3PTKA

The crystal structure of rice (oryza sativa l.) os4bglu12
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
478
structure length
478
Chain Sequence
PVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase Os4BGlu12
publication title The crystal structure of rice (Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-glucosidase with significant thioglucohydrolase activity
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
total genus 193
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ptkA00
3HN3A 1UR4A 2CYGA 4MB3A 4QFUA 3MUAA 1P6WA 3KL0A 1WZAA 2WHKA 2VVSA 2WMIA 1NP0A 1BLIA 4UTFA 2XIBA 3N17A 5CZKA 2J79A 2PBGA 1BFNA 3TOPA 5AC4A 3TTSA 5I6SA 2O9RA 4PMUA 3WELA 3EDDA 2DPEA 1M53A 1K9TA 4CCCA 2VOTA 5M03A 4MDPA 3NSNA 3L2MA 3WBEA 4D6JA 2Y4SA 5A6JA 4KGJA 2V3EA 4GZIA 4UOQA 4Q7NA 1BYDA 3O2LA 5BXTA 4P7OA 1E71M 1H3GA 4N0RA 3PZOA 5C8BB 4E8DA 5D8WA 1V3LA 2GVYA 3ARRA 2CIPA 1HF6A 2G8ZA 2YA2A 2WHLA 1GHSA 2BY1A 1WP6A 3SUTA 3TA9A 3N1AA 3CZJA 3GXFA 4FLSA 3ARZA 3VTRA 3CZ8A 3VMOA 2EQDA 2YL6A 4AZ5A 3VD5A 1HVQA 4HTYA 1CGXA 3SEPA 1BYCA 2DH2A 3CBWA 4GI9A 3M46A 3POHA 4PN2A 4B16A 3NCOA 2UY4A 1FA2A 2FH8A 3GZAA 2WWDA 4Z2KA 1GW1A 1TVPA 1ISVA 1SMDA 5A8PA 1M01A 1HKJA 1C7TA 1G1YA 2FGZA 5LA1A 3AIRA 1ODUA 3APGA 4CD5A 1VEPA 3WQVA 1WZMA 3GH5A 4BQ5A 5JBEA 2V5DA 4GKLA 3ZOAA 1EQPA 1UYQA 1O7AA 4KMQA 1KBKA 1BQCA 2CERA 3WNOA 2ZE0A 4UQCA 2YOCA 1HT6A 2VO5A 2EXOA 1US2A 1VJZA 1EDQA 3TONA 4AIUA 1E6PA 1HKIA 5D9OA 3EDKA 2CKRA 3CPUA 2MANA 2FH6A 1GJWA 1TUXA 1JGIA 1EIBA 3ARXA 2X05A 5ABFB 4ZXLA 2CKSA 3PZGA 3WNMA 2D0GA 2VX6A 3T0AA 3WNNA 3CLWA 4PMOA 1JDCA 4ZE4A 2CITA 1K9FA 1VEMA 4DM1A 3AIWA 2GJXB 5LA0A 2WLYA 5A2CA 2XSAA 1PIGA 1WO2A 3II1A 2J8GA 2CXGA 3RIKA 5D4YA 1UA3A 3BSHA 4UFMA 3AXHA 3BGAA 1IT0A 4DWSA 4U2YA 3SCQA 2Y2WA 5HXMA 2QF8A 3OB8A 1VRXA 1W9XA 3AIQA 2W91A 1NWRA 3WUEA 1V3IA 3GNPA 5CSYA 4S3KA 3VO0A 2D1ZA 4ZFMA 4H8UA 1JFXA 3OIHA 4CU8A 3RM4A 3L4UA 4J7RA 4X9YA 4UQ9A 4RE4A 2AOSA 2ZWZA 1FFRA 4QLLA 3AXXA 1CDGA 3LPOA 4HPHA 5KEZA 3AMGA 1KB3A 1UOKA 1UD3A 2XPKA 2OLHA 4ZE5A 3U7BA 2FHBA 1CYGA 1H5VA 2VRJA 4D6IA 4B9YA 1LG2A 5A6LA 3WUFA 1UWTA 2FHCA 2YL5A 2ZXQA 2CBIA 2FHFA 3DECA 4AZCB 1H0IA 3EBVA 1W1PA 2WC7A 3SCUA 1DWJM 2ZUTA 3OLGA 4MADA 1W3JA 2ZXBA 2EEXA 1FP8A 4BQ2A 2J7GA 3S2CA 1E4MM 3VDCA 1QBAA 3CZGA 3AQUA 3VM7A 3B9DA 1ISYA 1GNXA 1JFHA 4AISA 3MU7A 2DSZA 1BGGA 4AC1X 5BXRA 2YA1A 1UH2A 3VGBA 3W28A 4Z2HA 1MW0A 2WMFA 2J62A 1DWIM 1X1NA 2D20A 3VX0A 1CXFA 6TAAA 3OA5A 3BAXA 5CGMA 1QI5A 8CGTA 1W1YA 1ZJAA 1XYFA 2UY5A 1LL6A 1XCXA 1KQZA 3VNYA 3WSUA 4W88A 5AC5A 1QNOA 1E9LA 1BHGA 3ZR6A 2J25A 3DYPA 3OGRA 3U5YA 5A2AA 1RD6A 1J12A 1QNPA 1XH0A 5ABGA 2J47A 3VIIA 3EDEA 1NP2A 4MNMA 1CXHA 1US3A 1GVYA 1V0LA 1DEDA 5IXEA 2JALA 4BCEA 3WENA 2OSWA 1V0KA 1VFOA 2D3LA 3M6DA 1FH8A 3W25A 3WH7A 2WZHA 1OB0A 3I3EA 2XM2A 2WC3A 1OT1A 4J3XA 1OGGA 5FD0A 4CD6A 4L4PA 5BWFA 3BXWA 3GYCA 3WEMA 4PEEA 3OBAA 1E0VA 1HJXA 2BVDA 2ZX9A 4F9DA 4V28A 2WSKA 1VF8A 3WH8A 2E9BA 4JKLA 1HL9A 1ZBVA 4MJ4A 2VZTA 2W62A 3AIVA 4CGTA 2DSWA 5IDIA 2Y8KA 1G9HA 5E9AA 1JZ7A 4CN6A 4W5ZA 3WKZA 4IISA 3W82A 2B31A 1H49A 1PZ3A 3W26A 1V6UA 5I24A 1XD1A 1B2YA 2J74A 3VIOA 5GNXA 4PUEA 4PMNA 2O9OA 3PZTA 1J0KA 1VB9A 4W85A 3ZT6A 4Z2JA 3ZJKA 4U5KA 4YHEA 2WKLA 2J7BA 4EE9A 3K4DA 3HMCA 1PAMA 1M7XA 1XC6A 4GI6A 3W0KA 1BYBA 1MW1A 1XRVA 5AY7A 1HJVA 4LQ1A 4FK9A 3OZPA 1C8YA 2ZICA 3VGGA 3WQ5A 1GQKA 1BG4A 1R7OA 1BSIA 4FF5A 4AZIA 2RGLA 3VGEA 4F9JA 1CPUA 4MB4A 1UR9A 2WSPA 4JFVA 5DT5A 3U7VA 2WB5A 2BXYA 1V02E 4U3CA 2CNCA 5ABFA 2J75A 2J7DA 5JIWA 3NIYA 5FOOA 4U3AA 1OIMA 4U33A 2JE8A 1V3JA 2J7CA 1CGTA 4D71A 3I3BA 1JDDA 2GJXA 3CHFA 3VDHA 2YDQA 3WL0A 3QOMA 2EO7A 1UD5A 1L0PA 1VFFA 3DC0A 2WVSA 2OSYA 4MAZA 1MW3A 3WD0A 1G01A 3CZKA 4CVUA 1BPLB 1W9VA 1G5AA 1E6NA 2GFTA 4UZSA 2FGLA 3MMWA 3WQ6A 2XWDA 3AZRA 3EMQA 2A3EA 5AYBA 3VDBA 1DTUA 2OWXA 3T09A 2HISA 3B9EA 4LX4A 1AQMA 3DHPA 4X0NA 1SR0A 3VD3A 2ZX7A 3U57A 4AD5A 2W67A 4E8CA 1UWSA 1UR1A 3BAWA 2QV4A 2DIEA 3W27A 4DWSB 5M3WA 1CECA 3ZR5A 4OUEA 3FXYA 3VPLA 2XVGA 2PWEA 1C7SA 1CENA 4PMVA 1JF6A 4P8WA 2VZVA 1PZ2A 4HP5A 1UKSA 4HZ8A 3AI0A 1NARA 1CXKA 3K46A 2DH3A 3MUY1 1GQIA 2EBNA 1TA3A 5I77A 1BYAA 1KXVA 4W86A 4TX8A 5BRPA 2WXDM 5CPTA 1PX3A 4XX6A 3VIHA 4JCMA 3VINA 4UCFA 1KCLA 5CPSA 4CVWA 3FY1A 5JBFA 3CO4A 2Z1KA 1JZ5A 1JI2A 1GORA 4M29A 2EPKX 1EXPA 2QMJA 1J10A 3MANA 3AFBA 2CBJA 3GBDA 2Y5EA 3OZOA 4U2ZA 1Q6GA 1GOMA 2VX7A 1XD0A 3AIEA 1GUVA 5BRQA 2W63A 1CLXA 3WMSA 1NWSA 2ZUWA 3CUIA 2DSUA 2GDUA 4DWSD 3AROA 3MMUA 4XUYA 4MB1A 3MUIA 3WH5A 2VCBA 2ZXDA 4D6EA 4LPCA 5DT7A 1CGUA 5A6MA 1EOKA 2YJQA 4BA0A 3VIJA 3VDAA 1HX0A 4M82A 3ZT7A 3T0DA 2Y8VA 5A6AA 3MUZ1 3NSMA 2WCAA 2A3BA 4UOJA 3MV11 2QHAA 4GI8A 1UQZA 2WAGA 1W9UA 2VURA 2OWWA 1DWAM 3EMZA 1KXHA 2XFFA 3SUWA 4UFKA 1EQCA 5A6BD 3SCSA 3UESA 4DM2A 1E3ZA 3EMCA 4V27A 5IFTA 3A47A 4NRRA 4R27A 4P8XA 1UD2A 3G6MA 3PZNA 5I78A 1RPKA 1WAWA 4AWEA 3WN6A 4B3KA 1FFQA 3AZSA 1QHZA 4ATDA 1UD4A 2WZIA 1OSEA 4HZ6A 3T2QA 5E70A 2V5CA 3O9NA 2D0FA 4C7GA 4P7QA 1J0HA 3VIPA 5EFDA 3EYPA 3WD1A 4BZYA 4PTWA 4RE2A 2VZUA 1I1XA 2CEQA 2Q8XA 3PZIA 4CD8A 4IPLA 3F5KA 