 1NJJA 5G1TA 3OLIA 2HROA 3UXLA 4DXXA 5DMMA 4FB7A 4MDOA 3LZ3A 3HBLA 3KOXA 3N4FA 2GOKA 2ADAA 3M16A 3QGAC 1OX4B 4UOZA 3ITGA 3GH7A 5KEZA 2RGMA 3W74A 5IXEA 3C2EA 2R14A 4CLMA 4GNKB 3A47A 1BGAA 1XLJA 4N9DA 5GPRA 2FTWA 2DW6A 2WWCA 3PBUA 1PTAA 4IQJA 3SQMA 4XO7A 3LOTA 2PDYA 3SZ8A 3ITYA 2Z6IA 3NPUA 2FQIA 4DWSC 3QRHA 1QO5A 1GVSA 3C61A 1VYPX 3MUZ1 2QULA 2D73A 1XIFA 4YYCA 1XG3A 3PPGA 4PUMA 1F2JA 4BI7A 5K4XA 1XYAA 2HS8A 3ZR5A 3BZGA 4QCEA 4PTMA 1DJQA 1AODA 4K37A 3M7WA 4OFCA 1EDGA 3BOLA 2WCSA 1OJXA 3BLPX 3VNDA 1UD4A 4QNEA 2BVWA 2I17A 4FXRA 1EEPA 5IM51 1OFOA 1Y0EA 1LTDA 1QPOA 4Q4KA 4QS5A 3PZOA 3C2FA 4ICCX 4GE8A 3FA4A 1PS9A 5GNXA 1SW7A 2J27A 1GKQA 4GYPA 1VPQA 1XC6A 3EXRA 3K4WA 4XZLX 1CENA 2JBMA 1KCLA 2P10A 1XH1A 1IWAA 4NZ3A 3GHTA 3QTGA 4EWND 3B8IA 1GYLA 1GVFA 2G3MA 4JTDA 1KM1A 3QMRA 4HSNA 1ZUAX 3W7QA 3Q45A 3WX7A 3BICA 1VBUA 4E2VA 1TZ7A 2QQ6A 3LEPA 4F8XA 2FJUB 3AXKA 4IOTA 1IXPA 3RMEA 3DGBA 3F03K 5D9OA 5EL1A 4N9BA 4LS0A 3WK0A 3RRAA 4PRWA 3W1TA 4GHRA 5CG0A 3U4AA 1TV7A 3P60A 1TPEA 3LHZA 4PC8A 1JNDA 1C8YA 1Z32X 1JI2A 3E2VA 4LW7A 4FK9A 2IXVA 2XSBA 4DO5A 3S5OA 1OD8A 2GPTA 2GGHA 2VDHA 5K9XA 2DH3A 1BXCA 3STPA 3DERA 2E6FA 3W29A 4C65A 4GH3A 3SUWA 1JEZA 3SCSA 2DSWA 1DV7A 3WNOA 2ISFA 1EEXA 1W5QA 2Q3OA 3TYZA 3WEZA 4CD6A 1OYAA 2DT1A 1PPIA 5I02A 4FXFA 1QK0A 3T09A 1H7NA 2J8TA 2BV9A 3S42A 1RY8A 3WQWA 1SFLA 1XDJA 1FWWA 5KZEA 4O14A 3ID7A 2NT0A 1A50A 2IKIA 3WZ0E 4Z1CA 2NV1A 4DZHA 3FSTA 4AZHA 3ONCA 4GBDA 4OT7A 3WBYA 4UQCA 1OY0A 3TOYA 1XRSA 4YNGA 3T0TA 3A22A 3DFSA 1FP9A 2PEVA 4Q8VA 3W2UA 3RLGA 1V6UA 4C1KA 1QOPA 3SCUA 3G8RA 3U57A 4HPGA 2HVMA 3W38A 1MVYA 2ZKMX 4UTIA 3H23A 2EXOA 3LM7A 4NAFB 1B4KA 1G01A 3B0PA 4N02A 5DEZA 4GACA 2J7GA 2FVKA 5F7UA 1R2TA 1TV2A 1TWZA 2RJHA 4OV9A 1I2QA 4ZA0A 2O4QA 3WFZA 1ITUA 3FFSA 1KR0A 4GISA 2CKRA 3GG1A 3P80A 2PWHA 4XD4A 1SU5A 1GOOA 2VUYA 3PPFA 1LWIA 1ZBWA 2WB5A 4H01A 3CHEA 1KM4A 5H6HA 1IXQA 3RR1A 3K1DA 2EPNA 5G1MA 2PTZA 5I7GA 4PUWA 3WLIA 3E0IA 1K70A 1IWPA 3FY1A 2WKLA 1Q8AA 2INFA 4PODA 4Y9AA 3A24A 3EWXA 4QR6A 4GX8A 1YPIA 5B80A 3S2NA 3E49A 4DJDC 1AVAA 1E1CB 1OC6A 2PDIA 3LD5A 2Y88A 3M6DA 4Q7NA 1BQCA 5FJTA 4XIAA 1OABA 4MY1A 1V3IA 1CEOA 3AAMA 1QNRA 5ECUA 4CU7A 5CJMA 4KCWA 2Y63A 1E6QM 2OT1A 3VPLA 2R1NA 4HHHA 2QUTA 1CXLA 4K1WA 4JIIX 3W7DA 9CGTA 1NDWA 4LUJA 4GXWA 1VJSA 4ADUA 1BAGA 4MKSA 1AH0A 3OA5A 2R82A 4QNWA 4PUJA 3H22A 5F2GA 5EBAA 1WOBA 3UXIA 4KESA 5CAKA 3W71A 3NFUA 1R3TA 3IVUA 3U4FA 2F61A 3PZ9A 4AVNA 2ZC1A 2PLKA 2WMFA 2Z1KA 4UMAA 5EMKA 3EB2A 3BLEA 3R1ZA 1BYBA 2D3LA 1IEIA 3MUXA 5BXSA 1UC4A 2F6XA 2AQVA 3HO8A 3MWAA 1EB3A 1EX5A 2O9PA 5I77A 3GNXA 2R6OA 1TREA 2A7PA 3C3UA 2HWGA 1HXJA 4TX8A 4ZFMA 3EOEA 3WQOA 2ZTJA 1EC8A 