3PTLA

Crystal structure of proteinase k inhibited by a lactoferrin nonapeptide, lys-gly-glu-ala-asp-ala-leu-ser-leu-asp at 1.3 a resolution.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of proteinase K inhibited by a lactoferrin nonapeptide, Lys-Gly-Glu-Ala-Asp-Ala-Leu-Ser-Leu-Asp at 1.3 A resolution.
rcsb
molecule tags Hydrolase/inhibitor
molecule keywords Proteinase K
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3ptlA00
2WUVA 2ZWOA 3GCXA 3WQBA 1Y3DE 3WIVA 1OYOA 5JXGA 1MEEA 1GCIA 1SUPA 3H42B 3Q5GA 3AJ8A 3DE6X 1Y9ZA 5I9SA 3SICE 3VTAA 3VYVA 3F49S 1Y1KE 1V5IA 3I37X 3QMPA 1CSEE 3DVQX 4KPGA 4OMCA 5AQEA 1TK2A 2DP4E 1EA7A 2P4EA 3D43A 1S2NA 4OMDA 1THMA 1R6VA 2Z57A 2PWBA 2WV7A 3VSBA 1TECE 1BFUA 1Q5PA 3TI7A 2X8JA 1Y3CE 1SCDA 2Z2YA 4KB5A 3ZXXA 1WMEA 3AFGA 2WWTA 2Z56A 2SICE 3DE1X 3DE0X 1TM7E 3L1KA 2Z2XA 5FBZA 1NDQA 5AVKA 2PMWB 3DE3X 3LXUX 3EDYA 3F7MA 3DYBA 2W2PA 5B1EA 2W2MA 1TM5E 2XRMA 1ST2A 3OSZA 1TM1E 1SPBS 1WMDA 2ID8A 3BX1A 4H6WA 4DWWA 1VSBA 4Z2AA 1SBIA 3LPAA 3DE7X 3DW3X 1CNMA 3QFHA 2Z58A 2GKOA 1ZVJA 4ZARA 1KDYA 1BE6A 2IXTA 4NE9A 2HD4A 1V6CA 4MZDA 1BE8A 1Y48E 3A3NA 1BJRE 3A3PA 3CO0S 5B1DA 1KE1A 3SQOA 4CFZA 1GNVA 1SCNE 4H6VA 1AK9A 3TECE 1TO2E 2SECE 2Z30A 4JP8A 3VV3A 4CFYA 3ZXYA 1BFKA 3PTLA 1IAVA 2IY9A 2W2QA 1SCJA 5AMXA 3Q40A 1S02A 1GA6A 1C9NA 1T1GA 3F7OA 1GNSA 3LPDA 2DQKA 1HT3A 2PYZA 4LVOA 1P7VA 1AVTA 1A2QA 3EIFA 3I30X 2G4VA 3GT4A 4RYDA 1SBCA 1ZVKA 3TI9A 1KDZA 1T1IA 1SH7A 1JEAA 4OV6B 3EE6A 4DZTA 5JXJA 1C9MA 1GTG1 1Y34E 1PJ8A 1P8JA 3DDZX 3QTLA 4M1ZA 1Y3BE 1IC6A 2DUJA 1SUBA 1T1EA 1Y3FE 4AKTA 5JXIA 2B6NA 1S01A 1AU9A 1Y33E 2V8BA 2Z2ZA 4KG7A 5FAXA 3UNXA 3VV2A 1SIOA 1YJBA 2TECE 3GT3A 1YJAA 2PQ2A 4HX2A 1SBTA 4CG0A 1AQNA 1SCBA 1UBNA 1Y4AE 1PTKA 3DE2X 3DWEX 3I34X 2ID4A 1SELA 3T41A 5ARBA 1NDUA 3PRKE 2SBTA 5SICE 3GCWA 2XTJA 2WUWE 2W2NA 1AV7A 4GI3A 1DBIA 1XF1A 2HPZA 3AJ9A 1TMGE 4LVNA 3I2YX 5K7SA 4HVLA 1OYVA 4NE7A 3WHIA 1AF4A 2E1PA 1SVNA 5CW1A 1PEKE 1GA1A 1KDVA 1MPTA 4FONA 3HJRA 1SN7A 3BGOS 4C3VA 4ZOQI 4WOBA 5JMOA 1GTJ1 1SIBE 1C9JA 4K8RB 4I0WB 1AH2A 1Y4DE 3DVRX 3LPCA 2PWAA 1R0RE 1ST3A 1TM4E 1SIUA 1NLUA 3VHQA 1TM3E 3D9QX 2ZWPA 1LW6E 1YJCA 1SUEA 2W2OA 1WSDA 3A3OA 3BPSA 3DVSX 1P7WA 1SUAA 2X8JB 4NMXB 1EGQA 1DUIA 1SUDA 3DE5X 2PRKA 4J94A 1GTL1 3DW1X 1TO1E 1GT91 3DE4X 4C3UA 4DJ5X 1YU6A 1GA4A 3WIUA 2ST1A 1OT5A 4AKSA 4BWGA 2ZRQA 4H6XA 5ARCA 1WVMA 5FFNA 1SUCA 2QTWB 4WOCA 1C3LA 1SBNE 3CNQS 1BH6A 1SBHA 1WMFA 1PFGA 2PKCA 5ARDA 5AVJA 1R64A 4B5LA 2SNIE 3P5BA 5JXHA 1KE2A 4YN3A 1SCAA
chains in the Genus database with same CATH superfamily
2ZRCA 5B3JC 4NONA 3EVZA 5FUVA 4DA0A 2C9DA 4JDPA 4QRHA 1JMKC 5JYCA 1NVVR 4LDAA 1NMQA 3ZHRA 5JAPA 3UJ6A 4DCNA 4YK7A 3KSRA 1T2CA 3RYFA 2E89A 4I6GA 3QPVA 2JGIA 1LNZA 4E46A 2ZIVB 3BWCA 3KIPA 1DQRA 4QREA 3T5AA 1WMBA 1E7YA 2WJZB 3GGSA 4KB5A 4QJIA 5JS2A 1WABA 4AJNA 1FYFA 3BE8A 4X8LA 2XY4A 4BMOB 2REQB 1TW3A 4P98A 3FWZA 2Q0HA 1DAFA 4ZQHA 4WT7A 4HNUA 2W6ID 4JBHA 4XCVA 3S5UA 4BLVA 1W5TA 4EPTA 2GB4A 2VJMA 4WDQA 3ZE9A 2HC9A 1Y8CA 2WDPA 3KYDA 1P75A 1T8TA 1LNQA 4RV5A 2FG6C 3EULA 4BVKA 1N8KA 2QW1A 5AI5A 3N59A 1X92A 2DBYA 5A4AA 2XCRB 1P9NA 3P94A 5AVUA 1XKTA 3TOSA 4X63A 2R6HA 1XVTA 3EPPA 5LWQA 5B1SA 3B8EA 2ZDGA 5JNVA 2CDCA 1Z4MA 2NTYC 3ITEA 2IY9A 6REQB 2PGDA 3IP3A 1XDZA 2AI2A 1X38A 3AB8A 4JJZA 4MB0A 5E7IA 4D9GA 5JPCA 1IN7A 1SK8A 4Z9AA 4PR3A 1EVJA 1Z33A 2D59A 3CA8A 3LM8A 4PFSA 3G2OA 3LP5A 3R74A 3ONWA 4WKBA 1R0CA 3M1LA 1YRBA 2IIQA 4QX6A 2D74A 1MG0A 3LCJA 4RFSA 5EWMB 4BFZA 3I61A 1JZQA 1XROA 3F6EX 5LQSA 2W90A 1PR1A 3OOEA 3GBPA 1M6NA 3CW9A 4NFSA 3DEKA 4MVXA 4HJXA 2I2BA 3PGJA 3ZQUA 4JDUA 3OIDA 2P67A 1T9CA 4FD2A 2V5VA 5T4EA 3ZIDA 1NP7A 1Y80A 1VBKA 4QO8A 2F1RA 1S89A 4HDQB 2JLYA 2YVKA 5CYFA 3TGWA 5ARBA 1U9JA 3BUSA 4HQOA 3AF5A 2RAPA 2BEUA 2P8SA 3V9PA 1SBZA 3ZU6A 3RU3A 2FZ4A 2YV1A 1G3MA 5HR5A 2LGJA 1EGVB 3ED1A 5MN5A 1L7BA 4WPGA 5EIAA 221PA 4XWYA 5THXA 2JIZA 2O4UX 1MCZA 2O2ZA 4JLNA 4QM7A 3RFFA 3W6NA 1K3TA 1XZNA 4MPDA 2HMSA 4XRRA 1DG1G 2BFEB 4I6EA 4CQNA 4LXYA 1XZDA 1DZIA 2G1AA 3GZTB 4BZXA 4E5VA 8OHMA 4BS9A 1W35A 3GLVA 4DJFC 3TUZC 1XZGA 3H11A 1H0HA 1YDHA 3BZBA 1CVIA 4TLCA 1DLJA 5DLDA 1OUMA 1HLDA 3UJ3X 1J49A 3IP1A 4HLCA 4AJ9A 4R1QA 1NM5C 1H1LB 3NFRA 5EA2A 1EFRA 1NLMA 2CEAA 4QT4A 3GP3A 4P81A 4BVHA 5KSZA 1VFNA 5CFQA 3EWAA 4DJ5X 1SR8A 1GYQA 4HZUA 5A5FA 1PK9A 5JFOA 3U3KA 3PNQA 1Q2UA 2GA9A 1GIAA 3WYEA 2EDAA 4DR2B 1H0SA 2DYKA 5KWJA 2FXVA 1CY2A 2PWYA 1X0VA 2JGDB 2YWJA 2YRFA 3COSA 4QZVA 1P6QA 4HS9A 4OREX 4BQIA 3WRXC 3Q3GE 3WNCA 4DUGA 2J5KA 2JI7A 2OAGA 2W6JD 2K4MA 1KZ4A 2WV9A 3PPIA 5U4XA 1Z4JA 3CURA 3O6VA 1IE3A 3PHHA 3VJMA 3A1TA 2LCFA 3QKTA 4BMXA 3GEEA 3EF1A 3R3VA 3IEUA 3UM9A 5HUQA 4O3MA 2NACA 2ORYA 5HZKA 4AO6A 3PR2B 3QRWA 1T1SA 3C45A 4GO1A 2ZYWX 2RIRA 4N9QA 1DJOA 1KAMA 2GRUA 1M2OA 1YZTA 3G7NA 2BF4A 3JZAA 4LJ8A 2YS7A 3GEMA 1QS0B 1MXHA 2OLEA 3AFGA 1FFWA 4MUJA 3I9V1 4YGYA 3SPXA 5K0GA 3OX3A 3KLOA 5CDTA 3E22B 3CVVA 1WBJB 1XTVA 1ADFA 1W6RA 3U6KA 4UC0A 3WGUA 4DM3A 1UBMS 1QB8A 2DR3A 4AYTA 3G5LA 3MWFA 3KQSA 4OHMA 1JG6A 4TM7A 1T8UA 1UWLA 2RI0A 2Q5CA 1JMYA 