3PTQA

The crystal structure of rice (oryza sativa l.) os4bglu12 with dinitrophenyl 2-deoxy-2-fluoro-beta-d-glucopyranoside
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
478
structure length
478
Chain Sequence
PVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of rice (Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-glucosidase with significant thioglucohydrolase activity
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
molecule keywords Beta-glucosidase Os4BGlu12
total genus 190
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ptqA00
1GHRA 4D6JA 3WEMA 3SCUA 2VQTA 4ZENA 1C91A 1H0IA 4BCEA 1KBBA 1P6WA 1CXHA 4UR9A 2X0HA 2YLLA 2WCAA 3N1AA 4UOZA 1CPUA 1TA3A 4W85A 3TTSA 4DM1A 4MJ4A 1OM0A 3WNKA 1E4IA 1QI5A 3KL3A 3CZJA 3L4ZA 4UQDA 1JXKA 1NQ6A 1V6UA 2HVMA 3EDJA 1BSIA 4D6HA 3VD5A 3WDRA 1FFRA 1GCYA 2PWEA 1V3MA 5CZKA 2YA2A 4FF5A 3LMYA 3WFLA 4ATDA 4CD8A 1E40A 1H3GA 2VZVA 3U5UA 4X0VA 1HVXA 4ZFMA 2W62A 1VAHA 4MAZA 1CGXA 4TVDA 1DTUA 4J27A 1JFHA 2JIWA 4QP0A 4PUDA 4ACZA 2EPNA 5GNYA 3VD3A 5A6BA 2EPMX 2PWHA 1WZMA 3F5JA 3GH7A 1H5VA 1JL8A 2WMIA 4W93A 1PAMA 5HPOA 3AMCA 3OBAA 2YKKA 1L8NA 1H4PA 3BMVA 1UWIA 2WMFA 1J10A 4M24A 1SMAA 1JF5A 2CNCA 3T0DA 2JEPA 3II1A 1KXHA 3LPFA 1VEOA 2WZIA 4AIOA 4IISA 5A6BD 4K68A 3VINA 8CGTA 2ZUUA 3WFZA 1TR1A 2G4FA 1V6YA 1HP4A 3DYMA 2ZUTA 2CETA 1UQYA 2CERA 1C90A 4RE2A 4L4OA 4Z2KA 4JL2A 1V0MA 1KGWA 3BAWA 3S2CA 3ZJKA 4B16A 4AD1A 1E6XM 3AS1A 4FMVA 2DQXA 3FAXA 2VI0A 1E0XA 1OCQA 3CMJA 2GVYA 3N15A 1A3HA 3W81A 4AMCA 1PX3A 3VNYA 2GJXA 2E0PA 4Z2LA 3MUZ1 5A6AA 1BAGA 2DSZA 4LYQA 4Z2JA 3WNPA 3T09A 2WMHA 2BVTA 4BQ3A 2E40A 2VZTA 5A94A 4TXEA 2CCRA 2B31A 1QPKA 3AMKA 2BNJA 3AJ7A 2EXOA 4BS0A 1WDQA 3AXXA 2XM2A 3IJ7A 5FD0A 4OUEA 1QNSA 4HTYA 2CBJA 1EIBA 1GW1A 2EQDA 2WHKA 3WD3A 1OIMA 1N82A 1UD3A 3MUY1 1CXFA 3W6LA 3WUBA 3ARZA 3AFBA 3OZPA 3POHA 1GOWA 5DEZA 2W66A 4MB4A 1TE1A 1KXQA 3VU2A 2E9BA 4LGXA 5D9OA 1JZ5A 3W6MA 5LYRA 3W4RA 3ZMRA 1RPKA 4H8HA 4F9DA 1V6WA 1W1YA 2O92A 3VM5A 2BHZA 4NZCA 3ZQ9A 2WLZA 1EDQA 1CXLA 1ZS2A 2WWCA 3WMBA 3WBAA 3MANA 4J3UA 3AIQA 1JI1A 5IFPA 2CBUA 2NSXA 1LL6A 1E4NA 1LJYA 1M01A 3T0BA 5BCAA 1V03A 1BTCA 2WWDA 2ZUMA 1JYWA 4FLQA 3M7SA 1JZ6A 3PZTA 3QOMA 1G1YA 2J7HA 1KGUA 5A8OA 1US3A 2XTKA 1XGZA 1J0KA 1E71M 1B9ZA 3VIHA 5IFTA 1R86A 2E4TA 1HN1A 1QHPA 3VIJA 2RGLA 2JIEA 1E0WA 1E5JA 4BQ2A 1QBBA 4AZCA 3GZAA 1V0KA 2XJ7A 2JEQA 3L4VA 4JL1A 4CN4A 3U57A 2WVUA 3ZOAA 1LF1A 2BY3A 2PB1A 1SYTA 3GNPA 1CLXA 4C7DA 5BXPA 3VILA 2QMJA 2EPLX 1Q6DA 1BG9A 1UH4A 4GO9A 2UY2A 1XV8A 2BXZA 3CZEA 1H41A 3A47A 1EXPA 4LYPA 5ABGA 2XFRA 3CUIA 1JZ7A 5CQ1A 3AOFA 1KR0A 4XUYA 1GJWA 1S46A 3AZRA 3AIWA 1OD8A 1QHOA 4UQCA 1GOKA 1TVNA 2J74A 2DT2A 1DWHM 4IPLA 1KCKA 3HN3A 1UZ1A 1GPFA 4N42A 1UUQA 2VC9A 2J7CA 2ZUVA 3PN8A 1ESWA 1KQZA 1CTNA 2CXGA 2DGAA 2XVGA 5DF0A 3CO4A 2WZHA 1ZB5A 4P7OA 1W9PA 1Q6FA 3SCRA 4F66A 1BGGA 1E3ZA 1EGZA 2A3HA 3WH9A 2WLYA 4WJXA 4AZ6A 2VX4A 4XX6A 5IHSA 1KXTA 1JDCA 3BAKA 2D0FA 3EMCA 1YQ2A 3ZSTA 2ZXAA 1TUXA 1UOKA 3GNRA 1E4MM 3M46A 2XVKA 4AZBA 1E1EA 2FGZA 3OIHA 4GZEA 4CVUA 2WKGA 5A6KA 2DIJA 3VDAA 3CZ8A 4CD6A 3G6LA 4PMOA 1B3XA 4MADA 4JZ5A 2ZX7A 1UYQA 4AEFA 4GI6A 2YL9A 1EOKA 4WKAA 5C8BB 1GOIA 3VGDA 9CGTA 4PBGA 3VPLA 4B9ZA 1HJVA 1GVIA 1QBAA 4WIWA 2A3CA 3N17A 5A6MA 1V02A 1Q4NX 3U7VA 3EYPA 1JIBA 3RM4A 1RP9A 2D3LA 2ZE0A 3BH4A 4UFJA 4LX4A 1E0VA 1FH8A 3WD0A 4H04A 1E3XA 2VZUA 2WKLA 2WPGA 2C0HA 3RJYA 1PZ2A 2X05A 4A4AA 1FP9A 4WF7A 1VBRA 3MSGA 1GOOA 4S3KA 2YLAA 4PSPA 4AIEA 1UR2A 2DSVA 1B3ZA 1CLVA 1U33A 3VNZA 3GYCA 3VIMA 3VD9A 2ZOXA 3APGA 3TA9A 3AS2A 2VQUA 1W9BM 1DWAM 4ZXOA 5LA2A 1C92A 3WN6A 3LPOA 3S6TA 3WH5A 1NM9A 3FW6A 4TTGA 1OBAA 1VEPA 3SCWA 1GQJA 4BQ4A 1C3FA 1TA3B 4OJYA 2D1ZA 3AIUA 4M80A 3N18A 3ZO9A 3IAQA 1WO2A 4HOZA 4D6FA 3QR3A 2W92A 3AICA 4JKMA 4CU6A 3W0KA 4UQ9A 4PMUA 2DPEA 4CGTA 4OBRA 3AIVA 3RILA 5A95A 8A3HA 3VVGA 1EQPA 3T2PA 5KEZA 3TOPA 1JF6A 3AROA 1HL9A 3E1F1 3SCTA 2JF7A 3ZR6A 4UNIA 3ARWA 3WNNA 5E6YA 3F4VA 4FLSA 5I0DA 4W86A 3KWXA 3N12A 4FLOA 1W9XA 2XSAA 3LPPA 3RO8A 2BVYA 4FLRA 5HXMA 1R7AA 5M17A 3GDBA 1XSJA 4AIUA 5DFAA 4WSJA 3VUPA 1V3HA 5A6SA 3PZOA 1AMYA 1J18A 5CPQA 5D8ZA 1JNEA 3ALGA 3BAXA 1J0ZA 1OT1A 1W2PA 2VRKA 1GORA 1KWGA 1E6PA 2VZOA 5I2UA 1UD8A 3CBWA 4W84A 1Q6EA 4HA1A 4PSRA 3FXYA 3J7HA 3PBGA 4X0NA 4CUCA 1B2YA 3PZUA 4LXFA 3NSNA 1QW8A 1MXDA 1NOFA 3A4AA 3K8MA 1NH6A 2E9MA 2ZX8A 5I79A 2PBOA 1E43A 2DDXA 3VMPA 4HA4A 3GH5A 3N9KA 1CXIA 1EO5A 2Y2WA 3HJEA 2DSUA 1JZ2A 4Q7NA 3AZSA 2IUZA 1UR8A 5BRPA 4A3HA 1QOXA 1H11A 4J3TA 4AY1A 4H7VA 2CKRA 3WF2A 4PTVA 1D7FA 4TX8A 2D23A 3AHTA 3SURA 4UFHA 5BROA 2XVLA 1BYCA 3CUHA 3WY1A 4AC1X 4NRRA 4NSBA 4RE3A 2Y24A 5ECUA 2BHUA 2XYLA 3PZVA 6A3HA 2OSWA 1UWTA 4W88A 1ZBVA 2Q8XA 3WENA 5AC5A 3WNOA 4U5IA 1HKMA 2VCAA 3SCPA 3A3HA 5CLWA 1FHDA 4W5ZA 2A3EA 3WNLA 2MANA 4JFTA 2WVVA 3PZNA 3M6DA 3GXMA 4AYSA 1LL4A 3BCFA 5A8MA 2EEXA 5D4YA 1LG2A 1MFVA 1E6NA 1XHGA 1H49A 2BFGA 2YBUA 3PZMA 4CCDA 4CU8A 2YA1A 3NCOA 1FA2A 3BXWA 1WE5A 3DYPA 4JAWA 4GIAA 1G0CA 2V5CA 4PUEA 3ZJ6A 1FH9A 4YPJA 5FIPA 5I78A 1QNPA 1GNXA 5EFFA 1ZBCA 4W7VA 2J77A 4TTUA 4BA0A 3JUGA 4PMXA 