3PTNA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptnA02
1F92A 3VB3A 2Q6GA 3M5LA 2VH6A 2VIPA 1WBGB 1PPEE 1A61H 2YOLA 4O97A 1W7XH 2OC8A 3PTNA 4LZ1H 1ZHRA 1O2ZA 1YPMH 2CF8H 1GBEA 3TVJB 1WV7H 2P93A 1DXWA 3M3TA 3TH2H 2ZFTA 3TPIZ 5F6MA 3M37A 3ESTA 3BTFE 3LGUA 1UTNA 3NK8A 1S81A 1OOKB 2PHBA 3MMGA 1DY8A 1O3CA 3E90B 3OX7U 3LC3A 2ZZUH 1KXDA 2Y5FA 2Q1JA 4UFDH 2SGQE 3P6ZB 3U1JB 1TNHA 2H9TH 3M7TA 3MU0A 3ZZ3A 4XFQA 1OS8A 2WPMS 2ZWLH 7KMEH 4Y10E 1Z71A 1BTZA 1HB0B 4X2YA 2FPZA 2VGCB 2IOTA 1JIMA 2R3UA 1UCYE 4CBNA 1O2HA 3UWJH 3UPEA 3RMOH 1UVSH 1UTKA 1FN8A 3MI4A 3RC4A 1KYNA 4Y79A 3PO1B 3UOPA 2BYAX 1O2GH 1C1VH 4Y71A 2BOHB 1DWCH 3QK1A 1DS2E 1IQJA 3SU4A 1Z1IA 1DDJA 2FOCA 4MNWA 3ZYDA 4CREA 4FVDA 2VB0A 1FAKH 3A83A 1LDTT 5E0GA 5ETXA 2A2XH 1S85A 1THSH 3GY4A 1MTNC 2HNTE 2JETC 4Y6DA 4YM9A 1PPBH 1O3EA 1UJ1A 2XW9A 1HJ8A 4O03A 4ABAA 1GJ8B 2PR3A 2O8TA 3D23A 1KLTA 4DVAU 3H7TA 1V2KT 1QL8A 2AS9A 1FMGA 1BBRH 3QTOH 3T2NA 3TK5A 1EAWA 5ESTE 5E2PA 1P01A 4ABIA 5B6OA 4MDSA 2OC1A 1CT4E 3E16B 1BDAA 3SUEA 5EGMA 8ESTE 3U1IB 3PMJA 4AZ2B 4H6TA 5FBIA 1SGRE 2BD9A 2P8OC 1AZ8A 5EPYA 5T6FA 2ESTE 3BTEE 1CT2E 4O9VA 3LKWA 1NS3A 1AZZA 1XMNB 1GHWH 3FP6E 1TYNA 2C8XB 1O3LA 2WV4A 3GY7A 2FXRA 2RCEA 1T4VH 1XX9A 1Z1JA 2IPHA 2B9LA 1XM1A 3GCTG 3SNEA 1V2LT 1GBTA 1SGQE 1DUEA 1KXFA 1TA2A 1UTLM 2Y7XA 2HPPH 1O5FH 1KDQB 5CMXH 3PLPA 1W11U 1BRBE 1OKXA 1DXPA 1PQAA 1Z8RA 4NWLA 1O5BB 1E0FD 2R9PA 1V2WT 2Z3DA 2FI5E 5LPRA 4WH8A 5K0HA 1NROH 2OBQA 1KTTB 1LPKB 1OP8A 3URCA 4NCYA 4ZROA 4Y0YE 1C1RA 1QBVH 2TGPZ 1MBMA 2PSXA 3ATKA 2PTNA 3HPTB 1BUIA 1G3EA 1GMHG 4FUDA 4SGBE 1ANBA 2OXSA 1MZAA 2TIOA 2ZNKH 4XSKU 4NSVA 3BEUA 5FCRA 4CH8B 3SV9A 4YO9A 1GBHA 1TMBH 4ABHA 1ELAA 1FY3A 2R2WU 3SJIA 1WTGH 3Q3YA 1O5EH 1FY8E 1D9IA 2BXTH 2ZQ1A 1GI6A 1OWHA 2V0BA 2ZFRH 1EATA 3TITA 1HAIH 2CF9H 1ARCA 1J15A 1L1GA 2GDEH 2ZGJA 4GAWA 3RXRA 3ITIA 3H7OA 4K8YA 2B5TB 3SU3A 2GP9B 1JMOH 3EGKH 4X6NA 1RD3B 3SO3A 3V13A 1D3QB 1O5AB 1SBWA 1TRMA 2BX3A 3CENA 4ZHAA 4AFQA 4X0WU 1CHGA 2FYRA 4ABDA 1RXPA 3V3MA 1T7CA 3OTJE 3U8TH 3MYWA 4CRBA 4NG9H 1XUGA 5DP6A 1PPFE 5T3HA 2RA0A 1CBWC 1AI8H 4CR5A 1HDTH 2FTMA 2OBOA 2PTCE 1ZOMA 1LVOA 2AYWA 1PPCE 1FJSA 1Y5AT 2A5KA 4Y8ZA 2P3UB 3SI3H 2WUCA 5C3NA 1YPJH 1B0FA 1ELCA 3UNSA 1A5IA 1W0ZU 1RS0A 2OTVA 4K1SA 5SGAE 1FLEE 1Z6EA 2FP7B 4YTAA 4NIVA 2XXLA 5HXFA 5EQRA 1C1MA 2ZFPH 1Y5UT 1EPTC 1UCYH 4U32A 1MCVA 3VEQB 5HM2A 3ZVEA 1LHFH 2ZHEH 3AASA 1WUNH 1GDQA 1SPJA 1TIOA 2ZCHP 3R0FA 1QCPA 3U8RH 1KXBA 2O8MA 2HWLB 1IQNA 7LPRA 1O3NA 4K8BA 4JK5A 2FZZA 9ESTA 1KLJH 1GBFA 2G4TA 1W12U 1AUJA 1C4V2 4GCHG 1A0LA 3DFLA 8LPRA 1P2IA 4CRDA 3O8CA 4BAMB 2P3TB 1Z6JH 5AHGH 4AYVB 1OWIA 2NU2E 4H4FA 1HJ9A 2XBWA 1P05A 1N1LA 1ZTKA 2NU1E 4MLFB 1SGEE 5FX6A 3I29A 1O36A 1TALA 1GCTC 3BTME 3D49H 4DOQA 1D3DB 3ZVDA 1UTOA 1D3PB 4OGXA 2CHAB 5H4IB 1UTPA 1YYY1 1QR3E 3RU4E 1UK3A 1FIZA 2BY7X 1H1BA 1GMCF 1TBQH 4NFFA 3NUMA 4Y8XA 1TONA 1SSXA 4DY7B 1OP0A 2I6SA 2H5CA 2C90B 1ZMJA 1JRSA 1HBTH 1A0JA 3SORA 3L3TA 2ZHQH 4AFSA 1C5SA 2A31A 5A09A 1NN6A 3W95A 1G3CA 4NGAH 4B2AA 1O2JA 1ELGA 1O2WA 4CRCA 2ANYA 3SN8A 1Q3XA 1A7SA 1C1QA 3FP8E 5EPNA 2BTCE 3LJJA 3PO1C 3MO3A 2TGTA 3T5FH 2ALPA 3OSYA 2R0KA 1XVMA 4CHAC 1S84A 4IGDA 4X2XA 3JZ2B 1C1UH 2OUAA 2PSYA 1NRQH 5G4BA 3EA7A 4B2CA 5JBCS 1C5MD 3EQ0H 3HGNA 1G9IE 5F8ZA 2GMTB 2RG3A 3STIA 4HI3A 4X6OA 1HAGE 3GICB 5A0BA 2QY0B 2XC5A 3MU8A 3ZZBA 3F6UH 4ABEA 1PPGE 3SJKA 3MNBA 2OQUA 4LZ4B 1X7AC 1BZXE 3FVFB 1XXFA 2HNTF 1TQ0B 2CMYA 1MQ5A 5C5OA 1XUIA 2NU3E 2GX4A 4E7RG 1GBKA 1BMMH 1WYKA 2Y7ZA 2OC0A 2PKAB 2EC9H 1W14U 1Z8JB 2ODYB 4JCNA 3SW2B 2ODPA 4FUJA 3TGKE 1GBIA 2V6NA 1DUAA 1CGJE 1GL1A 2AEIH 1D4PB 4TY7A 3VB7A 1NZQH 3SU5A 4I8JA 5JBTA 4IN2A 1BMLA 1O0DH 2AMPA 5A0CA 2VH0A 1V2RT 1DT2A 5GDSH 1W3CA 1YCPK 1GPZA 2W26A 3LDXH 4D9RA 2ZDLA 3SU6A 4WWYA 1XUFA 5GPIB 1QBNA 4JYTA 1AFQB 4RSPA 1O2UA 2THFB 1N6XA 1IQIA 1W13U 3RXPA 2A5IA 2QCYA 3VPKA 3T28A 1MU8B 1ZRBA 3GDUA 3P8NA 4R0IA 2YNBA 4D76A 1H9LB 3KF2A 1K2I1 4UE7H 4BAKB 1L1JA 2ZGBH 3GY5A 4UFFH 4HGCA 5K7RA 3QN7A 1Y3XA 5EU8A 5HMAA 3SI4H 1O3AA 1NO9H 1QB1A 5C2ZA 3QGNB 3MWIU 4MNVA 1MD8A 4YOGA 3S9AA 3Q76A 2A2QH 4CH2B 2EI8A 3SUDA 4CRFA 1C5WB 1GJ5H 4BTUB 1EAIA 4Q7YA 3BV9B 2A5AA 5FAHA 3MO6A 2A1DB 1GHXH 2D1JA 3ATWA 4FU7A 2V3OH 2JH0D 1CT0E 1UMAH 2QF3A 4E7NA 1O3MA 2J9NA 3LT3A 3A88A 5E0JA 1NRRH 1ZPCA 1K21H 2KAIA 5I25A 2IJOB 3NCLA 3MTYA 2FS9A 1EX3A 1O2IA 1FUJA 1PQ7A 2B7DH 2QN5T 3A7WA 1SFIA 1IQKA 2WUBA 4ISIH 2GDDA 2VWLA 3SQEE 4A6LA 1SOZA 2ILNA 1Q31A 1C2MA 3E6PH 2PKSB 3IG6B 1AB9B 4I8HA 1FV9A 1SGPE 4U2WA 3K9XB 3AW0A 1P10A 1MH0A 2GCTB 1SLUB 1AGJA 1ELBA 4FU8A 4WF8A 4XBCA 3KL6A 2F9OA 3BTQE 1AO5A 2J95A 1NTPA 4FUIA 2BD4A 2ZFQH 3DA9B 1MKXK 1H9IE 2BVXH 1EOJA 2PWXA 1G36A 2ZG0H 2Z7FE 1HV7A 1ZJKA 1S6HA 1SGNE 2XRCA 3P8OA 1RJXB 3S69A 2AGEX 1XXDA 1NRSH 1ZGIA 2FM2A 1C5QA 1YPHC 2ZU5A 4GSOA 1GI2A 4WMFA 4Q7ZA 3GCHB 1QQUA 3UTUH 2W7SA 1XUKA 2ALVA 3BTKE 4KELA 4FU9A 4MNYA 2GGVB 4BXWA 4JZDH 3ZVFA 1O2QA 4J2YB 5A8XA 4J1YA 1AE8H 1P12E 3OY5U 2G5VA 1H8DH 1V2NT 3LC5A 1DWDH 1G30B 2ZECA 3PV4A 1GHAF 4Y7BA 1O35A 4WXVA 