2PZMA 2QMYA 3BF7A 1CUAA 2JI9A 1PT9A 4QYTA 5TF4A 1YIOA 4NQRA 3EB9A 4XWAA 2XWBF 4ZARA 5KUTA 1UOQA 4AS2A 2G07A 3DFZA 2VYVD 4BAGA 5CDGA 4ZYYA 5KQSA 4LDQA 2F48A 1WUIS 2Z8XA 3DNPA 1BFDA 2FZWA 2GBLC 4HEA1 4QSHA 5EP3A 4B5KA 5JI3E 4RTRA 2BKEA 5JMWA 5L6LB 1O97D 2JIBA 4KWEA 4CT5A 4KUGA 2V5UA 1OI3A 3T5TA 3TIVA 2FFQA 4PC7A 1HR0B 4UNIA 4DLYA 5SYAA 3QKIA 1Y5RA 4ENVA 1KP2A 1NNI1 3WV5A 2H4YA 1PJ3A 2FJPA 2WWIA 1Q6ZA 3ER6A 1SA0B 4UE3S 3GAFA 2QTTA 3S68A 3IUSA 1B00A 1IEXA 2NTJA 2GZ3A 1IH8A 2XV1A 2NWQA 4ALNA 3REQA 3K31A 2O8EA 2VTVA 4C30A 4BBZA 2YOHA 4G84A 2D7CA 1OH8A 1LFDB 3IEPA 2MINB 1KI1A 3O4HA 4CM4A 3ZV6A 2QLLA 5CFPA 5ECGC 5CGZA 3H3JA 3UWDA 1T9GS 1HDIA 1X7YB 4G2TA 3S2UA 1ICEA 2W2NA 3EZFA 1UBRS 2R8BA 3B52X 4RZHA 2XUDA 3CPSA 1F6WA 4R05A 1RLJA 2OV1A 4HDKA 4ND4A 1TTTA 3D2LA 1XVIA 5AKJA 4CKEA 1YE3A 3ZDZB 3HJFA 1U7HA 2ZSDA 4FDTA 2GFQA 3NASA 5EHGA 5I3ZA 4ZO7A 3EG5A 2VT6A 5H4GA 1JE1A 4WFIA 1HRKA 2J1LA 4ZOLA 4G6ZA 2O5EA 5LKRA 1BGWA 3KWMA 4BMNA 3VAYA 4D3DA 5KTKA 1S1CA 1OWNA 1SUFA 3A4NA 1PVOA 1BWRA 3E15A 1TIPA 4GZ5A 1IM8A 4EUEA 3W5AA 3L4KA 2QY9A 5EP2A 4MHOA 4D9KA 5AVQA 1N6OA 1G8MA 1NVMB 1ZA1A 2G71A 3QW4B 2GCGA 4FS3A 1NZFA 1GJRA 1HORA 2Z6AA 1XEXA 4X1KA 2V4UA 3MA0A 5FPPA 4EYKA 4CTJA 2HIAA 2OBXA 2VEOA 3KQWA 4GGMX 4HF7A 5KKCA 2OAQ1 4AY6A 1DBPA 4MYTA 1D1TA 4JT8A 1A1SA 3MINA 1OX4B 4WXYB 2HLDD 2NSHA 3MTIA 4KMSA 2AUTA 4Q9JA 5JTTA 5IWAB 1IN1A 5IU6A 3ZV3A 5J2UA 1HQKA 2AIRA 2YCLA 5HCUA 1J9ZA 1IZYA 4W63A 2E0IA 4QXRA 1Q44A 2VXOA 4WLUA 3KVYA 3WIBA 3GJSA 4PNHA 1A9ZA 3WLEA 1JJAA 3IUYA 2OCYC 1G20A 4O4JA 4ND7A 3C3XA 4PVDA 3T7SA 3ZYZA 4CKYA 4ZRMA 4G5QA 1WV1A 4C1BA 4CM7A 5ULLA 4BQEA 1N2CA 3CPEA 2H11A 3BXZA 1FDVA 1H9AA 3KQHA 3M5WA 2A5LA 5ED0A 3RV3A 3HK2A 2DKNA 3ORSA 2UZ1B 3DMFA 5CEJA 3DWFA 2AEJA 2Y1XA 2QD3A 4HG2A 5AVVA 3JAMA 3LYHA 3VC2A 2J45A 4H6WA 4BE9A 1Z18A 2LDXA 3M6IA 1M2VA 2XT0A 1L5SA 4HRYA 4CHGA 3DO6A 5LU9A 3D6AA 3OD1A 3JALB 3PX2A 4LJ5A 5BSGA 4YP1A 4MRRA 4IKPA 3SS8A 4BY9E 3IVRA 3G23A 4IOJA 1OSNA 2Y1GA 4MS4A 1N77A 4IRXA 4HGRA 5JYEA 1NG1A 3GA5A 3UOWA 5FI0B 5JH7F 5LOVF 1E64A 4BMYA 1K68A 2DHCA 1LF5A 4BQPA 1AKVA 4XCQA 3ROQA 3GJZA 3M4JA 1FQJA 1T2NA 4I4CA 1H05A 4MQMA 2XCTB 1LBHA 2ZYAA 4TLEA 2XRYA 3T5CA 1VPWA 2G9ZA 3MVEA 2HHAA 4DGQA 1NC1A 2GPBA 5ICGA 1U8YA 2GZRA 5DLEA 3RC7A 2A9RA 2GLUA 3LHDA 2IODA 2VHZA 4MVJA 4DNXA 3O1LA 3PJRA 3D6MA 1Q12A 3L06A 1O6CA 2GM3A 2EYQA 3BB3A 3JYLA 5D5PA 3RGGA 4BNJA 1TYBE 4FB4A 2C5AA 2AOUB 2Z2ZA 3UKJA 5KKNB 1WEKA 1E59A 2R68A 3UJ9A 2CYBA 4ZHQB 1EKXA 2CBGA 4OU4A 2R5FA 2VWPA 4GG1A 1Q0LA 3UWSA 4EL5A 5KVVA 1ORTA 2G0AA 2FR8C 2OV3A 4Y2TA 4FW9A 1DOAA 1NOKA 4DCOA 2ZANA 3AVQA 4LJSA 1E1KA 3T1TA 1QFZA 3PHJA 4YUZA 2E48A 1MDBA 3ZU2A 1QH9A 1WXXA 5IN4A 1B4DA 5BV8A 4G8BA 2FWJA 3D4PA 1RPAA 1VDZA 4JQSA 1VHQA 1RZ3A 3UPUA 2FX3A 3Q0TA 1IEQA 2IZ7A 2ZVJA 3QMMA 4D99A 4FFSA 3CSDA 4OQMA 5CP8A 3VSDA 1SMKA 3NR2A 4EA7A 4O2AA 4QEDA 3P0EA 3V2GA 2WPDD 4GR5A 3GRYA 1TUIA 1GZVA 3QU9A 3CR3C 1ISFA 1PLJA 1U0LA 4MDHA 2W2OA 4DCCA 4MWSA 2CLIB 2UKDA 3DVSX 4YV1A 3DHYA 4BV2A 3U16A 4X00A 1Z13A 2E87A 1WKCA 1TADA 1F4VA 1PNOA 2AN9A 5JSFA 3E7FA 4G9BA 1BGVA 3CLTD 3S1SA 5CTAA 2DRIA 3UUWA 1E20A 1P2TA 2JGKA 1USGA 1HYQA 4LOJA 4PXYA 2R85A 3A27A 1JLKA 1SBQA 5AK5A 4YMLA 4GL2A 4Q34A 3VR4D 3RWOA 3GEHA 1PL0A 4QQ8A 2G06A 4Z0PA 3QF4B 3X1XA 3GLGA 4KPFC 1LB1B 2P9EA 3F74A 4EY6A 1BEUB 1U3FA 2C83A 5TE9A 1XUOA 2WZDA 3K2QA 4OJMX 2IYAA 1A97A 2Q3LA 4H35A 5DHRA 1RYFA 2CYCA 2JLAA 2ZR8A 3K9LA 3TR6A 4Z4FA 3EVFA 3VI4B 2HJHA 4MRMA 2C2WA 4K8OA 4JEHA 2DQSA 4KDRA 4TV8B 3G2LA 3ND8A 1ZL0A 4IJ6A 2DP4E 3FTQA 4KMMA 4NS4A 1P4RA 4NU8X 2D0OB 2NN3C 4TWAA 1TTQB 4B4UA 4ZMBA 1KC3A 1UADA 4ZYUA 5I6DA 3STUA 4EY8A 3RM3A 2OCBA 2Q2QA 1KOJA 2XHZA 1I7PA 1K75A 4RFVA 3IPYA 1BKDR 4L85A 5M5BA 3VR6A 5LMUB 1E2LA 3GRCA 3F7MA 1K3FA 5JAUA 4JUAA 1JPUA 2IW1A 2QTGA 2H07A 3NIWA 2FZGA 2IKSA 5EGNA 1NLYA 1OQAA 1X7ZA 3PVSA 2F2TA 5D87A 4I55B 1AZWA 4D2IA 5IUKC 2QUJA 2XWPA 3LH5A 2G08A 2Z95A 2A9JA 4QXMA 2QG4A 3QITA 5HKBA 3DHWC 5JIBA 4QHTA 1PAUA 1MC8A 1SC1A 1W49A 1JDBB 1JU4A 2XDQB 4LXQA 1K8YB 2HB6A 4FXOA 5J2UB 1SOWA 5H8WA 4PINA 3AB3A 5DGTA 1B15A 2HQ1A 4G0WA 5CAEA 4Q3OA 4RPLA 5E1MA 1JA0A 4CKWB 1J56A 3EDQA 1UFVA 1H85A 1YQGA 3CRZA 1NF8A 2A1TS 3OBBA 3Q5DA 4YREA 4S2EA 3PLNA 3Q9NA 4QUJA 3FI0A 2MR6A 3B5IA 1E2IA 4LNUB 1J8FA 1YR8A 1CJMA 3HCNA 3I4FA 3IR5A 2COEA 3HDJA 1Y4UA 2ZAOA 4K6MA 3T9EA 4CUJA 3LNTA 4W1RA 5IANA 3ZHBA 1YS6A 3OLCX 1X1BA 5DPMA 3FYTA 3K6RA 4ZOLB 2QUKA 1WETA 1P80A 3PF8A 3ZOZA 1MEOA 4MS1A 1YDMA 3UMGA 2BFMA 2IU4A 4C4AA 4ZCMA 4EJ6A 2JBHA 5ICCA 5JJKA 3RT7A 1DDOA 2PA0A 4A92A 3WGVA 2BMAA 4GLBA 2X2OA 1E1QD 4O4JF 4L0CA 3ZYCA 1CQJA 2RH4A 2R5NA 3CX8A 3L49A 4O4HF 3ZK8A 3UB4A 3OH8A 2RD2A 2Q50A 3U1BA 2ZXUA 1TKCA 2JIQA 4UMEA 5FHQA 4QUKA 3A1WA 1XAIA 4UUBA 1CP3A 1EUDA 1OI4A 4GUAA 3HJAA 3OCUA 2AFIE 2GXAA 5CBKA 2O8FA 1CS0A 1GSAA 2WWHA 1EB9A 5HRCA 4UHFA 1F6DA 3IBFA 1KRXA 4ZT7A 3HKBB 3D9QX 1II9A 1QV7A 3PVZA 1NJ2A 1JEOA 1UC9A 2HHJA 1BD4A 2WTEA 3C3CA 1DXHA 3JZDA 4LW8A 1P7WA 3RF7A 3OE7D 1KDTA 4OK3A 2XKJE 3PQ8A 2JGRA 4IIVA 4D43A 4EJSC 5ALOA 2WM3A 4O1IA 4FD3A 2B4YA 2GILA 4HMOA 5FX2A 2Z6UA 