1H2JA 1V08A 1UH3A 3PTMA 1MQRA 5A2AA 3K4AA 1ISYA 1IZKA 1WDPA 2ZXDA 1K9TA 4IUGA 1G9HA 4EANA 1NWRA 3SUUA 3ARVA 1UWQA 3CZGA 2NT0A 2GSJA 5D9PA 1UH2A 4PMRA 1UKQA 1NP2A 5JBFA 1DWJM 3M07A 5A2BA 3OLEA 1WCGA 4HMEA 3VDBA 3O6AA 2BY0A 3SCOA 4QLLA 3WQWA 1H1NA 3NUKA 1W3LA 2IXVA 3UG3A 1WDRA 3CHFA 1C7TA 3B9EA 1L0PA 1CNVA 1I1WA 3B8SA 1NWSA 2ZWZA 2PI6A 4ATWA 4LYRA 1YHTA 4OOZA 5BXTA 3AS0A 4E4PA 1XH0A 3OB8A 2J8FA 4CN1A 3MMUA 4GQRA 2W91A 4BQ5A 5BXRA 4PMDA 4WK9A 1V3IA 4J7RA 1OINA 2XIIA 3ZT6A 3THCA 2CEQA 3WEOA 4KWUA 4MNMA 4DUVA 1KXVA 3AQUA 4JCMA 2J7FA 1BYDA 4DUXA 1UZ4A 4AZ7A 3AXIA 1MW3A 4WSKA 1B3YA 1VIWA 2NW0A 3AI0A 1UD5A 1UKSA 1UQZA 3KE0A 5CSYA 4TVUA 2D20A 1BG4A 5A8QA 4PCSA 1CEOA 4MNJA 3BSGA 4P8WA 4W5UA 1A47A 4PMVA 2WBGA 1KCLA 1TMQA 3W38A 1UKPA 3VDHA 3IANA 2J7DA 3PHAA 3W29A 4KH2A 1W3KA 4DWSC 3IJ9A 2BHYA 1BVNP 3RPMA 3KL5A 4PTMA 1NOUA 1PBGA 3K1DA 4AXNA 3WUGA 4AD5A 3RJXA 3BLKA 4M1RA 1ZJBA 4UQEA 3BC9A 1E72M 4PTWA 3BCDA 2TAAA 4J3SA 2ZX9A 5CXPA 3VX1A 2WYSA 4C7FA 5M5DA 1GJUA 3POCA 4UFIA 2CKSA 3VO0A 5LA0A 4MB1A 2Z1KA 2FHCA 4JFUA 1DHKA 3CHDA 1OSEA 1D2KA 4OIFA 3ZR5A 3VIFA 1LWHA 2OWCA 1E73M 2F8QA 2J79A 2HISA 1EQCA 1HJQA 4P7RA 3WUFA 4DWSD 4TOQA 2QF8A 3AHVA 4QFUA 5CG0A 1HKKA 2V3DA 3GH4A 4W87A 3ZIZA 1HL8A 2DEPA 3TTQA 5BXSA 2VL4A 1HT6A 3CUGA 1Q6GA 5ABFB 3NJ3A 4AZ5A 3SIMA 4M29A 2XHYA 3RMEA 5BYWA 4D6EA 1MWOA 1AQHA 3VD7A 1HXJA 3UG4A 1CXEA 2ZICA 3OZOA 1UR1A 3WSUA 4W8LA 5HNNA 2WVVB 1QI0A 5CPTA 3NSXA 3ARYA 1K9DA 3D3AA 4KRTA 1CYGA 4Z2GA 4HPGA 5CGTA 1NWTA 2YJQA 5CLTA 4JFVA 1UR9A 4UZUA 2E8ZA 1U30A 4NI3A 3ZJ8A 4KMQA 3T08A 4PCTA 2C8NA 1XYZA 3WKZA 3VTRA 1W9DM 2VR5A 2GJXB 2J4GA 1E70M 1QHZA 3ARXA 2XWDA 2PWFA 3VD4A 5A2CA 5E70A 4B3KA 4PMYA 2WAGA 1AQMA 5M03A 1E56A 1KQYA 3PZQA 2OYLA 4EAMA 3K4DA 1CXKA 2E9LA 3MS8A 4AWEA 3F5LA 1E1FA 3OGVA 1JZ4A 3RDKA 5ABHA 1GZJA 5FL1A 2OSXA 5D9MA 4AZHA 5A1AA 1G01A 2OSYA 1HNYA 4E8DA 3FAWA 2FH8A 3CGTA 2V3EA 2WHJA 7A3HA 2WC3A 3SCNA 3HU7A 3WDIA 4U3CA 3I3DA 3FHAA 2VX5A 3VX0A 3SCVA 2CHOA 2W61A 3DECA 2GK1A 1SR0A 3GM8A 5TD4A 1WDSA 1PX8A 2UY5A 3MUIA 3PTKA 3WDQA 2DH2A 1MW2A 1VB9A 3K8KA 4QLJA 2GFTA 5ABFA 4JKLA 1EO7A 4HP5A 1GQKA 5A6JA 2JFEX 2ZXQA 1DP0A 2XFFA 1RP8A 3AHYA 1X1NA 1QNQA 2OLHA 3L4WA 4BF7A 4QCEA 1MYRA 3HMCA 5D8WA 2G41A 1K9EA 3O2LA 1ZL1A 2Y8VA 4M81A 4F8XA 1E6QM 4CCCA 3GTNA 3VGBA 3VIGA 2WK2A 3OA5A 1UR4A 3RM9A 3WF3A 4B9YA 1F4AA 2BXYA 4UFLA 2XM1A 2WW5A 3UR7A 3AMDA 4D6IA 3OLGA 3B9DA 2CBVA 2XGBA 1I75A 2G3JA 3GXDA 4PRWA 2EJ1A 1PIGA 1XH1A 2GK1B 1XH2A 1J0IA 2CIPA 2OYKA 2X0YA 3CUFA 3A4WA 2W4XA 1BHGA 2JE8A 2FGLA 1WZAA 4ZXLA 4MB3A 1O6IA 1ODZA 4BZYA 3NIYA 1BYBA 3VM7A 1AQ0A 4HMCA 4N0RA 1DEDA 4MDPA 1B0IA 2W67A 5I5RA 1ZU8A 5CGMA 4KGLA 1ISZA 3N11A 3MO4A 2QMKA 3SUVA 1O7AA 3BSHA 2EO7A 1ISXA 3ARQA 3FN9A 3WD1A 3UETA 2Y4SA 2XUCA 4HZ6A 2QLYA 3OLDA 2YL8A 5ABEA 2YL5A 1VENA 1UR0A 1HJSA 4W8AA 4MTVA 1EDGA 3EMQA 3IJ8A 3ZT5A 5HPCA 4TX6A 5CPSA 4W7UA 3CHCA 3K46A 3WF0A 4J3VA 1CENA 3ALFA 2DSWA 3L4TA 2G3NA 5A8NA 4HZ7A 4M82A 1WNOA 5AYIA 1E6ZA 3WDPP 2J25A 4AD3A 2ZUSA 4PMQA 2PBGA 2VNCA 3TP4A 2NT1A 2G8ZA 2CITA 4XZBA 4R27A 4Z2HA 1UA3A 2ZWYA 1JNDA 1EA9C 1QW9A 4EKJA 4GZIA 3AYRA 1MVYA 3WF4A 3AS3A 1B90A 3WH7A 4W89A 5BWFA 2CHNA 2V38A 5HDRA 4CVWA 3L2MA 3SUWA 1OWQA 3A4XA 3PTQA 3VGEA 2O9PA 3SCQA 4D1IA 2WC7A 3WMCA 2VUYA 3AIEA 4U33A 3WNMA 3ARPA 3WQ8A 3GXIA 1B30A 4V2XA 4D6DA 1W2VA 2AAAA 3VKKA 1TZ7A 3AYSA 3W26A 1UKTA 1EDTA 2BV9A 3MUAA 4Y7EA 1US2A 2XGIA 1VRXA 3F5KA 5I77A 1JYNA 1TCMA 3N04A 3RCNA 4AD4A 2WVTA 2VVSA 4U31A 4JHOA 2ZIDA 1GVYA 1DWIM 5DT5A 1I1XA 2W63A 3QHMA 4ACYA 3L4UA 2WMJA 1R7OA 3PZIA 2PWGA 1OIFA 4P7NA 3VOCA 4U3AA 4DUWA 1ODUA 4UQAA 3WL1A 1IZJA 2VT0A 4IPNB 1OGSA 4UOQA 4IM4A 3RM8A 3EDKA 2WSKA 1B31A 1E55A 1JDAA 4JCLA 2QPSA 1OD0A 2EBNA 3WF1A 3WH6A 2X8RA 1VFOA 3TTYA 3T2QA 3ZJ7A 3WQVA 3AMGA 1Z32X 2DT1A 3PZ9A 1V0LA 4XB3A 1JYVA 2YDSA 4GXPA 4YN5A 5DT7A 1Q6CA 1VFFA 3DHUA 2V5DA 2WB5A 5DO8A 2PC8A 1JZ3A 3BAIA 5A8PA 3MMDA 2UWFA 4M8UA 1CBGA 4MB5A 4AZCB 2VMFA 1OB0A 2CBIA 5EB8A 3D5HA 4HU0A 4CD5A 3ZM8A 4GO8A 1NARA 1V3LA 3O9NA 4U5KA 1PEZA 4TUFA 5BRQA 4E8CA 3WD2A 1BQCA 1BGAA 1JD7A 1NOWA 2YDQA 4WKFA 2VURA 1J12A 1JAEA 4A3YA 1G5AA 1J0JA 1E15A 5EFDA 4JKKA 1J0HA 1PIFA 1XYFA 1ZBWA 4PMNA 4GQQA 3VGGA 1V0NA 3A6OA 2V3FA 1JYXA 1JZ8A 4P8XA 2Z1SA 3QHNA 1ZBKA 2J47A 2VO5A 1FH7A 2XSBA 3OLIA 3VMOA 3AIRA 2W5FA 1HJWA 2ZUNA 4D71A 4AISA 4RE4A 4ACZB 1KGXA 4FK9A 1V6XA 2YA0A 1B3VA 7TAAA 1C93A 5C70A 2PWDA 5IHRA 2VTFA 3TTOA 2QV4A 4QDMA 3WIJA 3ARRA 3PZGA 4UFMA 5E6ZA 3KEHA 4EK7A 1ITXA 5IDIA 3KZSA 4HZ8A 1HKJA 1GOQA 5F7UA 2DT3A 4CU7A 1M53A 4GZJA 1IT0A 1WZLA 4D6CA 2YOCA 1QNOA 2BVDA 5AC4A 1CIUA 2GUYA 1LG1A 1XSKA 2AMGA 4MJ2A 4ZEPA 1BF2A 5GQBA 4QCFA 4AD2A 2D24A 1ECEA 1W1VA 2WMKA 2VX6A 2DT0A 1WP6A 4L4PA 3WBEA 3AISA 1W9VA 1OGGA 4UCFA 4AZGA 2WANA 5JIPA 1DWGM 1XC6A 3UEQA 2E3ZA 3B9AA 5KZ6A 1FP8A 2ESCA 3CMGA 4AW7A 4AZIA 1MQQA 1C8QA 2WVSA 2WHLA 2ZX6A 5FKYA 2VCBA 3UESA 4CCEA 1C8XA 4CKQA 4GI9A 4P7QA 3BGAA 4W8BA 3FY1A 1XCWA 3CUJA 2XG9A 1KFWA 5C71A 1WAWA 4X9YA 3T2OA 1HF6A 3L4XA 5FCZA 1CGVA 2YL6A 4GKLA 5GPRA 3SUTA 3WQ5A 4UQBA 4UFKA 3WL0A 5E9AA 3VIPA 5JIWA 5JBDA 1V3JA 1NWUA 