2QEZA 2VZUA 2ZCGA 3M46A 4DUXA 4UQAA 5HUPA 1YXYA 4DLFA 1I2RA 1KRBC 3GXFA 3W81A 2VI0A 3MMDA 1OQFA 4NJHA 2JFEX 1HKKA 4NVTA 4UXDA 2XISA 2QGHA 3PTMA 1Q85A 2D24A 4KIRA 1WUEA 2HSAA 1Q5MA 2QMJA 1G4PA 3IPWA 4XZMX 5CSYA 1JRCA 2QYGA 2QDEA 5A2BA 3DFTA 1ZS2A 4US6A 1AW5A 2AMGA 4IZGA 1YPFA 4B92A 4X2RA 3EPNA 2PDFA 1R38A 1HP5A 2D3NA 5G4WA 4QFUA 4E8CA 3T81A 2CPUA 2DT0A 3RX2A 2W9MA 4PMZA 1HJXA 1HT6A 4DPQA 4MWAB 1UR0A 2JGYA 2VRQA 3K2GA 3N2XA 1ICPA 2YXGA 3CTLA 1XICA 5AVHA 1W91A 4PUDA 1W17A 5FOOA 3W73A 2X30A 2ANUA 2PFHA 1D7KA 3FN9A 3H70A 1G7VA 4AY1A 1UR8A 4FAMA 1QUMA 1ELSA 3LQGA 5HR6A 4L56A 4Q4OA 4B2DD 1UBPC 4HA0A 5C9RA 1YBQA 1AW1A 3IK4A 3KTCA 4JFVA 2OEMA 1QR7A 1BYAA 3N13A 3LBOA 1UH2A 1QW7A 1EUAA 2VYOA 2FVLA 4W4QA 1JDCA 2YZ5A 3O0FA 4R5EA 3RCNA 1U30A 2ZE3A 3ZT7A 4AD2A 4WDXA 3SDOA 4U4MA 4A6GA 1DXEA 5HPCA 2D2HA 4HK7A 4WSJA 4C7FA 3AC0A 3CUIA 1FWDC 1KKRA 1LWHA 4M8UA 1CXEA 3LN3A 2MUCA 3I6EA 3LUTA 2GSHA 1RJPA 1RJQA 4X61A 3IJIA 1R86A 4W88A 2F2KA 2ISWA 2OR2A 1IT7A 1GGOA 4XUGA 1PIIA 2PDCA 3BC9A 3O1NA 3V35A 3FSUA 3CHFA 3AXHA 4LVFA 3T78A 1MUWA 2NT1A 4J2MA 5KTLA 2OO6A 1F74A 3TCEA 1YMYA 2V5LA 3LZ5A 1EWEA 3LI0A 3N25A 2HZGA 3E96A 1J0JA 2Y7FA 3WQPA 4EAMA 1W5PA 3CV2A 4AMAA 1GNXA 2CZDA 1E4IA 2PDMA 1HJWA 4UMCA 3AMCA 4P8UA 3MV11 2ZZ7A 3OOQA 1UWIA 1E56A 2F7FA 3EX6A 1B3XA 3H7UA 2Z6JA 1WDQA 4MY9A 4H9TA 5BRQA 3NDZA 3H53A 1O7AA 2YGYA 1X39A 4KWUA 5I03A 3TLLA 1EJSC 1ZALA 4H6RA 3SI9A 1ALDA 4W5ZA 1YTKA 2G37A 2Q3RA 3CGTA 2PDKA 4OU1A 4QISA 1O5RA 1EBGA 5KMYA 4R53A 1XS2A 3O3RA 2BY3A 2B7OA 1Z42A 3ZSSA 1K8ZA 1Q7QA 1OFDA 2I56A 1PB0A 1XPYA 3LMYA 4DJED 3BV4A 1MRQA 1W1YA 4XO6A 5HWMA 3NOEA 1BKSA 3M0IA 2VXNA 3SN0A 3UT0A 1CT5A 2J7CA 3QV6A 5I23A 3BAKA 3FAXA 3TW7A 1TKKA 1K7FA 1HVXA 1K7XA 3M43A 1ITQA 3PG9A 3PBWA 3GTXA 3MSDA 2XTKA 1GPWA 3PJXA 3PM6A 5I00A 3OGSA 4NZ1A 4I5UA 3QY7A 3OPSA 1QNQA 3GNPA 5H8MA 3UWWA 4H6QA 2WLYA 4U2ZA 1E0TA 3RLVA 4H4IA 3LB0A 3G3DA 3UZ5A 1W5OA 5M17A 1FFQA 5HMDA 1OYBA 1GZ1A 4JL2A 4PEEA 2XFRA 1XLBA 1G4EA 1TMHA 1TCDA 2PRMA 1O1ZA 4W84A 1KCZA 1V51A 4DBDA 1DJIA 3QGVA 3NM1A 5DELA 1W1VA 3B9NA 2Q8ZA 3LPGA 1AMYA 3G22A 4J3TA 4RW3A 2C79A 3UYIA 4G2DA 1HKVA 3UESA 1ZJBA 3V36A 3VX0A 3GXMA 1AUSL 1P7TB 4PMUA 1JCTA 4MB1A 4O1AA 1A5UA 1IYXA 2Y8UA 2G97A 2PDGA 2HISA 1QOQA 1E9IA 1IGWA 3K8MA 1RCXB 4Y96A 2BG5A 3K8KA 4WZHA 3TQ0A 3WLSA 2EGZA 5K9DA 2A4AA 2FGBA 1GOIA 2XM2A 2WNQA 2WNNA 3VNKA 1KNWA 4W85A 5CC7A 4Q4RA 4K38A 3KRSA 1Y5XA 3QV8A 1XIDA 1S38A 2ZDRA 3H21A 1P1XA 1ZL1A 2HE8A 2PGWA 3R8GA 2ZZ6A 1MFUA 4YS1A 4PZVA 3WK3A 5CSUA 4MFDA 3NYZA 1BEUA 1TJ0A 1QT1A 3NOYA 1J4EA 3SO7A 1A5SA 1U2YA 4FPSA 3T2OA 3KOZA 4NT0A 4L4MA 3ABXA 3FYYA 3LCHA 3LHYA 1M1BA 2C0HA 4S3CA 1KKOA 2Q8LA 4O28A 