1QRXA 3BTGE 2O8UA 5C5NA 4U01A 3GISB 3RMNH 1GHBG 2BVRH 4I31A 1EJAA 3AVZA 3S9BA 1AVGH 2WPJS 4Y11E 4YLUA 1C2HA 2A0QB 1GMDG 1SGIB 2WYJA 6ESTA 1S6FA 2BDYA 3M35A 3P70B 1GBAA 4GUXA 5EG4A 4DIHH 4DIIH 2FLBH 1QJ7B 1ELTA 1O3FA 3KNXA 1TGBA 4ZHLU 3ATIA 1GG6C 1O3KA 3A7TA 3U69H 3RXJA 2RDLA 2UUFB 6CHAC 2A4QA 2D26C 1TRNA 1HAXB 4IBLH 3SOSA 9LPRA 3BTWE 2QV1A 2QYIA 1CHOG 3A7VA 3SJOA 3TJNA 4JYUH 1T8OA 1NFYA 3RXIA 1F5LA 4D9QA 3RXEA 2ZTXA 1GJDB 1HYLA 3ODDA 1LPZB 3ZZ9A 4YESB 1MAYA 2W7UA 2V3HH 2PUXB 3HGPA 2H9EH 1GCDA 1NFUA 4NZLA 4OS6A 3A7YA 4UFEH 5DP4A 1XKBC 1EKBB 2A4OA 4X1SU 1CGHA 4ZKSU 2ZCLP 2QXIA 1BTHH 2HALA 3RDZA 2LNCA 1GI1A 2TPIZ 1GJ4H 1HNEE 1CA0C 3MH4A 2W3IA 3V0XA 2BQWB 3M61U 2Z9LA 1ZTJA 3SNCA 1LVMA 5A2MH 4AG2A 3K6YA 1QHRB 1ABIH 2FODA 3KQBA 1O31A 1SQTA 3CS0A 2OP9A 1ETRH 1MKWK 1VCWA 4ZUHA 1UK4A 1IQEA 1QRZA 2M5TA 2PKAA 4WY3A 2BB4A 2W5EA 3GCNA 1F0RA 4ISOA 3VGCB 3Q77A 3T27A 1GVLA 1C9TA 4X1NU 3DT0H 2FDAA 7GCHG 2ODQA 2D8WA 1UTMA 3HKJB 5E0HA 3KQEA 1DOJA 1ELFA 3SBKA 2AGGX 2G8TA 1TNLA 2CGAA 4ESTE 1LMWB 3GY3A 2QXJA 2J38A 1DLEA 3TJVA 2Z9KA 1QY6A 1ZJDA 1DANH 1WU1A 2Q6DA 1ABJH 2J94A 4X6MA 1V2ST 1P9SA 1C2GA 4ZHMU 3SV8A 1P2JA 3Q00A 1VITH 2C4FH 4YT6H 4QT8C 4BNRA 4I8KA 2AFQB 3M3SA 5F8TA 3ZVBA 1C4Y2 4AB9A 2Z3CA 4GHQA 2EI7A 5J4QA 2FMJA 1TBRH 1E38B 2AIPA 3K65B 2ZDAH 1AKSB 4OS5A 1JWTA 5F03A 1AQ7A 2A7CA 1NFXA 1NU9A 3ZZ5A 4AFZA 2O8LA 1GHAG 5L30H 2BZAA 1EB2A 3TU7H 1TWXB 3U8OH 3A82A 2ULLA 1HIAA 1EAUA 1J14A 2ZFSA 3KIDU 3O8RA 1SHYA 1V2VT 2VNTA 3DFJA 1VGCC 1O2MA 4BXSA 2TGAA 3KGPA 2XWAA 3SGAE 3A89A 3RXQA 1S5SA 4NSYA 1C5UA 1S83A 1OYTH 1AHTH 3T62A 3A7XA 3SHAH 4ISNA 1TGTA 1FNIA 1OWKA 1ZRKA 3I78A 1C9PA 1A0HB 1QGFA 2VIWA 3PLBA 3RLWH 2C8ZB 1MZDA 3M5OA 1SGFG 1TGCA 1Z8IB 2UWPA 1SGCA 4Q80A 5TCAA 4ABGA 2ZGCA 1TNKA 4X8UH 1Z7KA 1YLDA 1SGTA 3SNAA 5CHAC 4BAHB 4NA7A 1OX1A 4OS2A 3LH1A 1EZQA 2O8WA 4A92A 1VITF 1A3EH 2P3FH 3RM0H 1GVZA 4JK6A 5A8YA 2Z9IA 1F5RA 2BDGA 4VGCB 3ZVCA 4IS5A 4NIXA 5EQQA 3IITA 2KAIB 1IQFA 2XBXA 1HLTH 2ZDVH 5TCCA 3GY8A 3SHCH 1O5DH 1XVOA 1YM0A 3PMAB 1TX6A 1WSSH 2BLOA 2B8OH 1TGNA 1O5CB 1ANCA 4BAOB 1EQ9A 2P59A 4I32A 1OP2A 2BDHA 3RLYH 2BDIA 3FZZA 4O3UA 4XE4A 1GBLA 2STBE 3BTDE 1S82A 1AE5A 1MTUA 5C1UA 1EB1H 3F9HA 2R3YA 1P3CA 1J8AA 4X8SH 1DITH 1V2QT 1IHTH 1A4WH 3A8BA 1N8OB 1LVYA 4TPIZ 2FOFA 4MPVA 1TGSZ 3IWMA 3LGTA 5L2YH 3SNDA 1YPEH 4OS7A 1EOLA 1AVXA 1L1NA 3SZNA 1TE0A 3RXLA 1HXEH 4JZIA 5L6NH 4ZMAH 3SV6A 2GVFA 2ZF0H 5FBEA 3ZZAA 4Q2KA 5GCHF 4AB8A 4A7IB 1OXGA 4KTCA 3MNCA 4F4OC 1G3DA 1NY22 5EXMA 3BSQA 1WQSA 3TJOA 3TNTA 3KEEA 4YOJA 2ASUB 1HJAB 2RA3A 2ZC9H 5I46H 2OCVB 4GLYA 3CS7A 1SOTA 4E06H 5GXPA 1K9OE 1PPHE 1ETTH 1L4DA 3MNXA 1K1LA 1SR5C 1IQHA 1BITA 4B75A 1ZHMA 4MTBA 2VWNA 3GDSA 5GWZA 1UTJA 3RU4T 1SFQB 3AAVA 2FEQH 1AIXH 2GV7A 3E0NB 1LHEH 1C5YB 3UREA 5EW2H 4JYVH 1RGQA 1HPGA 3A86A 2VIOA 1C5VA 1P11E 3MO9A 1HUTH 2YNAA 3U98H 4H42U 3TK6A 3L6PA 4UFGH 1BBRK 1GDUA 2QC2A 4Y76A 2VVVA 3RXVA 4FUFA 2AMDA 1BB0B 2GZ7A 2C3SA 4ZXYH 1C5LH 3ZV9A 5L2ZH 1MKXH 2VGCC 3SV7A 3BN9A 2G4UA 5PTPA 4B76A 3H5CB 3RMMH 3RXFA 3ZVAA 5DP7A 1PYTC 3SJ9A 3T29A 6GCHF 2PV9B 1A1RA 1OWDA 1UVUH 2BD2A 3RP2A 1ID5H 4LOYH 3TK9A 1DLKB 1O3OA 2SGDE 1INCA 2BY5X 2ZPQA 4B74A 5GIBA 3MH5A 4KTSA 2A7JA 5HYOA 5JPMH 1CVWH 1ZZZA 1P57B 1XKAC 3LPRA 1TA6A 3HK3B 4B71A 3S9CA 2EI6A 1SMFE 5FPTA 3ELAH 3M7UA 3RC5A 2OD3B 2ZHDA 4JZEH 1TABE 5LPFA 5ABWA 2JH6D 1THRH 1MAXA 1EASA 3A7ZA 8GCHF 1ZR0A 5AFZH 4CR9A 4X2VA 3GDVA 3UR6A 4NIWA 2XCNA 4ISHH 3QWCH 3ZZDA 4YLQH 3RXKA 1PQ8A 1V2JT 2FX6A 1ZMNA 2BM2A 2HOBA 3EDXB 3PLKA 1QFKH 3RC6A 1YCPM 1E36B 5T6DA 3K6ZA 1TMTH 1V3XA 4KKDA 1WTHD 1V6DA 3P17H 1DX5M 2WV5A 5GJ4B 1AKSA 4AGJA 3BTHE 1W2KH 1HAPH 1PFXC 3SUFA 1W8BH 1BTPA 1BTYA 1C1TA 1LPGB 3SU0A 1IHSH 2SNVA 2ZU2A 2VINA 3PM3A 1BTXA 1GVKB 2Z9GA 1L0ZA 1F0SA 5FPYA 3KHVA 2PGBB 2SGAA 2NU4E 1P04A 1C5TA 1MTNB 4O3TA 2A7HA 2JETB 2G55A 3R3GB 2HNTC 4OGYA 2ZDMA 2WPLS 2BZ6H 3E0PB 2SGEE 1GI4A 4MG3A 2FLRH 4D7GA 1GBDA 5A8ZA 1Y59T 3M7QA 1K1JA 1OPHB 3B9FH 1E34B 1QA7A 2PLXA 4NWKA 2HLCA 1ESBA 1G2MA 4DGJA 1GL0E 1YF4A 2ANMH 1P2MA 2F3CE 4K1TA 1P9UA 1UTQA 1C1WH 2VIDA 4RN6A 1MTVA 4FUHA 5E8EH 1GHVH 3M36A 1DWEH 1AU8A 1G3BA 3UIRA 2GD4B 2FOMB 3NXPA 1HIAB 1O34A 3QX5H 2P8OB 3GY2A 1BRCE 2ZTYA 1GHYH 2TRMA 5A0AE 1GMCG 2ZTZA 3BG8A 3KCGH 3VB4A 3QTVH 1GBMA 2XTTB 3QZRA 1TRYA 1ANDA 5T6GA 4ZH8A 4K3JA 1SG8B 4MPUA 5C1YA 4X1QU 1TBZH 1SQAA 3M3VA 3UNQA 1P2NA 1C5RA 3A8DA 2A4GA 5CE1A 5DP9A 5DPAA 3QO6A 1L2EA 1A2CH 4LK4A 1HAZB 1P03A 2XC0A 1G32B 5FHTA 1SLWB 1P3EA 3ODFA 1PQ5A 3QGJA 3RXCA 2ZPRA 2ZKSA 1BJVA 3GOVB 2H1UA 3MU1A 1IQLA 1EP6A 2FOBA 1RRKA 3P95A 3MU5A 1AN1E 2EEKA 1THPB 1LHDH 2SGPE 3UQVA 1C5NH 1OWJA 3SJ8A 1GJ7B 1UVPA 3FAOA 4IN1A 1CQQA 1FPHH 1E37B 4F49A 4AG1A 1YLCA 3JZ1B 3Q3XA 2FTLE 1O2OA 1ETSH 4DJZB 2DE9A 1J9CH 4I7YH 1O2LA 3ZZ7A 4DW2U 3LIWA 4UD9H 2ZQ2A 3MHWU 2QXGA 3UQOA 1Y3VA 1C5PA 2ZHWH 3PTBA 4WXIA 1YBWA 1LVBA 3RXDA 1O32A 1GBBA 4CRAA 1ESTA 1JOUB 2FESH 1HAOH 4TPYA 2ANKH 1LKBA 2VU8E 1SB1H 5IYTA 1QBOA 1ZYOA 5DP3A 4JZFH 3SU1A 1P2OA 3RXAA 2A32A 1O3JA 3TGJE 4PROA 3UFAA 3PROA 