3CF2A 5CT6A 3RPEA 1J99A 5JNUA 3PE3A 4L8WB 4ZCRA 3GFOA 4W9MC 3BIOA 2JHGA 4Z4IA 5WRFA 1TAUA 3KYIB 2VAPA 5FTMA 3UHFA 4E14A 4E2ZA 2HYIC 3AY6A 1I1NA 3LECA 1WBDA 2CVQA 4J76A 1Y6QA 5IJXA 3UFXB 2O7QA 4X62B 3MMZA 3L5OA 3DQZA 1HZJA 2BFCA 3OPQA 4A8JB 4MRNA 3BZWA 3DTVD 1N8TA 4F91B 1P8AA 3TLXA 3DP9A 3NTLA 3FR7A 2C3UA 3GK3A 1XXHE 1ZICA 2O2DA 1CERA 5M29A 5B2EA 4YQEA 4DMCA 1GD1O 3HDVA 4TQAA 3EQ7A 1W9HA 1XZJA 1HYHA 1QP8A 2B8NA 2O6HA 1MEJA 1M8PA 3O8QA 3RK0A 3HNRA 3WJ1A 4LYDA 3E9ZA 2O8CA 1QGUB 2WFLB 1H2YA 1K9SA 2AYXA 2L17A 4V38A 4NYJQ 3IL2A 4LF4B 2O0JA 4HEQA 2CDRA 1DC3A 2ZJAA 5ECWA 4D0RA 1QGAA 1T5OA 1UT8A 3OLVA 2FPRA 3V46A 4ARIA 2UU9B 2VTBA 4EP1A 2R9VA 3E2MA 4CNBA 1UKBA 4PPNA 4B7CA 3H6KA 1PQYA 1BMFD 4QE3A 3DC2A 2PCJA 2Q1UA 3I73A 1BKSB 1XBTA 4F3TA 1P6UA 1N7GA 4P7BA 5HVNA 3CUUA 3MTDA 2HUNA 4PAGA 1TCAA 5LBIA 2Q0SA 1QH1A 2JJ2A 1IK4A 5ILOA 1WCWA 1DB3A 2NYVA 4FR5A 2OFPA 3UJCA 1YO6A 4MHSA 2XMGA 4L8FA 1EK5A 4MWOA 3KT3A 4M1WA 1QPZA 1I3NA 4TTTS 3K1TA 3BXHA 2QLFA 3ONDA 3IEMA 4EG8A 1C3XA 1KIAA 3S4YA 1E8NA 2QT1A 2GWHA 3LUJA 3S5JA 3U0BA 5CBPB 1POWA 4XR9A 5AW9A 4YC7A 1C29B 3VDMA 3AZPA 4P7GA 4RACA 5DBOA 5FBWB 3Q2OA 1AB5A 1Z6QA 4FC6A 4YRBA 2C2ZA 2IZ0A 3K35A 3NUGA 3CZRA 4GXQA 2HWKA 2DWUA 4NAHA 4C43A 5KYXA 3NJ4A 3LA6A 1OIWA 1E9RA 4DOMA 2TECE 2Q9BA 1SD5A 2ZJOA 4PZLA 4J0KA 3TZLA 4UBKA 1Q1EA 4PPFA 4FS8A 1LDBA 1EINA 1KS2A 1ZOSA 1NW7A 1RRPA 4JXJA 1U5CA 2WSLA 3DPUA 3HJNA 3KAKA 1MABB 2IS4A 1QFMA 2BEUB 2F1IA 3OFKA 4O4LB 3S0JA 2WF5A 4PN3A 1MPTA 1R5NA 3ZXIA 4ZJZA 2OQRA 3GT7A 4F5ZA 2FAXA 4J2OA 3PXGA 1G8YA 1X9IA 1UZLA 2BBTA 4RJTA 1QYIA 1RWBA 3EVAA 3C7KA 2A57A 1SHJA 3I9MA 1ND6A 3OJ0A 3CZCA 3JQ7B 4D5GA 4ONEA 5A9SA 1GWNA 4C4XA 5KWSA 4RVGA 4RFSB 2B36A 2Z3WA 1CU1A 2W22A 2IY8A 1RWWA 5EWMA 4B3HA 5K8LA 4YT2A 1EFLA 2H08A 1O08A 1ODTC 4MUEA 4MW1A 2VTEA 2GXQA 2H7XA 5L3RA 1QVRA 2KI5A 5JTUA 4QOIA 2VF2A 4XYLA 3RV4A 2ECKA 4II3A 4CDNA 3ZE7A 3N07A 5FAKA 2P78A 3ASZA 4NLLA 4RXMA 5SYMA 3RR2A 4OGKA 4MV6A 3AV0B 1ZX1A 4AKEA 2W2KA 3OOHA 2HCRA 2Y0DA 3G1UA 2C5LA 3DB2A 3MWYW 3WIVA 3WQQA 4KE6A 4KO3S 4GNKA 1QG4A 5DNDA 2A0FA 4U02A 1Z68A 4WLOA 2HU2A 4UTZA 3R24A 4C29A 4AJEA 1I01A 2WU1A 1W94A 1F3OA 2K2WA 2PSDA 5EMMA 5J5AA 1LY1A 2IFTA 3NW9A 1M6EX 5JPIA 1NY6A 3T7IA 3PS9A 1ATZA 3WL3A 5J23A 2NNLD 2BVNA 1XZ8A 3OCWA 4Q3NA 1PFVA 2CFTA 1AMNA 3ZH2A 2KB0A 4NBNA 3IAUA 2W2PA 4D26A 1V6SA 4I66A 4A27A 4O2LA 1VKHA 1CJTC 3L7JA 4FW8A 4I9GA 1Z4QA 2RE8A 3VVMA 4H59A 2Z5VA 2PQ0A 2ZJ2A 3TRKA 3RYFB 1LU9A 1S8AA 4OP2A 1E1NA 1PZXA 3ELBA 5ESWA 5T4BA 3WLAA 4S2UA 4C1NA 3OQOA 2FPGA 4M0DA 3CNHA 4NBUA 1L1RA 1FVXA 3HDGA 1CHNA 2BWJA 5EZ6B 3WWPA 3ZHXA 1PWXA 3MLBA 2XD4A 1JEQB 2XBUA 5DGHA 5IK2A 5DIZA 2H4HA 2J5XA 4FHCA 3UG6A 1E1DA 3RI3A 3SSMA 4P35A 4WK0B 3UUEA 1W88A 3R6WA 1ZR2A 2XA1A 4CCWA 3SIXA 1ZVKA 2IIPA 2WTBA 5A3SA 3ZGVA 2JRCA 2MYUA 1C9MA 1KJ9A 1NAIA 3DDZX 2XD9A 3G9QA 4RVHA 1WTCA 4OEHA 3SY8A 4IQFA 2QTVB 3TLBA 3WGHA 2HO4A 4CR6A 1KHTA 5LPNA 3RJTA 2JB9A 1RYHA 1T2FA 4DLWA 3R77A 3ABIA 1NPYA 1RPNA 3BN3A 4Q7KA 4XM0A 3AGQA 1IEWA 4A8JC 5KOHA 2EWMA 3R41A 1J0DA 3UAGA 1UFKA 1GEEA 1RHMA 5ALFA 2HA3A 3SOPA 3WMFA 3CLRC 3KKMA 3OFNA 1EQ2A 5HDBB 1XA3A 2A5GA 3P96A 4AM8A 2A84A 3DNFA 1QV9A 5A4DA 4C14A 1WCIB 3I4CA 3NHBA 2E6UX 3ED5A 2CB0A 3TE7A 4KAXA 4XWTA 1P9WA 1GPUA 2B4RO 4A2WA 4CMHA 2Y27A 3COZA 1ZOLA 1E66A 3PZRA 4FM9A 3IKLA 2ES4A 3OU7A 1I80A 3I01M 3ANTA 3CT6A 4TRNA 3C8ZA 2X8AA 4BPRA 4IGIA 3PJGA 3G82C 4D25A 3GEDA 4Z3DA 3RRZA 1XA0A 1AUXA 5I45A 2YZKA 2C4NA 3RRXA 3BC1A 1WHTA 1PUIA 2GF2A 2IUEA 3C7AA 3QWBA 4R16A 5DN9A 1NXOA 3RUHA 4RJ2A 5B1YA 1RYBA 3KXKA 2PPVA 3BAZA 4WN3A 3IS3A 4K9MA 5FLXA 1MJFA 2OG1A 1PQPA 1TDJA 2J31A 1YQQA 1JR4A 4Q9NA 3U80A 3KZXA 1FL9A 3HXLA 5LD2C 1LVUA 3P2EA 3I62A 1ENPA 2G72A 1ECCA 3DDWA 3QPUA 4DMMA 3CUTA 4V0NA 1XQVA 4IX1A 4E3ZA 4HY3A 4NICA 4MMYB 5FHRA 3CUSA 3D0QA 4DJEC 1M2EA 2I8LA 9GPBA 4W1PA 1GO2A 3I09A 1T8RA 1WXWA 4FYPA 1UXIA 3DLTA 4G8CA 3F3SA 1A77A 1FJHA 1T0IA 2Q6KA 4OJYA 4W5HA 3LX6A 3GFVA 3QENA 4HBZA 3ZCQA 4BCBA 4F9GA 1APBA 3SC6A 4QBFA 1KZ1A 3QVLA 1TAHA 3KALA 3I9OA 3QI7A 3QU4A 1DQYA 4UZSA 5L8VA 2DKFA 1ZK3A 3EDOA 4KREA 3GELA 1E5QA 2PY6A 2VWGA 4KE9A 5IF3A 1BZYA 3HKCA 1QPGA 5DDIP 2B8WA 5FOXA 2B8TA 3R0QA 3BMNA 2BFNA 3I2FA 2P3QA 2Q4DA 3CO5A 5I8PA 2CDBA 5I7RA 1KOFA 3TAXA 3P2OA 3NQ41 5CXXA 4KNWA 2P9FA 3VKVA 3ICCA 3TOZA 3I2GA 4RK6A 1XRQA 4DQUA 4JLWA 2ZM5A 4JI2B 3PTLA 2WT9A 3WLTA 2XSZD 1XU9A 1JDTA 2XUAA 3MMNA 4WOKA 4ZV9A 4E6EA 2ZI4A 3SQXA 3UJPA 1Z12A 4HNQA 3BK2A 3PCXA 2RGNC 2BZSA 3TKLA 4DCGA 1SKUA 3SR4A 1NKVA 2ZWIA 1I4LD 3CQ9A 4EY5A 1K0FA 4GL4A 3G7SA 2WUGA 4HL6A 1L7PA 1FQOA 2FGKA 2HCBA 2VXYA 3HJGA 4RXUA 3DJFA 4JUBA 3R9KA 1R0WA 3T06B 4E15A 2EQBA 2QMEA 4P36A 5DGXA 4B3DA 2ODBA 4EF4A 3H9EO 5FOTA 4A2PA 2OR3A 4KG7A 5EYPA 3M6MD 4H3SA 4QT0A 3V1KA 1NR1A 5GONA 3S1LA 4DLUA 1OBFO 4KQXA 1L8OA 2BUBA 1JIIA 4AL4A 3WO1A 1CUDA 2OQ2A 3BD7A 3BTSA 2WFAA 3S29A 2RONA 4KYTA 1WZCA 1JAHA 1NFRA 1BVYF 1Q0RA 1QDLB 1GQSA 2V7WA 4IX9A 5BW8A 3NLLA 3ZPXA 2HPZA 2QLJA 1UPXA 3CEHA 1OXTA 2Y1KA 3MIZA 4CV2A 1NWCA 4X95A 6CHYA 2NADA 1AGNA 5AHRA 3SHTA 4OB7A 1K1EA 3PEYA 4NQZA 5D51S 1JVBA 