1UR3M 1VBJA 4KW2A 3UXAA 5FJRA 3ANVA 3F4WA 1O60A 1EO7A 2BB0A 2DZUA 4TTUA 1S2AA 1S5MA 4L9ZA 1B30A 1EHAA 3H4WA 3VKCA 4HBKA 5F2MA 2RDUA 4TX9A 1XISA 3KCJA 2C71A 3WD0A 4OUEA 2OZ8A 1XIJA 5AHLA 2E5DA 1TVNA 3AO0A 1QOXA 1NTHA 3WNNA 5G5IA 3CXOA 3TYEA 2WC7A 3WBWA 5KZMA 5LIYX 5FESA 1YQ2A 3TYCA 4A3YA 3M6YA 4ZR8A 4Q8QA 5LXXA 2GJPA 3RPDA 1YXCA 3HF3A 1RD6A 1H7XA 3HGJA 2OB3A 1ZJIA 1BYCA 3VU2A 3C2VA 3BK0A 3GC5A 2ZX9A 1SO5A 1C9DA 1W9PA 4BF9A 4IISA 3L4YA 1FXPA 4V33A 4IGMA 3ZM8A 4I5RA 4O1EA 4RZ6A 2AQWA 3DFOA 2VTFA 3VIKA 2FLIA 2BFGA 5ENLA 3UNDA 4ZOAA 3V16A 4RV3A 3UR7A 4QJ3B 3U5YA 1SR9A 4XIMA 1MWOA 1X96A 3RU6A 3CV6A 2Z4GA 2PUZA 4BA0A 1VPYA 3ABZA 1WQ5A 4CCCA 3ZIZA 3TFXA 4Q7IA 3DESA 2PE4A 1JULA 3QLDA 1E1CA 3W22A 3GYCA 1EJ7L 1BQGA 2DUZA 3GDLA 3QPZA 5LGZA 2GGEA 1FOBA 4BQ5A 5FF7A 4D6GA 5I0DA 2PBOA 2EG8A 5KZ6A 5TQLA 1DOSA 2GK1B 2P8BA 4PMDA 2UY3A 2W91A 3LHVA 1YE4A 2BGNE 1UPPA 1I2OA 5H8UA 3UPMA 4XSMA 5HR7A 5BROA 2YA1A 1E6PA 3B0UX 1BWVA 2VFFA 1VP5A 2E6AA 3NEVA 2DW7A 5AYXA 2BXYA 4J3UA 3V4BA 3BUVA 4GIRA 1P0NA 1ZP3A 3LLDA 1H0IA 1M41A 3N11A 4F2UA 3W75A 1QPNA 2WVSA 2DU2A 4V28A 4M19A 3IJ8A 4GUJA 3MQTA 1E9YB 3USBA 3R58A 3UZXA 3ZYZA 1H5VA 3UPWA 3RFAA 3VD4A 1M7XA 5HMSA 3SCWA 3WBEA 3UJFA 1JDAA 1T7LA 3WQFA 3L4TA 4I8DA 4MZ8A 1GJUA 5DXXA 5DLCA 3VMNA 2CLPA 2V6AA 3ERPA 1W3JA 4FNRA 1VBHA 3NR0A 3W24A 3WQEA 1RZMA 3DFQA 1XD0A 2L5HA 4GG9A 4PMNA 1E3ZA 2ZRYA 3SFKA 4CNNA 1YBQB 2REQA 1JCXA 1ENUA 1G7UA 1AQ0A 1UWQA 4OECA 1AH3A 2JEPA 5LSMA 3BAXA 3Q2DA 3NQAA 4IQEA 2Q02A 2Z1SA 3GR4A 4NHVA 3UYCA 3BPWA 4LJ3A 4D71A 5CSSA 3IIOA 4LY8A 4EACA 1SJBA 4R7WA 3CH9A 4CD5A 4PL2A 1AMKA 4OQVA 3QZAA 3R79A 3OVGA 4C6JA 3WUBA 1RH9A 4UB9A 3KOWA 2VRJA 2ZFAA 3A13A 1XIEA 3SQLA 3H4XA 2XSXA 3KTXA 2A5HA 3BWWA 3WNKA 2W79A 4LAOA 1QI0A 1BYDA 1XR2A 2TODA 3DH7A 1IR2A 7PTDA 4K8EA 2R94A 4ERAA 2Y6ZA 1JZ6A 4B5SA 3CPRA 4V2XA 3EDKA 1TPB1 4XAFA 3L66A 3HG2A 3VD5A 3W1PA 3ZZ1A 4PCNA 3U2CA 3EEGA 1AL8A 1LORA 5TAOA 1H60A 3CT2A 4DYKA 1BXBA 3U48A 1MZHA 5AB3A 4H41A 3WDPP 2BNJA 2R8WA 1XINA 4AZ7A 1UOKA 1RLDA 4GKLA 1FH7A 3QR1A 1LRTA 1TZZA 3GNOA 3A64A 4KWSA 1HX0A 4C60A 1JCMP 3BQ5A 3SIZA 3CL6A 2OX1A 5M1TA 1HJUA 1PIGA 2WSKA 3DG6A 4TVCA 4EF9A 3R10A 1V6TA 4B3ZA 1R0MA 2DZSA 1W6TA 3DAQA 3WLQA 1M53A 3NJ3A 4U10A 2XN2A 3WG6A 4RNHA 1IXNA 3OEXA 4BWLA 4L9YA 2XVPA 1LCOA 5LA1A 1B54A 3M1ZA 2FHCA 3OYXA 4X63A 2IKGA 2PLJA 4JTHA 3G1DA 3H2OA 2V38A 1C7SA 1OFPA 1TV3A 3N3TA 1WCGA 3GVGA 3OIHA 3QTPA 1ZJAA 1V3HA 3VFCA 1R9ZA 2WK2A 4DZAA 1VEOA 4ATLA 1R46A 1DWAM 4C6FA 1YNQA 3IRDA 3WDHA 3VO0A 3SY5A 4CCDA 2Z1WA 4H9UA 1E5NA 4PFHA 4C6DA 4HD5A 4HVXA 1O94A 2NXGA 1WXZA 4HB7A 4IP4A 3BG9A 1CGXA 3B4UA 3B3DA 2A85A 2YYTA 4V15A 1WZMA 3LNPA 4W89A 