1LKAA 4JMYA 1SL3A 1PJPA 1VCQA 2PGQB 1CBWB 1FY1A 3NZIA 8KME2 1O3BA 3D65E 1O2VA 3D62A 4NFEA 3A80A 1G2LA 3LGVA 2BX4A 1EP5A 3DD2H 1WCZA 1K1PA 4Q7XA 1C4U2 3KN2A 3KQCA 2Z94A 4CBOA 4FUEA 2D2DA 5JYIA 3BEIB 1D3TB 5HM9A 4E05H 2ZFFH 2OC7A 1O3DA 2CHAC 4YZUA 5BRRE 1NC6A 3QZQA 4INHA 5DP8A 1Z8GA 2CN0H 2TBSA 2BDCA 1F5KU 4FUGA 4FVBA 1SI5H 4YT7H 2K1QA 1BTWA 1Y3YA 2ZHFH 2A45B 4DG4A 4CRGA 2UWOA 1VZQH 3GCTF 4Z0KA 1O33A 3MFJA 1TNIA 1C2IA 4ZKRU 1DY9A 1DFPA 2AIQA 4GVUA 4ABFA 5F8XA 2WINI 4AORA 2F9NA 3S0NA 2GT7A 1GHZA 3C1KA 2HRVA 1P02A 4K1EA 3PWCA 1RTLA 2BLVA 1RTFB 3UNRA 1Y3UA 1C2LA 3ENSB 3TH4H 2XNIA 4Z6AH 3LGIA 1VR1H 3PYHA 2C93B 1Y8TA 2F91A 3VB6A 3HATH 2FX4A 1G37A 1LTOA 1GCTB 1LHGH 1GMHF 3F9FA 3SUGA 1WQVH 1TOMH 1GJ6A 5DG6A 3RXTA 4AOQA 2GMTC 5E2OA 2FOAA 2BVSH 2XYAA 2WPIS 1ESAA 1V2TT 1UO6A 1ACBE 3SQHE 1FY4A 4KGAA 4X2WA 2I6QA 2ZEBA 3E1XB 2Q6FA 3ZZ6A 2G51A 2J2UA 2H2ZA 3M5MA 1EZSC 2Y81A 1C1OA 4FXGH 2J34A 3BG4B 3OYPA 3FP7E 3E91A 3RM2H 2GKVE 3RXSA 2ZGHA 4XBBA 3MH6A 1W0YH 1T8NA 2QIQA 1NU7B 1YC0A 1EXFA 1TPOA 2WYGA 1MTSA 2HGTH 4YOIA 3GYLB 4CHAB 4BTTB 2BQ7B 1QIXB 2Y5GA 4NZQA 1SGFA 3DHKH 2ZCKP 2FYQA 1LCYA 2ZU4A 5DO4H 1BIOA 1MBQA 2UUJB 3T25A 4D8NA 1A3BH 2DUCA 2P95A 2GTBA 3PB1E 4IW4E 4MQAA 4RKJB 1LQDB 3V7TA 2P94A 1W10U 4TWYA 1KY9A 4B1TA 1BRUP 1O3HA 4X8VH 4FUBA 1SHHB 1ARBA 1KSNA 1O3IA 1AFQC 2GZ9A 1KLIH 3TNSA 1OYQA 1BHXB 1KXEA 1IAUA 3QDZB 4HFPB 4TWWA 4UONA 1O5GH 1Y5BT 1BTUA 3FANA 3O8BA 1GJ9B 1O38A 2TGDA 1CSOE 1HGTH 1NPMA 1WOFA 1SQOA 1NRPH 4INLA 4IMZA 3LJOA 4DCDA 1CA8B 5C1XA 3WY8A 1ZGVA 2STAE 1KIGH 2FO9A 2FI4E 1CE5A 2VWOA 1SGDE 4GCHF 3PWBA 2GV6A 3PMHB 1TX7A 4UDWH 1O3GA 1VJAU 2FI3E 3Q3KA 3QUMP 3OU0A 3I77A 5C67A 4IC5A 1UVTH 1UHBA 3RXUA 1ZHPA 3SU2A 1HAVA 3LOXA 1BA8B 1EUFA 4TY6A 4NA9H 1J16A 3VXEH 4AN7A 1ELVA 1BRAA 2GZ8A 3EA9A 1HXFH 2C8WB 2CXVA 1J17T 2IN2A 2PKSC 1AB9C 4MPWA 3ZZ4A 4WVPE 3HK6B 1N6YA 1ELDE 1TNJA 2BD5A 3L33A 4ISLA 2GCTC 1GI9B 4OS1A 3B8JA 2ZDNA 3MU4A 1OWEA 1PPZA 1T8MA 1O2NA 2ANWA 1P09A 4ZXXH 3A85A 5EXLA 1EJMA 3PMBB 1PYTD 1O2XA 2BY6X 2BY9X 1QNJA 3GY6A 1ZTLA 1YCPH 2J92A 4Y7AA 1V2UT 4OS4A 1BCUH 1H4WA 3TLOA 5JBAS 4KTUA 3E8LA 1FN6A 1FZZA 1HCGA 4K5ZA 3E3TA 2BY8X 2OQ5A 5EXNA 2B0FA 1ZSLA 1FDPA 4X6PA 1NRNH 3ATLA 1YPHE 4U30A 4A1TA 2BDAA 4X1PU 4BAQB 3ZVGA 4XOJA 4XBDA 1YGCH 2ZPSA 4MPXA 5FXLA 3AW1A 1GI0A 1O39A 2C8YB 4IMQA 1HRTH 2FOHA 1SGYE 3GCHC 2O9QA 1NM6A 1BMNH 1TB6H 3G01A 3KQDA 4LXBH 2SFAA 2VWMA 5C20A 1KTSB 2ZIQH 2G81E 3EA8A 2ZA5A 1AY6H 1HAHH 1XUHA 2OLGA 5TJXA 3BEFB 3CP7A 1A46H 1AVWA 3RUOA 2FS8A 4FUCA 1C2JA 4NIYA 3LGYA 1O2PA 1V2PT 1GI5A 1TPAE 2NWNA 2AH4X 1EAXA 1YPKH 4D7FA 1RIWB 1MCTA 5ESBA 3UWIA 1C2KA 1Q2WA 3UR9A 4AYYB 2PUQH 2Y5HA 2XBVA 1EPTA 1CO7E 1IOEA 5LPEA 1TAWA 4HZHA 1T4UH 1VCPA 3A8CA 3F9EA 1M9UA 4UEHH 1C5XB 2SGFE 2BMGB 4AX9H 1D6RA 1BQYA 1P2KA 2GCHF 5JB8S 3ZV8A 1BMAA 3RXGA 1EZXC 1TMUH 1GBCA 2VIVA 2Y80A 3RMLH 1E35B 4I8LA 2ZU1A 4THNH 4WMDA 1ZPBA 5BPEA 1ELEE 1GGDB 2DE8A 1EZUC 1MD7A 2GT8A 5LGOA 1RTKA 2Z6BD 3MNSA 2SNWA 1QB6A 4X8TH 1U6QA 3RXMA 1HFDA 3VXFH 1O30A 2ZU3A 5DJ7A 3GCOA 3SGBE 3P8FA 3S7KB 3MOCA 5LH8A 2G52A 5JDUB 6LPRA 3B23B 2NU0E 3BIUH 5AVDA 4BTIB 1GG6B 1O2SA 1IQMA 1QL7A 2A4RA 6CHAB 1DSUA 3C27B 2ZGXH 1O2YA 5FX5A 1VITG 1BHXF 1ZSKA 4AGKA 3RXOA 1DPOA 2AMQA 2H5DA 2ZO3H 2F9UA 3BG4C 1JXPA 1P8VC 3LGWA 2XBYA 1SC8U 3FFGA 2BOKA 1BOQA 1QL9A 3VGCC 1GJAB 1K1IA 1DSTA 2AERH 4SGAE 1H9HE 2VIQA 2UUKB 4BANB 3UOUA 4GHTA 5DGJA 1C2EA 2Y82A 1YP9A 4R8TB 4BOHA 1T32A 1YKTA 3F68H 1ORFA 1Y3WA 1C2FA 1FI8A 1S0QA 1GJCB 1DM4B 1LO6A 1MUEB 1CA0B 4M7GA 3VB5A 1K1OA 5HGGA 4I33A 4XDEA 2QF0A 1B0EA 2EA3A 5JB9S 1TNGA 4GPGA 1CU1A 2F9BH 3SGQE 2BDBA 5FCKA 1C1PA 5IDKA 2BHGA 3NWUA 2V35A 2XWBI 1B5GH 4WH6A 2QA9E 4INKA 1DICA 5DK1A 1NT1A 4A5TS 1K1NA 5DKMA 3UY9A 4A1XA 3EYDA 1RFNA 1UK2A 3BIVH 3O8DA 2Y6TA 5GCHG 1QURH 2FOEA 3P8GA 1ZSJA 1FAXA 2F9VA 2F83A 3RXBA 3SV2H 2H9HA 1JBUH 3MH7A 3W94A 3BTTE 3U9AH 3ZZ8A 4WJG2 3HKIB 2P16A 2JKHA 1BJUA 1IQGA 1P0SH 2R2MB 2H6MA 2Z3EA 4DURA 2BQ6B 1QA0A 2CJIA 4ZKNU 4ZKOU 1F2SE 1TQ7B 2GCHG 1AFEH 1KDQA 1SVPA 1FY5A 3V12A 5EOKA 2VJ1A 3TH3H 5AFYH 1GHBF 1O3PB 5AF9H 1AD8H 1TLDA 1DVAH 1GMDF 1O2RA 4Y0ZE 1F0TA 3K2UA 2UUYA 5EQSA 1ANEA 2VVCA 1MKWH 1T31A 1KXAA 1UCYK 3T26A 1K22H 3SNBA 2BD7A 3RXHA 4TYDA 1C2DA 1UHBB 2Z9JA 2LPRA 4VGCC 1EJNA 1VGCB 1HAVB 1CHOF 1V2OT 2BLQA 1A5HA 3BF6H 1D6WA 1YPLH 1AMHA 3TGIE 2FOGA 4A1VA 6GCHG 1FXYA 7ESTE 3NPSA 4MVNA 3OY6U 3NKKA 1K28D 1KXCA 1TX8A 2ZP0H 1FIWA 3M5NA 4KP0A 2G5NA 1BT7A 2G00A 1MQ6A 3AAUA 1QJ1B 1T8LA 1TPSA 1FPCH 1DE7H 2UWLA 3ATMA 3F9GA 2WPKS 1BBRE 1P2QA 3RU4D 1SLXB 3UUZA 4HTCH 3STJA 3DUXH 2QGRA 1GI3A 3VFEA 1N8OC 2PFEA 5DP5A 5CHAB 1S0RA 2FWWA 5EW1H 1TOCB 1K1MA 3LU9B 1XUJA 4I8GA 5J4SA 1NESE 2QAAA 4Y8YA 8GCHG 3QLPH 1O2KA 4B73A 2OINA 3S7HB 1NFWA 1C5ZB 3GYMA 1H8IH 1GI8B 4H6SB 1AUTC 1OSSA 1AWHB 1ZPZA 3ZYEA 5EODA 4K2YA 3A8AA 4DT7B 2HPQH 1RIWC 1FONA 3A81A 2ZDKA 1GDNA 1GBJA 7GCHF 4ZAEA 2BLWA 4ABJA 4AFUA 1A5GH 3URDA 4K60A 5FPSA 2BD3A 1P06A 1HJAC 2R0LA 1GWAA 1LQEA 1O2TA 4JZ1A 1C1NA 3EE0B 3P92A 5JBBS 3FZDA 2PW8H 1L4ZA 4IC6A 1JRTA 3ZZCA 2BD8A 1V2MT 1QB9A 4MNXA 1C5OH 1F0UA 3A84A 1AWFH 2HVXA 4ASHA 1HAYB 1W7GH 1MMJN 2XCFA 1FQ3A 2ZI2H 1VJ9U 3EAJA 1JIRA 1WAYB 2J4IA 1LHCH 1GI7B 4K69A 1DWBH 1EPTB 1ZLRA 1O37A 1QJ6B 1ZMLA 2W3KA 1TPPA 2AGIX 4ABBA 1QTFA 1C1SA 4B2BA 1F7ZA 1GGDC 2VVUA 3LH3A 2XC4A 1TFXA 1GJBB 1SLVB 3A87A 3LONA 3F1SB 3TJUA 1CGIE 1QQ4A 2CV3A 2FIRH 1MU6B 2WPHS 2F9PA 2QXHA 2BXUH 3N7OA 1UVOA 4WMEA 3TIUA 1B7XB 4NA8A 1QRWA 2JH5D 4X1RU 1YPGH 1MTWA 4RKOB