2ZUWA 2WC4A 1JG9A 4AEEA 2J8GA 4M56A 2WHMA 3OGRA 2YDRA 2D22A 4URIA 1HJXA 1VJZA 3UG5A 3ECQA 1W3JA 4GI8A 5DMYA 1QNRA 4F79A 1E6RA 1EOMA 2WCGA 3WQ4A 2J78A 1J01A 4DWSB 1E9LA 2VRJA 1HX0A 2J7EA 5AY7A 1UG6A 3DC0A 4PYSA 5A69A 3QOKA 4U2ZA 2G3IA 4H8VA 3VGHA 3WH8A 1MXGA 1XD0A 4HMDA 2BY1A 3KL0A 4H8UA 3CTTA 4P7LA 1J9YA 2QHAA 3RIKA 3BAYA 4B15A 1J11A 4OZOA 3ARTA 1JD9A 3QHOA 1U2YA 2GDUA 1X6NA 5E0CA 1FFQA 4CN6A 2XIBA 1OGBA 4CD4A 4U2YA 3VDCA 2X1IA 1CGYA 5I6SA 1IV8A 1CGWA 1ZJAA 2BY2A 3GBDA 1F4HA 2WSPA 4F9JA 3NSMA 4MAVA 4OBSA 2VCCA 1CZ1A 4OOUA 3U7BA 1UA7A 1EHAA 2IXUA 3CIVA 4HA3A 5E0FA 4JHZA 1MFUA 1C8YA 4V27A 2QPUA 6TAAA 1R8LA 2XPKA 3AIBA 5FOOA 4YHEA 4KRUA 3L2LA 4LPCA 3VGFA 2J62A 3MSDA 5I3DA 1W32A 2OYMA 3DHPA 5CJ5A 4ZE5A 1GHSA 1HKIA 4MDOA 2DH3A 3N13A 1GONA 2CESA 3I3BA 1TFVA 1XRVA 3EDDA 3WELA 1H0GA 1XCXA 1EHNA 1QVBA 2C7FA 2XFYA 4QAWA 3OGSA 2JALA 4GINA 2PF0A 2WBKA 1WPCA 3AHXA 1UWRA 1SMDA 1MW1A 2BS9A 4HU8A 4RL3A 3THDA 2J7GA 3FNDA 1E6SM 1VJSA 4JIEA 1VFUA 2WMIB 1UHVA 3EBVA 4WKHA 2J7BA 2FHFA 1CWYA 2JF6A 3EMZA 1QI4A 1PJ9A 3NYDA 2X2YA 3OG2A 1FHLA 4D1JA 1B1YA 1E5NA 1BFNA 3ZSSA 3W24A 1CDGA 3IK2A 3K8LA 4OKDA 2DSKA 1BPLB 2XWEA 3VIKA 3UCQA 1JXJA 1W1TA 4PMZA 3NDYA 4C7GA 1G94A 3TONA 2GJPA 4NRSA 2X09A 3SEPA 3L4YA 3MU7A 1QI2A 2O9RA 2Y8KA 1M03A 2Y5EA 1HVQA 3NDZA 4JFSA 4CD7A 2E8YA 5D9NA 4H2CA 1FOBA 4MNKA 1LLOA 1WZKA 2UY4A 3FHQA 1D3CA 2ZX5A 1E4LA 1W3HA 1NP0A 1XD1A 1V02E 3CZLA 4DM2A 3IAPA 4PTXA 3ZT7A 5LA1A 1J0YA 1UWSA 3WMSA 4HOWA 1ISWA 2OWXA 3LPGA 3UR8A 1UD6A 4YHGA 1KWKA 3AZTA 1V6VA 1BYAA 7CGTA 2WMGA 4NF7A 2VOTA 1LL7A 2VVNA 2YIHA 3U5YA 3W37A 4D72A 1R87A 4UTFA 3QGVA 4P8UA 1CGUA 1GQLA 2D0GA 1XSIA 3WDJA 1KR1A 4MNLA 5GNXA 1CGTA 3G6MA 1DWFM 4UOJA 2WZEA 4PN2A 4HPHA 2CYGA 1JI2A 4J28A 3SUSA 1KBKA 4P8VA 1K9FA 4S3JA 2A3BA 2FHBA 1BVZA 3CPUA 1W91A 1UWUA 3MMWA 5IXEA 5M3WA 2GDVA 3CLWA 1TG7A 3DYOA 1UKOA 1M7XA 2EPKX 5AYBA 4B3LA 4D6GA 2FDMA 5CSUA 1B3WA 5A6LA 2D2OA 1TVPA 4V28A 1WKYA 1JGIA 3ARSA 3W25A 3W27A 2VX7A 2WXDM 4H41A 4XV0A 3T0AA 5I24A 4HOXA 3WDHA 2D3NA 1KB3A 5EMYA 5JBEA 1LWJA 2VJXA 3I3EA 4PEEA 1PX4A 1UD2A 2DIEA 4R5EA 1WB0A 4J3WA 1QI3A 2GJRA 5HOSA 3MV11 1AVAA 4GPNA 1UD4A 1VFMA 1K6AA 2UY3A 3W53A 2J75A 2YBTA 3VIOA 1VF8A 5A3HA 2V3GA 1ITCA 1GUVA 1HIZA 6CGTA 3VIIA 1VEMA 2WCSA 2VRQA 5JUVA 3VMNA 3SCSA 5EBAA 5GNZA 2G3MA 3GXFA 2AOSA 2WM0A 1X6LA 1MW0A 2EPOA 3WD4A 2VR4A 4XZWA 1C7SA 1VBUA 1W1PA 4J3XA 1LQ0A 4EE9A 2CPUA 3W28A 3BAJA 4QLKA 5E09A 2XVPA 3WEZA 2OWWA 1JAKA 3AHZA 1HJUA 4KGJA 4E2OA 2D0HA 3GNOA 1GQIA 1RH9A 2O9OA 2A3AA 1PPIA 4Z2IA 4Q22A 3W82A 1SFSA 4WLCA 4ATLA 4ZE4A 1OT2A 1CECA 2O9TA 4TVCA 4UZSA 1MQPA 1RD6A 2RGMA 4MPKA 4DWSA 3BMWA 3EDEA 1V3KA 2FH6A 1JDDA 1BLIA 3WQ6A 3CHEA 1H09A 1ISVA 2WNWA 5FL0A 3WUEA 1Y7VA 1R85A 1EH9A 2XVNA 3AMLA 2F2HA 3ARUA 3AXHA 3MKKA 4AD0A 3EDFA 1W9UA 3GBEA 1GOMA 2F61A 2VZSA 2ZXBA 3CH9A 4W7WA 5HBFA 3MV01 5I23A 1PZ3A 1HP5A 3UERA 4ML4A 4JFWA 3BLPX 4LQ1A 3CZKA 1JFXA 1M04A
chains in the Genus database with same CATH superfamily
2HK1A 1GHRA 5XIMA 2VQTA 3P74A 4ZENA 1R5YA 4AYGA 3NPXA 1L6GA 5EMMA 1P6WA 3M16A 2GVJA 3W71A 1UR3M 1UROA 5H6HA 1VGAA 4CQDA 5D32A 1R3YA 5I3IA 4KWSA 4TU1A 3V0SA 3CZJA 4GACA 1JXKA 1V6UA 4XKYA 2HVMA 4D6HA 4GBUA 1FFRA 1V3MA 1NU5A 2V2HA 4LCRA 1PDZA 2CZDA 3K4WA 3O0KA 4FF5A 3T9PA 1LOSA 2RDXA 4ATDA 3KCLA 3W7PA 3TJXA 2FYMA 1E40A 4DXVA 3L9CA 3U5UA 4X0VA 4KKXA 1KTBA 4MAZA 3INPA 2P5NA 3PSVA 4TMBA 4CNSA 1QPRA 3B8IA 4RXFA 2UBPC 2EPMX 4QR6A 3DCPA 5LNRA 3TE9A 1JL8A 1QK2A 3B0UX 3AMCA 1L8NA 1H4PA 4LVDA 4IQLA 3S6DA 4H9YA 2HBXA 3M43A 3TMLA 3WK1A 4G9PA 4JQAA 2W9MA 4XAGA 2R8WA 3II1A 3I6RA 3CNYA 2AL2B 5DX7A 4HSOA 2NSOA 8CGTA 4D8ZA 4PCPA 3T81A 3WJSA 4IL0A 1V6YA 1ITUA 1SM9A 1UQYA 2CERA 3TSDA 2W3ZA 3PAOA 3LSBA 4Q32A 4CNNA 1HGYA 4Y9OA 4MFEA 3S2CA 4B16A 4KEUA 5LNVA 1B4EA 2DV0A 4X61A 1MZHA 4B2DD 5CAKA 1YIXA 1H1ZA 2VI0A 2V30A 3U48A 2P1FA 2GJXA 3RMJA 4MVAA 3CC1A 4K6AA 2OT1A 4PFMA 1BAGA 5C9WA 1G4SA 3QJAA 2PGWA 1YXCA 3O3RA 2E40A 2QVNA 1VD6A 4QNWA 4JYFA 3TC7A 1AW1A 3AMKA 2DIKA 3URAA 3W01A 3AJ7A 2V2CA 2EXOA 4L5ZA 4BS0A 1P1XA 1X98A 4DO5A 5FD0A 4ZQPA 1W0MA 4P2VA 1GW1A 1Q7ZA 3WD3A 3O6DA 1UD3A 3MUY1 4HCHA 2YX0A 3W6LA 3JZUA 1DOSA 1S2TA 3ZLHA 5D05A 2A6NA 4LGXA 4OBTA 4DN1A 5PTDA 3SY1A 4O16A 3CUXA 1F73A 4MY8A 1SJDA 2WWCA 3WMBA 3HFYA 4AAJA 4DHGA 3WBAA 3C2VA 3AIQA 1XIJA 1JI1A 3GC2A 4JIHA 1J96A 2NSXA 1W17A 1M01A 3EEZA 5BCAA 1JYWA 1HZYA 4F48A 3ABOA 4Z08A 4AC7C 1G1YA 2IS7A 1L6WA 5A8OA 1B9ZA 5HULA 1L2UA 5BNKA 4HSNA 1FCQA 2G5WA 3IJQA 2RGLA 5G1TA 5DANA 1WXJA 3GVVA 5BU6A 1XLAA 3N14A 1KFLA 3FGCA 4AZCA 4KCUA 2XJ7A 1OC6A 1UBPC 3U57A 2X1TA 3ZOAA 3QQ0A 3Q94A 4JNMA 3W7RA 4YS1A 4C7DA 2NX3A 4IPJA 1Q6DA 3R6IA 4O1AA 3CAKA 2V63A 4LUSB 2BXZA 1H41A 2GOKA 5ABGA 3MJYA 3MZ2A 4DYKA 2GYIA 1GVRA 3M47A 1ONWA 1KR0A 3AZRA 2J74A 3H7VA 2NQHA 3WJZA 1F3TA 2GLKA 2BGQA 3URNA 1ESWA 1KQZA 1CTNA 2YXXA 4P7OA 2CZFA 4F66A 1GZ1A 3RR1A 3W7HA 1QASA 1E3ZA 4JYDA 1F6YA 2WLYA 4JGDA 3JZEA 4WJXA 4AZ6A 5H8PA 3Q37A 2DVUA 1VFHA 3AXKA 1D9EA 3KTCA 3FDGA 5LGXA 2YSWA 4E4UA 1VJIA 3OIXA 2GUBA 1UOKA 3GNRA 3QYSA 1WYIA 3M46A 3RCYA 4AZBA 2OMAA 1UC5A 3OIHA 3WK3A 4CVUA 