3PTQA

The crystal structure of rice (oryza sativa l.) os4bglu12 with dinitrophenyl 2-deoxy-2-fluoro-beta-d-glucopyranoside
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
478
structure length
478
Chain Sequence
b'PVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase Os4BGlu12
publication title The crystal structure of rice (Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-glucosidase with significant thioglucohydrolase activity
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
total genus 190
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ptqA00
1NH6A 4H8UA 2PB1A 2FHFA 3N11A 2XG9A 3GNOA 3NUKA 3VMOA 2NSXA 1HKJA 1HKMA 2HVMA 4MNLA 2W61A 3AJ7A 3PBGA 4CN4A 4JHOA 2QF8A 4D6CA 1GOMA 4UQCA 3GXFA 2BHYA 2FH6A 4JCMA 5AYIA 5AYBA 2V3GA 3OGSA 3VM5A 1C90A 4RE2A 4ZXOA 4F79A 3NDYA 5EFFA 4W87A 1JZ4A 4NF7A 3RO8A 1M01A 2D3LA 5HOSA 1CTNA 3AOFA 1ISZA 1C7TA 4AZIA 4U31A 1ISVA 3AIQA 2X0YA 3OZPA 5A8MA 8A3HA 1E6RA 1JXJA 3PN8A 3WD3A 1GORA 4HPGA 2DH3A 5JBFA 2IXUA 1UKOA 1JL8A 3AYSA 3AHTA 1CEOA 1J0YA 2UY2A 2ZWYA 2O9OA 1WCGA 2CIPA 1NP0A 4W7WA 2FDMA 1K9DA 5CPQA 5DT5A 3VDAA 4TTGA 1W1VA 2XWDA 3WF3A 4PMVA 3A47A 3O9NA 1D2KA 5DO8A 1Q6CA 2J8GA 1B9ZA 1XD0A 2WZEA 2J8FA 4CD7A 3WH8A 2VTFA 5C8BB 1ZBKA 2DGAA 4AD1A 5AC4A 4KRUA 3MSGA 3HJEA 3IAQA 3AHYA 4D6EA 2WCAA 3MMWA 1FA2A 4HU8A 5LYRA 2ZUSA 1C92A 1V0LA 3LPPA 4QDMA 1JG9A 3RM4A 3ARWA 3BCFA 5HNNA 1GOKA 4J28A 4EE9A 5FL1A 2WPGA 2DT3A 1CECA 4MDPA 1GCYA 1NOWA 3AS1A 2X1IA 4PTVA 4U2YA 5FOOA 2YBTA 2PBGA 4J3VA 5M17A 3THDA 1H3GA 5GPRA 4D6HA 4TX8A 2GJPA 4CD4A 5HPOA 2YKKA 1JD7A 4QAWA 1SR0A 3FHQA 1UR9A 2XUCA 1CIUA 4W8LA 1XSIA 5GNXA 3OB8A 3U7BA 2QPSA 4ATLA 4AZCA 3F5KA 4ML4A 4CCEA 1R86A 1FH8A 3QOKA 4AWEA 1HJWA 1K6AA 3B9EA 4OIFA 3CIVA 3CUIA 1XC6A 1D3CA 1PBGA 5ECUA 1H4PA 4KGJA 