4HU0A 5FKYA 4Y7EA 1YQ2A 4JIEA 4QAWA 3BAKA 3NJ3A 5A1AA 1SMAA 1LWHA 1NH6A 1EDTA 4Z2GA 4XV0A 3RCNA 1KWGA 5DO8A 1MQRA 1W9PA 4M1RA 4ATLA 2FDMA 3AIUA 1TMQA 2ZUMA 2Z1SA 5HDRA 3MO4A 3L4TA 4F66A 2WCGA 2D23A 2X1IA 6CGTA 1E5JA 1J0YA 3AMCA 1H4PA 4BS0A 3WF3A 1KGXA 3WQ4A 1JZ8A 3THDA 3MS8A 2XVKA 2D3NA 1UWUA 1B0IA 1E6XM 5E0FA 3PTQA 4B3LA 3SCVA 2YLAA 1PEZA 1UD6A 2CCRA 1HKKA 1LL4A 4MDOA 4FLRA 3WEZA 4CN4A 1MFUA 6A3HA 3VM5A 5GQBA 1JNEA 1WDRA 4TXEA 4KRUA 4F79A 4HA3A 2RGMA 5F7UA 3NSXA 4MAVA 3D3AA 4UFLA 3LPGA 1H1NA 3A4WA 4AW7A 4AY1A 3IAPA 3ALFA 4OJYA 1TCMA 3W53A 3SUSA 1JAEA 1HP5A 3UR8A 1MXGA 1LLOA 4AIEA 1V6WA 3ARWA 4H8VA 3MSGA 2BVTA 3WH6A 2BHYA 4GQQA 3AS2A 3AZTA 2PWGA 2QPUA 4J3TA 1JD9A 3AISA 1B30A 1MFVA 4TVCA 3CHDA 3BCFA 4TTUA 3W24A 4H04A 5A94A 1N82A 1W9DM 5BROA 3PZVA 5ABEA 1S46A 1UR8A 1VFUA 4CU6A 3GH7A 3CUHA 1H09A 3VNZA 4AXNA 1EO5A 1LQ0A 1CXLA 2WM0A 4K68A 4JFWA 5A8MA 3AHVA 4IUGA 3AICA 4LYQA 2WVTA 2G3NA 1B3WA 1PX8A 4CD7A 3N18A 1B3YA 5CXPA 3AS1A 3LMYA 1GHRA 3FAXA 2GJPA 3DYMA 1ISXA 1ISZA 3WIJA 5HOSA 2BHUA 1ECEA 3ZO9A 4ACZA 1Q4NX 4CD4A 1LF1A 5HNNA 7TAAA 1CBGA 1PX4A 3A4XA 3WD3A 4E2OA 3KL3A 1E4IA 1PBGA 1V03A 1QI0A 2C0HA 1TA3B 3ZJ7A 3PBGA 2TAAA 2VQUA 5A6BA 1GOQA 1HJQA 3VUPA 3CMGA 1DWGM 3WMCA 4CN1A 1E15A 2XTKA 3N12A 4PUDA 3WF4A 1LG1A 2PB1A 1C91A 4WKHA 3AYSA 1DWFM 3WF2A 1MYRA 1SYTA 4JKKA 4ACYA 4UQEA 4A3HA 3VMPA 1WDQA 3W4RA 2ZX8A 4HU8A 4MTVA 1FOBA 1J18A 4WIWA 1VBUA 2WHMA 3IANA 2WZEA 1M03A 1NWTA 4JAWA 4BF7A 4KGLA 1UKQA 5LA2A 2JFEX 1J11A 3VILA 1KXTA 1L8NA 3GM8A 3GTNA 5EFFA 3BAJA 1E1EA 1C3FA 2JEQA 2WANA 3VGDA 3ZSSA 1W2PA 4WSKA 2YBUA 2WK2A 3AHTA 1MQPA 3MSDA 3N11A 1JZ6A 1WCGA 4PSPA 3SCWA 2X09A 1GOOA 1E40A 2JIEA 4LYPA 1ZJBA 4BQ4A 2X8RA 2EJ1A 2WCSA 1GVIA 5D9NA 4M24A 1CGYA 2WMJA 3HU7A 4D72A 1M04A 1JYVA 1B1YA 2VT0A 1NOFA 1HJWA 4KWUA 2DT2A 5D9MA 1ZBWA 3PZMA 1K9DA 4QP0A 5I23A 2JIWA 4UQDA 2ZUVA 1MWOA 1V3MA 2AMGA 1G0CA 3L4VA 4QCEA 3AMLA 1JD7A 3FN9A 5DFAA 4CU7A 5LYRA 3BAYA 2VZSA 3N15A 3CH9A 4UR9A 2XYLA 1QNQA 2JF6A 3W6MA 3WMBA 1EGZA 3T0BA 3CUGA 2XIIA 3SCTA 2UY2A 5A69A 1NOWA 1Q6DA 3CHCA 3SURA 4PTMA 3CIVA 3AHYA 1XH1A 2BFGA 4JZ5A 2CBVA 1VJSA 3ZT5A 1UA7A 1ZU8A 3UG5A 4P7NA 1WDSA 3F4VA 1E72M 4D1JA 1B31A 3A3HA 4NI3A 1J0IA 1OD8A 2WVVB 2W4XA 3AMKA 1V0MA 3UEQA 2F61A 1GQLA 2VRKA 3LPFA 2J77A 1FHLA 3A4AA 4WF7A 1C8XA 5HPCA 3BLPX 2ZX5A 1XSIA 1GOWA 3MKKA 3T2OA 5I5RA 5IFPA 1B3ZA 2BXZA 2F2HA 4DUVA 5FL0A 1CZ1A 1QPKA 4W93A 3SCPA 4AZBA 4NF7A 1TZ7A 1UD8A 1VBRA 2OYKA 1J9YA 3VU2A 2DEPA 2VMFA 4A4AA 4JHOA 3NYDA 4LXFA 3BLKA 1A3HA 5HPOA 1RH9A 2WC4A 4OKDA 4AIOA 1E5NA 3W6LA 2WW5A 1UUQA 5BXSA 2VTFA 2GSJA 4OOUA 1UR0A 3WF0A 4WLCA 5TD4A 1KXQA 3FW6A 1R85A 4WKAA 2E8ZA 2ZUNA 2JEPA 1XSKA 3RJYA 4D6GA 3U5UA 1BVZA 1QI3A 4TUFA 1HJSA 1XSJA 4HMCA 3NDYA 3VIGA 3GNRA 4J3WA 1OM0A 2A3HA 1I1WA 4JCLA 5CGTA 2WNWA 4JFTA 2YIHA 2BVYA 4URIA 3WD2A 5C70A 5CG0A 1QI4A 2XM1A 4PMRA 2GUYA 4EKJA 4AD1A 1JYNA 2DSKA 1J01A 3WBAA 4C7DA 3QR3A 1E1FA 2WVUA 1B9ZA 2GDVA 4W8BA 5GNYA 4EANA 1W1TA 3AXIA 5A8OA 3CGTA 2OSXA 1RP9A 4D6FA 1X6NA 4ML4A 2XVLA 5IHSA 4W8AA 3W38A 4PBGA 1VFMA 1QI2A 9CGTA 4ACZB 3K8LA 5HBFA 1KBBA 3AMDA 1G94A 5A8NA 5CJ5A 4J27A 2YL9A 2CHOA 4GXPA 1V3KA 4B9ZA 3WH9A 3CTTA 1D7FA 4DWSC 4J28A 1GJUA 4PMQA 4M8UA 1UH4A 4B15A 4M56A 1GQJA 1EH9A 2D24A 4AZGA 1KCKA 2E8YA 4RE3A 1TFVA 1E6SM 3W29A 3SCOA 4KH2A 2IXVA 3HJEA 1Q6EA 5A95A 1D2KA 1QHPA 2JF7A 1HIZA 5EB8A 2NW0A 3W81A 4V2XA 3GNOA 1DWHM 2WLZA 4DUWA 3QHOA 3BMVA 2ZX6A 3VVGA 2GJRA 4L4OA 4F8XA 3QHNA 3RM8A 3T2PA 5ECUA 2X0YA 1HNYA 4MNLA 4W5UA 2ZUUA 3FAWA 2OWCA 1CNVA 1ZBKA 3UR7A 4MNJA 4UQAA 1B3VA 2WKGA 1BGAA 1OBAA 2DQXA 1GOKA 4UZUA 2VVNA 4GQRA 2BY0A 2VR4A 1CGWA 1UWRA 1KR0A 3L4WA 1MVYA 1W32A 1BG9A 2J8FA 3GBEA 2O9TA 2BNJA 2E4TA 1EHAA 3ZMRA 4NRSA 2E40A 4Z2IA 1F4HA 1JNDA 1WB0A 4NSBA 3AS0A 1FHDA 1U33A 2WWCA 1J0ZA 1EHNA 5CLTA 1JZ3A 3UETA 3ZSTA 3PN8A 3OGSA 4N42A 1R8LA 4OZOA 1U2YA 4M80A 4QLKA 3VGHA 1V02A 1WPCA 5C71A 1IZKA 3ARVA 4ZXOA 3OG2A 1OCQA 1U30A 3RM9A 4AD2A 2J4GA 4AMCA 1I75A 1E55A 3AHZA 4W7VA 1MQQA 1B3XA 4ZENA 1CLVA 1VEOA 5CLWA 4W87A 1UZ1A 2XSBA 2VX4A 2PBOA 3VIMA 7A3HA 3M07A 4WSJA 3ARYA 1IV8A 1PJ9A 2V38A 4JL1A 2VR5A 3B9AA 3FHQA 4JFUA 1CIUA 2BHZA 1GPFA 1V0NA 1R7AA 2J7HA 1CWYA 5JBDA 1WNOA 2XGBA 1JIBA 5AYIA 2V3FA 3BSGA 3T08A 3VIKA 3N13A 3ZM8A 4JKMA 2WVVA 3VD7A 5D8ZA 3VIFA 1GCYA 1TG7A 4PRWA 1CEOA 1HN1A 4PCTA 1OWQA 2BY2A 4UFIA 2CPUA 3NDZA 7CGTA 2VNCA 4TOQA 5A6KA 3BAIA 1CXIA 2PI6A 2VX5A 4OOZA 4ATWA 4PMDA 3FHAA 1VAHA 4XZWA 4PMXA 4IPNB 1W2VA 3OLEA 4BQ3A 1IZJA 3SUVA 3PZ9A 1BVNP 2WMKA 4HPGA 5BCAA 1WZLA 1WKYA 5GNZA 5A2BA 5CQ1A 3SCRA 1C93A 1ZB5A 2WBGA 4AZ7A 4UFJA 1FH7A 3LPPA 3WQWA 3KZSA 4PMZA 2DT1A 5CSUA 4FLQA 4DUXA 1ISWA 1BTCA 2NT0A 4E4PA 2XFYA 1AQHA 2W61A 3CZEA 1TVNA 1XCWA 3BCDA 1DHKA 1MXDA 4AZ6A 2HVMA 4CKQA 1JAKA 3WY1A 3OGVA 1KGWA 4AD0A 2PWFA 3TTOA 1LL7A 3ARTA 2V3GA 5ABHA 2F8QA 2XG9A 2C7FA 4W89A 1W3HA 5FIPA 3K1DA 1C90A 3VX1A 1XV8A 3IJ8A 3THCA 1E43A 4W7UA 3N9KA 4MJ2A 3EDJA 1ODZA 3DHUA 4UOZA 2DGAA 1KQYA 1E4LA 4HOWA 2E9LA 2WMHA 2EPNA 1UH3A 2VUYA 1YHTA 2QPSA 3SUUA 2J78A 1W3KA 4OIFA 3KWXA 3FNDA 4M81A 3SCNA 3WDJA 2E0PA 1JZ4A 