2WKGA 5A6KA 2FVMA 3PNUA 3TYZA 4P61A 4REQB 1XPGA 3Q2DA 3CZ8A 1XUZA 5E1QA 4DZ5A 2P3EA 1Q3NA 2YL9A 1EOKA 5C8BB 5LXXA 1LYXA 4RZ6A 5EMUA 1GVIA 1QBAA 4WIWA 1V02A 1QXLA 1MZRA 1ZLPA 1ICPA 3CTLA 4IP7A 3BH4A 3DBNA 5DRCA 2BOEX 3RAOA 2NX1A 4NNCA 3WD0A 2VZUA 2C0HA 1JRBA 4GUFA 4IH3A 4YL2A 1PZ2A 3P93A 4WF7A 3GU1A 1VBRA 2YLAA 2PRMA 1JCNA 3U2ZA 4F0HA 1FWIC 2Z27A 2CLEA 3EWZA 3BOLA 3AS2A 1W9BM 1DWAM 2EPHA 1XYCA 1C92A 4NUWA 3HG2A 4K37A 4S3GA 2QCGA 2QR6A 4L6DA 4BQ4A 2D1ZA 3BQ5A 5FAGA 3MA8A 3WZ0E 3N18A 3ZO9A 3LBOA 3S8HA 1WO2A 4HK5A 3AICA 3N3MA 2OLSA 3KHJA 3BG5A 3GK0A 5JQ9A 4OBRA 2QXWA 4MYAA 3RX2A 1DV7A 1JUBA 4R34A 3TOPA 1HL9A 4A6GA 4UNIA 1RQEA 5K2ZA 2FZMA 5I3HA 3MQTA 4B5UA 2DVXA 5F2GA 4FLOA 2PDJA 2XSAA 3LPPA 4EXBA 4FLRA 3ONCA 1Y65A 3GDBA 3BJSA 5FJPA 4AIUA 3PPCA 5DFAA 1V3HA 1F8IA 3RLUA 4MKSA 1AMYA 3VA8A 5D8ZA 5LIYX 3GKAA 4DF1A 3BAXA 5FA5A 3EA3A 4MYXA 4WXYA 4QJ1A 3GU2A 4E3TA 5I2UA 3NAVA 4C6BA 4PSRA 5CPLA 3FXYA 1KLYA 3J7HA 2H8ZA 3PBGA 5ECVA 2NQJA 3EWCA 4LXFA 4Z42C 1MXDA 3QY8A 1NH6A 5I79A 2PBOA 1E43A 2DDXA 1CXIA 3TUUA 3S2LA 3HPXA 4Q6JA 3WLLA 5D33A 4GJIA 1YE6A 2BBFA 5K7JA 5BMXA 1UR8A 3EX2A 4AWTA 1KV8A 3GHUA 1W8GA 2Z24A 3GG7A 3NQDA 3TU9A 2GDQA 2D23A 4NZFA 1PE1A 1E0UA 3VI2A 1S38A 1BYCA 3CUHA 4GVGA 3WY1A 2ZVIA 4AC1X 4NSBA 4Y6GA 4Z1CA 5CJMA 4O0ZA 4PH6A 1DVJA 4JTGA 1OFOA 1EZ2A 1ZBVA 4DJED 1QWKA 3WENA 4DI9A 3DX5A 4NZ3A 1HKMA 3IIXA 4JQ3A 2Z1VA 3PANA 3C0LA 4PEKA 3ORWA 1QCWA 1FHDA 1A5LC 2A3EA 1TO3A 5AZ0A 3EXTA 4RE0A 4JFTA 5FEZA 2OJPA 4Q8NA 3Q45A 1VCGA 2OU4A 1MFVA 2Y89A 3FVDA 4NAFA 5DY3A 2KAUC 1JJKA 2E1WA 3IV3A 3BXWA 4GIAA 3ZJ6A 1FH9A 3WLOA 5FIPA 4DYJA 5EFFA 2J77A 3NEVA 4BA0A 3N19B 3PTMA 2PDNA 4LAMA 3K4AA 4S3BA 3VYLA 3QM3A 5FI8A 1WDPA 4JX5A 1F2JA 3CS2A 4LW7A 1NWRA 1A0CA 2VENA 2ONEA 1QOPA 4MG4A 2GSJA 3MT1A 2A79A 4PMRA 5FJIA 5JBFA 3H12A 3V0TA 3OLEA 3O6AA 4WOQA 2WZTA 5TF0A 4QLLA 3WQWA 1C9WA 1T96A 4H2HA 3NUKA 3IUDA 4JTEA 1W3LA 3EGJA 3UWZA 1YRRA 1JQXA 5D30A 4EPEC 3R12A 5FESA 5CSRA 1CNVA 3EB3A 3B8SA 4PFHA 1NWSA 2ZWZA 2PI6A 5AHEA 1PWLA 5GJPA 4M51A 3AS0A 4E4PA 1XH0A 2PDKA 3OB8A 2XN0A 4CN1A 1VYPX 1G7VA 3TQVA 1DE5A 5G1MA 3R25A 1OINA 1RLCL 4R7WA 4KWUA 3O05A 3AQUA 5EYWA 2HXTA 4JCMA 2J7FA 1BYDA 3VOHA 4AZ7A 1O12A 2NW0A 1OEPA 1LP6A 2Y7DA 2YXOA 4E4FA 4Z1YA 5C7VA 1UB3A 2WBGA 1KCLA 4DX3A 4US5A 3IANA 4JTJA 2J7DA 3C2YA 1W1IE 3LTYA 4ZB2A 1NDYA 3NM3A 3AALA 2V68A 1WBHA 1BVNP 3KAOA 3KL5A 3W76A 5CBJA 3BICA 3R94A 4PTMA 4IJBA 1NOUA 4F2TA 1H60A 3WUGA 3RJXA 4M1RA 3E0FA 4MM1A 2QDGA 5ENLA 1ZJBA 2CLLA 7TIMA 3CJPA 2TAAA 4J3SA 4R88A 1GJUA 3POCA 4UFIA 2JGQA 2FHCA 1DHKA 1VPYA 3ZR5A 4S3FA 1E73M 4L6OA 2F8QA 4KCVA 3NZ1A 3G8EA 2ABAA 4GG9A 1G4PA 1THFD 3GFXA 4KEMA 1SUXA 2QF8A 3U2EA 1HKKA 4W87A 1O60A 2DEPA 1PKMA 2VL4A 4L65A 4RCXA 4U28A 3MJMA 3WFAA 1GG1A 1SFJA 4Q4OA 1MWOA 3E38A 3VD7A 3UG4A 1CXEA 2ZICA 3OZOA 5FF7A 1UR1A 3WSUA 4W8LA 1R9ZA 3NSXA 1JUKA 1G69A 2ZRVA 4DI8A 3D3AA 1ENUA 2B81A 1H7RA 1ML1A 1CYGA 5FJRA 4HPGA 4JFVA 1UR9A 3EB2A 4HCLA 2WNZA 3ZJ8A 3KVJA 2C8NA 3WKZA 3NG3A 4IXXA 2VR5A 4ML9A 4A29A 1E70M 4UWMA 2PWFA 2VC5A 2WAGA 4NILA 1A5KC 1IEIA 1E56A 2HVNA 3MUXA 1CLKA 4N9EA 2OYLA 1MRAA 3E5BA 4AWEA 4H9VA 3F5LA 4Q8UA 1R0MA 2Z1XA 2FIQA 3CT2A 5H8UA 3R8RA 2J13A 1KM3A 5A1AA 3W1RA 3H2AA 5CG7A 4X2PA 1J5SA 3W7GA 4E8DA 3CGTA 1O5RA 3D3FA 3DFSA 3WDIA 2DW6A 3I3DA 1YBQA 3QW4B 4YNGA 1OC5A 1QW7A 1SR0A 5D02A 1VPQA 1PX8A 3DENA 3PTKA 1ZJHA 3QY6A 1XQLA 4S39A 1BVWA 2EKGA 3AJXA 3FYYA 1Z89A 3K8KA 4IT1A 2GFTA 3NR0A 2Q6ZA 2AMXA 4PUNA 2ZXQA 3CAVA 2QCDA 4EPKA 3AHYA 1JVNA 5AVHA 4OWGA 5D8WA 4KIRA 1K9EA 3LYEA 3O2LA 1ZL1A 4F8XA 4MY1A 5I00A 1K8CA 5I07A 5XINA 3VIGA 2WK2A 2PLKA 2BXYA 2WW5A 4I8YA 3AMDA 1SPQA 4JTAA 4A05A 3XINA 4S3EA 4Y9AA 4A21A 5K4ZA 3H2OA 3VE9A 2NVAA 1KFBA 4C6OA 2NQ5A 5HWMA 2JE8A 3SIZA 4AIBA 2YB1A 4K7YA 3M6YA 1A80A 4HMCA 2ODOA 2XSXA 4G7EB 1PTGA 2W67A 2ZZ6A 1ZU8A 2Z2BA 4Q4RA 1X8CA 1NAL1 3RG6A 2J9XA 3SADA 3W1AA 4GX8A 1O7AA 3BSHA 4A8IA 1XLEA 4Q33A 3FN9A 4K39A 4ZSTA 4R53A 4NY2A 4RPPA 5CH9A 3OLDA 3LLFA 1B5TA 4M3PA 1VENA 2Y63A 3OBKA 4MTVA 3BLOA 3U4FA 3IJ8A 5XIAA 1A50A 5CPSA 4J3VA 2DSWA 4RDVA 4YCOA 1AFSA 5A8NA 7REQB 1W54A 4RNFA 4AXKA 4JX4A 5KSWA 2J25A 2X16A 4PMQA 2PZ0A 4G6CA 3M0XA 2CITA 3GX9A 2ZWYA 5HQMA 3M7WA 1QW9A 2QPXA 4EKJA 4GZIA 1MVYA 3WF4A 3IACA 1XRTA 2PDPA 2CHNA 2V38A 5HDRA 1OVDA 3W7EA 3SUWA 3C3NA 3A4XA 4IIBA 4E2VA 4LBSA 3W70A 4AHPA 4GBDA 4D1IA 4JHMA 3B0XA 2VUYA 4U33A 2Z1BA 2FZBA 3GXNA 4C6QA 3NO3A 2AGTA 4CEXC 4MWAB 4DLFA 4S3CA 3L5LA 1TZ7A 1EDTA 2BV9A 4I90A 5HATA 3LLDA 1KRMA 1WKFA 2H9AB 4O1DA 3MCNA 4JHOA 3M0KA 2X1UA 2WJEA 3WBYA 2W63A 3RCMA 3PZIA 2PDWA 1OIFA 3VOCA 3BMXA 4FS9A 3UR5A 1X6UA 1EP3A 1OGSA 4ZO7A 3UJ2A 3OVGA 3V16A 4D9PA 3PR2A 3RM8A 5U4NA 1B31A 4JCLA 2QPSA 4KF1A 1OD0A 4KS0A 3WF1A 1VKFA 3CLMA 3KS5A 4UTIA 5BOOA 3T2QA 3ZJ7A 1GT8A 1TPH1 3CIXA 3WQVA 3CV1A 4GHRA 3FVMA 2HPMA 1IR1A 2Y88A 1JYVA 1XR2A 1LT8A 3T55A 3NQ8A 3GD6A 3QF0A 2Q8ZA 2INZA 4UUIA 4GD0A 3MMDA 4YMZA 4MB5A 3FGCB 4AZCB 4ZO6A 2CBIA 5EB8A 2QQ6A 4HU0A 1TV8A 2OKTA 1WQ5A 4GO8A 2X41A 4EP8C 4YWIA 2HS6A 4YTTA 1I2NA 3W1LA 4RK8A 2IKIA 1Y8BA 1BGAA 1NOWA 1RCQA 1R6WA 3PFMA 2CWNA 3LBMA 