chains in the Genus database with same CATH superfamily
1F92A 3VB3A 2Q6GA 3M5LA 2VH6A 2VIPA 1WBGB 1PPEE 1A61H 2YOLA 4O97A 1W7XH 2OC8A 3PTNA 4LZ1H 1ZHRA 1O2ZA 1YPMH 2CF8H 1GBEA 3TVJB 1WV7H 2P93A 1DXWA 3M3TA 3TH2H 2ZFTA 3TPIZ 5F6MA 3M37A 3ESTA 3BTFE 3LGUA 1UTNA 3NK8A 4RT1A 1S81A 1OOKB 2PHBA 3MMGA 1DY8A 3CNRA 1O3CA 3E90B 3OX7U 3LC3A 2ZZUH 1KXDA 2Y5FA 2Q1JA 2QF4A 1NBME 2KR7A 4UFDH 2SGQE 3P6ZB 3U1JB 1TNHA 2H9TH 3M7TA 3MU0A 3ZZ3A 4XFQA 1OS8A 2WPMS 2ZWLH 7KMEH 4Y10E 1Z71A 1BTZA 1HB0B 4X2YA 5EIYA 2FPZA 2VGCB 2IOTA 1JIMA 2R3UA 1UCYE 4CBNA 1O2HA 3UWJH 3UPEA 3RMOH 1UVSH 1UTKA 1FN8A 3MI4A 3RC4A 1KYNA 4Y79A 3PO1B 3UOPA 2BYAX 1O2GH 1C1VH 4Y71A 2BOHB 1DWCH 3QK1A 1DS2E 1IQJA 3SU4A 1Z1IA 3VG8A 1DDJA 2FOCA 4MNWA 3ZYDA 4CREA 4FVDA 2VB0A 1FAKH 3A83A 1LDTT 5E0GA 5ETXA 2A2XH 1S85A 1THSH 3GY4A 1MTNC 2HNTE 2JETC 4Y6DA 4YM9A 1PPBH 1O3EA 1UJ1A 2XW9A 1HJ8A 4O03A 4ABAA 1GJ8B 2PR3A 2O8TA 3D23A 1KLTA 4DVAU 3H7TA 1V2KT 1QL8A 2AS9A 1FMGA 1BBRH 3QTOH 1E1QD 3T2NA 3TK5A 1UW7A 1EAWA 3FN8A 5E2PA 5ESTE 1P01A 4ABIA 5B6OA 4MDSA 2OC1A 1CT4E 3E16B 1BDAA 3SUEA 5EGMA 8ESTE 3U1IB 3PMJA 4AZ2B 4H6TA 5FBIA 1SGRE 2BD9A 2P8OC 1AZ8A 5EPYA 5T6FA 2ESTE 3BTEE 1CT2E 4O9VA 3LKWA 1NS3A 1AZZA 1XMNB 3F0OA 1GHWH 3FP6E 2IPQX 1TYNA 2C8XB 1O3LA 2WV4A 3GY7A 2FXRA 2RCEA 1T4VH 1XX9A 1Z1JA 2IPHA 2B9LA 1XM1A 3GCTG 3SNEA 1V2LT 1GBTA 1SGQE 1DUEA 2F43B 1KXFA 1TA2A 1UTLM 2Y7XA 2HPPH 3N7DA 1O5FH 1KDQB 5CMXH 2WPDD 3PLPA 1W11U 1BRBE 1OKXA 1DXPA 1PQAA 1Z8RA 4NWLA 1O5BB 1E0FD 2R9PA 1V2WT 2Z3DA 2FI5E 5LPRA 3W1EA 4WH8A 5K0HA 1NROH 2OBQA 1KTTB 1LPKB 1OP8A 3URCA 4NCYA 4ZROA 4Y0YE 1C1RA 1QBVH 2TGPZ 1MBMA 2PSXA 3ATKA 2PTNA 3HPTB 1BUIA 1G3EA 1GMHG 4FUDA 4SGBE 2JDID 1ANBA 2OXSA 1MZAA 2TIOA 2ZNKH 4XSKU 4NSVA 4ACBA 4HG6A 1COWD 3BEUA 5FCRA 4CH8B 3SV9A 4YO9A 1GBHA 1TMBH 4ABHA 1ELAA 1FY3A 2R2WU 3SJIA 5B6LA 1WTGH 3F2HA 3Q3YA 1O5EH 1FY8E 1D9IA 2BXTH 2ZQ1A 1GI6A 1OWHA 2V0BA 2ZFRH 1EATA 3TITA 1HAIH 2CF9H 1ARCA 1J15A 1L1GA 2GDEH 2ZGJA 4GAWA 3RXRA 3ITIA 3H7OA 4K8YA 5FL7D 2B5TB 3SU3A 2GP9B 1JMOH 3EGKH 4X6NA 1RD3B 3SO3A 3V13A 1D3QB 1O5AB 1SBWA 1TRMA 2BX3A 3CENA 4ZHAA 4AFQA 4X0WU 1CHGA 2FYRA 4ZCNA 4ABDA 1RXPA 3V3MA 1T7CA 3FOAA 3OTJE 3U8TH 3MYWA 4CRBA 4NG9H 1XUGA 5DP6A 1PPFE 5T3HA 2RA0A 1CBWC 1AI8H 4ASUD 1HDTH 2FTMA 4CR5A 2OBOA 5EJZA 2PTCE 1ZOMA 1LVOA 2AYWA 1PPCE 1FJSA 1Y5AT 2A5KA 4Y8ZA 2P3UB 3SI3H 2WUCA 5C3NA 1YPJH 1B0FA 1ELCA 5KEDA 3UNSA 1A5IA 1W0ZU 1RS0A 2OTVA 4K1SA 5SGAE 1FLEE 1Z6EA 2FP7B 4YTAA 4NIVA 1YWUA 2XXLA 5HXFA 5EQRA 1C1MA 2ZFPH 1Y5UT 1EPTC 1UCYH 4U32A 1MCVA 3VEQB 5HM2A 3ZVEA 1LHFH 2ZHEH 3AASA 1WUNH 3DCLA 1GDQA 1SPJA 1TIOA 2K0QA 2ZCHP 3R0FA 1QCPA 3U8RH 1KXBA 2O8MA 2WSSD 2HWLB 1IQNA 7LPRA 1O3NA 4K8BA 4JK5A 2FZZA 9ESTA 1KLJH 1GBFA 2G4TA 1W12U 1AUJA 1C4V2 4GCHG 1A0LA 3DFLA 8LPRA 1P2IA 4CRDA 3O8CA 4BAMB 2P3TB 1Z6JH 5AHGH 4AYVB 1OWIA 2NU2E 4H4FA 1HJ9A 2XBWA 1P05A 1N1LA 1ZTKA 2NU1E 4MLFB 1SGEE 5FX6A 3I29A 1O36A 1TALA 1GCTC 3BTME 3D49H 4DOQA 1D3DB 3ZVDA 1UTOA 1D3PB 4OGXA 2CHAB 5H4IB 1UTPA 1YYY1 1QR3E 3RU4E 1UK3A 1FIZA 2BY7X 1H1BA 1GMCF 1TBQH 4NFFA 3NUMA 4Y8XA 1TONA 1SSXA 4DY7B 1OP0A 2I6SA 2H5CA 2C90B 1ZMJA 1JRSA 1HBTH 1A0JA 3SORA 3L3TA 2ZHQH 4AFSA 1C5SA 2A31A 5A09A 1NN6A 3W95A 1G3CA 4NGAH 4B2AA 1O2JA 2JJ1D 1ELGA 1O2WA 4CRCA 5C0TA 2ANYA 3SN8A 1Q3XA 1A7SA 1C1QA 3FP8E 5EPNA 3F2GA 2BTCE 3LJJA 3PO1C 3MO3A 2TGTA 3T5FH 2ALPA 2KCYA 3OSYA 2R0KA 1XVMA 4CHAC 1S84A 4IGDA 4X2XA 3JZ2B 1C1UH 2OUAA 2PSYA 1NRQH 5G4BA 5DN6D 3EA7A 4B2CA 5T1VA 5JBCS 1C5MD 3EQ0H 2L74A 1G9IE 3HGNA 5F8ZA 2GMTB 2RG3A 3STIA 4HI3A 4X6OA 1HAGE 3GICB 5A0BA 2QY0B 2XC5A 3MU8A 5CHBA 3ZZBA 3F6UH 4ABEA 1PPGE 3SJKA 3MNBA 2OQUA 1WDIA 4LZ4B 1X7AC 1BZXE 3FVFB 1XXFA 2HNTF 1TQ0B 2CMYA 1MQ5A 5C5OA 1XUIA 2NU3E 4TSFD 2GX4A 4E7RG 1GBKA 1BMMH 1WYKA 2Y7ZA 2OC0A 2PKAB 2EC9H 1W14U 1Z8JB 2ODYB 4JCNA 3SW2B 2ODPA 4FUJA 3TGKE 1GBIA 2V6NA 1DUAA 1CGJE 1GL1A 2AEIH 1D4PB 4TY7A 3VB7A 1NZQH 1SKYE 3SU5A 4I8JA 5JBTA 4IN2A 1BMLA 1O0DH 2AMPA 5A0CA 2VH0A 1V2RT 1DT2A 5GDSH 1W3CA 1YCPK 1GPZA 4P00A 2W26A 3LDXH 4D9RA 2ZDLA 3SU6A 4AC9A 4WWYA 1XUFA 5GPIB 1OHHD 1QBNA 4JYTA 1AFQB 4RSPA 1O2UA 2THFB 1N6XA 2YMSD 1IQIA 1W13U 3RXPA 2A5IA 2QCYA 3VPKA 3T28A 1MU8B 1ZRBA 3GDUA 3P8NA 4R0IA 1W0JD 2YNBA 4D76A 1H9LB 3KF2A 1K2I1 4UE7H 4BAKB 1L1JA 2ZGBH 3GY5A 4UFFH 4HGCA 5K7RA 3QN7A 1Y3XA 3SYJA 5EU8A 5HMAA 3SI4H 1O3AA 1NO9H 1QB1A 5C2ZA 3FO8D 3MWIU 3QGNB 1MD8A 4MNVA 4YOGA 3S9AA 3Q76A 4P02A 2A2QH 4CH2B 2EI8A 3SUDA 4CRFA 1C5WB 1GJ5H 4BTUB 1EAIA 4Q7YA 3BV9B 2A5AA 5FAHA 3MO6A 2A1DB 1GHXH 2D1JA 3ATWA 4FU7A 2V3OH 2JH0D 1CT0E 1UMAH 2QF3A 4E7NA 1O3MA 