1Q3NA 1F7BA 3V0UA 1PDYA 5A6KA 3KP0A 1EA0A 2ZRXA 2YW3A 1TMLA 4MJ4A 4JEJA 3IUHA 2H9AB 4XISA 3GE7A 1L6SA 1IHIA 2J24A 4ZODA 1XGEA 1BRLA 1H63A 2RDWA 2BP1A 4L64A 3FKRA 4PYSA 4DJDD 1JF6A 4NXSA 3L7RA 2XFYA 3GZAA 4IX2A 5AHFA 2W67A 1PSCA 1W54A 4HNVA 1IEVA 1OG0A 4EOUA 3L4ZA 2HMCA 2D2GA 5HMFA 2J9ZA 4IL2A 1TPFA 5G2IA 4HNOA 1UH3A 5D32A 3VNIA 3F4DA 3LRMA 4D72A 1A0CA 3AHZA 3WY1A 3OB8A 4TXEA 1NELA 1DEDA 4O11A 3MI2A 5SWUA 1VHNA 1X6UA 4IGHA 2J88A 1N8IA 3W02A 4M51A 1Y65A 4RXGA 3HIJA 6REQB 4LRTA 3PAOA 3SAZA 1B1YA 1S2TA 5JBDA 1XIBA 4WKAA 5D8WA 2QPSA 4X22A 2BVDA 3LCGA 3HPXA 2CLMA 4MNLA 4M29A 2O7QA 3R4IA 2NVDA 4WRHA 3F4NA 2G96A 4D6DA 3CPUA 3CQHA 3KWXA 3WDJA 1MDRA 3AHXA 4RPQA 3GR7A 1WA3A 3ZVHA 3HURA 4UOJA 4PMOA 2W63A 4U5IA 3N9KA 5MHBA 3GNRA 1PKNA 1YYAA 1KV5A 1M9HA 3K1GA 2R1LA 3LPOA 4GYJA 2J7HA 3USZA 5HMEA 2NQHA 3WMLA 3WDRA 3ES8A 4UFMA 3CLWA 3OVRA 3HTWA 4XZ9A 3GBEA 4OBTA 3WDQA 3WK1A 3DHUA 3PZUA 3WLNA 3V18A 1F6PA 1ZCCA 4G7EB 2OSWA 3KWSA 1V0NA 4QQUA 3CHVA 4C6OA 1ME7A 5DCBA 5AYZA 3CPGA 5C55A 3F5KA 3BLLA 4DWSA 3IAPA 2VZTA 4S3EA 1EPXA 5CLWA 2GVJA 4MFEA 3RMJA 4LUTA 1JUBA 3DBPA 3CB8A 3BGAA 3NM3A 4ZQNA 1T99A 3W37A 4KIEA 1WDWA 1XBXA 3FNDA 1PKYA 3IV3A 4TMCA 1BD0A 1AD4A 2YCEA 1GEHA 4O18A 1EP1A 2WMIA 4J40A 1KFWA 2DUXA 4IMEA 2YL9A 1HKIA 2E6YA 2V3FA 2EPLX 5LIKX 3BARA 4DF1A 3IEBA 3WD2A 4JTKA 4PCTA 4IP7A 1PTGA 4HTYA 4NI8A 4EIVA 3EOUA 1YKWA 1KFBA 2V81A 4Y9NA 3ES7A 2EPOA 2VD8A 3LQLA 5EY5A 4AYSA 4F0RA 3BZJA 1XRFA 3HGRA 2OKOA 5REQA 4GK8A 4A3UA 1XWYA 4I9JA 5DT5A 4PTDA 4L6HA 3GNDA 2J25A 1Q6CA 3H2EA 3WF4A 3RRXA 4JX6A 3ARQA 1P0BA 3CC1A 2CU0A 2WNZA 1XIMA 4DYJA 5CQ1A 3N2MA 1Q6EA 4AZ6A 2CLIA 3AXIA 3ZJ6A 3APYA 1UJPA 3HG3A 5KSWA 2ISVA 3TKFA 4B16A 2Y7GA 1P0DA 3P3BA 3AS0A 1DIOA 6ALDA 3PANA 3O9NA 2VFIA 3KBMA 1R5YA 3F4VA 3KBWA 4GJIA 3PSWA 3SRKA 4P7QA 3NQ2A 3GAKA 2DPEA 2PZNA 4J9JA 2VEIA 3CUJA 4HYVA 1DTUA 2ZUUA 5A6MA 2XGIA 3YPIA 5KINA 4CUCA 1QRQA 5FF0A 2XWEA 5D2YA 3STCA 2V5JA 4DNHA 2AL2A 3CZLA 2J6VA 4IGSA 1UASA 4W87A 1X8CA 4BCEA 2PDBA 1V7YA 3GW3A 2VC7A 5HATA 3AMKA 3W7OA 3JUGA 1A5KC 3I3EA 3NPWA 4OZOA 1I75A 3UY8A 1PTDA 3MKVA 2IMRA 2WANA 3G8EA 5DANA 3FKKA 1IV8A 3WLOA 4GUFA 4MWAD 5CGQA 4YMZA 4YVPA 3SSJA 3AU2A 3C0QA 1IXOA 1B3VA 1US3A 4DXVA 3WFAA 3VGEA 3BLDA 2VD9A 4AIBA 4KETA 3OG3A 4H8NA 5A3HA 2PSNA 3MHUA 2FMOA 3CAWA 4MZ1A 5A6AA 3A5VA 3WNMA 3WEOA 4E4UA 3C86A 5MF5A 2BBFA 1YDNA 1G69A 1W1A1 1NDYA 1CBGA 3HA1A 1GW1A 2NQLA 1OX5A 4LS1A 4C6LA 3S1XA 5BWAA 3G2GA 3T42A 3W1XA 1DJYA 2QCNA 1EF2A 1RUSA 4UQDA 1XP3A 3NDOA 4LF2A 4PUNA 1ONXA 2ESCA 4K3ZA 4UNKA 4EX4A 1W1PA 2A3CA 3DEQA 4IICA 1P43A 1V7AA 3PR2A 4CN1A 2WO5A 3GDBA 1GPFA 2PI6A 3CK5A 1F3WA 1FDJA 2PCEA 4I7UA 4D1JA 7TIMA 