2ESCA 3ALGA 2O92A 4GZEA 1TE1A 3BH4A 1JDAA 4GINA 1HVXA 1K6AA 3ARPA 2VC9A 3QGVA 4FMVA 4TVUA 2ZWYA 1X6LA 2UWFA 2YDSA 3MV01 4P7RA 3MMDA 4AEFA 3WEOA 8A3HA 3RO8A 3CUFA 2EPMX 1W91A 3JUGA 1D3CA 1R86A 4C7FA 1KR1A 3GH4A 5FL1A 1MW2A 3F5LA 2IUZA 1QW9A 2CESA 1UKTA 1KWKA 1K9EA 1JXKA 3RILA 2PWDA 3E1F1 4EAMA 1E6RA 3RPMA 4Z2LA 1KGUA 2D0HA 3SIMA 3K8MA 4GIAA 1ITCA 4H41A 2E9MA 1CTNA 4YPJA 3ZIZA 4UQBA 1JZ2A 3ARSA 3GXDA 2GK1A 1PPIA 4GZJA 3AOFA 1UKPA 3WQ8A 3VMNA 2XUCA 2J7EA 4A3YA 2V3DA 1ZL1A 2DIJA 1JF5A 1QOXA 1NM9A 4TTGA 2QMKA 3N04A 1FH9A 4PCSA 3IJ7A 1W1VA 3ARQA 1QNRA 4W84A 5KZ6A 1EO7A 1XH2A 1BAGA 1B90A 1CGVA 4H7VA 1QVBA 1HJUA 3ZJ6A 4LYRA 1OINA 2D2OA 1Q6FA 1C92A 4PYSA 4HZ7A 3UERA 2NSXA 2AAAA 5DF0A 4AZHA 4WK9A 4HMEA 2QLYA 2XJ7A 1XHGA 1E6QM 4J3VA 3WDRA 1E3XA 3G6LA 3TTQA 4Q22A 3AJ7A 2BS9A 2XVPA 1JG9A 3AIBA 1UHVA 3CHEA 4D6CA 1E4NA 1A47A 2XWEA 3QOKA 2WMIB 5A6SA 1PIFA 1ZBCA 4P8UA 2OYMA 4GO8A 2WHJA 5E6YA 2G41A 2VI0A 4HOZA 3WNKA 3WNPA 3L4ZA 1UG6A 2D22A 2OYLA 1H2JA 1NWUA 1GONA 1HP4A 5E09A 2EPOA 4MB5A 1UQYA 2ZXAA 4GPNA 5EMYA 2G3JA 1NOUA 1HL8A 3VOCA 3BC9A 5M5DA 4YN5A 1J0JA 4OBSA 3RDKA 3WD4A 3WL1A 3S6TA 3TP4A 4R5EA 2G3MA 1WDPA 2VZOA 3QHMA 5I79A 4EK7A 5I0DA 1JL8A 3D5HA 5JIPA 5GPRA 2W66A 4TVDA 4RL3A 3ZJ8A 2YL8A 5BYWA 2PF0A 3IAQA 2X0HA 3ZQ9A 2XFRA 4TX6A 2C8NA 1V3HA 4P8VA 1E73M 1HXJA 2EPLX 4WKFA 1AMYA 4H2CA 2ZOXA 3OLDA 2YKKA 3EDFA 4QDMA 2DDXA 4YHGA 5A3HA 1GZJA 1WE5A 5E0CA 3VKKA 3ECQA 3CZLA 3AS3A 1H0GA 3K4AA 1KFWA 1Y7VA 1CXEA 4P7LA 2NT1A 1UZ4A 2BV9A 5DEZA 3VD9A 1QW8A 2YA0A 4CUCA 3CMJA 3IJ9A 4U5IA 2CHNA 3BMWA 1Q6CA 4AD3A 3B8SA 2BY3A 3PHAA 2IXUA 2O9PA 3W37A 3WDPP 2WPGA 1OGSA 2A3AA 4GO9A 4UNIA 2W5FA 1E56A 4W8LA 3KE0A 2WYSA 5CPQA 3VGFA 3K8KA 2XGIA 1E0WA 4X0VA 3VD4A 4JHZA 3GXMA 2DT3A 2VCAA 2WBKA 2VRQA 4AD4A 1BF2A 5EBAA 4FLOA 5DMYA 2XVNA 5BXPA 3KEHA 3L4XA 4J3UA 1O6IA 1UKOA 1OGBA 4HOXA 2ZIDA 1FP9A 2VJXA 3WFZA 1OIFA 2G3IA 1DP0A 4PTVA 4W7WA 4NZCA 1RP8A 3GXIA 4JFSA 4HMDA 4PSRA 5FCZA 1JYWA 5E6ZA 3WNLA 3UG3A 3L2LA 1R87A 1HKMA 1C8QA 4XB3A 1E70M 3WDQA 2W92A 4CCDA 4U31A 4D6DA 4D6HA 1JXJA 3A6OA 3DYOA 4QCFA 1QHOA 1GOIA 1V6YA 4H8HA 2J7FA 1OD0A 1H11A 3POCA 2ZUSA 1JYXA 1QBBA 3ARUA 4QLJA 4LGXA 3KL5A 3WDIA 4AYSA 1UWIA 2VCCA 2PC8A 2YLLA 1H41A 3WUBA 3PZQA 1V6VA 3NUKA 1AQ0A 2DSVA 5JUVA 5I3DA 1JI1A 2UY3A 4HA1A 4WJXA 3UCQA 4AZCA 1E0XA 2WMGA 3RJXA 2YDRA 1VENA 3IK2A 3UG4A 1LWJA 3TTYA 2CETA 1W9BM 5A8QA 2DT0A 3WDHA 4ZEPA 4XZBA 1XYZA 2A3CA 3GDBA 4CCEA 1ITXA 1F4AA 4OBRA 1Z32X 1UR2A 4MNKA 1V08A 3L4YA 1SFSA 1ESWA 2VL4A 3PZUA 1XGZA 4S3JA 1EA9C 2YBTA 1W3LA 5IHRA 1NQ6A 2VQTA 5D9PA 3WUGA 1E6ZA 2X2YA 1EOMA 3F5JA 4PTXA 2E3ZA 2GK1B 3AHXA 2Y24A 3J7HA 3I3DA 1VIWA 1UWQA 3M7SA 3WF1A 4UFHA 2CBUA 2G4FA 1V6XA 4J3SA 1TR1A 4IM4A 1ZS2A 3O6AA 4JL2A 4HA4A 4PMYA 1WZKA 3CUJA 1OT2A 4AEEA 1EDGA 3WFLA 3AYRA 4KRTA 2XHYA 3PTKA 3PTMA 1QNSA 1LJYA 5I2UA 4D1IA 1AVAA 3RMEA 3OLIA 4MPKA 2PWHA 5M17A
chains in the Genus database with same CATH superfamily
3HN3A 1UR4A 1G67A 2GDQA 5K2ZA 3B8UA 2ATSA 1Q8AA 3NQAA 4KT2A 4B90A 2DVXA 2PGEA 4LUIA 3TTSA 4JY8A 3TMQA 1GVOA 1Z89A 3VOJA 3GG0A 2DPEA 3TIMA 4U28A 1M53A 1K9TA 1FWWA 4C65A 2OEMA 4BI7A 3L2MA 3WBEA 2V3EA 4GZIA 3VUSA 2QDDA 2ZYFA 3BV4A 3PZOA 4JXCA 4E8DA 2GVYA 3ARRA 1T6MA 4MM1A 2WHLA 4KETA 4ICNA 5CKSA 3CZ8A 3VD5A 2CWNA 4HTYA 3K5XA 3R8RA 3TROA 1CGXA 5FJOA 3SEPA 2V82A 4PN2A 3IIPA 1PE1A 3POHA 3E9AA 2HBVA 1FA2A 3VOHA 3QZAA 3B8VA 3TCEA 1GKRA 1XLDA 4QSHA 4MKVA 1AZ2A 1TVPA 1SMDA 3MSRA 3QV9A 1R9ZA 1GW9A 4CD5A 1EC7A 4ROPA 3VZZA 5JBEA 3LI1A 2V9DA 3IJIA 2XIOA 4NQ1A 4UIOA 2V63A 4DJDD 2EXOA 4ZQRA 1US2A 5I7GA 1VJZA 4AIUA 1HKIA 2CFFA 2P3ZA 3RU6A 1U1JA 1ENUA 1TWDA 1MI3A 2Q3RA 2VGGA 1W54A 1TUXA 4M0XA 3ARXA 4MIMA 1S3HA 2CKSA 3R5EA 2BMBA 3WQPA 4Q8WA 2D0GA 2VX6A 1JDCA 2I7GA 2CITA 4PA8A 3URBA 3FX4A 1VJIA 3GVVA 4N6EA 1E9YB 1YPIA 3CHVA 2QCDA 4LCRA 3NVDA 2CXGA 3UGRA 2JBMA 1YNQA 2WQDA 4UFMA 5I3HA 2CLEA 3W7KA 3SCQA 5HXMA 1VRXA 3AIQA 2AKMA 2W91A 3WUEA 5MKGA 1V3IA 4S3KA 3VO0A 3N34A 3N2BA 5AC6A 2D1ZA 2ACQA 4H8UA 4XBJA 4O4VA 4K39A 2AOSA 3PJTA 4H7CA 3W1XA 1GOXA 4HPHA 5KEZA 4NI8A 4BWLC 1HW6A 3CQJA 3WLMA 1F73A 4PODA 3KTXA 1WX0A 4ZE5A 3O05A 3GNNA 1CYGA 5A6LA 1A5LC 3LGEA 2PAJA 1NIUA 2ZXQA 3UR5A 4O8RA 4H2HA 4GH1A 1DJIA 2WC7A 3SCUA 2OX1A 2MNRA 2HK0A 1NFPA 3AC0A 3TW7A 2A7RA 3LNPA 4IIGA 4R88A 2E1DA 2VWSA 3UJFA 1FP8A 1SZNA 4BQ2A 2J7GA 4DJFD 5I3JA 2CLPA 1E4MM 1K8ZA 3VDCA 1QBAA 3CZGA 1MEIA 3B9DA 4G7EB 3MU7A 3TV8A 1RLDA 2ZKMX 4Z2HA 1MW0A 3QV6A 3HPZA 1X1NA 5JMUA 2Z6IA 1CXFA 2X1SA 6TAAA 1P0BA 2IPWA 8CGTA 3S5NA 2V81A 1OABA 1EJVC 4MKNA 3WSUA 4W88A 1ZALA 1QNOA 1DJHA 3OW1A 5KINA 3M43A 3M0XA 1TIWA 2J25A 4L65A 1K02A 3MDWA 1YW1A 4Z1DA 4NHVA 5AN7A 1RD6A 4GVGA 1NP2A 4FX7A 7ODCA 1US3A 2TRSA 3BV7A 1TPVA 1X98A 4FA3A 1A5NC 5DCEA 2AAMA 4JN6A 1THFD 4M5PA 2WNQA 2QCMA 2JALA 3AYVA 4C6MA 1F7BA 5AKQA 1VFOA 1U83A 2D3LA 3NPWA 1W3IA 3GHRA 4UB9A 4XKYA 3W25A 4KCUA 6XIAA 3LYEA 1LLWA 4I7VA 2WC3A 1OT1A 4J3XA 1OGGA 3NPUA 3QJAA 3UF9A 1VRDA 3BO9A 1R3WA 1OY0A 1FTXA 2HRWA 4B5VA 4DHGA 4S3CA 5M2FX 3OJGA 1ZBVA 4X2RA 3KRBA 3MZNA 1ZRQA 3AIVA 1JJKA 3IPWA 4LCSA 5IDIA 4DO4A 1MUWA 