2AZMA 2H1FA 5LXTF 1COWD 3I9FA 5KYXB 2PH5A 2P1ZA 5DZSA 3UHAA 3IP7A 1V2GA 4KITB 2RMKA 4UEJA 3TQRA 3UXHA 3QVVA 1S8NA 4FU0A 4EA6A 3FB1A 1PDOA 4NNJA 5A7GA 4JU9A 1ECGA 2Z8YA 3EGVA 3HCPA 3SIRA 1GTL1 1SXGA 2BI4A 2ILVA 2GBFA 1RAIA 4KIGA 3M6LA 1YOVA 5JHGB 1ZIYA 2VWHA 4AFNA 3UMSA 1URPA 5C5EA 2ET6A 4AF6A 3AI2A 5FUYA 3RVRA 3B70A 3GZ4A 4KXQA 4XGRA 2Q1SA 1E3DA 3T0IA 3WE7A 5D7BA 5CFOA 4MPRA 2FNAA 2PZBA 4QUBA 3L40A 4S1NA 4KR3A 4JJFA 3KTAA 1XD9A 3G9ZA 3G0CA 1G2QA 4I4TA 3C39A 5IJ0A 2F1OA 1AGRA 1KJJA 3R7BA 3IUJA 4HEJA 4HZIA 1BW9A 2J3MA 5FWXA 2X9LA 3JWJA 3LS2A 2ZKIA 1KYIA 3AVOA 4UUQA 1UJ6A 3BGVA 4HDSB 4OFBA 4WA7A 5I8ZA 1R3DA 3ELYA 3JD4A 4X1OA 4B6GA 3JD3A 3DLBA 1PGNA 5AP9A 5EOVA 2FFAA 4ZVPA 3BA1A 5KWEA 1WB5A 2OSBA 2P2SA 1C4OA 2VATA 3WZLA 1L4LA 4PTLA 2I3DA 5EJFA 1T2VA 1PVDA 2GBIA 4U9IS 4C4PA 2VTDA 1Q1NA 1IY1A 4B4DA 4NF2A 1YRHA 3ELDA 3ZI4A 1OLUB 2BCEA 1AKUA 4JN6B 3IQDB 4K6KA 3ZQ6A 2VYCA 2ATEA 2Z58A 4OPMA 3EEOA 4UVIA 3G9UA 1ISJA 3FRHA 3GJQA 2X19A 4FXPA 4S35A 1N1EA 3A9UA 4N8EA 4ZHQF 1SPXA 3SXUB 2HIMA 1G20E 3QFRA 2BRUC 3VO2A 1HH4A 3CZ4A 3R7WB 3EXHA 3OTQA 3DBHB 2PLRA 4BLRA 4ITRC 5AKYA 2G6TA 2VXCA 4FKMA 4JVLA 3N0VA 4Q7LA 1B2RA 3MUFA 5KHAA 3ZDFA 4UM5A 1GTRA 1XI2A 3DB1A 1AOXA 4U2DA 1CUHA 4ZQIA 1JH9A 4DXAA 5EJ5A 2JVKA 2O3RA 3GQBA 2QTVA 4FFOA 3O91A 4IGFA 2SHKA 5IUJC 4QUGA 3BA6A 1KDZA 3BM5A 3AR5A 2JRLA 1T43A 1DEXA 3DZCA 3OIUA 3KR0A 4GF5A 1YB5A 3QTLA 4L76A 4LZOA 2VLIA 5BMVF 4WCFB 1DFIA 3KLBA 5C37A 3QVTA 3Q5EA 3W2FA 3ES9A 1L1FA 4HAUA 2NU7A 1UDAA 3WNVA 2C58A 5JDIC 4Q9KA 5BR7A 2ADMA 3HYRA 1GAQA 2JIOA 2D00A 4ZCQA 4DXDA 2OL4A 1D2RA 3FNGA 3TRDA 4U7WA 1CLUA 4DPMA 5KOYA 2AVNA 1GN9A 3C7TA 4B34A 2FMFA 2ID4A 3NI2A 4KQHA 2O48X 3PRKE 3T15A 5EUMA 4BEJA 2IPXA 4BVAA 3NHLA 2A5FA 1G5QA 2R96A 2WWWA 1UBEA 3RWMB 4C0HA 5JWRA 2EARA 1CQJB 1M8FA 2AN4A 5AK4A 2NO7A 1L7OA 4NULA 5BWBA 2D5CA 3V7FA 4BMZA 2G8NA 1R8YA 4J4HA 4LYJA 4R54A 4E94A 1ZOPA 5L51A 2EX4A 4LOHA 4RVUA 2VH5R 5AKGA 4E11A 1QGOA 4JLUA 4PSAA 3SZOA 1SXHA 3QXHA 5I9BA 5IC6A 1DDGA 5DKFA 1EGAA 1L6RA 1LDGA 2B2CA 2FUKA 1UBSB 1B0PA 1HQCA 1R5JA 2FK7A 2FOIA 2P9HA 3B60A 1UBFA 1QYCA 1RAFA 5HRUA 2AA3A 3BERA 3RTBA 3OJXA 1E3WA 3KJNA 1FUIA 4JVOA 1TZKA 3EXAA 1D3AA 1CQWA 1T0BA 4LYGA 1RAGA 1VL6A 1JYFA 2BFBB 3KO8A 4OHCA 3RT1A 3S2IA 4IZHA 3AVVA 5B64A 3F47A 4K3VA 5LWHA 1BHJA 2D4AA 3NYWA 2ZI7A 2F3PA 2IZ5A 3A9TA 3USES 2WVHA 1QIFA 3M6AA 4RC9A 3BMQB 5DHAA 2FEKA 5CU7A 4DABA 2ZR7A 4Q4LA 4GYJA 3GMDA 3AL0C 3A6ZA 1IUNA 3H1AA 3OSUA 4TVKA 4CGYA 4Y2YA 4MUXA 2RHMA 4HGPA 3U37A 3WJ2A 1KAGA 2D2XA 3HY3A 2Q3JA 3JATB 2BSXA 4EG0A 4ZFNA 2CHEA 5TMPA 5HILA 4CL8A 1D9ZA 1VDMA 1E2EA 2ZPUA 4CVNA 1ZH4A 2I71A 3UJHA 3FX2A 3H13A 2OHOA 2HPHA 2NVBA 1X9HA 3QSYA 5A3RA 1VJ1A 3KYCA 3H19A 1N36B 3TYXA 3KVVA 3ZDAA 2IUFA 4P4GA 1QYXA 1HE1C 1VBMA 2A7QA 1O89A 2FPKA 3MZ0A 2WAAA 1GXSB 1SUIA 2QE7A 1DUVG 1XDGA 4J1SA 1BWSA 1B8UA 3C70A 1YZ3A 4J29A 5D6NA 2IPAB 4D57A 6PFKA 3LY5A 2P3OA 4QSMA 2A5JA 4RVOA 2YNMC 3W5CA 5CVVA 3GDWA 2XQIA 3DTVB 4GZMA 5CH8A 3E84A 5GAJA 3TIXB 4ODIA 4TT3A 4A16A 3FR8A 2PO5A 4J0GA 4C5CA 1RRMA 2AZXA 3KM0A 3D3KA 2UZ3A 3K8OE 2OECA 4K9QA 5HMMA 2C7BA 5LZ5A 4Z53A 2E37A 2OCPA 3WGLA 4R1PA 4ZREA 4F3CA 2VZEA 3VZQA 4ZZ2A 1A96A 4PCUA 3O0TA 4ZO9A 4MDEA 2OGTA 2QI9C 4Q4AA 2HWWA 4TXMA 5K6AC 3TFOA 1C7QA 2NYUA 3P8ZA 4JJAA 4MW7A 2CDAA 3LBYA 1C9YA 1Q74A 3EIXA 1IMJA 3FCEA 4Y30A 1L4MA 2GDJA 1TPYA 4GXTA 4CUKA 3V7WA 3RIMA 3LJKA 1IC6A 4M76B 1KQGA 2EJUA 1ZRMA 1I1QB 4AQ7A 2BZ1A 3SR0A 3NDPA 5L4NA 1GKLA 1EM6A 1HDEA 2QJRA 2ZJFA 3RS9A 1QP7A 1TJ4A 4RFLA 1ODLA 5E1DA 3OPYA 5ALEA 3U44B 3W1EA 1NMSA 1G4UR 5E95A 5AW0A 3OCXA 4HLUA 4TV9F 2ALJA 5F1YA 4OI0A 5CDYA 3DSRA 2H65A 2LRHA 1VG0B 3RYIB 3DQQA 1J07A 2IYXA 4RBNA 3DBLA 5TNXA 3ROEA 1XR3A 3U81A 4BJ6A 1Z0DA 4EB6B 5ADHA 5IM4A 3KSUA 4REMA 4Q1CA 5C7LO 4RKYA 3A28A 3I64A 4G3XA 1CY1A 1T2EA 4LZPA 4JLBA 2I1LA 4EM6A 5EIEA 2LIPA 3O03A 4ND6A 4MEBA 3W06A 4GM4A 4B09A 2I34A 4YRJA 3GGGA 3AFMA 1JWAB 1ZGGA 1VJCA 3C87A 3H9QA 3O8QB 4NEHB 4BDSA 4C7JA 3NTRA 1K8XB 4AZVA 3MAJA 4PG5A 1WNTA 2YTZA 4DLVA 2Q1WA 1HDCA 4GVXA 3TGPA 4U00A 1X3LA 2B1IA 3PRHA 4KIUA 3ZLVA 4G2NA 4ZJUA 4TTAA 5CIYA 3F96A 2CXOA 3RSQA 2AJ8A 2XNDA 3EIUA 3GARA 3P9NA 1KZGB 5C4MA 1KHHA 2HEIA 5DEIA 2ID7A 4CM8B 1MO4A 3WDMA 4QNMA 1W4ZA 3F6PA 4LGMA 1UJNA 1DCMA 1KAEA 2DFTA 4DR3B 3GP5A 3NWPA 5DTEA 5REQB 1E3LA 4B40A 4ZZ0A 1PL6A 4DNQA 2JEYA 3JQAA 4Z0TA 2PRYA 4QJBA 1VYHA 5DO9A 1QIGA 3A1FA 4CM9D 3JQGA 1BWPA 3N0RA 2FFJA 2BLNA 5K5EA 3ANXA 4BE7B 3FHCB 3IMEA 2O8VA 1E2FA 2MMCA 3VR3D 3D7RA 2PUWA 3DV0A 3FPLA 3HRKA 3KG2A 4KE7A 2IOFA 4Q03A 2I78A 1EI9A 1JBQA 1RP7A 3EQ9A 3DE1X 4NBLA 3AHCA 5FPKA 1ISHA 1MDFA 3S8MA 1W52X 2I6TA 4RK1A 5HKKA 1GZUA 2CLMB 2WE8A 2QN3A 1ODIA 3AUAA 4IS3A 4QQNA 5KTMA 1KU6A 1YUMA 3FMIA 1RWNA 3HVKA 3LDUA 3BXXA 1ZESA 4MVJD 4DIKA 3ZGXA 2B34A 2FQYA 5JMPA 3AUJB 3BK1A 3OFND 4H1TA 3LT2A 2CJWA 3DMYA 4KMOA 4WHMA 3FYDA 4NJMA 3MJVA 2K7FA 4Z54A 1YQXA 1ZM9A 1V6CA 3JRWA 4RA9B 1I2AA 5F2NA 3CO0S 1G59A 2W6CX 4WFQA 5A62A 4Q4CA 1W0JA 4M1TA 3TQHA 2ZS8A 1JZTA 1L4NA 3C3JA 1SB8A 3ZBPA 5LYJB 2AE2A 1NULA 3PEUA 3DFKA 3TTXA 2IOFK 4FE3A 5BR4A 5FTLA 2HU7A 