1GZJA 1I8JA 2JGQA 3U9IA 1XSKA 4UZUA 4HPNA 1GW9A 3H55A 3RXZA 4H6EA 1W9XA 1UB3A 4GVHA 1LBFA 3EA2A 1XCWA 1KRAC 3UG4A 3P81A 1IT0A 4LANA 2PURA 5EMUA 1T40A 2GUBA 2OGYA 1NF0A 4LEQA 2ZVRA 4S3DA 1I4NA 2ACSA 4Z2IA 2CBJA 4JPGA 4DY1A 3QGKC 1LROA 1E3XA 3ECQA 1HL8A 3A3XA 4HSHA 3S2LA 5A8MA 1E4LA 4XD3A 1KFCA 4K7VA 5BOEA 1WDSA 2VX7A 3AYVA 1P1MA 3F7JA 4JIEA 4HU8A 1QCWA 2DUAA 1POKA 1THFD 1FWEC 1RHCA 2WNWA 4N6EA 3PTKA 4JN8A 3TTEA 1CCWB 1LL6A 1ZRQA 3HV9A 3SUUA 4PUKA 1EL3A 3E9AA 4N6FA 2W4XA 4NJGA 1KB3A 1R2SA 3E38A 1BRLB 4LUIA 1ISVA 1S2UA 2DSZA 2A0NA 4FX8A 2XZ7A 4XZNX 3URQA 1TX2A 1R7AA 5K3VA 1MW3A 1V4YA 2DZTA 2WYSA 3D46A 3LCWA 2WW5A 3IJ7A 3E12A 4QG8A 3THDA 2WJFA 1GK8A 1D8CA 4FXJA 1VYSX 3VOGA 1DYSA 4JKKA 1X6LA 4DAFA 1MDLA 3LI1A 3LXCA 5CC3A 1VJIA 1ZAJA 3BW3A 1R9XA 1E4MM 3GKFA 5I3FA 1UD5A 1YIXA 4RR4A 4YHEA 1NWSA 4W9TA 3L4VA 1EH9A 3PBVA 3WMCA 3KP1A 1FKXA 2BOGX 5CH9A 4HN8A 3KHDA 1XYLA 2DZXA 5FEXA 1TPVA 1SR0A 2ALRA 4RL3A 2Q09A 4JQAA 4JTJA 3R8RA 2BOFX 4HP5A 3POCA 7TAAA 4B5WA 1ZTVA 1HIZA 2G41A 2Y7DA 4QDMA 5I3KA 1MO0A 4GNJA 4U3AA 1H1ZA 4LYKA 3BW4A 1L8NA 3GX9A 4XBSA 2PBGA 4BR1A 3R0KA 3H7RA 2ABBA 1GZGA 3SUSA 3VM7A 5FEZA 4HNUA 3SUTA 4FP1A 4ML4A 3IJLA 3FA3A 4JICA 2VURA 2WVVA 1IIGA 4CVWA 3BCDA 3L23A 3OODA 3ZS4A 5A8NA 4ES4A 4ATDA 1LZOA 3M64A 3CAKA 3OHIA 3SJ3A 3PPHA 4D6EA 3H26A 1ZGDA 4AWSA 2GJLA 3EDJA 1BFNA 3FXGA 4O1BA 2OU4A 6CGTA 3V1HA 2PF8A 3GM8A 2O9RA 3OVQA 1UPMB 4I9AA 1TTPA 2YL8A 3DI0A 4LUSA 4LEFA 4ZQOA 2QUVA 3W1UA 3DKJA 2J78A 3W1MA 3L5MA 3LHTA 1RQEA 1VPXA 1E6XM 2E09A 1EJRC 5LNSA 5DQPA 4AZBA 3GVVA 2NVCA 4IG2A 1BTCA 2PP0A 2DZPA 3OZMA 3VNJA 1KTCA 1KGXA 4O0KA 4E4PA 4J3ZA 3PFRA 1BF6A 2D2OA 4H8HA 1LT8A 2E8YA 1OG6A 3QZEA 1CLVA 1CNVA 2QLYA 1OIMA 5CPNA 3CO8A 1I0DA 3T05A 4QIUA 4X2PA 3ITVA 2YBUA 3MSRA 3GHSA 1OZMA 4DJEA 2HS6A 4MAZA 3S46A 2PC8A 3OQ8A 2X42A 1SVDA 5XIMA 4XVEA 5BCAA 4KH2A 3S2CA 3K4AA 5BXPA 3NQBA 3EMZA 1O95A 1F9CA 4XAGA 1JF5A 3VGHA 2YPIA 1F3TA 2Z2BA 4JTEA 3TCSA 3SIMA 2V2HA 3CO4A 1QI5A 3NQFA 4DWSD 1XLKA 1M6JA 4CNTA 1EQCA 1XLMA 4QCFA 3M5YA 3PS7A 3N1AA 2E25A 2O92A 3NIYA 1X1NA 3VDGA 4Z0SA 3AZRA 4HNLA 1LOSA 4E8DA 3V0TA 4N42A 2C15A 1ZAIA 1YXDA 1U33A 5AKQA 1ZP4A 4X9YA 3TJXA 3EKGA 3TONA 3O63A 3MKKA 4MLRA 4IPNB 2AL2B 2V8ZA 5BRPA 1LYXA 3AS3A 1UC5A 1TG7A 1T5AA 3HMJG 4MJ2A 4AZCA 2AOSA 5REQB 4GUHA 1OFQA 1UUMA 4JCMA 1EIXA 3W2KA 2PWUA 3CUHA 3GUGA 1NDZA 1IGSA 1EOKA 4Q8TA 1J6PA 2PLMA 2CFFA 2RHGA 2CLLA 4H19A 1MEHA 4C6BA 2BX7A 1GOXA 5I3JA 1VKFA 1KTNA 2REQB 4HCLA 3FV9A 1VBGA 4XD6A 5F2LA 3ABRA 2XPKA 3ONBA 2OEKA 3FS2A 1AQMA 2BLEA 2Z1BA 4A35A 4B5TA 2ACQA 2WSPA 2XVNA 5ABHA 2OYLA 3GR8A 5AHIA 3GDKA 2FB3A 3OZYA 3ARUA 5HNUA 2DH2A 4DBEA 3VE9A 5H91A 4IF2A 2NXIA 