4HZ6A 3WBAA 3BH4A 1WE5A 2QPUA 3WKZA 1QHZA 1JDDA 2W91A 5A6AA 3SCTA 4UNIA 2VNCA 5EB8A 3CHFA 1Q6GA 4A3HA 1UWRA 1DWHM 1US2A 1UD4A 3AXHA 3UERA 1MXGA 1GPFA 1G1YA 2C0HA 4CVUA 2IUZA 3WN6A 4KH2A 4GQRA 4W85A 1CGUA 1J9YA 4MB3A 2ZUWA 4OUEA 1TFVA 1X6NA 4UFHA 4P7OA 3QHOA 1E0VA 4GKLA 1E55A 1UWIA 2WWDA 3KZSA 3VX0A 2AOSA 2VZVA 3UESA 3AS2A 1V6VA 4UQBA 1WNOA 5IFPA 1GUVA 4UQAA 3WF0A 1QHOA 4V28A 1E6XM 4XV0A 4XUYA 4J3WA 1GW1A 3O2LA 1VEMA 3CLWA 3WBEA 4AISA 2WHKA 1JFXA 4GI8A 1XD1A 3BC9A 3SCPA 2G3NA 1B2YA 3ARRA 1UD8A 4U3CA 3MO4A 2WHJA 5HPCA 1CNVA 3GDBA 2J7DA 2PWDA 4PBGA 4YHEA 4HZ8A 1ZJBA 4AD0A 4LXFA 3L2LA 1GHRA 1UWTA 4JL1A 3B9DA 1QNOA 4GZIA 3WDJA 1R85A 1V02A 1CXIA 2O92A 1UQZA 1JZ6A 3WELA 2NT1A 4TUFA 3GTNA 5A6JA 2WM0A 1DEDA 1UWQA 3SCQA 1MW3A 4ACZA 1W9DM 2X2YA 2OLHA 2Z1SA 3W24A 5I3DA 2O9RA 3CZEA 3ZJ6A 2BV9A 1KWKA 2D0GA 2E40A 2VRQA 3ARZA 1AQHA 1KWGA 3IJ8A 3VIGA 3DYMA 4WK9A 3T08A 6CGTA 1IV8A 4PMZA 1PPIA 4AIEA 3WH6A 4PMDA 2DSZA 4B15A 4CKQA 2VI0A 1BF2A 5ABGA 5HDRA 3VGGA 2WMHA 4CN1A 3NIYA 3RCNA 3ZT6A 1KB3A 1QPKA 2J7GA 4JFTA 1W9UA 5I23A 1SMDA 1OM0A 4JFUA 4LYQA 4UFIA 4TVCA 2VQUA 3ZO9A 4W84A 1EQPA 4CU7A 2WCSA 4BZYA 3LMYA 3WMBA 2WAGA 4Y7EA 1R87A 3WNLA 1E5NA 1R7OA 3PZQA 3L4XA 1MYRA 2B31A 2XM1A 1E6QM 5BROA 5A6SA 2ZXQA 1J0HA 3WUGA 3PZUA 1PX8A 4UCFA 4AZHA 4J3UA 3FXYA 1VAHA 4XX6A 1VJZA 2D3NA 1GOQA 3M07A 2UY3A 3W6MA 1J10A 2WBKA 4TVDA 1UQYA 2Y4SA 4QLJA 3ARYA 1GQLA 4C7FA 5BXRA 4JFSA 5IHRA 1WZAA 3AYRA 1IZKA 3WD2A 4U2ZA 2FH8A 1E3XA 4Q7NA 1BHGA 1W3KA 4GI9A 1N82A 1LG1A 2WMKA 4PUEA 1KGXA 1UZ1A 1ZS2A 2YIHA 1H0IA 2VX5A 1XHGA 1KGUA 3BMVA 3AMCA 3TOPA 1W3HA 4BQ5A 3GZAA 3K8LA 4ZE5A 3UR8A 1JGIA 1QBAA 3MUAA 4PTWA 5A8PA 3MANA 4DWSB 1CWYA 2NT0A 3T09A 4BQ4A 3AIBA 3AHVA 1CGXA 3VGDA 3W0KA 3WFZA 3MS8A 4TTUA 1UR8A 5CG0A 4UQ9A 1FP9A 5E6YA 3EMCA 2VL4A 