2J9NA 3LT3A 3A88A 5E0JA 1NRRH 1ZPCA 5CDFE 1K21H 2KAIA 5I25A 2IJOB 3NCLA 3MTYA 2FS9A 1EX3A 1O2IA 5IK2D 1FUJA 1PQ7A 2B7DH 2QN5T 3A7WA 1SFIA 1IQKA 2WUBA 5EJ1A 4ISIH 2RFKC 2GDDA 2VWLA 3SQEE 4A6LA 1SOZA 2ILNA 1Q31A 1C2MA 2W6JD 2PKSB 3E6PH 1AB9B 3IG6B 4I8HA 1FV9A 1SGPE 4U2WA 3K9XB 3AW0A 1P10A 1MH0A 2GCTB 1SLUB 1AGJA 4XRNA 1ELBA 4FU8A 4WF8A 4XBCA 3KL6A 2F9OA 3BTQE 1AO5A 2J95A 1NTPA 4FUIA 2BD4A 2ZFQH 3DA9B 1MKXK 1H9IE 2BVXH 1EOJA 2PWXA 1G36A 2ZG0H 2Z7FE 1MABB 1HV7A 1ZJKA 3NRLA 1S6HA 1SGNE 2XRCA 3P8OA 1RJXB 2M2AA 3KQ5A 3S69A 2AGEX 1XXDA 1NRSH 1ZGIA 2FM2A 2KCOA 5C17A 1C5QA 1YPHC 2ZU5A 4GSOA 1GI2A 4WMFA 4Q7ZA 3GCHB 1QQUA 3UTUH 2W7SA 1XUKA 2ALVA 3BTKE 4KELA 3KYGA 4FU9A 4MNYA 2GGVB 4BXWA 4JZDH 3ZVFA 1O2QA 4J2YB 5A8XA 5C0UA 4J1YA 1AE8H 1P12E 3OY5U 2G5VA 1H8DH 1V2NT 3LC5A 1DWDH 1G30B 2ZECA 3PV4A 1GHAF 4Y7BA 1O35A 4WXVA 1QRXA 3BTGE 2O8UA 5C5NA 4U01A 2W6ID 3GISB 3RMNH 1GHBG 2BVRH 4I31A 1EJAA 3AVZA 3S9BA 1AVGH 2WPJS 4Y11E 4YLUA 1C2HA 2A0QB 1GMDG 1SGIB 2WYJA 6ESTA 1S6FA 2BDYA 3M35A 3P70B 1GBAA 4GUXA 5EG4A 4DIHH 4DIIH 3UAIC 5C94A 2FLBH 1QJ7B 3H09A 1ELTA 1O3FA 3KNXA 1TGBA 4ZHLU 3ATIA 1GG6C 1O3KA 3A7TA 3U69H 3RXJA 2RDLA 2UUFB 6CHAC 2A4QA 2D26C 1TRNA 1HAXB 4IBLH 3SOSA 9LPRA 3BTWE 2QV1A 2QYIA 1CHOG 3A7VA 3SJOA 3TJNA 4JYUH 1T8OA 1NFYA 3RXIA 1F5LA 4D9QA 3RXEA 2ZTXA 1GJDB 1HYLA 3ODDA 1LPZB 3ZZ9A 4YESB 1MAYA 2W7UA 2V3HH 2PUXB 3HGPA 2H9EH 1GCDA 1NFUA 4NZLA 4OS6A 3A7YA 4UFEH 5DP4A 1XKBC 1EKBB 2A4OA 4X1SU 1CGHA 4ZKSU 2ZCLP 2QXIA 1BTHH 2HALA 3RDZA 2LNCA 1GI1A 2TPIZ 1GJ4H 1HNEE 1CA0C 3MH4A 2W3IA 3V0XA 2BQWB 3PV5A 3M61U 2Z9LA 1ZTJA 3SNCA 1LVMA 5A2MH 4AG2A 3WWBA 3K6YA 4YXWD 1QHRB 1ABIH 2FODA 3KQBA 4Q63A 1O31A 1SQTA 3CS0A 2OP9A 2HLDD 1ETRH 1MKWK 1VCWA 4ZUHA 1UK4A 1IQEA 1QRZA 2CK3D 2M5TA 2PKAA 4WY3A 2BB4A 2W5EA 3GCNA 1F0RA 4ISOA 4RT0A 3VGCB 3Q77A 3T27A 1GVLA 1C9TA 3GS9A 3OTPA 4X1NU 3DT0H 2FDAA 7GCHG 2ODQA 2D8WA 1UTMA 3HKJB 5E0HA 3KQEA 1DOJA 1ELFA 3SBKA 2AGGX 2G8TA 1TNLA 5GNDA 2LELA 2CGAA 4ESTE 1LMWB 3GY3A 2QXJA 2J38A 1DLEA 3DSPA 2Z9KA 3TJVA 1QY6A 1ZJDA 1DANH 1WU1A 2Q6DA 1ABJH 2J94A 4X6MA 1V2ST 1P9SA 1C2GA 4ZHMU 3SV8A 1P2JA 3Q00A 1VITH 2C4FH 4YT6H 4QT8C 4BNRA 4I8KA 2AFQB 3M3SA 5F8TA 3ZVBA 1C4Y2 2JIZD 4AB9A 2Z3CA 4GHQA 2EI7A 5J4QA 2FMJA 1TBRH 1E38B 2AIPA 3K65B 2ZDAH 1AKSB 5KGOA 4OS5A 4M9FA 1JWTA 5F03A 1AQ7A 2A7CA 1NFXA 1NU9A 3ZZ5A 4AFZA 2O8LA 1GHAG 5L30H 2BZAA 1EB2A 3TU7H 1TWXB 3U8OH 3A82A 2ULLA 1HIAA 1EAUA 1J14A 2ZFSA 3KIDU 4FETA 3O8RA 1SHYA 1V2VT 2VNTA 3DFJA 1VGCC 1O2MA 4BXSA 2TGAA 3KGPA 2XWAA 3SGAE 3A89A 3RXQA 1S5SA 4NSYA 3SZEA 1C5UA 1S83A 1OYTH 1AHTH 3T62A 3A7XA 3SHAH 4ISNA 1TGTA 1ZRKA 1FNIA 1OWKA 3I78A 1C9PA 1A0HB 1QGFA 2VIWA 3PLBA 3RLWH 2C8ZB 1MZDA 3M5OA 1SGFG 1TGCA 1Z8IB 2UWPA 1SGCA 4Q80A 5TCAA 4ABGA 2ZGCA 1TNKA 4X8UH 1Z7KA 1YLDA 1SGTA 3SNAA 5CHAC 4BAHB 4NA7A 1OX1A 4OS2A 3LH1A 1EZQA 2O8WA 4A92A 1VITF 1A3EH 2P3FH 3RM0H 1GVZA 4JK6A 5A8YA 5KECA 2Z9IA 1F5RA 2BDGA 4VGCB 3ZVCA 4IS5A 4NIXA 5EQQA 3IITA 2KAIB 1IQFA 2XBXA 1HLTH 2ZDVH 5TCCA 3GY8A 2KM0A 3SHCH 1O5DH 1SQRA 1XVOA 1YM0A 3PMAB 1TX6A 1WSSH 2BLOA 2B8OH 1TGNA 2WV9A 1O5CB 1ANCA 4BAOB 1EQ9A 2P59A 4I32A 1OP2A 2BDHA 3RLYH 2BDIA 3FZZA 4O3UA 4XE4A 1GBLA 2STBE 3BTDE 1K0HA 1S82A 1AE5A 1MTUA 5C1UA 1EB1H 3F9HA 2R3YA 1P3CA 1J8AA 4X8SH 1DITH 1V2QT 1IHTH 1A4WH 3A8BA 1N8OB 1LVYA 4TPIZ 2FOFA 4MPVA 1TGSZ 3IWMA 3LGTA 5L2YH 3SNDA 1YPEH 4OS7A 1EOLA 1AVXA 1L1NA 3SZNA 1TE0A 3RXLA 1HXEH 2RDEA 4JZIA 2QF5A 5L6NH 1WXRA 4ZMAH 3SV6A 2GVFA 2ZF0H 5FBEA 3ZZAA 4Q2KA 5GCHF 4AB8A 4A7IB 1OXGA 4KTCA 3MNCA 4F4OC 1G3DA 1NY22 5EXMA 3BSQA 1WQSA 3TJOA 3TNTA 3KEEA 4YOJA 2ASUB 1HJAB 2RA3A 2ZC9H 5I46H 2OCVB 4GLYA 3CS7A 1SOTA 4E06H 3KYFA 5GXPA 1K9OE 1PPHE 3N7EA 1ETTH 1L4DA 3MNXA 1K1LA 1SR5C 1IQHA 1BITA 3OFND 4B75A 1ZHMA 4MTBA 2VWNA 3GDSA 5GWZA 1UTJA 3RU4T 2YMSB 1SFQB 3AAVA 2FEQH 1AIXH 3FKSD 2GV7A 3E0NB 1LHEH 1C5YB 2KX4A 3UREA 5EW2H 4JYVH 1RGQA 1HPGA 3A86A 2VIOA 1C5VA 1P11E 3MO9A 1HUTH 2YNAA 3U98H 4H42U 3TK6A 3L6PA 4UFGH 1BBRK 1GDUA 2QC2A 4Y76A 2VVVA 3RXVA 2XOKD 4FUFA 2AMDA 1BB0B 2GZ7A 2C3SA 4ZXYH 1C5LH 3ZV9A 5L2ZH 1MKXH 2VGCC 3SV7A 3BN9A 2G4UA 5PTPA 4B76A 3H5CB 3RMMH 3RXFA 3ZVAA 5DP7A 1PYTC 3SJ9A 4TT3D 3T29A 6GCHF 2PV9B 1A1RA 1OWDA 1UVUH 2BD2A 2PP6A 3RP2A 1ID5H 4LOYH 3TK9A 1DLKB 1O3OA 2SGDE 1INCA 3OAAD 2BY5X 2ZPQA 4B74A 5GIBA 3MH5A 4F48B 5HKKD 4KTSA 2A7JA 5HYOA 5JPMH 4F55A 1CVWH 1ZZZA 1P57B 1XKAC 3LPRA 1TA6A 3HK3B 4B71A 3S9CA 2EI6A 1SMFE 5FPTA 3ELAH 3M7UA 3PV2A 3RC5A 2OD3B 2ZHDA 3F2FA 1TABE 4JZEH 5LPFA 5ABWA 2JH6D 1THRH 1MAXA 1EASA 3A7ZA 8GCHF 1ZR0A 5AFZH 4CR9A 4X2VA 3GDVA 3UR6A 4NIWA 2XCNA 4ISHH 3QWCH 3ZZDA 4YLQH 3RXKA 1PQ8A 1V2JT 2FX6A 1ZMNA 2BM2A 2HOBA 3EDXB 3PLKA 1QFKH 3RC6A 1YCPM 1E36B 5T6DA 3K6ZA 1TMTH 1V3XA 4KKDA 1WTHD 1V6DA 3P17H 1DX5M 2WV5A 5GJ4B 1AKSA 4AGJA 3BTHE 1W2KH 1HAPH 1PFXC 3OEHD 3SUFA 1W8BH 1BTPA 1BTYA 1C1TA 1LPGB 3SU0A 1IHSH 2SNVA 2ZU2A 2WZQA 2VINA 3PM3A 1BTXA 1GVKB 2Z9GA 1L0ZA 1F0SA 5FPYA 3KHVA 2PGBB 2SGAA 2NU4E 1P04A 1C5TA 1MTNB 4O3TA 2A7HA 2JETB 2G55A 3R3GB 2HNTC 4OGYA 2ZDMA 2WPLS 