4WKFA 4G2DA 3KLKA 3RFAA 2PC4A 3P14A 3PULA 4YYFA 1TV4A 4GQQA 1KA9F 1SZEA 4QE5A 1ZBKA 2VO5A 4JTDA 1FH7A 4HPJA 1QRQA 1HQTA 2YB4A 1O94A 3APTA 4NX5A 3PVFA 3WLRA 2ZUNA 3UA4A 4AISA 4L7ZA 4ACZB 1CCWB 1V7YA 1AUSL 4FK9A 4KRZA 1V6XA 1A5CA 3H7RA 3VKAA 2PWDA 3F7JA 3TTOA 4KIEA 5E6ZA 4QDPA 1ITXA 4WVXA 3KZSA 4HZ8A 2ZA3A 2DT3A 4XG1A 1M53A 2ATSA 4D6CA 3BANA 1QNOA 5K3VA 2AMGA 1T0OA 2DT0A 4Y9PA 4Y96A 3AISA 1OGGA 3ATZA 2A7NA 4AZGA 1RK6A 2WANA 3UGVA 2BVWA 3W1QA 4UMBA 2REQB 1ADDA 2X7WA 3WQPA 2NWSA 5I03A 3G1SA 3MPGA 3N4FA 3SW6A 1TVLA 2PDFA 5I3FA 3ENLA 5FKYA 2C1HA 3PFRA 4C5ZA 2NV1A 4WSHA 3QPYA 3HGOA 4WDWA 3M4HA 4GI9A 3BGAA 3K1GA 4B5XA 4JY8A 4UQBA 3ZWTA 4FNPA 1KNWA 3WL0A 3GFYA 2FPTA 5IOBA 2WC4A 1F6PA 2J8GA 4M56A 1I45A 1TPB1 3BQ6A 4FAMA 4URIA 1HJXA 4GI8A 1E6RA 5L9FA 3GRIA 3NQ6A 1HX0A 3PAJA 5AY7A 3SGGA 5LIUX 4LU0A 4O54A 5C54A 2HZGA 4IX0A 3IVSA 1JCYA 4PYSA 4FNQA 2G3IA 5HMDA 3SRKA 3S5SA 4QSFA 2AKMA 1XD0A 4H8UA 3BE7A 3ARTA 3WQGA 4JS3A 1RBOB 5LSMA 3QHOA 3PG9A 1K7FA 1R2RA 1DKWA 3QC0A 1E9IA 3BSMA 3KW3A 1CGWA 1EC7A 3O6YX 3TQKA 3EWBX 3NSMA 4MAVA 1RBAA 3UFYA 4I7VA 1EHAA 4E5TA 1C8YA 2QPUA 2XPKA 3AIBA 2VEGA 4KRUA 4UIOA 3WLMA 3L2LA 4MZ1A 3MSDA 2WOQA 1XIDA 4ZE5A 5LKYA 4Z0SA 1GHSA 3M64A 5HNUA 1GONA 1NDWA 1L9WA 3I3BA 4S1FA 2J8TA 1HUVA 3WELA 3R89A 1EHNA 4JTSA 5AHIA 2XFYA 2VEMA 1NFPA 4QAWA 4KEZA 1ICQA 3F4NA 3IIZA 3GY1A 5I02A 2YPIA 4N9BA 1SMDA 1MW1A 5DBTA 4RL3A 2PZNA 2J7GA 3FNDA 2G0WA 1IEXA 5BW6A 4S3DA 1UHVA 4WKHA 3L68A 2IPWA 4JYEA 4R9OA 2QCHA 3OG2A 4UMAA 4GVHA 1E5NA 1BFNA 3ZSSA 3W24A 1CDGA 3IK2A 3RLHA 9XIMA 3T4WA 2OLAA 3VIKA 3U8GA 3V1HA 4PMZA 1MEHA 1G94A 2X09A 5L6UA 3SEPA 2DW7A 4I5UA 1QI2A 3DERA 3LGGA 2O9RA 2Y8KA 2Y5EA 4HN4A 4CD7A 4IJCA 4H2CA 2TRSA 1VP5A 3FFSA 3WYZA 1S5WA 4JX6A 3H6OA 2GSEA 2ZX5A 4PB4A 4DM2A 1XG3A 3FJ6A 2WSQA 3H53A 1ISWA 4L80A 1XYLA 3UR8A 5FJOA 3H23A 1V6VA 3SY5A 3UU0A 4JPGA 2VOTA 1KBIA 2IQ0A 3PM6A 4DRSA 2F38A 3CT7A 1R87A 4UTFA 2ISDA 1CGUA 1GQLA 4J9JA 3P5YA 1AH3A 3MW7A 4MNLA 4BF5A 2J88A 2NUXA 1CGTA 2NV9A 1YDOA 3UPWA 3RUBL 2RH9A 3SUSA 1OK4A 2NWRA 4H9ZA 4YTSA 1K9FA 4GY7A 3GHSA 3C8FA 2QAFA 2CLHA 5EY5A 1BVZA 5IRPA 5M3WA 4J3ZA 2GDVA 3DFNA 3KOYA 1GEHA 1M7XA 3GW0A 5CSUA 4D6GA 1Z7AA 1B3WA 3B4YA 3N9SA 1PZ1A 1R3RA 3NGFA 1QK0A 3LQLA 3W25A 1S5VA 3MY9A 3W27A 5F2LA 4HOXA 3UWUA 3NL3A 4O8RA 3C0QA 4XK2A 3ABXA 2VJXA 3MYPA 1XGDA 3KRBA 3DI0A 2GJRA 4QAIA 3M5XA 3K2GA 4JNYA 1K6AA 2VOMA 3N4EA 2V82A 2J75A 2V5LA 4NXKA 1VF8A 3FA3A 2V3GA 3DFTA 1ITCA 1OABA 4HK7A 1Q63A 3T40A 3SCSA 4WGXA 2G3MA 1A49A 3CHVA 4DYEA 1MW0A 4XZWA 3FKKA 1W1PA 1DIOA 1I9CB 3TIMA 1LQ0A 4LWWA 4AHQA 2QIIA 4HNOA 3WEZA 3GC4A 2OWWA 3AHZA 5CGQA 2D0HA 4S3AA 2HMCA 1GQIA 1P6CA 3R7MA 4CNUA 2D2GA 2A3AA 5F1VA 4C6CA 4ICNA 2PDIA 4Q22A 2PDGA 4WLCA 4ATLA 1OX4B 1XDLA 3IEBA 3CV7A 4C6NA 4IF2A 4M1BA 1LLZA 3W87A 2JGYA 1V93A 2WZMA 1NELA 1MQPA 4MPKA 2QGYA 3BMWA 2PLCA 2FH6A 4IFOA 4M6UA 1H09A 5DCDA 3BLLA 2WNWA 1Y7VA 1R85A 2X42A 4FXJA 1M68A 3AXHA 3GTXA 4AD0A 3EDFA 4JTLA 2QULA 3GBEA 1UC4A 2F61A 5A6TC 2ZXBA 4W7WA 2YW4A 2VC6A 3C8NA 1PZ3A 4F0MA 3S1WA 1EGMA 2Y85A 2GGIA 3LTPA 4LQ1A 3CZKA 1JFXA 1S39A 2AQVA 4C91A 4QEEA 4G7EA 1C91A 3BOXA 5HR7A 1XRSA 3STEA 4ERGA 1SW3A 5F4WA 4UR9A 2QUUA 3N1AA 2QCFA 1CPUA 1TA3A 5K4XA 3TZFA 3E74A 1AL7A 1TJPA 4IIEA 2DORA 1NQ6A 1D8WA 1SO3A 3MMTA 1XINA 3LQGA 1BSIA 2QW5A 3VD5A 1S5TA 5CZKA 2YA2A 1IZCA 3LMYA 1FDYA 4PA8A 4O17A 3PY2A 4GVFA 2C13A 5H2ZA 1H3GA 4IGNA 2QZRA 1HVXA 1SJBA 4ZFMA 3TX9A 4J27A 2JIWA 1GYNA 4PUDA 3VD3A 5D2YA 2PWHA 3F5JA 1SQ7A 1H5VA 1FWJC 3SRHA 1TELA 4C1LA 2R24A 2POZA 1RXOB 3FEMA 4LF1A 4QJ3B 3BMVA 1UWIA 1J10A 1FWDC 3PTDA 2VFHA 1SMAA 4BI6A 2SFPA 2CNCA 4ERIA 2JEPA 4JTCA 1UP2A 1KXHA 1VEOA 2WZIA 4IMDA 1F5ZA 5AOUA 5FJTA 4EPBC 3VINA 2OGJA 2ASHA 4HJFA 1TR1A 3EA2A 2FMOA 1HP4A 3DYMA 2ZUTA 1KTNA 4LAOA 1U5JA 1J2WA 3TK7A 1C90A 3GU9A 2IKJA 4L4OA 1CT5A 2W27A 1DIEA 3NQAA 3ZJKA 4AD1A 3LI1A 3AS1A 3TEVA 3P62A 1AL8A 4HGXA 3AYVA 4AX7A 2G37A 1E0XA 5BMWA 3CMJA 4NZ1A 3DIPA 1XDJA 5AHFA 1FWHC 2GVYA 3QTGA 3BGGA 4AMCA 4KWVA 2PSNA 3VCCA 1OJXA 4DAIA 2DZVA 2YFOA 3P60A 5A6AA 2G95A 4DEFA 1OF6A 3W1UA 5KETA 4AMAA 4GQ0A 1PDYA 4GISA 1Q7QA 2WMHA 3N6QA 3GXPA 4BQ3A 2GWNA 1XIMA 4MZYA 2B31A 4DJEC 1QPKA 3KOFA 2BNJA 4XZNX 4M0XA 3AXXA 1DE6A 1RZMA 1SSGA 3NNTA 3E6EA 3PBWA 4HYVA 1D8CA 1QNSA 4HTYA 2XH4A 3IS4A 2CBJA 2EQDA 1VBHA 3EOOA 1KV5A 1T7LA 5FF4A 3WUBA 3ARZA 3R13A 2IKHA 2ZZ7A 5CCZA 1GOWA 1TE1A 1KXQA 3VU2A 1L6SA 1TX2A 1HFBA 3LGDA 3W6MA 4NZ5A 3W4RA 5BZAA 4F9DA 1M41A 4F2UA 2H9AA 4GMEA 4JOMA 3SFWA 3T7VA 1VLWA 1W1YA 1YX1A 2O92A 1W5PA 2BHZA 2XIMA 4J3UA 4WZHA 4LV9A 2WJFA 3USBA 3S0CA 1ONXA 2CBUA 1LL6A 3OG3A 3GDMA 1PUDA 3P0WA 3UZWA 1BTCA 4JIIX 2WWDA 2ZUMA 3S5NA 1POKA 4DJDA 3S2MA 2YZRA 3DOPA 4DZAA 3G22A 3S5ZA 3TKFA 4JN6A 2XTKA 4LAZA 3S9IA 3ABZA 5IFTA 3LRKA 3LDVA 3QY7A 1ZSXA 4IIHA 1E0WA 1H5YA 1J6PA 4IL2A 3TMQA 4LC8A 2PS2A 5CPNA 2NX9A 3NO1A 2JEQA 4IMFA 1DJYA 3G2GA 1KFEA 2QJIA 2EKCA 2PB1A 4XQ6A 5FF0A 4XWUA 5M2FX 1XKJA 4JDBA 1UH4A 3CZEA 3R58A 4UTKA 1EXPA 4LYPA 1JZ7A 3CUIA 4PZVA 3VZXA 5CQ1A 4XBJA 3UZYA 2Q3OA 5K9CA 1EPXA 4ZZ9A 1O5KA 1TQXA 1S46A 1OD8A 4GIYA 1EEPA 1TVNA 1DWHM 2GOUA 