3VU2A 2CPUA 3PZIA 2WVVA 2ZUUA 3IK2A 3AXIA 1V3JA 5CXPA 4J7RA 1CXKA 3BAKA 1NWTA 1UKTA 3NJ3A 4X0NA 2WVUA 5E9AA 2V5CA 1WZLA 5CZKA 4M81A 1GOWA 1V0MA 2J62A 1TMQA 1VEOA 3WEOA 4ATDA 2QV4A 5AY7A 3W29A 2QLYA 2WCGA 4B9YA 2CESA 3I3EA 1E72M 4WF7A 2XWEA 5HXMA 3BXWA 1NQ6A 3WEMA 3RDKA 3W53A 2XVNA 3WNPA 3BSHA 1FH7A 4CCDA 1JI1A 4ZENA 3FY1A 4PCSA 3WD1A 1EHAA 3VD9A 1E4NA 2DT1A 1M53A 4QCEA 1VJSA 1LG2A 4B16A 3SCUA 3N18A 3HN3A 2RGMA 4MB4A 1R7AA 4IUGA 2WW5A 5M3WA 3UG5A 4OJYA 3W82A 1HNYA 3VIKA 3FAWA 4D72A 5GQBA 2PI6A 3D3AA 1QNQA 5A8OA 3MSDA 4P7LA 2CERA 1ISYA 1XCXA 2ZXDA 1M7XA 4J3SA 3ARPA 1BG4A 2VQTA 1LLOA 4PMRA 4NRSA 3AZSA 3UR7A 4BQ2A 1FFQA 5BXSA 1B3YA 3WFLA 1K9TA 1PX3A 5I5RA 3OG2A 1IZJA 3QGVA 1AQ0A 2ZICA 4A3YA 3WH7A 1B31A 1NWUA 1PX4A 1DWAM 2OSXA 4TVUA 5CLTA 3KE0A 4D1IA 1E15A 1ISXA 4H41A 4QLLA 2WSPA 1HJQA 1UOKA 4C7GA 3VIHA 2W63A 1TZ7A 1AMYA 1E9LA 4RE4A 3SIMA 3BSGA 2JIWA 4M82A 2JEPA 5E0CA 1Z32X 1JD9A 1EH9A 1MQRA 3ZSSA 3AHXA 3ZQ9A 1ZBCA 2VZSA 1EOKA 1KR1A 2GUYA 1D7FA 3GYCA 2E3ZA 2J25A 2HISA 2DEPA 4LQ1A 3PZMA 3A4AA 2J79A 4PRWA 3ZIZA 2DT0A 2DPEA 3ALFA 1E1FA 3CZKA 1HP4A 3FW6A 3SEPA 3WL0A 1C7SA 4GQQA 5IHSA 3WNMA 4KRTA 1CGVA 4HMEA 1CXHA 4D6FA 2JEQA 4OBSA 3J7HA 5FL0A 1ZBWA 4E8DA 1JF6A 1JZ2A 4JIEA 3ARUA 1QNRA 1HKIA 3MKKA 5I79A 1OBAA 3N12A 4AXNA 1KBKA 2VCBA 2D1ZA 3F4VA 3W37A 3KEHA 1C91A 5BRPA 1SYTA 2XHYA 3HU7A 4W8AA 3FN9A 1GZJA 4Q22A 1AQMA 2YDQA 2E4TA 2WHLA 2J7CA 3N9KA 5GNZA 3WQWA 5I2UA 3PTMA 4B3LA 1QI0A 1ZU8A 4HP5A 1E6SM 3WQ4A 3MUZ1 4PUDA 2OWXA 3WQ8A 3SUVA 1NP2A 3EDFA 1X6LA 3GNPA 1QVBA 1LL7A 4CD6A 1U30A 2EQDA 1BYAA 3WNOA 2GFTA 1BPLB 5CSYA 1TUXA 3EMQA 1MW0A 3VGFA 1MVYA 1VFUA 1OGGA 5IFTA 1SFSA 3WH9A 2OYKA 1TE1A 4Z2GA 1NOFA 5CGTA 2YDRA 1XH1A 2UY5A 1PIGA 4NI3A 3WSUA 3PZOA 1HJVA 1ZBVA 2FGLA 3MV01 4CUCA 1OINA 3DECA 2XFFA 3K8MA 