2BZ6H 3E0PB 2SGEE 1GI4A 4MG3A 2FLRH 4D7GA 1GBDA 5A8ZA 1Y59T 3M7QA 1K1JA 1OPHB 3B9FH 2AHME 1E34B 1QA7A 2PLXA 4NWKA 2HLCA 1ESBA 1G2MA 4DGJA 1GL0E 1YF4A 2ANMH 1P2MA 2F3CE 4K1TA 1P9UA 1UTQA 1C1WH 3MQKC 2VIDA 4RN6A 1MTVA 4FUHA 3PRBA 5E8EH 2JJ2D 1GHVH 3M36A 1DWEH 1AU8A 1G3BA 3UIRA 2GD4B 2FOMB 3NXPA 1HIAB 1O34A 3QX5H 2P8OB 3GY2A 1BRCE 2ZTYA 1GHYH 2TRMA 5A0AE 1GMCG 2ZTZA 3BG8A 3KCGH 3VB4A 3QTVH 1GBMA 2XTTB 3QZRA 1TRYA 1ANDA 5T6GA 4ZH8A 4K3JA 1SG8B 4MPUA 5C1YA 4X1QU 1TBZH 1SQAA 3M3VA 3UNQA 1P2NA 1C5RA 3A8DA 2A4GA 5CE1A 5DP9A 5DPAA 3QO6A 1L2EA 1A2CH 4LK4A 3ZIAD 1HAZB 1P03A 2XC0A 1G32B 5FHTA 1SLWB 1P3EA 3ODFA 1PQ5A 3QGJA 3RXCA 2ZPRA 2ZKSA 1BJVA 3GOVB 2H1UA 3DSOA 3MU1A 1IQLA 1EP6A 2FOBA 1RRKA 3P95A 3MU5A 1AN1E 2EEKA 1THPB 1LHDH 2SGPE 3UQVA 1C5NH 1OWJA 3SJ8A 1GJ7B 1UVPA 3FAOA 4IN1A 1CQQA 1FPHH 1E37B 2KFWA 4F49A 4AG1A 1YLCA 3JZ1B 3Q3XA 2FTLE 1O2OA 1ETSH 4DJZB 2DE9A 1J9CH 4I7YH 1O2LA 3ZZ7A 4DW2U 3LIWA 4UD9H 4I86A 2ZQ2A 3MHWU 2QXGA 3UQOA 1Y3VA 1C5PA 2ZHWH 3PTBA 4WXIA 1YBWA 1LVBA 3RXDA 1O32A 1GBBA 3U28C 4CRAA 1ESTA 1JOUB 2FESH 1HAOH 4TPYA 2ANKH 1LKBA 2VU8E 1SB1H 5IYTA 1QBOA 1ZYOA 5DP3A 4JZFH 3SU1A 1P2OA 3RXAA 2A32A 2EY4C 1O3JA 3TGJE 4PROA 3UFAA 3PROA 1LKAA 4JMYA 5EJLA 1SL3A 1PJPA 1VCQA 2PGQB 1CBWB 1FY1A 3NZIA 8KME2 1O3BA 3D65E 1O2VA 3D62A 1FX0B 4NFEA 3A80A 1G2LA 3LGVA 5DSFA 2BX4A 1EP5A 3DD2H 1WCZA 1K1PA 4Q7XA 1C4U2 3KN2A 3KQCA 2Z94A 4CBOA 4FUEA 2D2DA 5JYIA 3BEIB 1D3TB 5HM9A 4E05H 2ZFFH 2OC7A 1O3DA 2CHAC 4YZUA 5BRRE 1NC6A 3QZQA 2K8IA 4INHA 5DP8A 1Z8GA 2CN0H 2TBSA 2BDCA 1F5KU 4FUGA 4FVBA 1SI5H 4YT7H 2K1QA 1BTWA 1Y3YA 2ZHFH 2A45B 4DG4A 4CRGA 2UWOA 4DT4A 1VZQH 3GCTF 4Z0KA 1O33A 3MFJA 1TNIA 2LP6A 1C2IA 4ZKRU 1DY9A 1DFPA 2AIQA 4GVUA 4ABFA 5F8XA 2WINI 4AORA 2F9NA 3S0NA 2GT7A 1GHZA 3C1KA 2HRVA 1P02A 4K1EA 3PWCA 1RTLA 2BLVA 1RTFB 3UNRA 1Y3UA 1C2LA 3ENSB 3TH4H 2XNIA 4Z6AH 3LGIA 1VR1H 3PYHA 2C93B 1Y8TA 2F91A 3VB6A 3HATH 2FX4A 1G37A 1LTOA 1GCTB 1LHGH 1GMHF 3F9FA 3SUGA 1WQVH 1BMFD 1TOMH 1GJ6A 5DG6A 3RXTA 4AOQA 4OM9A 2GMTC 5E2OA 2FOAA 1E1RD 2BVSH 2XYAA 2IJD1 2WPIS 1ESAA 1V2TT 1UO6A 1ACBE 4B6FA 3SQHE 1FY4A 4KGAA 4X2WA 2I6QA 2ZEBA 3E1XB 2Q6FA 3ZZ6A 2G51A 2J2UA 2H2ZA 3M5MA 1EZSC 2Y81A 1C1OA 4FXGH 2J34A 3BG4B 3OYPA 3FP7E 3E91A 3RM2H 2GKVE 3RXSA 2ZGHA 4XBBA 3MH6A 1W0YH 1T8NA 2QIQA 1NU7B 1YC0A 1EXFA 1TPOA 2WYGA 1MTSA 2HGTH 4YOIA 3GYLB 4CHAB 4BTTB 2BQ7B 1QIXB 2Y5GA 3EE7A 4NZQA 1SGFA 3DHKH 2ZCKP 2FYQA 1LCYA 2ZU4A 5DO4H 1BIOA 1MBQA 2UUJB 3T25A 4D8NA 1A3BH 2HVYB 2DUCA 2P95A 2GTBA 3PB1E 4IW4E 4MQAA 4RKJB 1LQDB 3V7TA 2P94A 1W10U 4TWYA 1KY9A 4B1TA 1BRUP 1O3HA 4X8VH 4FUBA 1QZ8A 1SHHB 1ARBA 1KSNA 1O3IA 1AFQC 2GZ9A 1KLIH 3TNSA 3PRDA 1OYQA 1BHXB 1KXEA 1IAUA 3QDZB 4HFPB 4TWWA 4UONA 1O5GH 2QE7D 1Y5BT 1BTUA 3FANA 3O8BA 1GJ9B 1O38A 2TGDA 1CSOE 1HGTH 2L6OA 1NPMA 1WOFA 1SQOA 1NRPH 4INLA 4IMZA 3LJOA 4DCDA 1CA8B 3F0PA 5C1XA 3WY8A 1ZGVA 2STAE 1KIGH 2FO9A 1YLNA 2FI4E 1YY3A 3N99A 1CE5A 2VWOA 1SGDE 4GCHF 3PWBA 2GV6A 2KCPA 3PMHB 1TX7A 4UDWH 1O3GA 1VJAU 2FI3E 3Q3KA 3QUMP 3OU0A 3I77A 5C67A 4IC5A 1UVTH 1UHBA 3RXUA 2J98B 1ZHPA 3SU2A 1HAVA 3LOXA 1BA8B 1EUFA 4TY6A 4NA9H 1J16A 3VXEH 4AN7A 1ELVA 1BRAA 2GZ8A 3EA9A 1HXFH 2C8WB 2CXVA 1J17T 2IN2A 2PKSC 1AB9C 4MPWA 3ZZ4A 4Q4LA 1EFRD 3HK6B 4WVPE 1N6YA 1ELDE 1TNJA 2BD5A 3L33A 4ISLA 2GCTC 1GI9B 4OS1A 3B8JA 4Z1MD 2ZDNA 3MU4A 1OWEA 1PPZA 1T8MA 1O2NA 2ANWA 1P09A 4ZXXH 3A85A 5EXLA 1EJMA 3PMBB 1PYTD 1O2XA 2BY6X 2BY9X 2V3MA 1QNJA 3GY6A 1ZTLA 1YCPH 2J92A 4Y7AA 1V2UT 4OS4A 1BCUH 1H4WA 3TLOA 5JBAS 4KTUA 3E8LA 1FN6A 1FZZA 1HCGA 4K5ZA 3E3TA 5HIYA 2BY8X 2OQ5A 5EXNA 2B0FA 1ZSLA 1FDPA 4X6PA 1NRNH 3ATLA 1YPHE 4U30A 4A1TA 2BDAA 4X1PU 4BAQB 3ZVGA 4XOJA 4XBDA 1YGCH 2ZPSA 4MPXA 5FXLA 3AW1A 1GI0A 1O39A 2C8YB 4IMQA 1HRTH 2FOHA 1SGYE 3GCHC 2O9QA 1NM6A 1BMNH 1TB6H 3G01A 3KQDA 4LXBH 2SFAA 2VWMA 5C20A 1KTSB 1NBMD 2ZIQH 2G81E 3EA8A 2ZA5A 5F53A 3UB0A 1AY6H 1HAHH 1XUHA 2OLGA 5TJXA 3BEFB 3CP7A 1A46H 1AVWA 3RUOA 2FS8A 4FUCA 1C2JA 4NIYA 3LGYA 1O2PA 1V2PT 1GI5A 1TPAE 2NWNA 2AH4X 1EAXA 1YPKH 2J97A 4D7FA 1RIWB 1MCTA 5ESBA 3UWIA 1C2KA 1Q2WA 3UR9A 4AYYB 2PUQH 2Y5HA 2XBVA 1EPTA 1CO7E 1IOEA 5LPEA 1TAWA 4HZHA 1T4UH 1VCPA 3A8CA 3F9EA 1M9UA 4UEHH 1C5XB 2SGFE 2BMGB 4AX9H 1D6RA 1BQYA 1P2KA 2GCHF 2VBCA 5JB8S 3ZV8A 1BMAA 3RXGA 1EZXC 1TMUH 1GBCA 2VIVA 2Y80A 3RMLH 2V7QD 1E35B 4I8LA 2ZU1A 4THNH 4WMDA 1ZPBA 5BPEA 1ELEE 1GGDB 2DE8A 1EZUC 1H8ED 1MD7A 2GT8A 5LGOA 1RTKA 2Z6BD 3MNSA 2KZ4A 2SNWA 1QB6A 4X8TH 1U6QA 3RXMA 1HFDA 3VXFH 1O30A 2ZU3A 2OK5A 5DJ7A 3GCOA 3SGBE 3P8FA 3S7KB 3MOCA 5LH8A 2G52A 5JDUB 1VKYA 6LPRA 3B23B 2NU0E 3BIUH 5AVDA 3OE7D 4BTIB 1GG6B 1O2SA 1IQMA 1QL7A 2A4RA 6CHAB 1DSUA 3C27B 2ZGXH 1O2YA 1S6LA 5FX5A 1VITG 1BHXF 1ZSKA 4AGKA 3RXOA 1DPOA 2AMQA 2H5DA 2ZO3H 2F9UA 3BG4C 1JXPA 1P8VC 3LGWA 2XBYA 1SC8U 3FFGA 2BOKA 1BOQA 1QL9A 3VGCC 2GJGA 3AK5A 1GJAB 1K1IA 1DSTA 2AERH 4SGAE 1H9HE 2VIQA 2UUKB 4BANB 3UOUA 4GHTA 5DGJA 1C2EA 2Y82A 1YP9A 4R8TB 4BOHA 1T32A 1YKTA 3F68H 1ORFA 1Y3WA 1C2FA 1FI8A 1S0QA 1GJCB 1DM4B 1LO6A 1MUEB 2F4LA 1CA0B 4M7GA 3VB5A 1K1OA 