4RLIA 4QLKA 3OP2A 2E40A 1MNSA 3O6CA 2CHOA 2ICSA 5G1YA 3ITXA 2DDXA 2GWGA 3SCVA 3RX4A 3DHFA 1TE1A 4DUWA 3PNUA 4PE8A 3T0DA 2FB2A 2ZZ1A 4FOJA 2VT0A 2VQTA 1GONA 3AIVA 3GK0A 1FTXA 3MHFA 1FDYA 4R85A 3CZGA 4CN6A 4IIGA 4GZIA 3RN6A 2WHLA 1OADA 2NWSA 4HU0A 1OF6A 1HG3A 5E0FA 2HXUA 1JVNA 2KX9A 2GSEA 3VNLA 4NX0A 3MYPA 3U7VA 1KBJA 2ASHA 5DRCA 2WOQA 1RP8A 3C0LA 1LWJA 3WF1A 4WF7A 4M6VA 1Q8JA 3A21A 1Z6KA 3MCOA 5D09A 5TNVA 2H3DA 4O8RA 4OTKA 4PMRA 1EKOA 1OT2A 4H2HA 3G1VA 3GTNA 1XQKA 3BE7A 3HM7A 4CKQA 1SW0A 4IQLA 5DT7A 2I5QA 3T9PA 1H7RA 4YCPA 4A8RA 2YOCA 4PCPA 4UFLA 1N2VA 2WHMA 2FGZA 4NG3A 7CGTA 1TTQA 3PK7A 3UGRA 3STEA 3MBFA 4AIUA 4HPXA 3U2EA 1Q7ZA 2QIWA 4OIFA 4W93A 2D1ZA 2FFCA 5C9UA 5KETA 1VQTA 2HCVA 2NLIA 3QR0A 3ZLGA 4Z1BA 4DBSA 2W62A 1A5LC 4DI8A 1Q66A 4P2VA 2QPXA 3UZJA 1GVQA 3W27A 3MCNA 4G8TA 3GVWA 3N2OA 1WO2A 2WC4A 3MB9A 3B04A 4EXAA 4QAWA 1DHKA 2HVNA 4X3ZA 4LOCA 4CCZA 4G6CA 4CNSA 3MMUA 3EPOA 1Q4WA 2WSQA 2CWNA 3N9SA 1E0WA 3GVRA 3QXBA 2YXOA 1EYWA 4IMCA 3M0JA 2QZRA 4O8AA 2CHRA 5EMYA 1SZRA 2I14A 4A2RA 4HK6A 4GQBA 4B5NA 3CL7A 1A5MC 4OKDA 3TYAA 1P7TA 1SQ7A 3ZFHA 4UCFA 2TYSA 3W2JA 3LX9A 1HGWA 2XN1A 3PG8A 1NP0A 3QLLA 2P76A 2V3EA 3GUWA 2R24A 1G5AA 3VC6A 4BQ3A 5E6ZA 2TPSA 2CZ5A 1W9BM 3EMQA 4ZCWA 1RLCL 5HWNA 1KRCC 3PZNA 4JTGA 3EWZA 3R89A 4PBEA 1I1WA 1GQJA 4HSOA 3ZSTA 1N55A 3JRKA 2VFHA 5HJYA 3UXKA 5DMYA 2Z29A 4IFKB 6REQA 4K8HA 2FJKA 5BRBA 3EKZA 3GU9A 1JPKA 4ERIA 1RK5A 3HN3A 3GXNA 3P84A 4L80A 2WHKA 2BY1A 3KRZA 4R7JA 4Q8OA 1BTMA 4ZE5A 1UWTA 2DEPA 4GJJA 1JPIA 1XKYA 1W8SA 1FWSA 4AF0B 5I3IA 1U1HA 1XF0A 5TD4A 3S47A 3IAQA 4HYRA 2X1UA 1EJVC 2AGTA 3GQYA 5CLTA 3T6CA 3N6HA 1EX1A 3HJEA 4P7RA 2DZAA 5H2ZA 3OU8A 2CW6A 3ZWTA 3Q67A 4AH7A 2XVLA 2B81A 3L5AA 2XIOA 4CEXC 3HG5A 4JQ1A 4QE5A 1EZWA 3LA4A 1H09A 1R7OA 1XBVA 1JZ5A 1F61A 3O06A 2J75A 3ZOAA 5FF2A 4ZQCA 5LXEA 1B31A 1YDYA 4YXGA 2R9RA 2X7VA 2NW0A 4GI6A 1OYCA 1WKEA 2XIJA 4E8GA 2OO0A 1A49A 3PBGA 5L6UA 3R94A 1FWCC 3DC0A 3IIXA 1E55A 3VOIA 5DN1A 1FUYA 3CWHA 3KFTA 1K8CA 1OBAA 2WMJA 1K9DA 3UF9A 5CBIA 1DORA 1PHWA 3RPMA 1DBTA 1ZBKA 5FF4A 4Y8FA 3VCRA 3SCRA 1YNPA 3VTRA 1U1JA 2QCCA 2CLHA 3AIRA 2V9DA 3OG2A 4ALDA 3O16A 3ALFA 4N9EA 1WZLA 4QSHA 4JHZA 3RO6A 3B8UA 3TE9A 1VIZA 2XVGA 3TTYA 1TV5A 3AMDA 2X8RA 4WOZA 1QBAA 2TSYA 1R3WA 3LK6A 4JTTA 4M6UA 2C1IA 4FNPA 2W61A 3TU9A 1HF6A 3PZIA 1SJCA 2OLAA 3MI3A 1M5WA 1WB0A 4XVDA 3UERA 3N19B 1CI1A 2ZXAA 3NDYA 1NOWA 3UNTA 3W7HA 3OIXA 1KRMA 2V5DA 1DWHM 3W7JA 3QBUA 3M0VA 1NFBA 5BXRA 3SB0A 3GVQA 2XH2A 4JHOA 1ZY9A 2BY0A 1AZ2A 4JTQA 3P82A 3N4AA 5JVLA 1VFUA 1C93A 5LNVA 5DMNA 4JOMA 4PB4A 1DE5A 4J27A 1X7FA 1S1RA 1RP9A 3EWWA 2GVGA 4W5UA 4YTRA 3UBPC 1WAWA 3BMXA 1F07A 2NV2A 3W1LA 