3T40A 2ABAA 1JZ7A 3LM7A 4US5D 4IISA 4GYPC 2X2GA 4IQEA 1LTDA 4I5XA 2P5NA 4KESA 5LHEA 3S2LA 2J74A 5GNXA 3E0VA 4IL0A 1KV5A 3FA5A 4GXMA 1J0KA 4RJEA 3STFA 4D9PA 4W85A 2WKLA 2J7BA 3UW6A 1AL7A 3G77A 4I8DA 3GHSA 2AQOA 1M7XA 5CGQA 4L64A 3LCXA 4GI6A 1XRVA 1FHVA 3OZPA 4MY1A 2W9MA 4LVGA 1K1DA 4PBEA 3WQ5A 2KAUC 4GX8A 3N3TA 1BSIA 1PTGA 3U48A 2RGLA 1GVEA 1UWAA 3C56A 1UR9A 2WSPA 3KZPA 3NM1A 4JFVA 4GUJA 2CNCA 5ABFA 2FZDA 1Q6OA 4GKTA 4JOMA 4RNIA 5FOOA 4U3AA 3T4CA 4GYKA 1WA3A 2JE8A 3QV8A 4IQLA 2ISWA 3R2GA 3LTPA 1CGTA 3CHFA 3BLDA 3WL0A 3QOMA 4A2RA 3B0UX 2EKGA 4PRRA 3NM3A 1LOLA 2F6XA 4MAZA 1FKWA 5SWUA 3C2EA 4CVUA 5DELA 2H8XA 1X8CA 1FKXA 1TTQA 2GFTA 2Z26A 4DBDA 3TR2A 3EMQA 5AYBA 4ZSUA 2VEKA 3P2VA 3AUJA 1DTUA 2OWXA 4XKMA 2HISA 3MVTA 1SO4A 1K8YA 1AQMA 3VD3A 4AD5A 1LWIA 4TV6A 2CLOA 3AU2A 1ZP3A 3ZR5A 2PDWA 3VPLA 2XVGA 4IPJA 4JYDA 2VZVA 1PZ2A 1EJ7L 3R0KA 2HBXA 2DH3A 4GA8A 1KD0A 4JQAA 2R8WA 3V0UA 3T7VA 4Z0JA 1BWVA 4LWWA 3R6IA 5E93A 3QPYA 1WXJA 4JCMA 4CVWA 1GORA 1RBAA 3TWBA 4IHCA 4HNNA 4FOKA 2EPKX 5GJPA 1XIEA 3CJPA 3RR1A 3GBDA 5HANA 3SRFA 3MCNA 3OZOA 2VEPA 3KX6A 3FGCB 4IMFA 4UCGA 1GUVA 4W9TA 1NWSA 4RDVA 3W87A 4DWSD 3AROA 4O8AA 4ZA0A 1TV3A 2A0NA 3MUIA 4UTJA 2ZXDA 4D6EA 4ML9A 5DT7A 3LV5A 4IXHA 5DCBA 4EX4A 4BA0A 1Q85A 1V5XA 2VXNA 3T0DA 3OIXA 5F2MA 3TN5A 2E09A 1XIBA 4PBFA 3W23A 3MV11 2DZSA 3EKZA 3H2NA 2NUWA 5A5WA 1UQZA 5CPMA 2VURA 2OWWA 5G4HC 4A2SA 1K7EA 5HA7A 4UFKA 3IUIA 1R6WA 1RXOB 4NZ3A 4V27A 1MUCA 3A47A 2Q09A 4YNGA 3GU9A 2Y61A 3QKZA 3H55A 1UD2A 3VOFA 2BOGX 4ZOBA 1BKSA 2Y62A 3O9NA 1AH4A 1G7VA 5HWMA 1AA1B 4J35A 1TWSA 3EYPA 4LBSA 1V79A 3LS9A 4YU1A 3WLTA 3EAUA 4PTWA 1OQFA 1I1XA 3CV1A 1IEXA 3PZIA 3RYSA 4XTIA 4X3ZA 3F5KA 2Y85A 3DIPA 5FKYA 4Y7EA 4UNKA 4UTWA 4E6MA 5A1AA 4BEQA 1DXEA 1LWHA 2W0UA 1OK4A 4O17A 3THUA 2VFHA 2D2JA 4C6BA 1VS1A 4NIRA 4A8RA 4KBXA 3RCNA 3QEZA 1W9PA 2VOMA 1KM4A 3AIUA 1TMQA 3W73A 5HNTA 6CGTA 1O5RA 3AMCA 3B97A 2WKJA 3THDA 3MS8A 4IFOA 2G37A 1RJRA 1B0IA 5E0FA 3SM0A 3XISA 5BNKA 4WDWA 1VC4A 2YLAA 4DO7A 1O5XA 4FLRA 4CN4A 4PTDA 6A3HA 2ZBTA 1RD5A 1JNEA 2OGJA 4MWAA 5KITA 4F79A 5F7UA 3NSXA 3D3AA 1TTPA 1BKHA 4AW7A 4HVXA 3IAPA 3L66A 4OJYA 3B8IA 5F4SA 1TCMA 3SUSA 1JAEA 1QK0A 1WKDA 3V16A 1UJPA 2YCLB 3ARWA 2IKIA 3WH6A 2BHYA 5D38A 4GQQA 1HGWA 1H1YA 2QUMA 2QPUA 3I7RA 1YDYA 3AISA 1B30A 3UCCA 4MHBA 3CHDA 2POTA 1N82A 4QSFA 4DUOA 1IWBA 4FNTA 3PZVA 5ABEA 1XLJA 3SQLA 3OBKA 3RNDA 3GH7A 4YTUA 3TYEA 1UASA 3WJWA 3UWZA 3EOLA 4K68A 1J2WA 2ZC1A 3DUGA 2AQWA 4IUGA 3O15A 4LYQA 1M5WA 4GQGA 2UBPC 1TJ1A 1OZMA 1SO6A 1PL9A 8XIMA 3ANYA 3KRSA 1FX6A 3AS1A 3V7PA 3LMYA 3UJRA 2GJPA 4JPGA 5G2WA 1OF6A 3WIJA 2Z2AA 1ECEA 3FFSA 2PEVA 1JPIA 1CBGA 3A4XA 4E2OA 2XIMA 3W1NA 1PBGA 2C0HA 3HM7A 3ZJ7A 5AECA 3PBGA 3UVAA 5A6BA 1HJQA 3LU2A 3HGRA 1DWGM 1JEZA 3C3NA 1UUMA 4HJFA 3MMTA 1UZHA 1E15A 2XTKA 2C18A 1LG1A 4WKHA 1YE6A 1Z8AA 4JTIA 4R9XA 5J8LA 4ACYA 3TR9A 4WUIA 1WDQA 3EX6A 2FVKA 4ADSA 5C9UA 5DRIA 3E38A 3I6RA 2PWVA 4LC6A 3IANA 1M03A 4JAWA 4BF7A 4KGLA 3WBWA 1ML1A 2JFEX 1NELA 3BG5A 3SQMA 5GJMA 4PUJA 3LXCA 4X63A 5EFFA 1V7AA 2ACRA 1FHUA 1YPXA 4I90A 2WANA 3TVAA 1ONWA 3W2NA 4LV4A 2YBUA 1PTDA 3AHTA 1MQPA 3MSDA 3N11A 1WCGA 2IQ0A 1M65A 4PSPA 2X09A 1E40A 2JIEA 2X8RA 2WCSA 1GVIA 4Q6XA 1NEYA 4BR1A 4K1GA 3AUOA 2WMJA 4D72A 2HNEA 2VT0A 3Q37A 1HJWA 4KWUA 3T55A 3FVDA 3NZRA 4XAGA 1TV8A 1QWKA 2JIWA 4J1OA 3UY8A 1XM3A 2ZUVA 2AMGA 2NQ5A 1KFBA 4G1KA 2HS8A 1QCWA 3AMLA 1S2UA 4RXFA 2O55A 3FN9A 1DBTA 3Q2DA 2ONEA 3BAYA 3EPNA 1P6CA 4GFIA 2DP3A 1GZ1A 3U8GA 2XYLA 1PKLA 1QNQA 2EPHA 3HPSA 3W6MA 4QJ3B 3WMBA 1XS2A 3M6YA 2Z27A 2JGYA 5A69A 3ZVIA 1NOWA 3IVUA 1FCBA 4NX5A 3P93A 5I02A 3W7HA 1EC8A 3A9BA 4PTNA 3W7PA 4JZ5A 2CBVA 4EIVA 3EA2A 4DPQA 2PD5A 3R8GA 4IG2A 5C7HA 1FCVA 4Y9MA 1S39A 4D1JA 2BB0A 3ABRA 1J0IA 3S5ZA 1VZWA 1SSGA 1GQLA 2DQWA 2J77A 4S3EA 3THAA 1OCJA 3KP0A 3UFYA 1XSIA 5HQEA 2PFHA 3DAQA 4CNNA 4RDYA 1EPVA 3P14A 4PFHA 3V0SA 2OKOA 1RJPA 4RXGA 1QPQA 4UTWC 5T8GA 2F2HA 4DUVA 4HJWA 3PB0A 1TZ7A 2X30A 4NNAA 4JQ1A 3U2ZA 2VMFA 1EC9A 4A4AA 2YDAA 5CSRA 3RLHA 1A3HA 2WC4A 1TPC1 4Z08A 1E5NA 4UTIA 1VD6A 4YWIA 4M6QA 3KRZA 2VTFA 2XN0A 1UR0A 3WF0A 5TD4A 4NX0A 1B4KA 3FW6A 4WKAA 2ZUNA 4D6GA 1RCXB 1XBVA 3MTWA 3WJZA 3GNRA 4J3WA 1F6PA 4JTAA 2A3HA 1I1WA 2FB2A 4JCLA 2GL5A 2Y8UA 2QKFA 4GVHA 5EMKA 2WNWA 5J04A 3NQDA 1KBIA 4JFTA 2BVYA 1I2NA 2WSYA 2FYMA 1EF2A 4PMRA 1JYNA 3UXIA 4F4RA 1VBGA 1FWCC 4C7DA 3SY8A 2FLIA 2WVUA 5GNYA 4C6JA 4EANA 5HMSA 1M9HA 3UWYA 2GZXA 2OSXA 4I5UA 1O12A 4C90A 2I56A 2J9YA 5BMWA 3S3GA 3LEPA 3TEVA 1QOPA 1KBBA 5CJ5A 5F2IA 2YL9A 3GK0A 2CHOA 3W9ZA 1FWHC 2E28A 3ZZ1A 3WH9A 3CTTA 4OFCA 1A3WA 1P5BA 2PLJA 4B15A 5DN1A 4S23A 1EL3A 2O56A 1GQJA 1EH9A 1DJQA 2GUUA 2Y0FA 4A35A 4XZMX 2PP1A 1KLZA 1PO9A 3HJEA 4K37A 4L9ZA 5A8GA 1P0KA 3IGUA 4H6QA 1KA9F 5C2XA 3B4UA 4V2XA 3W02A 2YZ5A 3GNOA 4DUWA 4K1WA 3LCWA 2GJRA 4L4OA 4F8XA 1HTIA 3RM8A 5ECUA 3U4FA 3ES7A 3LHYA 4GI4A 3H23A 5H6HA 4IMGA 1EKOA 5I07A 4DI8A 4QROA 2WKGA 2DQXA 4UXDA 5ECVA 1GOKA 4MKSA 4GQRA 5F4WA 2BY0A 2QDEA 1UWRA 1H60A 5AHIA 3NQ2A 1BG9A 4S3GA 3GBEA 3KCOA 2O9TA 2PDFA 2E4TA 1EHAA 3NVTA 2HE5A 4Z2IA 1WB0A 1U33A 1NF7A 