5HGGA 4I33A 4XDEA 2QF0A 1B0EA 2EA3A 5JB9S 1TNGA 4GPGA 1CU1A 2F9BH 3SGQE 2BDBA 5FCKA 1C1PA 5IDKA 2BHGA 3NWUA 2V35A 3F3BA 2XWBI 1B5GH 4WH6A 2QA9E 4INKA 1DICA 2WHXA 5DK1A 1NT1A 4A5TS 1K1NA 5DKMA 3UY9A 4A1XA 3EYDA 1RFNA 1UK2A 3BIVH 3O8DA 2Y6TA 5GCHG 1QURH 2FOEA 3P8GA 1ZSJA 1FAXA 2F9VA 2F83A 3RXBA 3SV2H 2H9HA 1JBUH 3MH7A 3W94A 2XNDD 3BTTE 3U9AH 3ZZ8A 4WJG2 3HKIB 2P16A 2JKHA 1BJUA 1IQGA 1P0SH 2R2MB 2H6MA 2J98A 2Z3EA 2BQ6B 1QA0A 2CJIA 4ZKNU 4DURA 4ZKOU 1F2SE 1TQ7B 2GCHG 1AFEH 1KDQA 2EQNA 1SVPA 1FY5A 1H8HD 3V12A 5EOKA 2VJ1A 3TH3H 5AFYH 1GHBF 1O3PB 5AF9H 1AD8H 1TLDA 1DVAH 1GMDF 1O2RA 4Y0ZE 1F0TA 3K2UA 2UUYA 5EQSA 1ANEA 2VVCA 1MKWH 1T31A 1KXAA 4B6EA 3WWFA 1UCYK 3T26A 1K22H 3SNBA 2BD7A 3RXHA 4TYDA 1C2DA 1KMHB 1UHBB 2Z9JA 2LPRA 4VGCC 1EJNA 1VGCB 1HAVB 1CHOF 1V2OT 2BLQA 1A5HA 3BF6H 1D6WA 1YPLH 1AMHA 3TGIE 2FOGA 4A1VA 6GCHG 1FXYA 7ESTE 3NPSA 4MVNA 3OY6U 3NKKA 1K28D 1KXCA 5HIZA 1TX8A 2ZP0H 1FIWA 3M5NA 4KP0A 2G5NA 1BT7A 2G00A 1MQ6A 3AAUA 1QJ1B 1T8LA 1TPSA 1FPCH 1DE7H 2UWLA 3ATMA 3F9GA 2WPKS 4FOUC 1BBRE 1P2QA 3RU4D 1SLXB 3UUZA 4HTCH 3STJA 3DUXH 2QGRA 1GI3A 3VFEA 1N8OC 2PFEA 5DP5A 5CHAB 1S0RA 1W0KD 2FWWA 5EW1H 1TOCB 1K1MA 3LU9B 1XUJA 4I8GA 5J4SA 1NESE 2QAAA 4Y8YA 8GCHG 3QLPH 1O2KA 4B73A 2OINA 3S7HB 3WW7A 1NFWA 1C5ZB 3GYMA 1H8IH 1GI8B 4H6SB 1AUTC 1E79D 1OSSA 1AWHB 1ZPZA 3ZYEA 5EODA 4K2YA 3A8AA 4DT7B 2HPQH 1RIWC 1FONA 3A81A 2ZDKA 1GDNA 1GBJA 4XD7D 7GCHF 4ZAEA 2BLWA 4ABJA 4AFUA 1A5GH 3URDA 4K60A 5FPSA 2BD3A 3OEED 1P06A 2J5UA 1HJAC 2R0LA 1GWAA 1LQEA 1O2TA 4JZ1A 1C1NA 3EE0B 3P92A 5JBBS 3FZDA 2PW8H 1L4ZA 4IC6A 1JRTA 3ZZCA 2BD8A 1V2MT 1QB9A 4MNXA 1C5OH 1F0UA 3A84A 1AWFH 2HVXA 4ASHA 1HAYB 2YMSC 1W7GH 1MMJN 2XCFA 2KCAA 1FQ3A 2ZI2H 1VJ9U 3DSGA 3EAJA 1JIRA 1WAYB 2J4IA 1LHCH 1GI7B 4K69A 1DWBH 1EPTB 1ZLRA 1O37A 1QJ6B 1ZMLA 2W3KA 1TPPA 2AGIX 4ABBA 1QTFA 4ACAA 1C1SA 4B2BA 1F7ZA 1GGDC 2VVUA 4RI0A 3LH3A 2XC4A 1TFXA 1GJBB 1SLVB 3A87A 3LONA 3F1SB 3TJUA 1CGIE 1QQ4A 2CV3A 2FIRH 1MU6B 2WPHS 2F9PA 2QXHA 2BXUH 3N7OA 1UVOA 4WMEA 3TIUA 1B7XB 4NA8A 1QRWA 2JH5D 4X1RU 1YPGH 1MTWA 4RKOB
chains in the Genus database with same CATH topology
1F92A 3VB3A 2Q6GA 3M5LA 2VH6A 2VIPA 1WBGB 1PPEE 1A61H 2YOLA 4O97A 1W7XH 2OC8A 3PTNA 4LZ1H 1ZHRA 1O2ZA 1YPMH 2CF8H 1GBEA 3TVJB 1WV7H 2P93A 1DXWA 3M3TA 3TH2H 2ZFTA 3TPIZ 5F6MA 3M37A 3ESTA 3BTFE 3LGUA 1UTNA 3NK8A 1S81A 1OOKB 2PHBA 3MMGA 1DY8A 1O3CA 3E90B 3OX7U 3LC3A 2ZZUH 1KXDA 2Y5FA 2Q1JA 4UFDH 2SGQE 3P6ZB 3U1JB 1TNHA 2H9TH 3M7TA 3MU0A 3ZZ3A 4XFQA 1OS8A 2WPMS 2ZWLH 7KMEH 4Y10E 1Z71A 1BTZA 1HB0B 4X2YA 2FPZA 2VGCB 2IOTA 1JIMA 2R3UA 1UCYE 4CBNA 1O2HA 3UWJH 3UPEA 3RMOH 1UVSH 1UTKA 1FN8A 3MI4A 3RC4A 1KYNA 4Y79A 3PO1B 3UOPA 2BYAX 1O2GH 1C1VH 4Y71A 2BOHB 1DWCH 3QK1A 1DS2E 1IQJA 3SU4A 1Z1IA 1DDJA 2FOCA 4MNWA 3ZYDA 4CREA 4FVDA 2VB0A 1FAKH 3A83A 1LDTT 5E0GA 5ETXA 2A2XH 1S85A 1THSH 3GY4A 1MTNC 2HNTE 2JETC 4Y6DA 4YM9A 1PPBH 1O3EA 1UJ1A 2XW9A 1HJ8A 4O03A 4ABAA 1GJ8B 2PR3A 2O8TA 3D23A 1KLTA 4DVAU 3H7TA 1V2KT 1QL8A 2AS9A 1FMGA 1BBRH 3QTOH 3T2NA 3TK5A 1EAWA 5ESTE 5E2PA 1P01A 4ABIA 5B6OA 4MDSA 2OC1A 1CT4E 3E16B 1BDAA 3SUEA 5EGMA 8ESTE 3U1IB 3PMJA 4AZ2B 4H6TA 5FBIA 1SGRE 2BD9A 2P8OC 1AZ8A 5EPYA 5T6FA 2ESTE 3BTEE 1CT2E 4O9VA 3LKWA 1NS3A 1AZZA 1XMNB 1GHWH 3FP6E 1TYNA 2C8XB 1O3LA 2WV4A 3GY7A 2FXRA 2RCEA 1T4VH 1XX9A 1Z1JA 2IPHA 2B9LA 1XM1A 3GCTG 3SNEA 1V2LT 1GBTA 1SGQE 1DUEA 1KXFA 1TA2A 1UTLM 2Y7XA 2HPPH 1O5FH 1KDQB 5CMXH 3PLPA 1W11U 1BRBE 1OKXA 1DXPA 1PQAA 1Z8RA 4NWLA 1O5BB 1E0FD 2R9PA 1V2WT 2Z3DA 2FI5E 5LPRA 4WH8A 5K0HA 1NROH 2OBQA 1KTTB 1LPKB 1OP8A 3URCA 4NCYA 4ZROA 4Y0YE 1C1RA 1QBVH 2TGPZ 1MBMA 2PSXA 3ATKA 2PTNA 3HPTB 1BUIA 1G3EA 1GMHG 4FUDA 4SGBE 1ANBA 2OXSA 1MZAA 2TIOA 2ZNKH 4XSKU 4NSVA 3BEUA 5FCRA 4CH8B 3SV9A 4YO9A 1GBHA 1TMBH 4ABHA 1ELAA 1FY3A 2R2WU 3SJIA 1WTGH 3Q3YA 1O5EH 1FY8E 1D9IA 2BXTH 2ZQ1A 1GI6A 1OWHA 2V0BA 2ZFRH 1EATA 3TITA 1HAIH 2CF9H 1ARCA 1J15A 1L1GA 2GDEH 2ZGJA 4GAWA 3RXRA 3ITIA 3H7OA 4K8YA 2B5TB 3SU3A 2GP9B 1JMOH 3EGKH 4X6NA 1RD3B 3SO3A 3V13A 1D3QB 1O5AB 1SBWA 1TRMA 2BX3A 3CENA 4ZHAA 4AFQA 4X0WU 1CHGA 2FYRA 4ABDA 1RXPA 3V3MA 1T7CA 3OTJE 3U8TH 3MYWA 4CRBA 4NG9H 1XUGA 5DP6A 1PPFE 5T3HA 2RA0A 1CBWC 1AI8H 4CR5A 1HDTH 2FTMA 2OBOA 2PTCE 1ZOMA 1LVOA 2AYWA 1PPCE 1FJSA 1Y5AT 2A5KA 4Y8ZA 2P3UB 3SI3H 2WUCA 5C3NA 1YPJH 1B0FA 1ELCA 3UNSA 1A5IA 1W0ZU 1RS0A 2OTVA 4K1SA 5SGAE 1FLEE 1Z6EA 2FP7B 4YTAA 4NIVA 2XXLA 5HXFA 5EQRA 1C1MA 2ZFPH 1Y5UT 1EPTC 1UCYH 4U32A 1MCVA 3VEQB 5HM2A 3ZVEA 1LHFH 2ZHEH 3AASA 1WUNH 1GDQA 1SPJA 1TIOA 2ZCHP 3R0FA 1QCPA 3U8RH 1KXBA 2O8MA 2HWLB 1IQNA 7LPRA 1O3NA 4K8BA 4JK5A 2FZZA 9ESTA 1KLJH 1GBFA 2G4TA 1W12U 1AUJA 1C4V2 4GCHG 1A0LA 3DFLA 8LPRA 1P2IA 4CRDA 3O8CA 4BAMB 2P3TB 1Z6JH 5AHGH 4AYVB 1OWIA 2NU2E 4H4FA 1HJ9A 2XBWA 1P05A 1N1LA 1ZTKA 2NU1E 4MLFB 1SGEE 5FX6A 3I29A 1O36A 1TALA 1GCTC 3BTME 3D49H 4DOQA 1D3DB 3ZVDA 1UTOA 1D3PB 4OGXA 2CHAB 5H4IB 1UTPA 1YYY1 1QR3E 3RU4E 1UK3A 1FIZA 2BY7X 1H1BA 1GMCF 1TBQH 4NFFA 3NUMA 4Y8XA 1TONA 1SSXA 4DY7B 1OP0A 2I6SA 2H5CA 2C90B 1ZMJA 1JRSA 1HBTH 1A0JA 