4LRSA 3T2QA 2D0HA 1LLZA 4ZBCA 2C19A 5IHRA 4NYYA 4YJ5A 3WIJA 1VCFA 2NX1A 2F6KA 1LG1A 1Z7AA 3IVTA 4JNYA 4D6JA 3T0BA 2BY2A 2DIJA 4GY7A 2XM1A 2V3DA 1K3UA 3BG5A 5DX7A 3CTTA 2ATSA 1WBJA 1Q6QA 4QE1A 4LB4A 2Z1XA 2V67A 4JTFA 4GGBA 3KBVA 1JIBA 1JL8A 1JRBA 4HJFA 3SECA 3VMOA 2P88A 4RNJA 1EXPA 2Y70A 3SGUA 4K1GA 1ZB5A 3U0HA 4HU3A 4MMWA 4N2YA 3S4TA 1DXFA 4K6AA 1PAMA 4INFA 4HNCA 5D03A 1CXIA 3B0VC 4MSSA 2E9LA 5DBUA 3CMJA 1XV8A 4FLSA 3M5XA 3VILA 4U33A 4MKNA 4MKVA 5CG7A 2PGFA 3NO3A 3PWGA 1PX8A 1NF7A 4XWUA 4MAVA 1HGYA 4A4AA 3U2ZA 3MDWA 5J8LA 4Q8NA 1UG6A 4AZCB 4NI3A 4DNMA 2QCHA 4K7YA 2OCZA 4ZB5A 3UQNA 3GG0A 4PL1A 4JYEA 3HQNA 3DYMA 1KD0A 5HANA 2WZMA 3PF3A 4PCFA 3RM4A 4HA3A 5AYIA 3S5NA 1DKWA 3QFEA 1BVZA 3EOSA 2E0PA 2CYGA 4PSRA 3AU6A 4MYXA 4N0RA 1QW9A 1K8YA 2YCKX 4ZOBA 2PTXA 1FHUA 4FX6M 1CGVA 5JUVA 2GUUA 3N4EA 3W7IA 1OB0A 1XIHA 4DIAA 2PPGA 3WL0A 1M7PA 4URIA 3RM8A 3U7BA 1X1ZA 3C3NA 3FDKA 4AD0A 2WSRA 4EVZA 3A12A 4ZMGA 2VGBA 4BKNA 4GC3A 4EXQA 4DAIA 3EXSA 1FWAC 3B9DA 2D0FA 3CZEA 1TWSA 2JF7A 5CPTA 4F0MA 2QR6A 2BVTA 1IWBA 3QQWA 1OCJA 2B31A 3PZMA 3C0JA 1TPWA 2DSKA 2ABAA 4PMXA 1K02A 1OM0A 3M5ZA 5I6SA 1HVQA 2RH9A 2X2YA 4Z2LA 4R34A 3HQ1A 1D3GA 2QCDB 4JIRA 4PMJA 3GG8A 4NZ4A 1AH4A 1OC5A 3NL6A 1XKJA 3IIPA 4P61A 3OW1A 3THAA 5HXMA 3S9ZA 1RCQA 4HJWA 4DM2A 1E73M 2XH7A 2Y8VA 3L9CA 2Y61A 4ZO7A 3H2NA 3W0KA 3M41A 2XU2A 2ISDA 2X1IA 3NPXA 2G3FA 4GZJA 3IGHX 4JKLA 1JQXA 2OKTA 1KM2A 4AWTA 1MEWA 2ZBTA 2ACRA 2A79A 3LY0A 1BVNP 4KF1A 2OX4A 4O1CA 2E1DA 2J8GA 2VENA 3TA6A 5FKYA 1F05A 4OUIA 3VABA 3LXAA 1XFBA 3ZVHB 3R8HA 3EX1A 4JFWA 5D9MA 1FH9A 2C3ZA 1TVLA 1EZ2A 2HNEA 4EXBA 1WYIA 2ZZ4A 1GYMA 1AQFA 1UKPA 4C1NB 5ABTA 3B97A 1W2PA 3LDVA 4ZXLA 3GKAA 4PTXA 1C9WA 1MZRA 1OINA 4IPJA 1Q2RA 4ZVJA 4H7CA 1QPRA 3FIGA 5FL1A 1CB2A 1IEWA 3WUEA 2UWFA 3BLKA 1XW8A 3KBSA 5D38A 3O0KA 4LAMA 1TX0A 1OFEA 1WBHA 4B4FA 3E5PA 4H7VA 1B2YA 5C7VA 3OVPA 4ECLA 3VGBA 1BVWA 1TTIA 4DHGA 3APGA 5C2CA 3E5BA 4XZIA 2NSXA 1KBIA 1I6NA 1R87A 1ISWA 4MNJA 3U5UA 3G1SA 1KBBA 1B9BA 1KFLA 1JJKA 4OBRA 2I57A 4IIHA 4B3LA 4RK8A 2A21A 3DFNA 2WVVB 2VX4A 3NVDA 4CQCA 1WX0A 3R2GA 5HNNA 1Q63A 3GS6A 3PB2A 4KRZA 3JVAA 2R91A 1OC7A 4F0KA 2GQ3A 3AALA 4WXZA 3QZ6A 1VJZA 3ZJ8A 3KUMA 3BJSA 4AWUA 3H7VA 4Q32A 4DWSB 3THCA 2YCLB 4BF7A 4O0QA 1ZENA 1FWIC 2CIPA 3ZO9A 2VNCA 4HTBA 4J1OA 4AF0A 1D3HA 3HPAA 1JGIA 4IXXA 1XBZA 4J3VA 3W70A 4KGJA 4BJHA 1W3NA 3QF0A 3C8NA 2G50A 3L2IA 1NWRA 4NF7A 1QWKA 2FH6A 3NQGA 3MCMA 4MJMA 1ITXA 3GXPA 4PUUA 3NA8A 1MFVA 5HAOA 1KQYA 1DHPA 3FDGA 3BXWA 3E3HA 5EGRA 3RPTA 5J5RA 2GOUA 4HA1A 4G9PA 5A8GA 1RCOB 3R5EA 5LKYA 3DIPA 1J18A 1WKFA 3GAYA 2Y85A 1PKLA 1DL3A 3BURA 1SM9A 3BL3A 4XZWA 3TC6A 4GY0A 2MANA 1EDTA 