4C6DA 3EXTA 1F5ZA 4WY0A 4Y9AA 5CLTA 3UETA 5HNUA 1J93A 2WOQA 4AF0A 1CI1A 4OZOA 4EACA 3V5OA 3VCCA 4CQ8A 4AXKA 4AD2A 4Y9OA 1E55A 1YDVA 4CNSA 3N4FA 4ZENA 1CLVA 1VEOA 4KCTA 4W87A 3UR2A 5FACA 1M7OA 1JCMP 3T44A 1BQGA 2HROA 2V38A 4ZO7A 1TV2A 4JFUA 4FOJA 3S5OA 1D3HA 4WDXA 1V0NA 4O0ZA 1NY1A 4Z1CA 3TJXA 1CWYA 4G2DA 3F4NA 2PDIA 3VIKA 5CC5A 5C5YA 4JKMA 1A3XA 1GCYA 1XYBA 2C1IA 4J9JA 3NQGA 1EJWC 4K3ZA 1K70A 2OLSA 1OWQA 3I6EA 1DE6A 2FKPA 1RK6A 3ERPA 2ASHA 1GTHA 1RJQA 3VC5A 4GIEA 3DOPA 3DI1A 4XD4A 1T0OA 5AHEA 1W17A 4GJJA 4PMXA 4Z1YA 1KM5A 1W2VA 2GJNA 3W88A 3OLEA 4BQ3A 5EMLA 1IZJA 3SUVA 2WMKA 4AVFA 5DQPA 4HPGA 3GKFA 1W8SA 5GNZA 3USBA 5A2BA 1ADOA 3SCRA 1P6BA 4TO8A 1HKVA 4QG9A 3LPPA 5FA5A 4PMZA 3W6YA 5FF2A 1B3OA 1IEIA 4DUXA 4FXSA 1BTCA 2ADAA 5C2CA 2W61A 1FWAC 3CZEA 4PUUA 4R7WA 2VFDA 3P60A 1TZZA 1MXDA 1P7TB 1UPPA 5C9XA 3WY1A 1WYIA 3OGVA 4XUGA 3PSVA 3OODA 4PB3A 3CU2A 2P88A 3WCZA 4GY1A 1EGMA 2DZXA 1W3HA 3PJUA 4RNHA 1C90A 3HQPA 1DVJA 1E1CB 1E43A 4RNFA 1NF0A 1S2WA 3CAWA 1E4LA 2HXUA 4DB7A 1L6GA 2TSYA 2EPNA 3M4HA 1YHTA 3SUUA 1SSDA 3NTYA 2QZRA 4HKPA 3TAKA 1QWGA 4XTDA 2X7WA 4TR9A 1EPXA 4QBXA 2ESCA 3B0PA 4RLIA 1JDAA 3VKBA 3GG7A 1K6AA 3BANA 4HNOA 1IF2A 2PLKA 4LEQA 3AXKA 2G0WA 3P5YA 4LUSA 2UWFA 4X22A 3W76A 3SGGA 3MV01 4Q8PA 3SN0A 1ZCOA 3OQEA 1W91A 1R86A 2HQAA 1W31A 1KR1A 5HJLA 1EUAA 3MI2A 4I8YA 3GB6A 1MW2A 3F5LA 3DGBA 3GFXA 4IUOA 2DUAA 3RILA 5CC6A 3GYEA 2QUVA 1XICA 1KGUA 3SIMA 4JNMA 5AYXA 2JK2A 2CLLA 4QTGA 4L6HA 2DUZA 1MUMA 4OVXA 2E9MA 1CTNA 5H91A 3ZIZA 2AL2B 2QW5A 2WJDA 2BOEX 4IP5A 3S4TA 3LK6A 3Q94A 4E38A 1VHCA 3GXDA 2GK1A 5FEPA 3CNYA 4NJIA 4C6NA 1UKPA 3WQ8A 3VMNA 3DU0A 4A21A 1QDSA 2XUCA 2C1GA 1K3UA 3NXFA 2J7EA 4A3YA 3DERA 3OBEA 5E1QA 2QMKA 3N04A 3GDLA 4PCSA 3IJ7A 3NR0A 1QNRA 5KZ6A 5IOBA 4NAFA 4UUIA 4H7VA 1HJUA 1OEPA 3GQYA 3TNBA 2VEIA 5EMUA 3L67A 1Q6FA 2PRHA 3MHFA 1DIKA 1BD0A 1AUSL 4HMEA 1E6QM 3DFNA 4J3VA 2NX3A 4FP1A 3G6LA 3TTQA 3PS7A 4ZQCA 4L1XA 4ROQA 5LNRA 2XVPA 1UHVA 1WXZA 2XWEA 4P8UA 3IGSA 5E6YA 2WHJA 4W4QA 1ELSA 3R94A 4HTBA 4Q7IA 2NUXA 5TF0A 5G4EA 2E25A 2OYLA 2VELA 4MB5A 1XPGA 2CLFA 1HL8A 3VOCA 3BC9A 2PURA 5AVHA 4IICA 4OBSA 3RDKA 3WL1A 1KV8A 3TP4A 1XRTA 4UTMA 4I6KA 4JEQA 3MWAA 1FBAA 3LHWA 4WGXA 3BOLA 4GYJA 5I0DA 3G0UA 1TPH1 5HJXA 5GPRA 4RZ6A 4LAZA 4LY8A 1FWJC 1LBFA 2YL8A 5BYWA 3IV8A 4JTRA 4GUHA 4ADTA 2OJPA 2ZRXA 2NSOA 1IWAA 2XFRA 1V3HA 4P8VA 1HXJA 1IR2A 2GGHA 2B7PA 2YKKA 3EDFA 3A3WA 4RW5A 2Z00A 5A3HA 1BXBA 1WE5A 3ECQA 3CZLA 1KTBA 4HPJA 3K4AA 4P7LA 2NT1A 4CLMA 1UZ4A 3URNA 1RQBA 3VD9A 1BWLA 3KHJA 4GC4A 4CUCA 1RBLA 2FIQA 2CHNA 3B8SA 5FI8A 1XRFA 4IIEA 2W5FA 5FF3A 5AYYA 4QAIA 5D09A 3IJLA 2W79A 3K8KA 2XGIA 3DFTA 4JHZA 2J13A 2VCAA 3SO7A 3WX7A 2VRQA 3UCDA 3ABOA 2PTWA 4FLOA 3SECA 4G7FA 3CH0A 4A8LA 2OX4A 1K7FA 3ICJA 3KS6A 4GGBA 3WFZA 2G3IA 4L80A 2UV8G 4O0QA 1E9IA 2IMRA 1KW1A 3FDGA 3L2LA 4V1YA 2PP3A 4XB3A 2Z6JA 3LZ5A 3WBYA 1RUSA 4CCDA 4U31A 1ZY9A 4NAEB 4D6DA 1JXJA 3A6OA 3GHUA 1V6YA 2ALDA 3H70A 2PA6A 1H11A 3POCA 4DO5A 2C16A 4LGXA 3KL5A 2CZDA 4EXQA 1UWIA 2P1FA 4N7QA 3WUBA 1H41A 1YIXA 3PZQA 1V6VA 1AQ0A 2NVCA 3NPVA 2NXIA 3UPWA 4HT3A 5I3DA 1JI1A 2UY3A 3L7RA 4MLRA 1Y8BA 4K6AA 1J2BA 3I7SA 4JY9A 1ITUA 2PD9A 2QCFA 1GT8A 2R1PA 3WK1A 4ZEPA 1SM9A 4CCEA 4DEFA 4OBRA 1Z32X 2POZA 2QDHA 1R3QA 1TSIA 4S39A 2YBTA 4LAKA 1W3LA 4NZ4A 4HMNA 3O6CA 1E6ZA 4KIEA 2QR6A 4KS0A 1Y65A 1EOMA 4PTXA 4RKAA 5G1YA 2E3ZA 1UWQA 3M7SA 1JRCA 3WF1A 1JULA 1W5OA 4H6EA 2G4FA 1V6XA 5TAOA 5LHFA 1TR1A 4DAIA 3CUJA 3QN3A 6XIMA 3AYRA 4KRTA 4Q4SA 3QV7A 5I2UA 1W5QA 1F07A 2X41A 2INFA 3W85A 3U0HA 3V0TA 1FWNA 4IPIA 2J88A 3FSUA 1P1XA 4QJ5B 2Q01A 2QCHA 2CXEA 4QFUA 3MUAA 1P6WA 4FR1A 2VVSA 2WMIA 4I9TA 1BLIA 4GJ1A 4GMEA 3N17A 2J79A 4Q4PA 4K38A 1J4EA 4OBTA 1GYLA 2HMCA 1YYAA 3F4DA 2O9RA 4FOUA 3WELA 4XBKA 5XIMA 4CCCA 2E7FA 2YXGA 3NO3A 1LDCA 2FZNA 3PM6A 2VOTA 4LFYA 1Z41A 4KFPA 3UNTA 2Y4SA 4KGJA 3TQ0A 1BYDA 5BXTA 1W5PA 7ENLA 1H3GA 4F0HA 4N0RA 1F05A 4WHBA 3PTDA 3B05A 2CIPA 2YA2A 3FDKA 4FR6A 2BY1A 1WP6A 3SUTA 2O7SA 3CZJA 4JTUA 4XSLA 3UJSA 3VTRA 4Q8TA 3U3HA 4L56A 1LT7A 2YL6A 3LCHA 2XISA 1DJNA 1HVQA 3BG9A 3I7QA 3MHUA 1WBJA 1CW2A 3QQ0A 4C6QA 1BYCA 3DFOA 3CBWA 3M46A 1EZWA 3OTRA 3G0XA 4IZGA 2FH8A 3TZFA 2ZZ1A 2WWDA 4KW2A 3R89A 2J66A 3E74A 4KWSA 4WJEA 4KCWA 1G1YA 2FGZA 2J6VA 3TCSA 1AFSA 2X40A 3E96A 3AIRA 4JHMA 3APGA 3GH5A 2I9UA 3BJFA 4BQ5A 3ZOAA 4FX6M 4FIRA 2ZE0A 3VNLA 2VFGA 5D9OA 2VEMA 2MANA 4PCPA 1FXPA 1JGIA 3QMSA 1NDWA 5ABFB 4ZXLA 1S5VA 1TJ2A 3TDFA 4PMOA 1K9FA 4EAYA 1U1UA 4F48A 4J2MA 3AIWA 5A2CA 4OECA 1NFBA 3HA1A 3F2DA 3LBOA 1U22A 3C2YA 4PUMA 2HXTA 4US6A 3V18A 1FWRA 4Q4KA 3RIKA 3VCNA 5D4YA 3BSHA 3DC8A 3AXHA 4F0RA 3BGAA 3CB3A 2QXWA 3UWQA 2OELA 3RX4A 4E8GA 3QLDA 1R2SA 4ZFMA 2KX9A 4KWOA 2NV9A 1G4SA 1MDRA 5T26A 1SZEA 4ZL1A 3AXXA 3H8AA 4GXWA 1Q6LA 2F2KA 3KBVA 1UD3A 2OLHA 1O1ZA 4XO7A 3H26A 4TU1A 3R43A 4D6IA 1LG2A 2FHCA 4LV9A 2NWSA 2QPXA 4QE5A 2PGWA 2FHFA 3DECA 3NEVA 2GWNA 4AZCB 2Y88A 3W7QA 4ASTA 3S83A 1W1PA 4IP7A 1DWJM 3C61A 3V1PA 4DWDA 5BU9A 4MGGA 1MNSA 1VCGA 4OQVA 2EEXA 5D02A 1S1RA 1XBYA 1TELA 5DXXA 3AQUA 4CNPA 3VM7A 5G4WA 1GNXA 4AISA 4Z1BA 1GZGA 