3IJIA 3HN3A 2RKXA 2F7FA 2VC9A 4C6EA 3H70A 2CXEA 2HQAA 3CU2A 3H24A 1ZJIA 5GJNA 2ZUVA 3PN8A 2ZZ1A 5LNUA 3CM4A 1OADA 4NNAA 4EACA 2XVGA 2ADAA 2FLIA 2WZHA 4JTRA 1W9PA 4B91A 2E6FA 2E6DA 3L7RA 3AWOA 4PBEA 2A3HA 3KVLA 3O0FA 5DQPA 4XX6A 1KXTA 1XBYA 3UR2A 2Y7FA 3BAKA 2DU2A 1KKRA 2J24A 1SFLA 2ZXAA 4O1CA 1TUXA 1QAPA 2XVKA 3VNLA 3CWOX 4MJZA 3NDOA 4QNEA 3KRUA 2BP1A 2I5IA 2Y7EA 3VDAA 4ZGYA 2IQDA 4PMOA 1B3XA 2PD5A 1D7KA 4AEFA 1ME8A 4LH8A 4MUPA 2WSRA 3M0IA 3S6OA 4BF9A 1TIMA 4V1YA 2A6LA 4PMJA 4B9ZA 3KBWA 1OYBA 5A6MA 4DLMA 1Q4NX 1LQ2A 1WOBA 2PGRA 1RUSA 3N2BA 1H50A 4TR9A 4OU1A 1FH8A 4HSHA 3Q58A 4WHBA 4H04A 4BI7A 1LOLA 4GH3A 4A4AA 1FP9A 1GOOA 1F74A 3FEQA 1PHWA 4H6KA 4R9XA 2E68A 1M3UA 1AJ2A 1B3ZA 1CLVA 4BR1A 1A0EA 3GDRA 4NZJA 1U33A 3KHDA 2I17A 4LAUA 3VIMA 3OZYA 3KUMA 3HGSA 3MBDA 5MHBA 3LPOA 4WX2A 3WH5A 1C29A 1OBAA 3T42A 5D38A 2ZTJA 1GQJA 3COTA 4KFOA 1HGWA 3LERA 4M80A 1K3UA 3DG7A 2GVLA 2R1KA 4B5WA 2WM1A 3BWWA 3V36A 4D8AA 3W0KA 4UQ9A 3E02A 3H7UA 4PMUA 1IXQA 4DVOA 3QBUA 3RILA 3KBJA 8A3HA 3TTEA 5LZLA 2YYTA 3T2PA 4YVPA 4C90A 4DO4A 3RR4A 1JF6A 1TPUA 3E49A 3SCTA 4L9ZA 3E2RA 3ZR6A 3ARWA 1EC8A 5E6YA 4LV4A 4Y90A 5I0DA 2F6KA 3TAOA 1RCXB 1XYBA 2QJHA 4W86A 1W9XA 1CI1A 1WOAA 2OZTA 1RLDA 5M17A 1EA0A 3LHVA 4DBDA 2ZFAA 3FJNA 3VUPA 3SQLA 3PZOA 4F0RA 2B7NA 4IGSA 1KLZA 1J0ZA 2VRKA 4N6FA 5G4EA 1QNVA 1TV3A 4XVDA 2A5HA 3GTFA 2IQTA 4C65A 1DJHA 1FWNA 1LRTA 2Y62A 3WO8A 3PZUA 3K8MA 1MEWA 2E9MA 3QPZA 5EMLA 1RR2A 4C6FA 1R2SA 3N9KA 3B05A 1XIFA 3S42A 3RLVA 3PPGA 4ORIA 1NSJA 3FSUA 2ZDSA 3HJEA 1F07A 1P0BA 3GNXA 4WEVX 4Q7IA 2A21A 2VGGA 4FOKA 1BKHA 1TJ0A 3LZ5A 4V1XA 1K1DA 3L0NA 2IUZA 3VNJA 4HZMA 4J3TA 4OHQA 2CKRA 1XG4A 1VFSA 4M6QA 2ZRUA 4UFHA 5CSSA 1S2UA 3R1ZA 4LC6A 3NA8A 5C0QA 2EF9A 2V69A 1HKVA 3LA4A 4NRRA 1ZPTA 4RE3A 4WR3A 2Y24A 3NFUA 3OEXA 4A3UA 4IIDA 2XYLA 3PZVA 3W00A 1MMFA 4W88A 1IE7C 3WNOA 2VCAA 3DZ1A 3SCPA 4NQ1A 1QO5A 3M0ZA 5CLWA 1XDMA 2I16A 3O15A 2MANA 1UOZA 4BEQA 3ES7A 3PZNA 1X7IA 3BW2A 3QZ6A 5A8MA 5D4YA 1LG2A 1BRLB 1XHGA 1H49A 2BFGA 2YBUA 4CU8A 3MTWA 2BXVA 1WBJA 3NCOA 1Q7MA 1FA2A 2BLEA 1UJPA 3DYPA 4NL1A 4LS1A 3W88A 4JAWA 5AFDA 1IEQA 2Q71A 1W1ZA 3OPSA 4OV9A 3T4CA 2G3FA 2ZZ2A 1QNPA 1ZBCA 1LTDA 2OPJA 2DZTA 3CAWA 1O68A 4A35A 3W7MA 5CC7A 1X38A 1OX4A 1V08A 1UH3A 2RDWA 1MQRA 1KRBC 1ISYA 2ZXDA 3EOEA 1TTPA 5KZDA 4IUGA 1G9HA 1QU4A 3SUUA 3ARVA 3TLLA 1MRQA 1XLHA 4QIUA 1X97A 1UKQA 3UA3A 1YMYA 1S3TC 3M07A 1MUWA 5A2BA 1Z44A 4HMEA 3BUVA 3VDBA 2XISA 2V5KA 3SCOA 1H1NA 4O1EA 1VLIA 4JNZA 2IXVA 3UG3A 4TX9A 4QQUA 1ZCOA 3B9EA 2W0UA 3ABSA 1JCTA 4B2DA 1I1WA 1TRIA 4HHHA 3BG3A 3LSCA 1P1MA 3S2NA 3MMUA 3GO2A 1TTQA 3GDLA 2ZA2A 4PMDA 3WJXA 4LEFA 5JH1A 3SO7A 3PWIA 4KFNA 2CEQA 3QMRA 1YNYA 3GAYA 4DUVA 4QE4A 1UZ4A 1Q6LA 1XIHA 1YTKA 4Q8TA 1Q2RA 4RUBA 4WSKA 1VIWA 1UKSA 1UQZA 2CLKA 3KE0A 4TVUA 2CZEA 3VFLA 5A8QA 3N2XA 1CEOA 2HWGA 2NLYA 4MNJA 3GUGA 3U4AA 1XIEA 1W5QA 3NPWA 3TSBA 2ZRYA 5T26A 1UKPA 8RUCA 2D2HA 3PHAA 4RXGA 4KH2A 1W3KA 2Q8LA 5DBUA 4DWSC 4W9TA 5HUPA 3IJ9A 4NAFB 2BHYA 1IYXA 3TFXA 4AWUA 4XAYA 1QFEA 4K8HA 2HEJA 1PBGA 2X1SA 3K1DA 1BQGA 4AD5A 4AXNA 3BLKA 3VUSA 1ZCCA 2PE4A 5FAJA 4MMWA 5TIMA 1JCMP 2PP3A 4UQEA 3BC9A 3FA5A 2Z2AA 4TV5A 2CFFA 4C7FA 1XX1A 3SN0A 3UZZA 3CV6A 2CKSA 1WKDA 3GIPA 4JFUA 4MWAA 4Y2WA 3VIFA 1LWHA 4WGHA 1MI3A 4GE8A 5IDZA 3W7IA 1HJQA 1H7XA 3WUFA 4TOQA 3H21A 3MHGA 3CQIA 1Z69A 3WLJA 1LBLA 4L6HA 1VYRA 1HT6A 3CUGA 1Q6GA 2REQA 3SIMA 3DU0A 3RMEA 2JK2A 4N02A 4D6EA 4ERAA 3DBPA 2QCCA 3M41A 5HNNA 2AQOA 3MB9A 3MYOA 4M7SA 2RUSA 3SRFA 5CPTA 5DELA 4LAKA 5HMEA 2V67A 2C19A 2ATMA 2ALRA 1UP3A 2V9DA 3ITGA 4KRTA 4S23A 4CNOA 1PCKA 2OXNA 4LNYA 1FHUA 5CGTA 4TQTA 1NWTA 2C79A 2V81A 2Z2UA 1FHVA 4KMQA 4PCTA 6ALDA 1XYZA 1EUAA 4YVXA 4ROPA 2DZBA 4Q7BA 2GJXB 3RN6A 5E70A 3U0HA 4B3KA 4PMYA 3U9IA 6TIMA 3PZQA 2GZXA 2Y7GA 3WQFA 3K4DA 1CXKA 3MS8A 5EMJA 1ICSA 4IPPA 3H2MA 4QISA 5J5DA 3B8WA 3LN3A 2GQ8A 3OGVA 1FKXA 1JZ4A 3RDKA 5ABHA 1GZJA 3SQMA 1H61A 2P10A 3HQOA 4GYJA 1IXNA 4Q4PA 2ZYFA 1TWZA 2V0TA 4HPXA 1I2OA 5C9RA 3FAWA 2FH8A 2H3BA 3C0SA 3KCJA 3F1QA 4O8AA 2A2IA 4GKTA 2OX1A 1ZP4A 4REQA 3FHAA 2FDSA 2I14A 3P3BA 3GZ3A 2Z26A 1YNPA 2VX5A 3EEGA 3VX0A 3W7LA 1AQFA 3W2UA 2CHOA 4FO4A 2W61A 3I7SA 1TWDA 2H90A 2OQLA 4WDTA 3W86A 3EX1A 3MUIA 3N4AA 3LU2A 1MW2A 1VB9A 4HP5A 1GQKA 2OVLA 2UV8G 4NYYA 5REQA 2XFFA 2V5BA 3W2NA 1OQFA 3P6LA 3C2OA 3DC8A 1X1NA 4CQAA 3ELFA 1RVGA 1EYWA 2OLHA 4QCEA 3HMCA 2VELA 2YCLA 2Y8VA 4M81A 1VHNA 3O1NA 5TQLA 5AHLA 3VGBA 2YYUA 3OA5A 4XBKA 1N8WA 3UCDA 5DCBA 2XN1A 3RM9A 4B9YA 2EHHA 4IMAA 2XM1A 1ADSA 5HA7A 4J35A 1AA1B 3HA1A 4D6IA 3OLGA 3NQFA 2G3JA 1J5TA 1DORA 1QUMA 2EJ1A 3TFCA 2PRLA 2IKGA 4MFDA 4G7FA 1XH2A 2GGHA 3HO8A 1S5NA 4GA8A 4GQBA 1D3GA 2QT3A 1SW0A 5AYYA 1TTIA 3CYVA 4JTKA 3EKGA 3S47A 4ZQOA 3EOLA 1FWWA 1WZAA 4MB3A 1O6IA 1OCNA 3TSMA 1S2VA 1WKEA 3VM7A 4NJKA 1DEDA 1N55A 4JIRA 3W7NA 3N11A 4RNHA 1PWMA 3EX3A 4PTNA 2EO7A 3NM1A 3TYUA 1ISXA 3ARQA 1FDZA 4Y8FA 3WD1A 4O4WA 2XUCA 2QLYA 4F0KA 2YL8A 4EIVA 2YL5A 4C60A 4DAFA 3LV6A 5HPCA 1DJGA 1M7OA 4TX6A 3O16A 4W7UA 1XIBA 2ZRZA 3H2FA 1H7PA 1ME7A 1CENA 3ALFA 3B40A 3DFOA 1VCVA 3QMTA 6XIMA 1E6ZA 2EG8A 4H1ZA 