1VRDA 4NQ1A 1XIGA 1KGUA 4RKAA 3CZ8A 1A0EA 1OCQA 1B5TA 5I06A 4AX6A 2VKZG 4LAKA 4Z08A 4Z17A 2ZA1A 5CZ0A 3VDHA 2PDWA 2YDRA 1VFFA 3A3HA 3NWRA 4IUGA 5CCZA 1W1ZA 1O6IA 1V6XA 4FSAA 1VGAA 2VDIA 1VFMA 1CGTA 2JQXA 3LCLA 4QJ5B 4DEFA 4QGCA 4UTFA 4DXKA 3CH0A 3MP4A 3RJXA 4A21A 1QHPA 9XIAA 4NJKA 3STFA 1JCLA 1V0MA 3RF9A 3GXTA 2VEPA 4H9YA 2YLAA 3ITOA 5FJOA 1EO5A 1TTJA 3DFYA 4DBUA 2GDQA 4O54A 3NPVA 3F2DA 1OGGA 5A6LA 2NXHA 2CZEA 4LNCA 1M04A 1JAEA 4B5UA 5IRPA 3OLDA 2NWRA 4BS0A 2QUNA 2YA0A 2X2GA 5CC5A 3GHRA 4HK5A 5A6TC 1L0PA 3TQVA 3HJZA 3PJUA 3Q37A 5C71A 3RITA 1DWIM 3NUKA 3W7NA 3BCJA 2EHHA 1GHRA 4I3GA 5C9ZA 2X1RA 2H8XA 2AL1A 3UWZA 4RDWA 1B4EA 4OE7A 3KVLA 3UR5A 4Y6GA 2GGIA 4NU7A 4BQ4A 1AA1B 1S5WA 3FJLA 3VOJA 1EC7A 1CX9A 4G1NA 4GIYA 4IJRA 2ZVIA 4EPKA 2Z00A 4UNIA 2J62A 1R3YA 5E0KA 1CTNA 2D20A 2ON3A 4RW5A 2WMKA 1EWDA 4F0LA 1C8XA 3GIYA 1VYRA 5ABFA 4ACZB 1PXGA 3PWAA 3RDKA 1VBRA 3ANYA 1B57A 4XZBA 4LV4A 1JDEA 1FBAA 3UWVA 5B7ZA 1E72M 3VYLA 7XIMA 4R9OA 2BHZA 3GB6A 5CPQA 3OHMB 4MZYA 2OOGA 1R30A 5IFPA 2BTMA 1BHGA 1D9EA 4UFIA 4H3DA 1GOWA 3PP7A 3S3GA 4MPQA 4O50A 3M44A 1FWJC 2ZRWA 1EJXC 4AX7A 4WHBA 3ARTA 4H9VA 4JTSA 3W88A 3TK7A 8XIMA 3BGJA 3GRIA 2OGJA 1SZEA 1XM3A 3CS2A 4Y9PA 5CXPA 4UOQA 1L6FA 1L2QA 1DWGM 1H50A 2GFTA 3CAVA 4ML9A 5GJNA 1R9YA 1LUCA 1C7TA 4HMNA 3TV8A 2TMDA 4O15A 3AYSA 4NXKA 1JYVA 2FKPA 3LV6A 4C7GA 4DJDA 1MYRA 2BS9A 4FEZA 3TYDA 3GTFA 3STGA 1LP6A 2DGAA 4XTIA 6XIMA 3FK4A 4C7DA 1V8EA 1DIKA 2YIHA 2DSUA 2DT3A 4IXHA 1RV8A 2VCCA 1HP4A 4ZFCA 3WBAA 4MY8A 3L4UA 1KR1A 1N8WA 3FVMA 2VWTA 1ISZA 5IDIA 2SFPA 1A53A 4N4QA 7REQA 1Z8AA 3N2BA 1RVGA 4AYGA 3RO8A 1PVNA 5CPOA 2EKGA 1RJRA 3FCPA 4GPNA 1XJBA 1YHTA 1V0LA 3UCQA 5AC7A 2YDAA 1LT7A 4Z42C 3LNMA 1QAPA 1XCXA 4NSBA 2JIEA 5A2AA 1QPQA 2EBNA 3ALGA 3TWBA 3VUSA 3WD4A 4FLQA 1ZZMA 1J93A 3NO5A 4YN5A 5AC6A 2PRLA 3L68A 4QQ3A 1K6WA 1U83A 1SGJA 1QHZA 1HTIA 1XLIA 1ZPTA 5A94A 1F5ZA 4GA8A 4ICMA 1KTBA 3BCFA 3LU2A 5JXQA 3FVDA 1PL9A 5FJIA 4WIWA 1YE6A 2BHUA 5HQLA 3HFTA 2A3AA 1VR6A 1DJWA 1IT8A 2YR1A 4DO7A 5CBBA 3T0CA 3KL3A 4P8WA 2AKMA 3HQOA 4WJ8A 3CV1A 3T44A 3PZQA 4UFHA 3D3AA 2YJQA 3B8WA 4KCVA 1PZ1A 1Y7VA 3C2OA 1K1DA 4GVIA 1N82A 1TRDA 3WNPA 4WR3A 4P5UA 1O5KA 4J3SA 3KVJA 3WMSA 3KCOA 3EYPA 2O0TA 4H2CA 4FIQA 2QCFA 2P5NA 4J3WA 4O16A 4CD4A 2F2HA 4OVXA 3UR2A 1TA3B 1QASA 3UWEA 2PRHA 3C2YA 3S5SA 3I6RA 1C29A 2EO7A 2QAFA 4H9XA 3UZZA 1X6NA 3PWIA 1FCUA 2ZUNA 1TELA 5F4WA 3BLFA 5HPOA 4NNCA 3W1NA 3IUDA 5C6MA 2W27A 1K8XA 4LY4A 7ENLA 2Y24A 1MUCA 2WKJA 1FWHC 3CIWA 1KLYA 3ZT6A 4PB5A 1ZJHA 2XZ9A 3CMFA 1DJHA 1PUDA 4S38A 1DWJM 4GVFA 3KRBA 4NAFA 3NEHA 1TB3A 4ZQRA 2WJDA 3AZSA 2C1HA 3KS6A 4PRRA 1UYQA 1PO9A 2G3IA 4PMQA 4BY3A 2J7EA 1R2RA