3SORA 3L3TA 2ZHQH 4AFSA 1C5SA 2A31A 5A09A 1NN6A 3W95A 1G3CA 4NGAH 4B2AA 1O2JA 1ELGA 1O2WA 4CRCA 2ANYA 3SN8A 1Q3XA 1A7SA 1C1QA 3FP8E 5EPNA 2BTCE 3LJJA 3PO1C 3MO3A 2TGTA 3T5FH 2ALPA 3OSYA 2R0KA 1XVMA 4CHAC 1S84A 4IGDA 4X2XA 3JZ2B 1C1UH 2OUAA 2PSYA 1NRQH 5G4BA 3EA7A 4B2CA 5JBCS 1C5MD 3EQ0H 3HGNA 1G9IE 5F8ZA 2GMTB 2RG3A 3STIA 4HI3A 4X6OA 1HAGE 3GICB 5A0BA 2QY0B 2XC5A 3MU8A 3ZZBA 3F6UH 4ABEA 1PPGE 3SJKA 3MNBA 2OQUA 4LZ4B 1X7AC 1BZXE 3FVFB 1XXFA 2HNTF 1TQ0B 2CMYA 1MQ5A 5C5OA 1XUIA 2NU3E 2GX4A 4E7RG 1GBKA 1BMMH 1WYKA 2Y7ZA 2OC0A 2PKAB 2EC9H 1W14U 1Z8JB 2ODYB 4JCNA 3SW2B 2ODPA 4FUJA 3TGKE 1GBIA 2V6NA 1DUAA 1CGJE 1GL1A 2AEIH 1D4PB 4TY7A 3VB7A 1NZQH 3SU5A 4I8JA 5JBTA 4IN2A 1BMLA 1O0DH 2AMPA 5A0CA 2VH0A 1V2RT 1DT2A 5GDSH 1W3CA 1YCPK 1GPZA 2W26A 3LDXH 4D9RA 2ZDLA 3SU6A 4WWYA 1XUFA 5GPIB 1QBNA 4JYTA 1AFQB 4RSPA 1O2UA 2THFB 1N6XA 1IQIA 1W13U 3RXPA 2A5IA 2QCYA 3VPKA 3T28A 1MU8B 1ZRBA 3GDUA 3P8NA 4R0IA 2YNBA 4D76A 1H9LB 3KF2A 1K2I1 4UE7H 4BAKB 1L1JA 2ZGBH 3GY5A 4UFFH 4HGCA 5K7RA 3QN7A 1Y3XA 5EU8A 5HMAA 3SI4H 1O3AA 1NO9H 1QB1A 5C2ZA 3QGNB 3MWIU 4MNVA 1MD8A 4YOGA 3S9AA 3Q76A 2A2QH 4CH2B 2EI8A 3SUDA 4CRFA 1C5WB 1GJ5H 4BTUB 1EAIA 4Q7YA 3BV9B 2A5AA 5FAHA 3MO6A 2A1DB 1GHXH 2D1JA 3ATWA 4FU7A 2V3OH 2JH0D 1CT0E 1UMAH 2QF3A 4E7NA 1O3MA 2J9NA 3LT3A 3A88A 5E0JA 1NRRH 1ZPCA 1K21H 2KAIA 5I25A 2IJOB 3NCLA 3MTYA 2FS9A 1EX3A 1O2IA 1FUJA 1PQ7A 2B7DH 2QN5T 3A7WA 1SFIA 1IQKA 2WUBA 4ISIH 2GDDA 2VWLA 3SQEE 4A6LA 1SOZA 2ILNA 1Q31A 1C2MA 3E6PH 2PKSB 3IG6B 1AB9B 4I8HA 1FV9A 1SGPE 4U2WA 3K9XB 3AW0A 1P10A 1MH0A 2GCTB 1SLUB 1AGJA 1ELBA 4FU8A 4WF8A 4XBCA 3KL6A 2F9OA 3BTQE 1AO5A 2J95A 1NTPA 4FUIA 2BD4A 2ZFQH 3DA9B 1MKXK 1H9IE 2BVXH 1EOJA 2PWXA 1G36A 2ZG0H 2Z7FE 1HV7A 1ZJKA 1S6HA 1SGNE 2XRCA 3P8OA 1RJXB 3S69A 2AGEX 1XXDA 1NRSH 1ZGIA 2FM2A 1C5QA 1YPHC 2ZU5A 4GSOA 1GI2A 4WMFA 4Q7ZA 3GCHB 1QQUA 3UTUH 2W7SA 1XUKA 2ALVA 3BTKE 4KELA 4FU9A 4MNYA 2GGVB 4BXWA 4JZDH 3ZVFA 1O2QA 4J2YB 5A8XA 4J1YA 1AE8H 1P12E 3OY5U 2G5VA 1H8DH 1V2NT 3LC5A 1DWDH 1G30B 2ZECA 3PV4A 1GHAF 4Y7BA 1O35A 4WXVA 1QRXA 3BTGE 2O8UA 5C5NA 4U01A 3GISB 3RMNH 1GHBG 2BVRH 4I31A 1EJAA 3AVZA 3S9BA 1AVGH 2WPJS 4Y11E 4YLUA 1C2HA 2A0QB 1GMDG 1SGIB 2WYJA 6ESTA 1S6FA 2BDYA 3M35A 3P70B 1GBAA 4GUXA 5EG4A 4DIHH 4DIIH 2FLBH 1QJ7B 1ELTA 1O3FA 3KNXA 1TGBA 4ZHLU 3ATIA 1GG6C 1O3KA 3A7TA 3U69H 3RXJA 2RDLA 2UUFB 6CHAC 2A4QA 2D26C 1TRNA 1HAXB 4IBLH 3SOSA 9LPRA 3BTWE 2QV1A 2QYIA 1CHOG 3A7VA 3SJOA 3TJNA 4JYUH 1T8OA 1NFYA 3RXIA 1F5LA 4D9QA 3RXEA 2ZTXA 1GJDB 1HYLA 3ODDA 1LPZB 3ZZ9A 4YESB 1MAYA 2W7UA 2V3HH 2PUXB 3HGPA 2H9EH 1GCDA 1NFUA 4NZLA 4OS6A 3A7YA 4UFEH 5DP4A 1XKBC 1EKBB 2A4OA 4X1SU 1CGHA 4ZKSU 2ZCLP 2QXIA 1BTHH 2HALA 3RDZA 2LNCA 1GI1A 2TPIZ 1GJ4H 1HNEE 1CA0C 3MH4A 2W3IA 3V0XA 2BQWB 3M61U 2Z9LA 1ZTJA 3SNCA 1LVMA 5A2MH 4AG2A 3K6YA 1QHRB 1ABIH 2FODA 3KQBA 1O31A 1SQTA 3CS0A 2OP9A 1ETRH 1MKWK 1VCWA 4ZUHA 1UK4A 1IQEA 1QRZA 2M5TA 2PKAA 4WY3A 2BB4A 2W5EA 3GCNA 1F0RA 4ISOA 3VGCB 3Q77A 3T27A 1GVLA 1C9TA 4X1NU 3DT0H 2FDAA 7GCHG 2ODQA 2D8WA 1UTMA 3HKJB 5E0HA 3KQEA 1DOJA 1ELFA 3SBKA 2AGGX 2G8TA 1TNLA 2CGAA 4ESTE 1LMWB 3GY3A 2QXJA 2J38A 1DLEA 3TJVA 2Z9KA 1QY6A 1ZJDA 1DANH 1WU1A 2Q6DA 1ABJH 2J94A 4X6MA 1V2ST 1P9SA 1C2GA 4ZHMU 3SV8A 1P2JA 3Q00A 1VITH 2C4FH 4YT6H 4QT8C 4BNRA 4I8KA 2AFQB 3M3SA 5F8TA 3ZVBA 1C4Y2 4AB9A 2Z3CA 4GHQA 2EI7A 5J4QA 2FMJA 1TBRH 1E38B 2AIPA 3K65B 2ZDAH 1AKSB 4OS5A 1JWTA 5F03A 1AQ7A 2A7CA 1NFXA 1NU9A 3ZZ5A 4AFZA 2O8LA 1GHAG 5L30H 2BZAA 1EB2A 3TU7H 1TWXB 3U8OH 3A82A 2ULLA 1HIAA 1EAUA 1J14A 2ZFSA 3KIDU 3O8RA 1SHYA 1V2VT 2VNTA 3DFJA 1VGCC 1O2MA 4BXSA 2TGAA 3KGPA 2XWAA 3SGAE 3A89A 3RXQA 1S5SA 4NSYA 1C5UA 1S83A 1OYTH 1AHTH 3T62A 3A7XA 3SHAH 4ISNA 1TGTA 1FNIA 1OWKA 1ZRKA 3I78A 1C9PA 1A0HB 1QGFA 2VIWA 3PLBA 3RLWH 2C8ZB 1MZDA 3M5OA 1SGFG 1TGCA 1Z8IB 2UWPA 1SGCA 4Q80A 5TCAA 4ABGA 2ZGCA 1TNKA 4X8UH 1Z7KA 1YLDA 1SGTA 3SNAA 5CHAC 4BAHB 4NA7A 1OX1A 4OS2A 3LH1A 1EZQA 2O8WA 4A92A 1VITF 1A3EH 2P3FH 3RM0H 1GVZA 4JK6A 5A8YA 2Z9IA 1F5RA 2BDGA 4VGCB 3ZVCA 4IS5A 4NIXA 5EQQA 3IITA 2KAIB 1IQFA 2XBXA 1HLTH 2ZDVH 5TCCA 3GY8A 3SHCH 1O5DH 1XVOA 1YM0A 3PMAB 1TX6A 1WSSH 2BLOA 2B8OH 1TGNA 1O5CB 1ANCA 4BAOB 1EQ9A 2P59A 4I32A 1OP2A 2BDHA 3RLYH 2BDIA 3FZZA 4O3UA 4XE4A 1GBLA 2STBE 3BTDE 1S82A 1AE5A 1MTUA 5C1UA 1EB1H 3F9HA 2R3YA 1P3CA 1J8AA 4X8SH 1DITH 1V2QT 1IHTH 1A4WH 3A8BA 1N8OB 1LVYA 4TPIZ 2FOFA 4MPVA 1TGSZ 3IWMA 3LGTA 5L2YH 3SNDA 1YPEH 4OS7A 1EOLA 1AVXA 1L1NA 3SZNA 1TE0A 3RXLA 1HXEH 4JZIA 5L6NH 4ZMAH 3SV6A 2GVFA 2ZF0H 5FBEA 3ZZAA 4Q2KA 5GCHF 4AB8A 4A7IB 1OXGA 4KTCA 3MNCA 4F4OC 1G3DA 1NY22 5EXMA 3BSQA 1WQSA 3TJOA 3TNTA 3KEEA 4YOJA 2ASUB 1HJAB 2RA3A 2ZC9H 5I46H 2OCVB 4GLYA 3CS7A 1SOTA 4E06H 5GXPA 1K9OE 1PPHE 1ETTH 1L4DA 3MNXA 1K1LA 1SR5C 1IQHA 1BITA 4B75A 1ZHMA 4MTBA 2VWNA 3GDSA 5GWZA 1UTJA 3RU4T 1SFQB 3AAVA 2FEQH 1AIXH 2GV7A 3E0NB 1LHEH 1C5YB 3UREA 5EW2H 4JYVH 1RGQA 1HPGA 3A86A 2VIOA 1C5VA 1P11E 3MO9A 1HUTH 2YNAA 3U98H 4H42U 3TK6A 3L6PA 4UFGH 1BBRK 1GDUA 2QC2A 4Y76A 2VVVA 3RXVA 4FUFA 2AMDA 1BB0B 2GZ7A 2C3SA