4NKCA 4AD3A 2WV8A 3FK4A 2ZUSA 3OODA 2PBGA 3EZ4A 4XZBA 4GXMA 4R27A 2PTYA 4A2RA 1MDRA 2L5HA 3W2KA 4PUKA 3AS3A 3L0KA 4MPQA 4L56A 3N25A 2YCLB 1GJPA 4CVWA 3L2MA 2G4JA 4JTTA 3PTQA 1GKPA 1ZENA 3DHFA 1GG0A 2R1NA 3UZ5A 1R3WA 2VYOA 3WNMA 2ZDRA 3GXIA 1B30A 3ITLA 1EP2A 2AAAA 3VKKA 3AYSA 7ENLA 3UY7A 3W26A 4DBEA 4UB9A 1XLBA 3L5AA 3O7UA 3WQOA 4DBWA 2VUNA 1TPDA 2DUZA 4PGLA 5DN1A 3F5KA 5I77A 1TJ1A 3N04A 1P4CA 5HQEA 4WRHA 1SZRA 5DT5A 1I1XA 3QHMA 4ACYA 3L4UA 1AW2A 1R7OA 3OO2A 4O11A 1VQTA 4DUWA 1ODUA 5MKGA 2MNRA 1IZJA 2VT0A 4UTTC 5HAOA 4U10A 4AG0A 3EWUA 3CXOA 1XLIA 1E55A 4S2BA 2EBNA 1XPYA 2X8RA 4GABA 1VFOA 3LG3A 3TTYA 4RZBA 1Z32X 2DT1A 1KKOA 1G67A 1M5WA 5DT7A 3UXKA 5FEXA 3E0IA 3ZS4A 1VFFA 3S46A 2V5DA 2Y5JA 2VWSA 2WB5A 3H22A 5DO8A 3C52A 2I9EA 4QJ4B 1I0BA 5A8PA 4M8UA 1I4NA 3E2SA 2VMFA 3DGRA 4GC3A 3HF3A 5LGZA 3BZJA 3E3HA 1NARA 2NZLA 2ZZ4A 4U5KA 2E67A 3BW4A 3E0WA 5K9XA 5BRQA 4LOCA 4GNJA 2RJHA 1TV5A 4DNMA 2VURA 2J9YA 3ITCA 1ZBWA 4PMNA 2HRWA 4NAEB 2QCLA 4HD5A 1JYXA 1KCZA 3KVKA 2Z1SA 1RA5A 3E0VA 3A22A 3C61A 2DP3A 3TYBA 1VRDA 4S38A 2XSBA 2V5JA 4ES4A 3AIRA 3PBUA 1VFLA 2B0MA 3TZNA 1KTCA 3G3DA 1KGXA 4N4QA 7TAAA 4PCFA 2QUTA 3T05A 5IHRA 1SZFA 1AJZA 1Q65A 2QV4A 3AWNA 3QSTA 4LRTA 3KEHA 4EK7A 1F6KA 1GOQA 5F7UA 2YBVA 4CU7A 3FIGA 4AH7A 5EPDA 4GZJA 3QFEA 4DO7A 2YOCA 1W1B1 3SAZA 1CIUA 2GUYA 1XSKA 3NURA 4MJ2A 4XTDA 1BF2A 5E0KA 4QCFA 3U3HA 3IK4A 1DXFA 2OKOA 1O66A 1GKQA 1W1VA 2VX6A 3OA3A 3WBEA 1AD1A 5CZJA 4UCFA 1NFBA 2OZ8A 1TUFA 1DWGM 4XIAA 3UEQA 4J40A 2PMQA 4F40A 1JPKA 3H4XA 5KZ6A 4GIEA 1BRLA 2Z4GA 1IQ8A 4XZLX 3SSJA 5KINA 3IIOA 4OV4A 1H7WA 3UESA 3G1XA 1C8XA 3SJ3A 1A4MA 5A8GA 4FXSA 3MVIA 4W8BA 3FY1A 1GVQA 4X9YA 2BASA 4MIMA 3W07A 3C2EA 2GUUA 1TJRA 3L4XA 2YL6A 3SUTA 2GQ3A 3M0HA 3ZWSA 5JIWA 1A5SA 1V3JA 1JG9A 4XD3A 2WHMA 3GVRA 4O14A 1GVFA 1P0DA 1RJQA 2D22A 4YXGA 1YNQA 1VJZA 3UG5A 5FEPA 1W3JA 1QNRA 1LZOA 1HTIA 3FYOA 4F0SA 1E9LA 2VRJA 3UJSA 3BG9A 1SU5A 2WSYA 5A69A 4U2ZA 1KBLA 3VCNA 4A3RA 4MWAE 5G2WA 1I6NA 3CTTA 2PDCA 4EXAA 2FQIA 1K7XA 1TWSA 4B15A 1J11A 4OZOA 2PTWA 5IBXC 1HL2A 4IJRA 4AUBA 3WLKX 4PCNA 1U2YA 2CZ5A 2GDUA 1ZP3A 5E0CA 2NXIA 1FFQA 2XIBA 1CW2A 4F4RA 3VDCA 3LK6A 4QGCA 1ITQA 3MCMA 5DMMA 1HG3A 4QM1A 3EAUA 4NASA 1F4HA 2WSPA 1XYAA 1W5NA 3LB0A 3FX4A 4OOUA 2IXUA 3T44A 5E0FA 1MFUA 4M6VA 3TW9A 3FOKA 4UTWC 1XI3A 5FOOA 4KEVA 5CJNA 3NQ7A 5I3DA 3M5ZA 4H9TA 5CJ5A 2BB0A 2HDJA 3CV2A 1KM0A 3C86A 3TQ0A 3N13A 2J6XA 2KZHA 3EPNA 1FVPA 3LRMA 1IT8A 1QVBA 3ZFHA 2NVCA 3OGSA 2JALA 3TYCA 5KTLA 5C5YA 2WBKA 1ONRA 1WPCA 2BS9A 4FZIA 2X7VA 1DXIA 1DJNA 2FTPA 3W1TA 3UY8A 4H00A 4AF0A 2WMIB 3CQHA 3QRHA 3U6WA 3EBVA 2J7BA 1CWYA 5HMSA 2XH0A 3NYDA 1FHLA 4FNRA 4B5TA 3THQA 1JUEA 4GUJA 2DSKA 4JQ2A 2DZAA 3GG0A 3P8IA 3NDYA 3V1PA 4C7GA 2GJPA 4XISA 4DB7A 2FZNA 2IPJA 4JEQA 1M03A 2FMNA 4E3VA 2E8YA 5D9NA 4MNKA 5CC6A 1OX5A 1D3CA 3A9BA 1EX1A 1NP0A 4GGBA 4CNTA 3CZLA 2DJXA 4PTXA 5LA1A 4KQNA 3HQNA 3V4BA 2BG5A 2BGSA 3O8AA 4O1FA 4YHGA 3AZTA 1YXYA 3MKCA 4R3UA 7CGTA 2WMGA 2YIHA 3UZJA 3QGVA 5EU9A 3BO9A 3DH7A 2WO5A 1XSIA 1KR1A 4QS6A 1JCXA 2JKPA 4GFSA 5GNXA 3SFKA 3TQPA 2OOGA 3W72A 1YTDA 2WZEA 3N6JA 3M0VA 3A64A 3TR2A 4J28A 1E1CA 4HYWA 1V7AA 2OGYA 4WY0A 1KBKA 5DXXA 3JR2A 5MKGB 2A3BA 3A3WA 1GOXA 2NQ9A 3IPWA 5IXEA 4GY1A 5FF3A 1TG7A 3DYOA 3NPVA 4B3LA 2FDMA 4GK8A 1XQKA 3EWDA 1JGIA 2GWGA 5LNSA 3ARSA 3DFYA 1B9BA 1V79A 5I24A 3UJRA 2XZ9A 2QJGA 3W1PA 2D3NA 5JBEA 4LVAA 4AF0B 3NXLA 1UD2A 2DIEA 4R5EA 4QXIA 1QI3A 5HOSA 1MEIA 4UXDA 3B0YA 1SO6A 3P84A 4OT7A 4RDZA 2YBTA 4DXXA 3GR7A 2I56A 1VBGA 4QDWA 1FWAC 4IZGA 3UJFA 3VMNA 4ZOEA 3NEHA 3QTPA 1J6OA 5EBAA 4RZ4A 5GNZA 3SGUA 2H3DA 2WM0A 4C1KA 4Y9MA 2IMRA 3GNNA 2R91A 4X9SA 3IJDA 4K1GA 2P50A 3BAJA 3E5PA 1R47A 1EJSC 4GC4A 4KGJA 4AVNA 4LJ3A 2E1DA 3GNOA 4Z1DA 1TKKA 1GVOA 1AZ2A 2HCVA 3MC5A 1XYMA 4MZ8A 4PB5A 3RPDA 5AYXA 1VH7A 1K03A 3R0UA 4GZ7A 2Y70A 4WQ6A 3HG5A 3W1NA 4UZSA 1RD6A 1J79A 1TCDA 1JULA 5C2XA 2R1PA 2DY3A 3GDTA 3CHEA 1TTJA 2HE5A 4HNCA 1XLCA 1EH9A 2XVNA 3W83A 3MKKA 1W9UA 2TPSA 2VZSA 3L5MA 3QR0A 3MWCA 2NUWA 5JH2A 4ZL1A 1GK8A 3QZEA 1PKLA 4JFWA 1M04A 1FBAA 4D6JA 3SCUA 3STFA 1OCBA 1F61A 2ACRA 2YGYA 2YLLA 2WCAA 2VDHA 4UOZA 8TIMA 1P6BA 4W85A 3TTSA 4MJ4A 3RITA 3GVWA 1E4IA 1QI5A 2VGIA 3KL3A 2C1IA 2AL2A 3W2LA 1JQVA 3DI1A 4QJ5B 4BHYA 5C55A 2RDTA 3EDJA 3M5YA 4FF7A 4JTFA 3WDRA 1GCYA 3C2RA 4NJGA 1JPMA 3EPOA 4EVZA 1TR9A 3WFLA 2HROA 1YDVA 4H9XA 4QS5A 3F4CA 2VZVA 1B54A 1AG1O 2FFCA 2W62A 1VAHA 1CGXA 1DTUA 4ZFCA 2PEVA 2YCJA 1OFPA 1EXBA 1EZWA 4QP0A 3I4KA 4GVIA 2GGJA 5A6BA 4XTIA 1T99A 3AU6A 1WZMA 2XIOA 2VFGA 3GH7A 1VYSX 3EB4A 2WMIA 1EF2A 4W93A 1MO0A 1PAMA 3PBMA 3KDOA 3GB6A 5HPOA 2PA6A 2YKKA 3ZZ1A 4M24A 2V8ZA 4JR5A 2E77A 3TWBA 1PKYA 1JF5A 1MNSA 2ISVA 5G2IA 4INFA 2PTDA 4ROQA 1Z48A 2HBVA 1AMKA 2ZUUA 2PDXA 3WFZA 4S2CA 3LEPA 2G4FA 8XIMA 3MZNA 4DZIA 4JD4A 3GC5A 4P5UA 1WUFA 3B8VA 4AB4A 2CW6A 4Z2KA 1V0MA 3BAWA 3D46A 5F4SA 2Z28A 4FMVA 2DQXA 2YDAA 4RDYA 1I2PA 2VFDA 4FEZA 3PWGA 3N15A 1A3HA 3MDWA 3VNYA 4C6KA 4GXWA 4Z2LA 3WNPA 4Q8PA 3N6HA 5A5WA 1XFCA 2VZTA 3F2BA 4TXEA 2CCRA 2Y0FA 1W3NA 1W8SA 2QVHA 4B4FA 1TIWA 1WDQA 5EBUA 3MWAA 4GYKA 2G97A 