1L4BA 3BBLA 3ZIUA 4JJ4A 3ZWDA 3HO1A 4F71A 4L95C 3PX7A 1W2WB 5EQFA 1B8PA 5JU6A 1WUHS 3ND6A 2KMLA 4EZIA 3LQ1A 3JPWA 4KEAA 1P17A 1S7CA 1VZ2A 2HI0A 3CF6R 2P30A 3D0OA 4G67A 1C41A 4RPGA 1EGMB 4W7SA 1ZUHA 5TC4A 4U2KA 3DULA 1UXGA 4MVJG 4EVQA 5MN4A 1HYEA 5K8CA 1EA5A 4W5QA 1W1WA 3LOUA 4OQFA 5LJIA 4HSGA 4IMRA 1NFQA 2YJNA 4GQAA 3ZDRA 1RADA 3KKLA 3WGYA 2A30A 3WK5A 4EX7A 3OJEA 1E8MA 5CLIA 1UBNA 5LN1A 4EVSA 2XMSA 4C0QC 3J80A 2QVBA 1Y8QA 1J8DA 1ISPA 4V0MA 4MQ5A 2G1PA 1UZUA 2M6KA 5EHIA 3B9QA 4WSOA 3RHFA 4A23A 4EPWA 3PQ3A 2CWDA 1TX4B 1GA1A 2O1WA 4C7VA 2I6GA 4AICA 4A5SA 3ZUPA 2J8ZA 4E03A 1I5EA 1M0SA 2IUYA 3B1ZA 3DR3A 4LTMA 5AXCA 4DUZB 2UXBB 3PA6A 1KJ8A 1Y8AA 5H9WA 4NZYA 3QVGB 4E2FA 4IGAA 5KX5F 3L4JA 4DEXA 2OORA 2UYYA 2EIXA 4QOSA 1UQUA 3DE5X 1LWOA 1UBGA 3OQJA 4XOUA 4JB8A 3N3AC 5E6SA 4W1QA 3LUPA 4H7FA 3K53A 3ILXA 1Z7EA 1TEVA 4MYDA 3BE6A 4H0CA 4FDVA 1L5KA 1PR2A 1J90A 5GPBA 5IABA 1XQ6A 3U7IA 5K6RA 2CHGA 4WWHA 4W5TA 2RHDA 2BM1A 3GROA 2N75A 1RVV1 1K7CA 4D74A 5E6RA 4I2NA 2YW9A 3TDMA 3UK2A 1RFGE 3QLVC 5DOZA 1NGSA 2B1QA 3O90A 3WKBA 3NM4A 1NYQA 5IM5A 1C81A 1TW2A 2C29D 2Q8QA 1SUPA 2VAVA 2YWEA 3RODA 2WEKA 3UW3A 4DR5B 4ARCA 1VLHA 1KA9H 3VC7A 1K92A 3CZMA 4HDMB 2DPMA 4QTYA 1MAWA 3QJGA 1NQTA 1SVWA 4KPUA 1SY7A 1H9BA 5E2BA 3TDNA 1DAKA 1OH7A 4MR8B 1UKCA 3GMSA 5I8WA 1FYXA 3JASA 4MGYR 1JDUA 1FTNA 1VRWA 5AHWA 3K8YA 3B82A 3BHJA 1DIHA 1E99A 3ISVA 3LIIA 1U2TA 3M9XA 5ALSA 1QIMA 4WBNB 1TM7E 1XNQB 1I10A 1EM8B 3HU3A 4XYEA 1E8DA 5AJHA 1O5TA 2Q5LA 4HEHA 4OQZA 5I7HA 4RULA 3GGOA 2IS2A 5DCYA 2FWAA 4ILKA 1JF8A 3FMVA 4PIPA 1ZGHA 5DCLA 4K03A 3SS9X 1JLMA 1KC1A 1G6HA 4XVQA 4EPVA 1SGWA 1VIDA 2ZI5A 2F3RA 5LXTA 3RANA 4XUEA 1P1RA 3SSAA 1TXGA 3LT1A 5CHYA 2G25A 2Y99A 3OMWA 4LDNA 1EMDA 1JI3A 5F77A 3QUAA 5KPJA 3INNA 4ZHQA 2F3SA 1J70A 1FFXB 4JP3A 2IUUA 1E6UA 3UB3A 4US2R 4BC0A 4MTCA 1QHXA 3D1VA 3W8DA 3AF1A 2MMGA 3G8DA 1RYMA 5B37A 3HVHA 2ZETA 1QIDA 3OICA 4OL9A 3GBVA 1Z0AA 3U4MA 1KNXA 4O2AF 2JLRA 3MNFA 2RJ3A 2DLDA 2X0KA 3P45A 2P69A 4XB6B 4A8HA 1QVAA 4DUPA 4F4DA 3H18A 2LTAA 5CG2A 1RWXA 3GGPA 4HLNA 1SZDA 3MRXA 1RYYA 3BGSA 3QWIA 4DLXA 3HEAA 2LCIA 1CR2A 3UAOA 5HFJA 2RC5A 1GAJA 4NFHA 2X23A 4YO8A 3FSJX 3RSCA 1NQAO 3SBOA 1S3IA 3IPCA 3WA6A 2P35A 1M54A 2CNNA 1AQNA 1JDJA 3NT2A 2W6MA 1FFAA 1VA4A 2JIZD 3HJCA 4LJYA 2R1TB 1ENYA 3G3EA 3G8CA 4TWBA 1U8TA 4HN9A 1A3CA 5KU1A 5HYVA 3T3GA 3HCRA 1F0YA 4EPRA 2PDAA 3PDWA 4GMFA 1OYVA 4PZAA 4RK5A 3ABOB 4C7OB 1JR3E 4MGIR 2BEJA 4NENA 4BO8A 1X87A 5E3HA 1O03A 2YINC 3SN6A 3QYJA 2VUTA 3F3MA 5FTJA 4Q4HB 2YY5A 1TYZA 3HGTA 4QXAA 4J3FA 1NYTA 1GXSA 2H2DA 4FYKA 4UUPA 1I24A 3HB1A 1Z2OX 5ALRA 2R4TA 4Q39A 1XNHA 4U39A 4B48A 1GTMA 1R9JA 1S4MA 2QGZA 1GYRA 5CCDA 2YYSA 1WB9A 1JAYA 1SHKA 1H2ZA 3PCTA 2QTMA 4ADSG 3DWIA 1FTGA 4AKSA 1GQFA 2YOFA 2HW8A 2HNBA 4IHJB 4QYMA 4S1VA 1NQ5A 1YCDA 1FTSA 1NUTA 5AOVA 1EPUA 1X1RA 2PKCA 5G3ZA 3TX6A 2WJWA 4ESOA 2UXCB 2G1UA 2MSDB 2RGRA 4H31A 1P1CA 4XGKA 3R1IA 4D4HA 4G0QA 4TSFD 4WUVA 3FPJA 3PPVA 3MINB 1HA3A 2DT8A 4LBZA 3JQ9C 4MYCA 5HS4A 4BN4A 5JBQA 2I6QA 2C8LA 4RSMA 3CMCO 3KHTA 4WK6A 1RP1A 1VKRA 3D4LA 4K9RA 1A8PA 2JCSA 1YA6A 1TK3A 3ZD9A 3NPMA 1TYDE 3ZVLA 1K2VN 1G9XA 2BFBA 2I4NA 4MZXA 3T4UA 1YJ8A 1XZPA 2CD9A 1OMOA 1YA4A 4FPXA 1F20A 3F5DA 1G8JA 2HMYB 4WKNA 3F6CA 5JFGA 3L7DA 4N5NA 3RVJA 3UCXA 5IM4F 4XKJA 4DTCA 3HACA 4TLAA 2JBAA 2RHWA 3LPNA 1WW3A 1EP3B 3PEFA 4DIOA 1WU8A 1KXZA 4A8TA 1MQ8B 3UOGA 4JYAB 2CMGA 4KRXA 3VKHA 1ESDA 1KO4A 5ALNA 2VYVA 3EH1A 2GF9A 4LCEA 3KU1A 4DLBA 1QR2A 3HL4A 3BJRA 5K1ZA 3FNIA 4H7KA 1YE8A 1GM5A 5EXPA 1VL0A 4BNHA 2XF8A 2Q5EA 4OKIA 2OK7A 4MDYA 5JARA 4HFNA 1I33A 4KZPA 1MAHA 4PLHA 4ZJYA 2NX2A 5EG5A 4B8WA 2XE6A 4BFLA 1AK9A 4HQNA 3W5JA 2V4ZA 3KETA 1T2UA 2V74B 2IV7A 1EWTA 3KD3A 2OYRA 1TU0A 2EKZA 4IUDS 3S7TA 4CM4B 4CEJA 1F2DA 5C1PA 4J0DA 4V24A 4PGFA 2FMUA 4WZBA 2JC3A 1QCYA 1TYEB 5CG1A 4ROSA 2WIGA 5F5LA 4AX4A 2ZB4A 3BD6A 1XV5A 2YV2A 3EOAI 5HGXA 3JQEA 2B3TA 3FKSA 4XB1A 1Z36A 4JBXA 4B2PA 3TJZA 2QJOA 3DKIA 1MU0A 2QNBA 4YQYA 3P4XA 3TBFA 3U7JA 4JXZA 2LKDA 1G55A 1CUGA 4KCGA 1JLRA 1U9YA 3U3RA 4L5AA 1JN0A 5AKEA 1F1BA 3VQTA 1KKMA 3ERCA 2P27A 4R0MA 4AURA 3PHLA 1KIMA 3TZ6A 3GRUA 1QIJA 3RUDA 4TVSA 2L69A 1VKOA 3FOCA 3K8QA 1ZJ6A 1N9GA 2XSZA 1UKAA 3CFYA 4DLTA 5JXWA 3N2KA 4KHPB 3OM8A 3PA8A 5EXEA 1NNLA 3MT7A 4HZGA 4CDRA 4NU0A 2WF6A 3FWPA 1A5SB 1CE8B 1U2RA 4MW5A 4I5DA 5DYYA 4Q1FA 3SHVA 4CKBB 4RTMA 2FCRA 4UULA 1MTOA 5KYYA 1NHWA 2IOHA 3OM0A 4FFRA 4RHTA 5C7YA 3GMIA 1M2OB 2AFHE 2FRDC 2OSVA 3OLWA 1X1CA 3PC8A 3VR2D 4BX3A 1XTSA 1Y3HA 2GNPA 4CLDA 3QMVA 1WXFA 1J2JA 2G4CA 4X1IB 4AIIA 4D9FA 3EHDA 4HRVA 2AUMA 1UXJA 1F8GA 3U4DA 2QP4A 3ASUA 5FWXB 1XC7A 3TTTA 3KP1A 3IE1A 4JCOA 5BN3A 5SY9A 1FBTA 1FZQA 5EGSA 4RCZA 3ER8A 1FUEA 3LGSA 4PYIA 1IBCA 1PR0A 2EJVA 2FE4A 3R5FA 4P34A 5CPFA 2AX4A 2P5UA 1JJ7A 1GKKA 3SLRA 3V7UA 2FWRA 2CCGA 3I04M 1CG6A 3ROXA 2VSFA 3URMA 4U7GA 3AEXA 4MGKR 3WLPA 1P61B 4HXGA 3A6GA 3OZVA 4TWIA 5BR8B 4X0EA 4JVMA 4P31A 1TD1A 3BCSA 1JH8A 4GMHA 3M49A 3OPXA 4EPXA 3O9MA 2W0SA 4CKCB 4PRZA 4MP6A 2O4CA 3I5AA 4ZJPA 4GLFA 3COVA 3CLUC 3HP1A 4URZR 2AGVA 2VBFA 3E35A 3IXMA 3TIGA 