4AC1X 3VNDA 4PULA 3HGSA 3VGBA 2OU4A 2I16A 2Q71A 5CGMA 4GIYA 3M44A 3CWOX 1ZJAA 1XYFA 2UY5A 1KQZA 3K30A 3VNYA 1OYBA 4DNMA 4HU3A 2ZVRA 5AC5A 5E5CA 3ZR6A 3R4IA 3C0LA 3S9ZA 1J12A 1QNPA 1XH0A 5ABGA 2J47A 1TB3A 3B0XA 2H3DA 2F38A 5LNSA 3A5VA 4MNMA 1CXHA 3ZWTA 1Q7QA 4DF1A 1YX1A 2XIJA 1V0LA 1DEDA 3KM8A 3WENA 5DLCA 3B06A 1EX5A 3PBYA 3S9YA 1PYFA 4FSAA 1SQ7A 3TK7A 1R9XA 3I3EA 5FD0A 3PUEA 3W2UA 4L4PA 5BWFA 3GYCA 4A6GA 1JCYA 3M0IA 2BVDA 2ZX9A 5T9CE 4GIRA 4V28A 1VF8A 2YBVA 1PV8A 4JKLA 3EGJA 2VZTA 1KNWA 4CGTA 3JRKA 3TSMA 2IKGA 5LXXA 2A7PA 2DJLA 4CN6A 2ZADA 4QS5A 2R9RA 3W1UA 3WKZA 1WOBA 1OYCA 5L6UA 3W82A 3RFAA 3QR1A 1TWZA 1VH7A 4BI6A 4DLMA 2HVOA 1B2YA 3VIOA 4Q8NA 4PUEA 4PMNA 2O9OA 1VB9A 3W1MA 3NL3A 4YHEA 2HK1A 5I09A 3U9IA 1PAMA 5HULA 1H61A 3TYAA 3FKRA 1XC6A 3W0KA 1P1MA 2FMOA 3M41A 4LRTA 1HJVA 5AVNA 4FK9A 1TWIA 1F8MA 2OPJA 3V1HA 1Z44A 1GQKA 3HG2A 4XIAA 4HD5A 1FWEC 4AVOA 5T91A 1LLZA 1KRCC 1TWWA 2Z2UA 3IK4A 3C4UA 4U3CA 4FB7A 4HHLA 2PSNA 1XPYA 2YCLA 3CYJA 1Z3NA 2J7DA 3KOXA 1J6OA 1F6YA 4LVAA 4GGHA 4JTHA 1JDDA 3W7JA 4Q4MA 2EO7A 2QCEA 4RZ4A 3TSBA 1L0PA 1VFFA 2WVSA 2OSYA 3B9OA 4KWWA 4QJ1A 1R3SA 3PFMA 3B03A 1E6NA 3WQ6A 4CEXC 1J96A 4DJFA 2A3EA 1H7NA 4LX4A 3DHPA 4HNCA 3U57A 4ERIA 3ZFHA 2R82A 4XZHA 2W67A 3RLGA 4E8CA 2OGYA 1UR1A 3W27A 3CB8A 1CECA 4PB4A 4OUEA 1MZHA 1POJA 1SVDA 5C9WA 3QFWA 1AD1A 1CENA 5I3FA 1KTNA 3HPFA 4HZ8A 3AI0A 4YIWA 1XX1A 1NARA 1CXKA 3MUY1 4E5TA 3A22A 2BOFX 1KXVA 4W86A 3TQPA 1FWSA 4TX8A 3RUBL 4N4QA 5BRPA 4N9EA 3BQ6A 1PX3A 4XX6A 3U2CA 4UCFA 1KCLA 3FY1A 1JUKA 1TJPA 3TFXA 1CLKA 1EXPA 1W37A 2QMJA 1XKYA 1TJ0A 4ZO6A 2CBJA 4C6CA 3R12A 3GTIA 4DYEA 3ZXWA 4YCOA 3RPTA 3UVIA 1WV2A 1HO4A 4QITA 5LGXA 5BRBA 1TCDA 3UGVA 1F2JA 2VFFA 2DSUA 2GDUA 4GK8A 3BTNA 4QDPA 3VOIA 4OHQA 1Z69A 4XZLX 3TC6A 2Y6ZA 2H9AA 5A6MA 2YJQA 3C2OA 3GX9A 4M82A 3NDOA 3ZT7A 4JQ3A 2Y8VA 2A4AA 1OADA 1EXBA 4HB7A 3DEQA 4DYJA 3E0LA 2QHAA 4GI8A 3ITVA 2WAGA 3WLRA 9RUBA 4H00A 2FTYA 1DWAM 5EY5A 4A29A 1T40A 4FIQA 4O12A 3SCSA 3UESA 1P4CA 4DM2A 1Q3NA 4IGSA 4C6OA 5IFTA 2X0SA 1IXOA 4R27A 4JX6A 4P8XA 1VHNA 2P0OA 4IH3A 4AWEA 4MFDA 3HV8A 1ICQA 1BF6A 3PG9A 3XIMA 1OSEA 5E70A 3P3BA 4NJJA 3SZ8A 4IPPA 2ON3A 3GUWA 1VCVA 3OHMB 1O1HA 3IJQA 4YVXA 1UMYA 3ZR4A 2WPBA 3LY0A 3QKEA 1A0EA 3FJ4A 4EPBC 4M51A 4EP8C 2WNZA 4JIEA 3NJ3A 1UP2A 4Z2GA 4NUWA 4B91A 1ZFJA 3WQGA 4R33A 1IQ8A 3EWCA 1YBQB 1TX2A 2J27A 4ATLA 2FDMA 3NQBA 3W07A 1KM1A 2NLIA 3SJNA 3JW7A 2XFWA 4ZO9A 2ZUMA 3CIWA 5HDRA 2WCGA 2D23A 2BODX 3LN3A 4IMCA 1E5JA 3N9SA 4BS0A 2CHRA 8XIAA 1Q2RA 1IYXA 1E6XM 1RLCL 3S42A 3P74A 1W56A 2OODA 5CZTA 1UD6A 1EWDA 1HKKA 4MDOA 3WEZA 3KLKA 4DJDC 4DY1A 1TPEA 5I3GA 3G3DA 5D04C 4DBUA 2YGYA 4S3DA 4EOUA 4HA3A 1QUMA 1G4EA 1LQAA 4UFLA 3LPGA 4D2JA 1EGVA 3QW4B 1KFKA 4GBUA 1ZAIA 1X39A 5AB3A 5D2TA 1HP5A 3UR8A 1MXGA 5G2IA 3C6CA 1VYSX 3I4EA 3NNTA 4HK5A 2H8ZA 4N9CA 1QPNA 5CAHA 4HCLA 1TPDA 1EFZA 1SU5A 3AS2A 9XIAA 1QR7A 1T5AA 2PWGA 2VDGA 4J3TA 3L9CA 4QXIA 3OG3A 1JD9A 3NPXA 3BCFA 4TTUA 3W24A 4D8LA 1VYPX 4H04A 5FJRA 3GXPA 2IKJA 1W9DM 5BROA 2PZNA 3PK7A 1S46A 5DANA 1AODA 1VP5A 1VFUA 3KBSA 1MMFA 4I9MA 1YADA 4O18A 4ZODA 3HJZA 4IJBA 2WM0A 1XIIA 5A8MA 3AHVA 2FZ9A 4REQA 3U4AA 1ZQ5A 3G8EA 3WZ0E 2G3NA 4JD4A 4NL1A 3VNIA 2Z0IA 1I8JA 5D33A 3N18A 4LNYA 4QR6A 1ZJIA 1B3YA 4LYKA 3BUVA 3CC1A 5HOSA 1KRBC 1PCKA 1Q4NX 3FYOA 5HNNA 7TAAA 1PX4A 4IIFA 1V03A 5K3VA 4L7ZA 2TAAA 5CPNA 1RPXA 3VUPA 3CMGA 2ZRUA 1RVKA 4Z42C 3WMCA 1OYAA 4PUDA 2QVHA 2PB1A 3AYSA 2R1KA 1SYTA 3BW2A 1A49A 4K2SA 4HU8A 1FOBA 1WUEA 2CZ5A 1J18A 3GY1A 4EF9A 1F6KA 1I2RA 1JDFA 1UKQA 5LA2A 3VILA 4UTHA 1PYMA 3KHDA 3CYVA 3PAOA 4LALA 3IGHX 4N6FA 4CQCA 3GTNA 3MKVA 1E1EA 4ES4A 1C3FA 2JEQA 3VGDA 1JCNA 4QJ4B 5K9CA 4WSKA 2NV2A 5DMNA 3O6YX 4B5SA 1FWIC 1XFBA 2Z1WA 4LYPA 4HCDA 4ORMA 5CC7A 1TYGA 4POCA 4B3ZA 1CGYA 3H54A 3UZWA 1ZP4A 1XL9A 4DLFA 3H22A 1M04A 3BOXA 3NQFA 1L8PA 3KBWA 3IEBA 3PZMA 5I23A 2WJFA 4H7ZA 4UQDA 1GEHA 3L4VA 4QCEA 4WQ6A 3UXDA 3ATYA 5LYRA 1QXLA 4B5XA 1T96A 2Z29A 4OGZA 2JF6A 1VPQA 3W2JA 3T0BA 4B4FA 2XIIA 2OZ0A 5H8PA 4AEOA 3W72A 1K8XA 1GKQA 2RDWA 3B8DA 3CIVA 2PZ0A 1VJSA 4FS9A 4YVVA 1I0DA 1UA7A 3DX5A 1WDSA 3F4VA 1E72M 2QJJA 2F7FA 1R5YA 4HK6A 2W4XA 1V0MA 1UC5A 3O3RA 3UEQA 3IRDA 2VRKA 4A05A 3A4AA 3A9IA 4Z0SA 4DQWA 3PUGA 1C8XA 5HPCA 1XLGA 3QMTA 5DXYA 3HO8A 3OYXA 3QMRA 3G18A 2BGNE 3DXIA 5I5RA 1X96A 3ENLA 5IFPA 3RRXA 1B3ZA 3DGRA 2NV1A 3TW9A 1G69A 1X1ZA 2R91A 2DW6A 2WSQA 1KBJA 5XINA 3SCPA 1FDYA 1J9YA 3VE7A 5CZJA 3ES8A 1OC5A 1P7TA 3W7CA 4FNQA 5HPOA 4JIRA 2G4JA 2PGRA 4AIOA 1IWPA 2DZWA 5JXQA 1POKA 4O0KA 3I4KA 1S1PA 3MWCA 4OOUA 3D3FA 4PUNA 2DJXA 3EWUA 4S3BA 3RX3A 4BWLA 1E1CA 2JEPA 9XIMA 1XSKA 3RJYA 1EF3A 3U5UA 2WJEA 1O5KA 1BVZA 1HJSA 4GFSA 1XSJA 2HZGA 4NZ5A 3NDYA 1TUFA 3KBMA 4I7WA 3LD5A 2W3ZA 4EF8A 3GFZA 2P76A 4FALA 4URIA 2YB1A 3N6HA 5CG0A 1GEQA 6PTDA 2GUYA 2DSKA 4MWAD 1CB7B 1B9ZA 5D05A 1TJRA 2FB3A 4V1XA 2DIKA 1F3XA 4D6FA 4MYAA 1PUDA 4ZOAA 5EL1A 1OX6A 4GC3A 5IHSA 2PDHA 4W8AA 1EZ2A 1Z42A 3NL2A 9CGTA 2DVUA 4ACZB 5HBFA 3AMDA 2QCGA 4J27A 1XWYA 1YXYA 4GXPA 2BSLA 1V3KA 1UIOA 1KO0A 1ZLPA 2V67A 4DWSC 4IIBA 1UH4A 1GYNA 1ZNNA 4R7JA 