1O6IA 4MJ4A 2GJXB 4E2OA 3T2OA 2D22A 4W86A 5C71A 3KL0A 4ATWA 3KL5A 1CLXA 1BGAA 1BGGA 1V3IA 2O9TA 4DUXA 2WYSA 3DYPA 3JUGA 1JDAA 3SCVA 3CZ8A 1B3XA 2XIIA 2WNWA 1B3ZA 1E40A 4X9YA 3RJXA 2XTKA 5EMYA 2EPMX 2YA1A 4PSRA 3NDZA 2CBIA 3TONA 2PF0A 2WHMA 4PTMA 2EPNA 3A4WA 3MMUA 2J77A 4TX6A 1UZ4A 2Y8KA 3SUTA 4MDOA 1UUQA 5LA2A 2BY2A 1JYNA 5GNYA 3M7SA 4AEEA 1IT0A 4PMQA 4U3AA 1WZMA 2V3EA 4GO9A 4LYRA 2X09A 1HL9A 3VILA 1KGWA 3BMWA 3N17A 4EAMA 3WDPP 4Z2IA 5E70A 3ZR5A 1NARA 3F5JA 1J01A 1J11A 4CCCA 3WNKA 4UOZA 1UYQA 3POCA 3CGTA 3I3BA 1GONA 4M80A 3ZJ8A 1BSIA 2DSKA 4AYSA 2XYLA 1QW9A 3VD7A 3T0BA 1QNSA 2C8NA 3VVGA 1HVQA 1VBUA 4LPCA 1QI4A 1R8LA 2YL5A 2G4FA 5A6BA 1FH9A 5BWFA 1S46A 1CENA 2CITA 1KXVA 2AMGA 3AZTA 4P7RA 3ZM8A 1DWIM 4P8VA 2WKGA 4AZ5A 1BYDA 1XSKA 3CHDA 1LL6A 3RILA 3VGEA 3BLPX 1EIBA 1ESWA 4AD3A 1UD2A 3N04A 4D6IA 2WBGA 2D0FA 4XZBA 5A6LA 3ZMRA 5JUVA 4GZJA 1WDSA 1EDTA 1VENA 3CPUA 1HF6A 2WKLA 4CD8A 1KBBA 3I3DA 4AC1X 3CUHA 3W25A 3HMCA 4Z2LA 2VCAA 1PJ9A 4IM4A 2FHCA 4UOQA 2CBJA 3OLIA 2TAAA 1U33A 1W9VA 3GXDA 1JAKA 1L0PA 1V3LA 3PZGA 4AZBA 4CGTA 2DSWA 4OKDA 1JNDA 2CHNA 3ARVA 3LPOA 3CUFA 2ZOXA 3BLKA 3BGAA 1QOXA 1KR0A 2J47A 2OWWA 4JKKA 5A6MA 2Y8VA 3AICA 1BG9A 1JNEA 5A6BD 2DT2A 1JDCA 4PTXA 3GH4A 1B0IA 1JZ5A 4HA4A 1W3JA 2CEQA 2YL6A 4KWUA 7CGTA 1ITCA 1G94A 3BAJA 3T2PA 2XVPA 1UA3A 3A6OA 3OGVA 1UKPA 4CU8A 1YQ2A 1OGSA 1US3A 2JE8A 5ABFB 3UETA 1V6YA 2Q8XA 1HXJA 4J3XA 3K4DA 3AZRA 2Y2WA 2VX7A 5CLWA 3TP4A 1KCKA 4QLKA 1TG7A 2GJXA 1CGYA 4UR9A 2PC8A 1E43A 4KMQA 4PEEA 3ARSA 1JZ3A 1VFFA 3SCRA 3VDBA 4R5EA 1V08A 3A4XA 3WENA 3GM8A 1H1NA 3AS3A 2E8YA 3CUGA 4YPJA 3SCOA 4CU6A 2VOTA 4M1RA 5DF0A 1UH4A 3WUEA 2YDSA 3IAPA 4F9JA 2JFEX 1G9HA 3MUIA 1LQ0A 1UD6A 3WY1A 1JIBA 2QMJA 1EXPA 1PZ3A 2AAAA 4FLQA 5BXPA 1XSJA 3VNYA 5ABHA 2MANA 2W5FA 1W2VA 2EXOA 1JZ8A 