2XM2A 3IJ7A 3SR7A 3CQJA 1UPMB 3APYA 4RZ5A 3KWSA 5KZEA 1EIBA 2WHKA 1N82A 1U22A 3IARA 1CXFA 3H26A 3DHDA 3AFBA 3OZPA 2QCEA 3GAKA 4ZQRA 2W66A 3VNMA 2E9BA 5D9OA 3P80A 3ZMRA 1RPKA 3I4EA 1I8JA 1IIHA 4H7ZA 3PUDA 1H63A 4GGHA 3VM5A 1LBFA 1OYAA 3FLUA 3B8DA 3ZQ9A 1OCJA 2PP1A 3TN6A 2ZQ0A 1UBSA 3IUHA 1EDQA 1CXLA 1ZS2A 1Z6KA 2RDUA 3MANA 1ZGDA 4NJIA 5TAOA 5AHNA 4JICA 2HV5A 3IRSA 4JBRA 3VOJA 5IFPA 4CQ9A 2QV5A 1E4NA 1LJYA 3T0BA 7PTDA 4CLMA 3HGRA 3PB0A 3LCGA 3GS6A 4FLQA 1JZ6A 1V4YA 2DUXA 3QOMA 3WLTA 1DIKA 1GTHA 2J7HA 2F6XA 1US3A 3QV7A 1XGZA 1J0KA 1PZ0A 3VIHA 4QSHA 1HN1A 2MUCA 3VIJA 3BOFA 2NVDA 3BLDA 1M7PA 1TPEA 2P3ZA 2JIEA 2PTXA 1DJIA 3QGKC 1FRBA 3E0LA 4F3HA 3I6EA 2GJLA 4Q4MA 1M65A 1QBBA 3L65A 3EX4A 1V0KA 3HJZA 2PWUA 1RV8A 3L4VA 3NQMA 4JL1A 3ZVHB 1FWRA 4K8EA 4PE8A 1I60A 4MF4A 3H4GA 4UR8A 3GNPA 3W7CA 1CLXA 3LCLA 2XINA 1LRQA 3QV6A 2XU2A 1BG9A 3T8LA 3TH6A 1UP0A 2UY2A 3A47A 1R46A 2XFRA 1B57A 2X40A 2FGBA 4AY7A 1L2QA 4LCQA 4ICCX 3AOFA 2ZBTA 4XUYA 4XD6A 3AIWA 3HV9A 4V33A 5HJYA 3ANYA 1UZ1A 3VKCA 1UUQA 1FUYA 4YIWA 3S1GA 2J7CA 3QV9A 3ITYA 2CXGA 4IP4A 1WV2A 2DGAA 5DF0A 3CO4A 4RNIA 2HJPA 3SCRA 3CO8A 1BGGA 3LHZA 4RR4A 2ANUA 1EGZA 3WH9A 1K4GA 3I7QA 4WCJA 3HZ3A 5IHSA 4JN7A 1JDCA 3NTYA 3FV9A 4O1BA 2NXGA 3E9AA 3EMCA 6ENLA 4IG2B 1LROA 1KO0A 4ADSA 3R10A 1E4MM 3ANVA 3BTNA 4GJ1A 3M0LA 2XFWA 1OX6A 4GZEA 4IGMA 4AX6A 4LRSA 1S1RA 2DIJA 4HN8A 3EXSA 3USZA 2RAGA 1TRDA 3NVDA 3G6LA 4DJFA 3HBLA 4JZ5A 1ZTVA 3ES8A 3DEQA 1QWGA 4PUMA 9CGTA 4PBGA 1I2QA 4ENLA 3B97A 1HJVA 2I5QA 3N17A 4LFYA 1W3TA 3EYPA 1JIBA 3RM4A 2D3LA 1F3WA 1YLVA 3TROA 3K5XA 1W56A 2ZE0A 1XLGA 1K8ZA 1J4EA 2QEZA 1E3XA 3CASA 3R79A 5AC7A 3A3XA 3UPMA 5LIWX 7XIMA 2VFEA 4E6MA 3NL2A 1P0NA 1LRNA 3MSGA 1PYFA 2YXGA 4PSPA 4AIEA 1EWEA 2UZ9A 2DSVA 2WQPA 5T9CE 3VNZA 1U1UA 3UWQA 3GYCA 3UW6A 1WA3A 2Z29A 2ZOXA 3APGA 3OVPA 4IIFA 2OO0A 2INEA 4ZXOA 4ZODA 1FXQA 3V3WA 2Z6JA 4M19A 5HUOA 3WN6A 3N2OA 3S6TA 3HB9A 1YPFA 4HYRA 4TTGA 1VEPA 3PSWA 4N7QA 3SCWA 1Q8AA 5C9XA 4NHVA 2PCEA 1KFKA 1TA3B 3WJYA 4OJYA 3AIUA 2VDGA 1ZQ5A 2ACUA 4L1XA 4MLRA 3QR3A 4JKMA 1JGMA 3JS3A 3B9NA 5LHFA 2DPEA 4E2BA 4HMNA 3AIVA 3TN3A 3F2DA 2WJDA 3QPEA 1UUMA 4IP5A 4KCWA 5J5RA 3AROA 3SBFA 2QIWA 1BEUA 1X39A 2JF7A 3F2CA 3WBWA 3WNNA 4L1GA 1OYCA 1UCWA 1A5UA 3VDGA 4A2SA 5LXEA 5DXYA 5M1TA 3BDKA 1ZNNA 3W2JA 4Q3MA 4XSLA 4DO6A 4WSJA 4U4MA 2W6RA 1JNEA 1T6MA 3ALGA 1W2PA 4HHPA 2FJUB 1A5OC 4O28A 1GORA 4IMEA 3N2TA 3CIWA 1KWGA 4L61A 2VZOA 2NQLA 3CBWA 4W84A 4UNLA 4RV8A 3WLSA 9RUBA 3TJIA 3KRSA 4X0NA 4CUCA 1B2YA 2DFAA 1NOFA 3Q67A 1LCOA 4QG8A 1Y5VA 3VMPA 3G5EA 3GH5A 4HA4A 4XKYB 1XUUA 3RK8A 1ZRQA 2GPTA 3T8QA 3QR1A 1A0DA 2XIQA 2Y1HA 1JZ2A 3KBSA 4Q7NA 1TX0A 1QOXA 4PRTA 1H11A 4H7VA 1S5MA 5CZTA 3BPWA 3RPTA 4PTVA 1A5NC 4TX8A 1N8FA 3SURA 3RXZA 2XVLA 2BODX 1GPWA 5ECUA 5RUBA 4A8NA 1V8EA 1MXSA 6A3HA 3AC0A 2OSWA 2Q8XA 1ME9A 1Z42A 5AC5A 1ZHAA 5CZSA 3B04A 1XP3A 3A3HA 4FIRA 1QO2A 3G1HA 4W5ZA 3TXZA 1YW1A 3LM3A 3KLLA 3WNLA 2GGGA 2ZRWA 5D03A 2WVVA 2AL1A 1LL4A 3BCFA 1PTAA 2VHLA 2PDBA 1V51A 2C1GA 3W7KA 1E6NA 2O55A 3THAA 3S1VA 1TPC1 1XKYA 2D73A 3CUZA 2OQHA 1RA0A 3C4UA 1G0CA 1XIIA 4YPJA 5I78A 2NLIA 4XAZA 1GNXA 3S5YA 4TTUA 3PB2A 3JUGA 1KCXA 5A2AA 5BU9A 3QQWA 1IZKA 1OFBA 3D47A 3W85A 1K9TA 3GVGA 3HIJA 4EANA 1IWAA 4C1NB 1CB2A 3S9YA 1XGEA 2NT0A 5CPOA 1I2RA 5D9PA 1KM4A 2INFA 1FCBA 5D2VA 2QGHA 2BY0A 4NYUA 4IQEA 2HNEA 4BK9A 4Q4QA 3RNDA 1XXXA 2YCEA 3CHFA 2RJGA 1C7TA 3MP5A 2DVTA 3NQVA 3W84A 4MOZA 5JMUA 4ZMGA 4HQVA 3S1UA 3W6YA 2GGEA 4HNNA 1NFGA 2VEFA 2ZZ5A 2QF7A 3DUGA 4GQRA 2ZCGA 4PULA 2W91A 5BXRA 1EGVA 3C5QA 1G4TA 4GYPC 2XIIA 5DY2A 4L1WA 1P0EA 3OYZA 4DUXA 3AXIA 3A23A 3TDFA 2A1YA 4LUYA 1Q66A 5T8GA 5CSYA 5DMNA 2O7SA 1KW1A 1BG4A 3WG6A 3BSGA 4P8WA 1A47A 4BEUA 2QUNA 3W38A 2TSYA 4HHLA 3FJ4A 3KFTA 5CKSA 1Q6QA 4D2JA 3BVJA 1ZAIA 4O10A 2PRHA 3GG1A 1QT1A 3R8GA 5F4XA 1H7NA 3NOYA 5C2CA 1R38A 3BCDA 3P5ZA 5CXPA 2EG7A 4K7VA 5M5DA 1AZ1A 1EUNA 4IQDA 3NYZA 2Z1KA 1OSEA 1D2KA 4OIFA 3ZVIA 3SECA 4BWLC 2Z6IA 1QTWA 1TB3A 3PUEA 1Z41A 4P7RA 3P67A 2ZC8A 3AHVA 5CG0A 4DXKA 2V3DA 3GH4A 1Q6RA 1HL8A 3MUCA 2QCDB 3TTQA 4HNTA 3UP8A 1IXOA 3LGEA 4B5NA 3TXVA 1PCWA 3TCSA 1YADA 5HJLA 4M29A 4LVGA 2XHYA 5BYWA 3BL3A 1K8YA 3KP1A 3GE7A 1XIGA 1HXJA 2WVVB 3FDKA 1KM2A 4C1NA 3STCA 2A0NA 4AFYA 3V35A 4K3ZA 4Q8MA 2FZ9A 1FDJA 1PVNA 2YJQA 3SSZA 5CLTA 4UZUA 5SWUA 2E8ZA 3ATYA 4NI3A 1W3IA 1LOQA 1TPVA 3KBNA 3T08A 1W9DM 1O95A 3LHUA 1R3QA 1QHZA 2KX9A 5I3GA 2NXHA 2XWDA 3VD4A 5A2CA 3VAVA 5M03A 3BGJA 4O12A 4GH1A 2CLPA 2E9LA 1DQXA 3BK0A 1PV8A 4WY0F 3VE7A 5C9ZA 2F2KA 4NNBA 3A12A 1F8MA 5D9MA 4AZHA 3LUTA 1J2BA 4C6IA 1G01A 3L23A 3S2JA 1HNYA 1LBMA 1YE4A 4HK6A 4LB3A 1U5VA 4TMCA 3CAQA 4H4IA 4JTHA 3NQ2A 7A3HA 2VXNA 3IGHX 4O57A 4ZA0A 3SCNA 3CH0A 3B06A 3HU7A 3OVQA 3B03A 1EJVC 4HU3A 3QVQA 4PL2A 1QPQA 4C6JA 1JDEA 3DECA 3H54A 3GM8A 4DUOA 5TD4A 1A3WA 1WDSA 4JXCA 3RLGA 3HFTA 1R3VA 2QS8A 4J2MA 2DH2A 3ABRA 3RGTA 3CPGA 4IX2A 3BV4A 4OVXA 4JKLA 1EO7A 3UXLA 1M6JA 5A6JA 5AECA 4ONVA 3UD6A 3NQCA 4F0LA 3MO7A 1R9XA 1RP8A 1AD4A 5AHMA 3KTSA 3IJLA 1QNQA 4BF7A 5I3KA 2G41A 4Z1BA 3ZLGA 1YKWA 3PG8A 3GTNA 4UC5A 1NEYA 1UIPA 3EWXA 1J8VA