4ZT5A 3T1YB 4WNAB 5GIPE 1FNSA 3RT9A 1DOHA 5LP6F 3GLHA 5AW4A 4E08A 1PZFA 1Y4ZA 1LQTA 2AI1A 2HPAA 3CG4A 1UDWA 3NIBA 4HDMA 4R83A 2J46A 2A0WA 3ZY5A 5IZCC 5KNBD 2ZWVA 1PIWA 1LA2A 2BP7A 2ZBUA 3F98A 1JHXA 4FYWA 3HXPA 5CA0A 2IRWA 2D2FA 1HKUA 2J67A 2VT3A 4KR9A 2GZHA 1NA5A 1XZQA 4IJKA 2YXBA 3RS7A 4KFUA 1ONBA 2QXTA 3WP1B 3OZ7A 2JK1A 3GT4A 3KXDA 3QX8A 3LBHA 4V0RA 2PS9A 4Y9DA 4EL0A 5CDUA 3IQWA 1ORDA 4RTQA 4F2PA 2I62A 3PZBA 4IBOA 5KDOA 3CUEF 3ZNPA 2LNDA 1YS9A 4W7HA 3KVOA 4Q4DA 3UAZA 5HKAA 3ZW8A 4OGLA 2GFHA 4NCBA 3ZE0B 2DGDA 2ZE6A 3FF4A 1E7MA 1V43A 2Q9UA 3FBTA 3SIPA 3TLGB 2OCXA 5T6MA 2VHWA 3L8CA 3MCWA 1PWEA 1XA4A 3WB2A 4EO9A 1SBTA 1SCKA 2HRCA 1AGXA 3DKKA 4OQLA 5BMVB 1O6FA 3P7MA 5ERYA 4OLAA 1VSTA 2CMHA 3R9XA 2XXBA 3NTOA 4FGSA 4EG7A 1JLLB 2CKDA 4BLTA 1Y8QB 3G13A 3PQ7A 1P4AA 1PQWA 3BRCA 4XX0A 4IF4A 3WRVA 5DBFA 2IBTA 1UBOS 4ZIRB 4TXJA 1ISMA 2VOEA 1Z6ZA 4N8DA 1XLTC 2IPLA 2QMOA 1CNFA 2RGCA 3E23A 5F1KA 2E49A 5K0ZA 4GC9A 4Z1OA 1ND5A 3AOGA 4WQMA 5JHHB 3T5MA 3SSNA 1ETUA 1BEZA 2QE6A 2X8JB 4RW0A 4XASA 1ZW6A 2VZ8A 2PRKA 4NFLA 2CVPA 2R44A 4CF4A 1V4VA 3DHEA 3L0PA 1E1RA 2J0VA 2YHAA 3CX7A 5A6VA 2WNHA 3H1BA 3V4PB 4EKIA 4U7HA 3AR4A 5DGDA 5HE9A 3FPBA 4YWHA 2ZAYA 2XUIA 3O8DA 3USZA 3UWKA 4MB6A 4IOKA 3C3PA 1W36D 2ZM6B 3AKEA 2L82A 4RY0A 1CDZA 2H2AA 3LU1A 3ECAA 4NYMQ 4XSHA 2PV0A 1OGJA 1IOLA 4MRSA 4YMWA 3BH7A 2P6PA 3UKOA 3MD9A 4A82A 3SF8B 7ABPA 1VHJA 1MQSA 4DLRA 7MHTA 13PKA 4I55F 4CIXA 4FZVA 3QMPA 2PX8A 1X7XB 4II7A 3HB7A 5T67A 2WJ6A 1TZ2A 4G23A 4B80A 4F8JA 2YDYA 1EH5A 1GQQA 1L7AA 3IV7A 4UMVA 3VX3A 3UMJA 3RTDA 5H80A 1P19A 4KXMA 1TA9A 4ND2A 4OO3A 1U2DC 3NOQA 3UW1A 1NVBA 4YY3B 1W5AA 1XD8A 3NAMA 2G0NA 4RCYA 5EL0A 3W3AH 3TW4A 1V7ZA 3BTOA 2GZDA 2R8ZA 4LDRA 4RWZA 4Z8XA 2N0SA 1ABEA 2BR4A 1VHDA 4A4DA 1ST2A 4GDMA 1ZIDA 3EZ7A 2CZCA 3PT9A 3S8EA 1BJTA 2QD5A 3LK7A 4OQ4A 1Z0KA 5AQ1A 3N2KB 1PFQA 2PL9A 4W1SA 1JUDA 1EFUA 1HV8A 3MOSA 3OAAD 4I5GA 2BH2A 4TUYA 4NESA 1QPBA 3LW8A 4MZDA 4M46A 3Q7SA 1RXIA 2PKXA 4FOLA 1N8SA 1ZLXA 3RC2A 5KAPA 4DA7A 3F6BX 3RIHA 4CHTA 3AY7A 3D0RA 1OA0A 2FSVA 3O3CA 4KYUA 4NL4H 4AUNA 1O97C 1CEEA 1F8UA 2K5UA 1CR4A 1FNNA 4MRAA 1GSOA 3ADCA 3HBLA 5ITVA 3G8AA 4N7JA 4N76A 3UGTA 5AM1A 3G2PA 5B2FA 3LD9A 2HFKA 1JILA 4PVCA 4PZYA 4A7PA 2OUKA 4DPLA 4BRWA 1YONA 2IL1A 1WY7A 3QPDA 1B93A 1U5AA 4L07A 4MW6A 4ND3A 4AZWA 3GG9A 3MPUA 3PUKA 3DL4A 1W5BA 1H2FA 3UK7A 5K03A 1SQFA 4IIHA 1NTRA 1AM4D 4O02B 3D2BA 3KJEA 4JJ8A 2Q1YA 2QJTA 4WZBB 3AWIA 4Q3AA 3U4QB 1CKEA 5TX7A 3IIIA 1S01A 2OCLA 2RHBA 4IDGA 1ECBA 1LLQA 1M1YA 3EVCA 2LIVA 3KQNA 2EBWA 1I4DD 2OP1A 5FOWA 1DX9A 1JDSA 1K7EB 1NI4A 1ZJWA 3DQPA 1KR5A 2G9VA 5FULA 3EBOA 4LJRA 4FUTA 4QOHA 1JDPA 1N6IA 4UTRA 1IULA 2GEFA 4EHNA 1RXUA 1ZH6A 5LP1A 1TMGE 3AG6A 2Q5QA 4XARA 3AHEA 5FEUA 1IXYA 3NNDA 2IS6A 1GZ6A 4H7PA 3B7PA 2IU3A 1E7WA 2E18A 3H6GA 3JQBC 2I2WA 4UU7A 1B0ZA 2YZNA 2IC5A 4UM9B 1JFRA 1L8XA 2OV4A 1ESCA 4LIPD 1HDYA 1XLWA 1YKGA 4PLPA 3IT2A 4L0QA 2FF5A 1SIWA 1GEGA 2O14A 1P81A 4HDRB 2C5GA 5E2AA 2ZVDA 1X7WB 3FA2A 4L4XA 5HDQA 5L3ZA 3EJ6A 3GJ3A 1NUUA 3OETA 4H0FA 3RUFA 3DE4X 5JMTA 1KH1A 1P1FA 1W96A 2DHRA 5KCMA 4MO9A 4UHJA 3O31A 2GPJA 2QTWB 1LUAA 4OU5A 3LLUA 4X54A 4BMCA 1SVLA 3EEFA 4GH5A 3I04A 3NZEA 1CUEA 3VVCA 3H75A 3I6ZA 1X15A 4E4YA 1JI0A 1II0A 4R69A 1LX6A 3ECSA 2ECOA 4RU1A 5A4FS 5A03A 5KTSA 4DDMA 2VUIB 2W2KB 4FGWA 1OILA 521PA 4ABYA 2XZLA 1ULUA 1RJ9B 4HGYA 2OY0A 4B4VA 1KOLA 3AHDA 3HVIA 5KOJA 2QAGA 4PQRA 4RLFA 3VTAA 1OTYA 1NP6A 2O2YA 3HQ4O 1OZGA 1N5IA 4FMPA 2O54A 1MF7A 1ZM4A 4W4TA 1N2HA 3NBYC 2YHSA 2HU8A 3IOBA 3OFSA 3PX3A 1ID8A 3THWA 3MTGA 10MHA 5LA6B 3WRWA 5A9SB 4NCJA 1IVNA 3T3EA 1JG2A 2V7VA 3OZTA 4PE5B 3DE0X 1DRWA 2GEBA 4HVAA 2OA0A 4F06A 1R88A 2YHUA 3Q9UA 3B1XA 1U0BB 4TGLA 1FS4A 2O9JA 3CF4G 5LDGA 2WFMA 3W8NA 3AG5A 1Y4SA 3AHIA 3E3OA 4YAJA 2HCJB 2HLDA 1OB2A 3GN2A 1X42A 1QCZA 3F97A 5GONF 3HYNA 1Z3IX 5KX5A 1FRFS 4BNZA 4FLFA 3SVLA 4YXFA 1W87A 3QKUA 2G7MC 1WOYA 1NMZA 4IIYA 5HTKA 5FH9A 2XGMA 3AU9A 3JAKB 3EYWA 5JQGB 2G80A 2F1JA 2PTGA 3RUPA 4H16A 1AE1A 1HE2A 2ZIAA 2ETXA 3HRHA 5E4YA 1PZMA 2YMQA 4EGFA 2GN9A 4GOOD 2JFNA 4TS9A 1SUSA 1MX3A 4A0HA 3GAAA 1ZLYA 2FUEA 3AQIA 2XQJA 3M5CA 3T95A 1GTSA 4PZUA 4X85A 3M6UA 1SJ9A 3JR7A 3IPLA 4H1UA 4B46A 2C1XA 4EKDA 1PHRA 1IZ9A 3DKVA 4NCHA 3R9IA 1OREA 3BFVA 3FYCA 1I2BA 4PN7A 4M1MA 2HCTA 1Y3BE 1U2PA 1ZSVA 1ZAYA 4IICA 1OASA 1RLMA 2DUJA 4YUXA 1G17A 1K4YA 1CY0A 1P45A 2NG1A 3R2JA 4GVLA 4I08A 4LN1A 3QLUA 4PICA 4RZXA 3VU9B 1TKRA 2R66A 4DCJA 2ASEA 5JV5A 5DXJA 2QM0A 2IKQA 5D8DA 2BKAA 1QE5A 1YI8A 4IHKA 3QFCA 3OZSA 9LDTA 1SELA 1M2JA 2QQGA 4CLHA 2VO1A 2B1GA 3OJCA 4I1OA 2Y6UA 4PF1A 3QOWA 1DAMA 4X60A 4XI9A 3V33A 1RYEA 4JR0A 4M1EA 4DRZA 2AOTB 1A7UA 4TYMA 1XMJA 1JFLA 4NPCA 3AF3A 4WE3A 2I65A 1U80A 4PTZA 5BW6B 5TXGA 3V4ZA 5BN1A 1JR6A 1O87A 2VTKA 1GFIA 2GM9A 1ACMA 2QS9A 1D2CA 1UDBA 2WIAA 1MH9A 2CJFA 2COUA 4II2A 5B6JA 1ZWLA 1OJLA 1SIUA 4HATA 4GKJB 1RU3A 3LKVA 3AF0A 4A0GA 4BNVA 2ZYHA 2ZVQX 2QI9F 3EDRA 1W59A 3IDQA 1X6VA 3U17A 1GRQA 5DWQA 3VJRA 1BMDA 4WCFA 2UDPA 4AS1A 3G0BA 3G85A 3UTCA 4EKYA 4BN0A 1NVKA 3ZS8A 3W1VA 1WOMA 4ZU3A 1QK4A 1CVLA 4R9SA 3UYKA 