4C6IA 3CIXA 4DZAA 1KCKA 3W7RA 2C6QA 3W29A 2AL2A 3JR2A 1D2KA 1FCQA 3JS3A 1HIZA 4JTQA 1TKKA 4Q33A 5EB8A 3W81A 1VPXA 3KTSA 3QHOA 5HATA 4JQ4A 2ZX6A 4XD3A 3R11A 2FPYA 3OVPA 1XYMA 4DPPA 3H2OA 2OKTA 2X0YA 4HBKA 2GVEA 2ZUUA 1XLHA 3BLIA 2FTWA 3URAA 4DI9A 1ZBKA 3LLDA 4HSNA 3REQA 3UR7A 4MNJA 4IOTA 2B7QA 1M7JA 1B3VA 1BGAA 3WBXA 4UZUA 2ODOA 4O52A 2YYUA 3PNUA 1V6TA 3QPZA 6TIMA 1KR0A 1LQ2A 4CQDA 1W32A 2J8FA 3NO5A 3LXBA 3PB2A 1F4HA 2QUNA 1JNDA 4NSBA 1JPMA 1FHDA 3CT2A 1JPHA 1LORA 4O54A 4JIHA 2GOUA 4GYPA 1Z7AA 4NAFB 3ZSTA 5BWAA 2PDLA 1V02A 3TAOA 3ARVA 4XG1A 1OCQA 3RM9A 2DY3A 4C6EA 2IQTA 2J4GA 1IIGA 5EBUA 3QR0A 2CLMA 4QG6A 3W22A 2BBFA 1W8GA 1Q13A 3RN6A 5HMEA 4DJEC 5DBUA 3CWNA 1FDJA 5LIWX 7A3HA 3M07A 4UWMA 4GCXA 3ARYA 1IV8A 4BEUA 3I68A 2LLEA 4C60A 2J7HA 1TPUA 5JBDA 1WNOA 2V3FA 3T08A 2WVVA 3VD7A 1D8WA 3VIFA 2KZHA 2ZZ3A 1TG7A 4PRWA 1CEOA 1HN1A 4Y9NA 3HPAA 4X61A 1F3WA 2BY2A 4CEUC 2VNCA 4TOQA 3BAIA 4ZFCA 4LTSA 1A50A 2PI6A 2YCKX 3N2MA 1H7RA 4OU1A 3CUXA 4A3RA 4ATWA 1VAHA 4DZIA 1FXQA 1O95A 2NLYA 4JQ2A 4KEZA 1GGOA 3A21A 2FPVA 1NDVA 1BVNP 3NA8A 1N8FA 5BCAA 4G6CA 1S2CA 1WKYA 3ITGA 2HJPA 1DOSA 1H51A 4KF1A 5CQ1A 2OT0A 2QS8A 1C93A 1ZB5A 5HQMA 2WBGA 3APYA 3MHGA 1FH7A 3A24A 1XQKA 2DT1A 1OFRA 2AL1A 1OFOA 4FLQA 1ISWA 3PBWA 4E4PA 1V8EA 1XCWA 1KM6A 3N14A 3GLCA 1DHKA 1OCNA 3M5XA 4F3HA 3ABSA 2HVMA 4AD0A 5CZ0A 3UZJA 5ABTA 2X1TA 1LL7A 2NVAA 2PPGA 3WLPA 1SFJA 2XG9A 4WR3A 3T81A 4W89A 3S2MA 3W00A 4GJIA 5FIPA 2A1YA 3OPSA 4UTUA 3IJ8A 3WLHA 4C5ZA 3THCA 2GQAA 4W7UA 4MJ2A 4NAEA 2PTXA 1PDZA 3W2KA 1KQYA 4DX3A 4LBRA 2E9LA 1ZJHA 4GCAA 3GR4A 2VUYA 1UH3A 3O63A 5TNVA 1MO0A 1B54A 2J78A 2EKCA 3VNMA 4H9VA 1DIEA 3FNDA 4M81A 2QVNA 3RR4A 3KBJA 1ZHAA 3Q45A 1JZ4A 3BH4A 3S47A 3BVJA 2J9ZA 3ARPA 2R14A 4O1CA 3S1XA 2X42A 3QGVA 4FMVA 4TVUA 5DMMA 3MMDA 8A3HA 4YXGA 2DZAA 2EPMX 4MY8A 4EPDC 4AC7C 1D3CA 4C7FA 3KTCA 4K8HA 2PDUA 2C19A 1KWKA 1JXKA 3E1F1 3FJ6A 1E6RA 1CCWB 3UZXA 1X1OA 2D0HA 1DIDA 3K8MA 6ENLA 3W7IA 3C0JA 4O57A 1AK5A 4UQBA 4WCJA 2QCNA 3N4AA 3ARSA 3HGJA 4AX7A 2X7VA 3QQWA 4F0SA 4LBUA 2ZCGA 4CNTA 3BW4A 1SJCA 2G95A 4MF4A 2DIJA 1JF5A 3IIOA 1QOXA 1O66A 1AD4A 3UZ5A 2NWRA 4JIQA 2R24A 5JH2A 2OMAA 3PWAA 4JTSA 1YDOA 3V75A 3BGJA 3ABXA 1VLWA 3W84A 3ZJ6A 1OINA 1E9ZB 4FNRA 4HZ7A 3RK8A 5DF0A 4AZHA 4WK9A 4PH6A 2W6RA 2XJ7A 5CPLA 2V69A 1RVGA 1R3VA 3UP8A 2FQIA 2BS9A 5EGRA 3AIBA 1KFCA 1WOAA 2GUBA 1E4NA 1A47A 5HK4A 2WMIB 5A6SA 1PIFA 1ZBCA 5BOEA 2VI0A 4P5UA 1RCOB 4F0LA 3P8IA 3WNKA 3NZ1A 3L4ZA 4KERA 4XAPA 1UG6A 4H3DA 1H2JA 1OCBA 5CAKA 1NWUA 3GW3A 5E09A 4L4MA 1NOUA 3K4WA 5M5DA 1SZRA 5FJPA 1OK6A 4R5EA 2VZOA 3QHMA 3UJ2A 1FVPA 3W70A 5JIPA 2W66A 2ZZ6A 4ZQPA 3EWBX 2Z1BA 3DH7A 2PF0A 2HE8A 2X0HA 3ZQ9A 3PWIA 2DV0A 4ZB5A 3ITCA 3E6EA 5BMXA 4H2CA 1CB2A 4H6RA 1TZ9A 3TXZA 2TMDA 1SGJA 4DNHA 4QDMA 5L9FA 2DDXA 5REQB 1VIZA 4PR4A 3G1DA 1H0GA 1Y7VA 1CXEA 3BGGA 5DEZA 3KDOA 3PJXA 3E5BA 1X8FA 3GAYA 3CMJA 1SZFA 3FEQA 3KWSA 4DELA 3BLFA 1XQLA 4OV9A 5AC7A 2A3AA 4XISA 3KE0A 2WYSA 5HNRA 2Z28A 3UNDA 3W83A 4KFNA 3VD4A 1XF0A 4JR5A 1XDJA 3NGFA 1RV8A 3PBUA 4AD4A 1BF2A 2XN1A 1N55A 5EBAA 5LNWA 1F3TA 3TJ4A 4XZ9A 3L4XA 3UZYA 4H9YA 1O6IA 2RH9A 3TYZA 4HOXA 2ZIDA 1XLIA 4ZQNA 1OIFA 4PTVA 1UZDA 3MO7A 3H4WA 1ICSA 4NXKA 4DYKA 3CMFA 5C9ZA 2DVTA 1JYWA 5E6ZA 3V36A 1LCOA 4XAYA 1RY8A 1R87A 4HZMA 3CS2A 4RPPA 3FKKA 5HMDA 4ZQOA 4D6HA 4NT0A 1GOIA 4R7OA 3QVQA 4H8HA 1HG3A 3H7RA 4BHYA 1OD0A 1JYXA 1QBBA 5HR7A 1PIIA 4QLJA 1OFQA 1K6WA 4LJ3A 3WDIA 3EX2A 3FS2A 1UIPA 4MWAE 2YCEA 3UWUA 1NFGA 4AZCA 1QASA 4CQBA 2HNHA 3GDTA 4JIIX 3COTA 1QPRA 1KM3A 3RITA 5EMJA 2DT0A 2Y7DA 3RCYA 4XZBA 1XYZA 2A3CA 4XZIA 4YWSA 1FCUA 1V08A 1R38A 1ESWA 2VL4A 4S3JA 1Q66A 4GABA 2VQTA 3PG8A 3WUGA 1M3UA 3GR8A 2A2IA 2X2YA 5FESA 3BG3A 5FEZA 3C8NA 1YTDA 3AHXA 1NU5A 3N4EA 3FLUA 1ZS2A 3SRDA 3GTFA 3O6AA 3BURA 1WZKA 3UZZA 5JU6A 4AU0A 4AEEA 1EDGA 3MT1A 4EVZA 3IACA 3G5EA 1SO3A 2XHYA 3PTKA 1LJYA 1A5OC 2C91A 2QCCA 3A23A 1S2TA 3RMEA 3MUXA 4UTKA 1XLFA 3QBUA 2BGSA 1SPQA 4KWVA 2CYGA 3KL0A 1UPMB 1WZAA 1IEWA 4UTFA 1NP0A 4DO6A 2XIBA 5CZKA 2PBGA 1Q7MA 5AC4A 5I6SA 1W1B1 4PMUA 1SZGA 3UWEA 3EDDA 2HWGA 3P61A 4GNVA 3GU2A 3M0LA 2EG7A 4Y2WA 1KFJA 3GE7A 4YTTA 1W3NA 1XLBA 3BZGA 5M03A 4MDPA 1BXCA 3NSNA 4D6JA 3C8FA 5A6JA 4Q7NA 1LBMA 3O2LA 2XH2A 4IF2A 1E71M 1V77A 5C8BB 2CLIA 5D8WA 2V5LA 3M5VA 3TYBA 1XRSA 1GHSA 4DJED 3TA9A 3N1AA 4QE4A 1I60A 3GXFA 2RDUA 5HWJA 4FLSA 3ARZA 1NDYA 1FRBA 4OV4A 3VMOA 2EQDA 1BXNA 3EPOA 3DFQA 3FOKA 4IL2A 4GI9A 2V5KA 4GX9A 4ADUA 3G1HA 1E51A 2UY4A 2EJAA 2Z7GA 1XR2A 3GZAA 4NG3A 1RAKA 1GW1A 2QUTA 3HQ1A 1DORA 1PCWA 3BSMA 1M01A 2ZZ4A 1I6NA 1C7TA 3LLXA 1ME9A 3CPRA 4H1ZA 5LA1A 1VEPA 4M7SA 3S2JA 4L6OA 1TMHA 2V5DA 5CSSA 1EQPA 2B4GA 5TIMA 1O7AA 3PPGA 5T9BG 1BQCA 2GGIA 2REQB 2YOCA 2VO5A 1EDQA 1YTEA 3EDKA 1EX1A 2PDCA 4G9PA 4B4HA 2FH6A 1GJWA 1EIBA 2X05A 3LTSA 4AQLA 1J6PA 3PZGA 5FSEC 4NYUA 2PDJA 3CLMA 3CLWA 4UTTC 3WNNA 4ZE4A 1VEMA 5DX7A 4DM1A 2W27A 2WLYA 4FPSA 2Z1VA 2XSAA 3NL5A 1PIGA 3F1QA 1X7IA 1WO2A 3II1A 3R10A 3BARA 1X38A 4H9ZA 4XO6A 3MP5A 4GYFA 1T99A 4B2DD 2ZZ7A 1UA3A 5HAOA 2CLHA 1DJZA 4U2YA 4C5YA 1W9XA 1WDWA 1XLMA 3CQKA 5CSYA 4RDZA 