2XMBA 2R6R1 4MWBA 1LDNA 4L5JA 3KOOA 5CXUA 1B0AA 1O54A 2QRNA 1FVFA 4L9RA 4PRLA 4Y6RA 1ZXLA 2E9SA 3GOHA 4MKIA 4MNTA 1DC7A 1DKNA 2IHTA 2AR9A 2YHBA 3NMUF 1QGDA 4B33A 4IGKA 3J81A 5HHTA 2E2WA 2PZFA 3SXJA 1AUQA 1N5DA 1SBYA 1U8EA 2B35A 3M4YA 4Q24A 5EJMA 2QP3A 3T9FA 4BQOA 5IZCA 3RADC 4ARSA 3AW9A 1DIBA 2O3JA 3EG9B 4OMDA 3SX2A 4FLMA 4BX0A 2WV7A 1OI7A 3SD7A 5K8IA 1FOEB 4RHEA 4RE5A 1WUTA 4KQ1A 4I4NA 2VNIA 5KSOA 3VTZA 1E9EA 2WT4A 4KSYA 1T8SA 3EFOA 3B89A 2C2BA 1CHDA 4OB8A 2XMRA 4V0ME 1UMKA 2I7XA 3LXXA 1GADO 4EW2A 2PM8A 4UU1A 1W0CA 3FNBA 4FFLA 4LC9A 1OZHA 1WMDA 2V03A 1A9YA 1TL7C 3PD7A 2R7MA 4E5UA 5C8ZA 5J4YA 2GJSA 4D8YA 4JL8A 2PANA 5ALLA 1GU0A 3FNFA 1WD7A 2WG2A 3PGA1 1C4XA 2O7RA 1LPPA 3TLYA 4JR2A 4ZAGA 1LTKA 4B2LA 1ZH2A 2GD2A 2X76A 3BWVA 3RC9A 2P6UA 4FQ5A 1XTIA 2GSWA 1YTUA 2WJ4A 2VI5A 3UICA 2Z30A 2VYNA 4HKTA 3RLIA 4EG4A 4UE6A 5KNCA 3DL7A 2C92A 3FCYA 4MQFA 4CW7A 4FCTA 4U9HS 1S02A 1D6NA 1JEYA 3ZEAA 3VA7A 3CS3A 1XTJA 1UBTS 3NALA 1MLDA 1CD5A 3PICA 4HB0A 4OHWA 5AW3A 1MJHA 2WIJA 4K6CA 2XAAA 4Y2XA 3VU0A 2YS6A 2QIPA 1QRTA 1N7JA 2Q21A 1MIOB 2R8YA 3HXKA 3AF4A 4F0JA 4F4IA 1VMKA 2H5IA 1BU5A 1JEYB 3WBFA 1YS1X 1U0OC 1BXZA 3H5OA 3U6BA 2XE4A 1G60A 2HZ7A 5CAEB 4Y6GB 3LDAA 2ISQA 3LDGA 1MX9A 3EF3A 2VT2A 1PTJA 3SYTA 3JVIA 5LLTA 5IN5A 3PPWA 3PD1A 4D4LA 5JZMA 4KXVA 1XJCA 4IFIA 4P9NA 4GMXA 5JSYA 2EFEB 4WJKB 3B2NA 2O06A 2VYQA 2QAIA 3BXEA 2QSZA 1R8SA 1IHUA 2D7JA 2EATA 1X1QA 3HCCA 4HEA6 3V6LA 4NH0A 4BO9A 4U7PB 4BJ1A 4FOPA 2GHIA 3H0KA 3DT9A 3L4EA 3L7BA 2NV0A 2OHVA 1F9AA 2B8EA 2FY8A 2HJVA 2BZGA 3A6FA 4A6DA 1EFAA 2HH9A 2ZJ7A 3IAFA 4Z4GA 3AEUB 3N1UA 2DHQA 4J16C 1EB8A 1E9VA 1NWHA 1Z37A 2XDAA 3A9SA 4O3FA 4R1MA 1ENOA 4GP6A 4OBBA 4YYZA 1EDOA 4URFA 3TVDA 3QF7A 1PEYA 1UZAA 2XBMA 4DXHA 1ES9A 1TUBB 5ECYA 1G7SA 1HLPA 2LPMA 4FEEA 5CVUA 2V58A 3D1JA 3AHGA 1ZWKA 1XMXA 4LMRA 4UFNA 1GKIA 4IAOA 1BXGB 1JSCA 1L8AA 1Y82A 1TMOA 2PIDA 3JQDA 4JH0A 4TV8A 1FYWA 3ZY3A 3MS2A 4F7DA 3WKAA 4CIWA 3TG2A 3ZLUA 3MEQA 2C2GA 5CDSA 5I01A 3OZWA 3WADA 4WTOA 4BYMA 4C0AC 4MR9A 2E4ZA 4IHJF 4R6WA 3GUZA 3ROZA 2NZ8A 3DM9B 5LOVA 5IDXA 1NI5A 4MULA 4R40A 1TMYA 2NT3A 2ZYRA 3I1FA 1T3GA 2AEEA 4JVSB 2IH5A 4OHVA 5HM8A 2A3RA 2AJDA 1KI6A 2PWBA 1YU9A 1HK7A 2FPLA 3CV3A 2PR2A 2TMGA 1WAMA 3IJPA 5TB5A 4AMGA 4IZ6A 2Y0CA 1BS2A 2OFOA 4PCAA 1GNTA 2GN8A 4DDUA 5GWXA 3MWEA 5EUBA 4I1IA 1DEKA 1NOJA 1ZSNA 1UJ2A 2MT9A 2WSSA 4TKVB 4TZ0A 3PXCX 3QPWA 4QDXA 3NP9A 4U2GA 4C2BA 4DR7B 3KSZO 1TT5A 3UC5A 3BZUA 1BCRA 3NEAA 4JEIA 4XQGA 3G8YA 5K0SA 3KZKA 3ZWMA 5BUQA 5B4VA 1Y7HA 1QRUA 3KZ1E 1N6HA 3OD5A 5I51A 3B20A 1TZBA 1QWOA 1TU4A 1Z5NA 2OBLA 2XOKA 3DVAA 3QXSA 4K28A 5B1DA 2BZ0A 2CUKA 2NU9B 3GLGE 2M2IA 3CEAA 2SECE 5CDHA 3U44A 1BFKA 1VJ0A 2QSYA 1T25A 4HTFB 1L5GB 3VU9A 3DOUA 4FE7A 4MWTA 4LUCA 3KCNA 3LCVB 4RJJA 4BB9A 2GH1A 3EGXB 1I30A 4DA4A 3RKSA 4CMEA 1XL0A 4MCAA 2QD4A 5SZJA 4AT1A 1M73E 4X6LA 4D6YA 1XFAA 4QKQA 2JFQA 1IAQA 1TLFA 2G5TA 3R3JA 4GE3A 2N47A 1Z34A 4ACBA 3ZWAA 5D6OA 3VR0A 3V3KA 3ABQB 3I0MA 5H5JA 1AHPA 4N49A 2WZBA 1P1BA 1Z29A 4KGDA 3NB0A 1Z63A 1A9XB 3DDUA 3OY2A 3PIRA 1QF9A 2ZTMA 2R6CA 3EPRA 4UREA 4CF3A 1J1IA 1IM5A 3ZCXA 3LG2A 1KYTA 5EKTA 1YWGO 4Q1DA 3NTVA 3FOZA 3RK4A 4GZ3A 3QVKA 4HVLA 3H2KA 5TQJA 1DKMA 5GV8A 3AY3A 3F5SA 3ZTYA 4OHUA 3TQFA 2PH7A 4L5YA 4MUKA 5KDLA 1G6KA 3IFSA 3WYFA 1WW2A 3NJ8A 2P6RA 2EHDA 2IYQA 3DM5A 3LUAA 2IIVA 5JVDA 5I9MA 1N5JA 3R5SA 3NIFB 4YUVA 4C7XA 1WXDA 2D3WA 3EXIB 1G5PA 3B9BA 3H04A 1C0EA 5TQ0B 3UK0A 3CM0A 3IAAA 3TD2A 5K0CA 2WHPB 3WAJA 1T9KA 3KPWA 1WSDA 4Q0MA 3FIJA 1LSJA 2B4TO 4XD7A 3BKWA 3EQ6A 4UEQA 4DS3A 1E2MA 2QOEA 3R6TA 2VUHB 3I8OA 3V5NA 4EBFA 2HFJA 2GRAA 2HK6A 4GE0A 1JU9A 4GPTA 2XQVA 5L7TA 2AVDA 2DFLA 5AESA 2BV3A 1ZKDA 3HFRA 2V3WA 3JATA 4R7GA 2FW9A 5FO0A 4DG5A 4TLMB 1Z6PA 4MVWA 2BT4A 2KBEA 1C7RA 3QI2A 4ZO8A 3SNHA 2YCBA 3WSVA 4U5XA 2H0RA 1JEQA 4P4UA 5HIMA 4G5YA 3C5HA 1OYOA 2BFWA 2PXXA 4K1LA 4E2XA 1VHTA 1JFTA 1K88A 1XCMA 2FHPA 2FPGB 1XEXB 3F49S 4OMCA 5B7NA 3E9NA 4EEZA 1JHYA 2QGNA 2Y1FA 2Z43A 4OP3A 4WKPA 3CUYA 2IHNA 4A91A 1EU1A 1DJPA 3BS4A 5F3DA 2GTPA 4BFCA 2Z4SA 3UJ8A 4H1HA 3WWCA 4P3XA 1ANKA 4DBLE 3CF0A 3FFTA 4ZQCB 4DUYB 2X0DA 3PUWA 3RTEA 1ZH8A 4Q3DA 3LXUX 4YRGA 4RNCA 4FX5A 1Y42X 3LQQA 4FDLA 4FFNA 3B1JA 2AEMA 3A9RA 4ENWA 2GCPA 1P5JA 4CI9A 1E1RD 2UZ4A 1JJIA 5SZIA 1BMFA 2QTCA 3RCBA 2HM7A 5H59A 2PEZA 3ZGNA 2OXEA 2VDKB 3WA7A 2XE7A 3B1WA 3U09A 1Z17A 3VKGA 3H5WA 1O2DA 1SU8A 1VGRA 1WA5A 3HCOA 4M4SA 1ZR4A 4LRTB 2VNJA 1CQZA 2YIVX 2EG9A 4B71A 2CY0A 1U7TA 4IMPA 4CLXA 5F7XA 1CT9A 1A1VA 5KVCA 2VHCA 2W42A 5ER6A 4DV3B 3K96A 4DMUB 1QDEA 2WJAA 2ZYUX 3LUDA 4KKVA 5LIRA 4YP5A 3EGWA 4G86A 1T1IA 1VHWA 5DGCA 1M5TA 1QO9A 1SQ6A 4O5OA 2WWRA 4OXNA 3CISA 4DCMA 1AV6A 3PKIA 1U0TA 2XDWA 1QQ5A 2ZJBA 3GQBB 2Y2UA 3PQCA 3SG0A 4AUMA 2YXEA 1EJ0A 1CB0A 2B6NA 2BGRA 3FHOA 4IRMA 1V39A 3VV2A 5BN4A 2PGLA 1M34E 5JVDB 3VR5H 1XELA 4Q4HA 3DBHA 4LS3A 4K9PA 1M5RA 1UC5B 2ZPTX 1SU4A 1VKJA 3N8IA 2XIJA 4A1OA 4WJZA 2FK8A 2HWYA 5B4TA 1K0UA 2EZUA 2W48A 2QSUA 4TUYB 3SQLA 3L1IA 1HNXB 4JX9A 4H15A 3A6KA 3LXRA 4R8KA 2XR1A 4OJKA 2F8LA 3THSA 2WF7A 3M0EA 4P7KA 2R1TA 1Y9JA 2W2XA 