4A3QA 3DFSA 3IUHA 3MBFA 4EWJA 1JFXA 3LGGA 1ECQA 3GVWA 3OIHA 1GVQA 4CU8A 1OFPA 4X9YA 4J7RA 3HPXA 4UQ9A 2ZWZA 1ITQA 2V68A 1IGSA 3IARA 4QLLA 3NQ8A 1CDGA 4ZR8A 3AMGA 1XGEA 1H7OA 3TLQA 1UOKA 1YPFA 1DYSA 2FHBA 2OCZA 1PZ1A 1OG6A 3OO2A 2YL5A 3TMLA 4AWUA 3FEMA 5EYWA 1H0IA 3WJSA 3EBVA 2VGBA 3TKFA 2HEJA 4H19A 1SFTA 4BF9A 3D0CA 2Q02A 2ZRVA 2H90A 2E5DA 4MADA 1W3JA 2ZXBA 1AL8A 1DIOA 3M0VA 3S2CA 2XN2A 4PC8A 4QGCA 2IKHA 1ISYA 1JFHA 4I7UA 2I5IA 4S1FA 2DSZA 5BXRA 5FEXA 3LA4A 5LKYA 2PCQA 1TE6A 2Z25A 2HS6A 4HYRA 2WMFA 3MCOA 5BOOA 2C0AA 4HPNA 1QI5A 2YXXA 3C52A 5DBTA 4AHOA 3VE9A 1LL6A 1TR9A 1VLIA 1XCXA 3NQCA 2H9AB 3TOYA 3F7JA 3U5YA 1PTAA 5A2AA 1UB3A 4LAUA 2QDGA 1FUYA 3E2VA 3K2GA 4GOAA 3VIIA 4E0CA 4AMAA 2YSWA 3EDEA 2XSXA 2NQZA 3PP7A 3UA3A 4ZTXA 1PVNA 5CC3A 3RXZA 4QRNA 3H2MA 4MVAA 4ZCWA 2QQ6A 2OSWA 1V0KA 3H53A 1X7FA 3M6DA 1A4MA 2VFEA 3TN4A 4F2TA 1LZOA 3WH7A 2WZHA 2XM2A 4RX0A 3KOYA 3SGZA 3PFRA 3MI3A 4JTFA 3WEMA 4PEEA 3OQ8A 1HJXA 3M9YA 4NJHA 4G1NA 2E9BA 1YEYA 4AHPA 1HL9A 2ZRYA 3M16A 4LF1A 3KS5A 3MI6A 1P0DA 1VFLA 5D2YA 1ADSA 5F4XA 2F9RA 2PLCA 2Y8KA 1G9HA 5E9AA 3TE9A 4W5ZA 3RHGA 2TODA 1S5MA 1YBQA 5D2XA 1XGDA 1HL2A 3DFYA 3LI0A 3W26A 1V6UA 5I24A 3YPIA 4YMZA 4RV3A 1R2RA 5U4NA 4YCPA 1GG1A 1EA0A 3HF3A 3KVMA 4Z2JA 3ZJKA 3O8AA 4Z1AA 1IR1A 2QIWA 1GYMA 1DXFA 3T42A 4WVXA 5D2WA 4LB4A 5DCDA 4ZGYA 2FDSA 2G97A 1KFLA 1XCFA 2O0TA 4LQ1A 4S2CA 2ZICA 4QX4A 2PDBA 4HSOA 2ABBA 4ENLA 3HBLA 2V8ZA 3DZ1A 1CT5A 4CQ9A 1R7OA 3M0HA 1RHCA 4ERAA 4LS2A 4MUZA 3GUGA 3VGEA 2AMXA 4PUKA 1CPUA 4MB4A 1XLCA 4V33A 3TW6A 3U7VA 5DT5A 4O1BA 2WB5A 3CAVA 1FWFC 2CZEA 2PP0A 3S46A 3KOZA 2ZTKA 4AVNA 5I00A 5JIWA 1OG0A 4HIBA 1R3TA 1OIMA 3RLUA 2PDPA 3KDNA 3VAVA 4IFKB 3SY1A 1V3JA 1Z6KA 2GJXA 3VDHA 1JR1A 2YDQA 5EA9A 3R0DA 1Q4WA 1U5HA 1MW3A 1G01A 1ZPTA 1G5AA 1W9VA 3M7WA 2GGGA 1EP3A 2OG9A 4YL2A 3R8HA 1R9YA 1XIMA 3B9EA 3LQLA 3APTA 4X0NA 2TPSA 3WMLA 3QM3A 3S6DA 3C0QA 3CL7A 1UWSA 3BAWA 2QV4A 4DWSB 5M3WA 1RSCA 3CAQA 2PWEA 1JF6A 4P8WA 4HP5A 3R7MA 4REQB 4DIAA 1DJYA 1MRQA 1ONXA 2EBNA 1Q5MA 1DTNA 3WLQA 1BYAA 1QRQA 1N2VA 2EAWA 2QGHA 3ONBA 3VIHA 2R1LA 2ZA3A 5CPSA 5JBFA 1JI2A 3C2VA 1MRAA 4RE0A 1BVWA 1OVDA 3MANA 1PKNA 3AFBA 1M68A 4CCZA 2Y5EA 2AGKA 4U2ZA 1Q6GA 1UBSA 3WQEA 1GOMA 3ITYA 3AIEA 2DZUA 5BRQA 2W63A 3CXOA 3FK4A 3VKJA 2E67A 3WMSA 3XINA 4Q4OA 3CUIA 5CZSA 3ZLFA 1SO5A 1XC4A 2Y63A 4MB1A 4O11A 3KBNA 1K77A 3M5YA 3EKGA 4XK2A 3N2XA 4ZZ9A 3WH5A 3O07A 2VCBA 4LH8A 4LPCA 4WZHA 1CGUA 2VEFA 3H7UA 5LXEA 1U1HA 3VDAA 1HX0A 5IBXC 2V30A 2GGJA 1OHLA 1UJQA 3TC7A 4CQAA 5A6AA 2DZBA 3GD6A 4MOZA 3IS4A 4IIDA 2DFAA 4FNPA 3MDUA 2EF9A 4ZOCA 5LNUA 3G24A 1TQXA 2RKXA 3ITTA 3U2OA 1KXHA 4JTJA 3BE7A 1DQUA 2HPIA 1D3GA 3KCLA 1E3ZA 4NRRA 3NZPA 3PZNA 5I78A 1RPKA 1PKYA 1WAWA 1PHWA 2YCIX 2QAPA 1TV5A 1QHZA 3S2NA 4ATDA 2WZIA 3S1WA 4HZ6A 1REQA 2NX1A 4S3FA 1DJXA 1FDZA 4C7GA 4P7QA 4YS1A 2Q8LA 4R53A 5EFDA 3WD1A 4BZYA 1GWJA 2A79A 4RE2A 1JCTA 2VZUA 2Z2BA 4CD8A 4IPLA 2BGQA 2Y70A 2VD9A 4HCHA 4QAWA 3B4YA 3BAKA 3PF3A 3WQCA 1EDTA 4JGDA 1M7PA 1A5AA 4ZB2A 3MYOA 1KWGA 5DO8A 3ZVHB 2Y7GA 2I9EA 3WLLA 3FJNA 2Z1SA 4BKNA 2NQ9A 3MO4A 3L4TA 3S5SA 3VYLA 4F66A 1DXIA 5C2GA 3W7DA 4PEKA 5FEWA 3WF3A 3P8JA 1KGXA 3WQ4A 4MJMA 2D3NA 4Y6GA 1UWUA 4B3LA 5IRPA 4C1NA 1L2UA 3A4JA 2CCRA 3ONCA 1LL4A 4G56A 1R47A 3L12A 3VM5A 3PUDA 3SN4A 3DKJA 4TXEA 5HQLA 4ICMA 2RGMA 3MW7A 4MAVA 3CT7A 3E2SA 1GK8A 2O4QA 3LDVA 1H1NA 4UBPC 2OFJA 1JCXA 3ALFA 2B81A 4N9DA 3W53A 1NVMA 1LLOA 5FJUA 1V6WA 3R0UA 3MSGA 2BVTA 2SFPA 3KVJA 4FXJA 3D47A 3MQTA 4O50A 1A53A 3AZTA 1Q7ZA 4PL2A 4WXZA 1OFBA 1MFVA 3ABZA 3AAMA 4LUJA 4Q6JA 3DDMA 4LC8A 5A94A 1UR8A 2OTDA 3CUHA 3C86A 3TN6A 1LQ0A 3GDRA 3D46A 2OEJA 5AHLA 2OZTA 4EWND 3AICA 3NAVA 4XWUA 1PX8A 4FHAA 4TQTA 3SQSA 1V51A 4CD7A 5CXPA 1T41A 5IM51 1RBOB 1GHRA 4C6FA 1T7LA 3L5MA 1PWLA 2WZTA 3EWXA 4O13A 2BHUA 3ZO9A 4MZ1A 3G1AA 3P5ZA 4ACZA 4CD4A 5F1VA 3CAKA 4AG0A 3KL3A 1E4IA 1QI0A 1NJJA 1TA3B 3WQOA 1GOQA 2OQYA 2C13A 1DKWA 3PPFA 1LYXA 3WJYA 4CN1A 2E6FA 3GNXA 3GVQA 4JYFA 2IQDA 1VFHA 2A3LA 3QSRA 3VNKA 2ATMA 3TUUA 3WF2A 1MYRA 4K7YA 2YB4A 4UQEA 3T8QA 3WK3A 3W4RA 2ZX8A 3WLSA 2IPGA 4MTVA 3MUCA 3NFUA 1HZYA 1VBUA 5K7JA 1JQVA 2WZEA 3QYQA 1NWTA 3E49A 2CLKA 1H7XA 3E0FA 2VFIA 1J11A 5G1TA 1KXTA 3NL6A 3GO2A 3KFTA 3BAJA 4IP4A 1W2PA 1OC7A 3IV3A 1AJ0A 3H6OA 3DFHA 3REQB 4NILA 4V15A 3F4CA 3RU8X 1XDLA 4Y9PA 3LHTA 4BQ4A 3CWHA 5HUPA 5D9NA 1T8XA 4M24A 1XIDA 3GC2A 2HTMA 2Q3OA 3CV6A 4AWTA 3M64A 1DE5A 1B1YA 1NOFA 2C3ZA 1B5TA 2DT2A 5D9MA 1ZBWA 3FCPA 1J5SA 2IS7A 3OZMA 3V5FA 3PJWA 3LCGA 1V3MA 1G0CA 3O0FA 4HQVA 3AU6A 4IX2A 3PC0A 3QF0A 4F0MA 3RX2A 1R2TA 2VZSA 1GJPA 3LHVA 4UR9A 4PFMA 3VZYA 5AYZA 5GVJA 4JTTA 1XIGA 3CUGA 3JU2A 4GD0A 2Y5JA 3LV6A 5FF7A 4WRHA 1ICPA 2GOKA 3UXLA 3CHCA 5H2ZA 3SURA 3AHYA 1XH1A 5MF5A 3CPGA 3KP1A 2VDHA 4ZOEA 1ZU8A 1W1A1 3UG5A 3B3DA 4RZBA 3DI0A 4DZ5A 5CEWA 1BRLB 1HQTA 1B31A 1IEQA 3A3HA 4PE8A 4NI3A 3R79A 1VYRA 2UZ9A 5AFDA 1OD8A 2WVVB 3KLLA 1RCQA 3STCA 1M1BA 2AKZA 2BG5A 4GBDA 4LOCA 3LPFA 1FHLA 4WOQA 1F3EA 3N2TA 4HU4A 3NQVA 3RO6A 1W1IE 3F4WA 2ZX5A 4NJGA 4IQJA 1XLLA 3T2OA 1E0UA 1ME7A 1IT8A 2P53A 2Z1XA 4GY7A 2BXZA 2O7Q<