4EYEA 1RLUA 4JR1A 3NBAA 3ON5A 1H66A 3DBRB 3DVRX 3FPHA 2BGNA 3TCXB 2Z2IA 4F5DA 1A5TA 1T9GR 1TM3E 2VK1A 1Z6GA 4K9OA 4KI7A 3HJBA 2OFFA 2JJQA 4UBJA 1O9HA 2DAPA 4S05A 3GXBA 4JQOA 1WDKA 3KHSA 4W5JA 5I7VA 3AUFA 3B6EA 4NZPA 4ALLA 4LV5B 1VRCA 2WT8A 3WGGA 4TZTA 1RZRD 2G0TA 1D7OA 2O7VA 3EGXA 1A88A 2QQ5A 3UA3A 2ZE7A 3ZDDA 3RKRA 3K1ZA 3PC7A 4XD2A 2NUAB 1KJZA 3ICPA 4I4TB 1UXHA 3KS9A 2XDYA 3GA7A 4G9EA 1H2WA 3EXHC 5JRJA 3JTMA 1ZNXA 2NUTB 3KUCA 3SICE 1GQOA 3ZK7A 3KEMA 4Z1MD 3KBBA 2H54A 2IXEA 1WXHA 4KWCA 2WIKA 1PRYA 3LYAA 4YAOA 5F51A 2Q3BA 2ZB3A 4FGJA 3OECA 4R4JA 3B6JA 3E8SA 1YHYA 1DHRA 2F3TA 1A7KA 1WU7A 3ZBTA 1PFUA 3HRIA 2X8JA 2DE0X 4DV2B 1EDZA 1K5GA 4EHLA 3F7TA 1LC0A 2YC4C 2HMWA 3E0XA 4ZYTA 1NDQA 3QSGA 5COBA 3IC5A 2GLXA 1EJ6A 1B73A 3KT0A 4H60A 2W4MA 2EFDB 3IXQA 1E3SA 2HHCA 3JVDA 1JB1A 3ABZA 3C3EA 5K2MA 2BBSA 1ZD5A 4O1MA 4RLSA 5JYDA 4AMVA 3RVDA 4U9UA 1J7KA 4PFKA 1PYDA 2FXIA 3V1MA 4FCCA 2R8PA 4XPIB 4ZAZA 1M8KA 3WFJA 1CW2B 4J75A 2HHHB 1U5BA 1JHOA 1M1NB 1DADA 1IVSA 4XM2A 4ZQEA 4X3OA 5DI3B 4DY6A 3UFXA 4FYMA 1VQ1A 3CEJA 3KEGA 4LC0A 4Y9TA 1QLJA 3OQBA 5BW4A 2XB4A 4EFDA 1T6NA 5IASA 1NZJA 1PNQA 3GLIA 4FFBA 3NHWA 1UMCA 3SHWA 4ZGWA 5KMGA 1U3DA 4UNRA 3RVMA 1D2AA 1TIBA 2HJGA 4TQ9A 4B4KA 4DBVO 1LBSA 4A6EA 3N0XA 4BJ3A 3TTSA 1TVMA 2QTBA 4FJ1A 2G28A 1OXKB 5AM5A 4RHFA 3ETJA 3LL4A 3PC3A 4IEEA 2Q45A 5LZ4A 4XX1A 1JQBA 4CIYA 2C2MA 1FSFA 2QDXA 3DJYA 4WLNA 5AJVB 4AJLA 2WTXA 1KTIA 3DZGA 2HJRA 2O8FB 3KQUA 3I9LA 5CA0B 1T5IA 3P9SA 4QDZA 4C04A 1P4JA 2ZUSA 1EXDA 2IYSA 3SJBA 2YWDA 4ITVA 7REQB 3EIOA 1FB5A 3QXXA 4X61A 1SQ5A 3I9NA 4LZNA 1EEHA 1MV5A 2WD9A 3BMNB 3DEHA 4GECA 4LVNA 4OQNA 5LMCA 4ALKA 1BIFA 1YR1A 3GIDA 5LP6A 2OV8A 3RAEC 2PMDA 1Z0UA 4ZAYA 4UE2A 2B5WA 1NVAA 2VRCA 3HB4X 5B3JA 1DRUA 1KZHA 1UR5A 4OKSA 4RY2A 5AR1A 3VPXA 2C5FA 1FX0A 1PFKA 1Z08A 2CNOA 2E4VA 2IF2A 4KLCA 4ZRNA 3TH5A 4EK9A 5GP1A 3I01A 2NIPA 3QLUC 1M2WA 5JDCA 5G02A 1GPLA 3B53X 4TL8A 2ZR9A 3PQ5A 1V5EA 3UJDA 2X1MA 1LZLA 1MA0A 3K6SA 3DMTC 1KS9A 1KH2A 2H92A 1X70A 2P5SA 4Y2QA 1DDIA 1VPDA 4KWHA 2ZYIA 3KC2A 5CPBA 4B4OA 5BQXA 3IBTA 1E58A 4R9NA 3CXRA 3H65A 1T36A 1E1LA 3KL4A 2FI1A 3ZZNA 2HQSA 1XQ9A 2X7XA 2H17A 4H4DA 4RO0A 2VRCD 3I92A 1LVHA 2Q0QA 2ZLBA 3QKWA 3A0UA 1YFJA 4LJKA 4UVEA 3R0JA 3RARA 2R47A 2WM2A 1GSIA 2CFIA 3RNLA 2N3ZA 3D7LA 1JIJA 2N1MA 4B0OA 1NL3A 1D0IA 3GG2A 1PNRA 4LF9B 4NJMB 5JCXA 1CUJA 1NXPA 1QRDA 5A5DA 2WAOA 1E60A 4TN1A 4XFJA 1XMPA 3W6OA 2QX9A 5CLJA 1P62B 3SYMA 3WQSB 3B2QA 1EXWA 3OHPA 2HRQA 4QFMA 5DCWA 3A06A 2BHNA 4GPBA 4K7JA 1R6XA 5E4TA 1I7NA 5E8JA 5BQFA 1GGMA 1DJNA 1XQXA 2EU8A 4W5OA 4IG9A 1H1TA 2XCIA 2VYFA 1HFEL 3LYUA 4KAJA 2BN4A 2ZP1A 3FVVA 4K9NA 4ZP1A 1KQNA 4RCVA 2FTKE 4WMLA 3V2IA 1CE8A 3UKDA 3E3MA 2YZ2A 4DE5A 3DV0B 4N8SA 2ZBRA 5DM70 4CMKA 3BTUA 5K0BA 2PMBA 2VP5A 3TTUA 1LX7A 3K9CA 3KQPA 1LRJA 1I7LA 2HKIA 1CR0A 1SVUA 4Q3KA 2CXXA 1RE1A 1Z2PX 1PR6A 1D2EA 4R71A 1LPSA 3BHMA 3KYJB 4QBGB 4Y2UA 3HEMA 2RKBA 1NX6A 7YASA 3U26A 4DJDC 5KB3A 2PJRA 3ZHSA 3ZKWB 2CZQA 5EINA 3CHYA 5K8UA 3ET5A 4ID3A 2VPXA 3VDRA 3NRBA 4KRGA 5TPWA 2J3QA 4XGNA 5JH7A 3B6KA 3O9VA 4HT3B 1CRPA 2QA5A 2PUAA 5AVRA 1YQWA 2NVWA 4GOLD 2AF3C 3EWSA 4P4LA 2HAEA 1RYNA 1IQUA 1J42A 1VL5A 2AXNA 4OV6B 4PAQA 1UT5A 5AK3A 5EN4A 2YJ5A 3A6PC 5DLQC 4RD0A 5EIHA 2J5BA 1GRNA 2AYYA 4GGPA 2I1VB 2B3DA 4MUAA 3HCFA 2QX6A 4RF4A 1W88B 2A5YB 2I6FA 3PPYA 2G77B 2X4GA 1VLMA 4JL5A 4P38A 1OXXK 1KY2A 1ZNYA 4XUGB 5DP1A 4EVIA 2NZ2A 4PNEA 2E21A 3TTVA 1YJBA 2GESA 1BCSA 1G21E 4IIBA 1L9KA 2PLFA 3ZWBA 1AN0A 1OI2A 4I5FA 4TKZA 4LF6B 3DT6A 3WLLA 3A36A 1LZKA 3FHJA 3C43A 5FUMA 2VZ0A 3S3TA 3ZHZA 4RPCA 4DT1B 4EHHA 5LNK6 3KYBA 1JAZA 1PS8A 4EB3A 1DEHA 4EHIA 5G1NA 5KYTA 3TG8A 2G6BA 3MGAA 4OHPA 3W6ZA 3WZ2A 2XTMA 1XD2A 1KMQA 2VF7A 4HN4B 4G1BA 1DUSA 1Q77A 2JIMA 2XUQA 4PSUA 2D1YA 1JFSA 2EOAA 3N8DA 5IJ9A 2H1HA 4FFPA 4ZAVA 4RMIA 3HZZA 3RVBA 1LLCA 1TCVA 2BY4A 4N48A 2AB0A 2I6UA 5JJCA 2Y77A 2ZWPA 5FJIA 3E9RA 1T5SA 4KH0A 1L7EA 3H16A 3IE2A 4JGIA 5AJTA 2C3YA 5EJ8A 4M6WB 1PF7E 2F1KA 5KO2A 3AR6A 4CMAA 1ECFA 1UC8A 3UF0A 1FU8A 1Z2DA 3AETA 3I6QA 4CQLA 1KFKB 3EIEA 3JCZA 4O4IB 3UQZA 2IITA 3AMVA 3D5TA 4GX2A 4MARA 4Q4AB 4KFCA 4CEHB 1P1IA 3IV6A 4LDJA 5ALVA 4BEVA 5AW7A 2C7RA 1EQUA 1QLWA 1EWQA 1ORRA 1XQWA 4RETA 1KYVA 3GW8A 2JD2A 4PSCA 3OIVA 4QJ4A 2VP9A 1B43A 1Y3DE 1YFZA 3LPMA 4UBNA 3QIAA 1NVXQ 5CNKA 1T3SA 3RG2A 2WSYB 5HZMA 3V1TC 1V41E 2VP6A 1Y1KE 4AG5A 4HK4A 4B3MB 2AQIA 2AQKA 3GV0A 4IDBA 1NJ1A 2L2QA 3OQ1A 4L4YA 5AJUA 5BYBA 4BUCA 3FFWA 4CMIB 1QWSA 2ZG6A 2Q1XA 3AX6A 2BGJA 4MCJA 5GJCA 5FBQB 1Z6TA 1W75A 4ATNA 2FMIA 4JSYA 4LSZA 4PLGA 5DNUA 5JYBA 2DETA 1TF2A 3IMKA 4QLOA 3JQ7A 3PC6A 2EKLA 2FPXA 3HDQA 3PQ2A 3AEQB 2Z2KA 3RS3A 5FTWA 5C9ZA 4YB8A 1ZM3A 3WBKA 4G5SA 5JE8A 3WB1A 4UDXX 3OG9A 3MT9A 1OC4A 5LQUA 2ID8A 1V1RB 1C8VB 2B25A 3B3QA 4EUHA 3R9WA 1RCFA 5EFOA 4OHFA 3A25A 4RIIA 4I3FA 3L0SA 4L2IB 3OF5A 4GBGA 3RFXA 5CVTA 4MGZR 4YR9A 3KJHA 5HCIA 2VHUA 1RLTA 1ZHHA 1H93A 2V0NA 1NT2A 2CE2X 5B7QA 1I32A 3KOZA 3A26A 1P29A 1UBJS 2K2QB 3GRPA 2FPUA 1TPZA 2IT1A 3AB7A 1NURA 4KYVA 3DFMA 5ENDA 2J48A 1ZGJA 4KJZA 2FUG6 2GZ2A 1XEWX 3A4MA 3HBFA 1G0NA