2XGIA 3APGA 1RH9A 1UWUA 2GK1B 1EO5A 1GOIA 4J3TA 4WSKA 2XM2A 2J75A 5EBAA 4E4PA 1XRVA 4UZSA 3T0DA 3NYDA 5A2BA 1UKQA 4WIWA 1VFMA 2ZUNA 4HZ7A 3BAXA 2Y24A 2VZTA 4S3KA 4F8XA 1W2PA 3GXIA 1V3MA 2BNJA 1XV8A 2BY1A 3II1A 2BY3A 1TVPA 2YJQA 3QHNA 3WQVA 2WK2A 3IJ7A 1EDGA 1V0KA 3VO0A 1XH0A 2J7BA 4H8VA 1HX0A 1LF1A 3ZT5A 2DIEA 1VEPA 3WD4A 2ZX5A 3SCWA 2D23A 4MNMA 4QP0A 4JFVA 3ZOAA 1J0IA 2ZX8A 1WDPA 2W67A 1FFRA 3NCOA 5I24A 1PEZA 4N0RA 3VNZA 1J0KA 4MB5A 3AHZA 1EGZA 3M46A 5CGMA 4M29A 1GJWA 1WZKA 6A3HA 1HL8A 3BAWA 4ZE4A 5KEZA 1J18A 1JYXA 1B90A 3CBWA 1WB0A 4CD5A 2DQXA 1XH2A 2VVNA 2DSVA 1V03A 3WDRA 3MMDA 1JZ7A 2GJRA 1I1XA 4M8UA 1Q4NX 1ECEA 1A47A 2XJ7A 3TTQA 4NRRA 1WKYA 1CXEA 1W1YA 4H7VA 1W1TA 3AS0A 3VD5A 1TA3B 2GSJA 2W62A 3RM9A 1QI2A 1CYGA 1PIFA 1J0JA 1W1PA 4F9DA 2WWCA 4DUVA 2CKRA 3AROA 4AD4A 4FF5A 4DM2A 3U7VA 3FAXA 5DEZA 1HKKA 2UWFA 2WC3A 1JFHA 5M5DA 1HVXA 4OBRA 2Z1KA 1TR1A 3PZNA 4AD5A 1H0GA 2XSBA 3AFBA 3VIIA 1QHPA 4HU0A 3AIWA 2YBUA 1AVAA 4QFUA 2V3FA 1OT1A 2DSUA 4GO8A 4H8HA 1NM9A 3F5LA 3CMGA 2VMFA 5ABFA 3DHUA 4WKAA 4AW7A 2VX6A 3VTRA 2RGLA 4GXPA 2G8ZA 2QHAA 2CNCA 1OGBA 1G01A 5FIPA 4AZCB 3WEZA 2BVYA 1UA7A 1K9FA 1QNPA 1ZL1A 2PWGA 3KWXA 3WUFA 2UY4A 1UD3A 2VUYA 4Z2JA 3ARXA 4R27A 4EK7A 1HN1A 2E0PA 5DMYA 3WF4A 5CQ1A 2OWCA 4D1JA 2ZXBA 3EYPA 1MFVA 4W7UA 3LPGA 4PMOA 1V6WA 4L4OA 2J74A 1GQIA 1U2YA 4LX4A 3RMEA 5DT7A 1MQQA 1SMAA 4U5KA 2JF7A 4YN5A 1L8NA 3WH5A 1B3VA 4BQ3A 2VJXA 4UZUA 2OYMA 5D4YA 3EDDA 4AZ7A 1J0ZA 2WVTA 4HTYA 3W6LA 3WL1A 1UHVA 2CYGA 2V38A 5A1AA 3AMDA 1Q6EA 4AMCA 1RD6A 1E6PA 1LWJA 2YLLA 2EPKX 4Z2HA 3MUY1 5A2AA 2WZHA 2YL9A 1E71M 1E73M 3CHEA 4WKHA 5I0DA 2XGBA 3VUPA 2EPLX 5A8NA 3WF2A 4DWSC 1C8YA 4JL2A 4HOWA 1OIMA 2G3MA 1I1WA 3U5UA 4GINA 4JHZA 3U5YA 5ABEA 1OIFA 4X0VA 2WSKA 4OZOA 3ZJKA 2JF6A 1VBRA 1P6WA 3WIJA 3DYOA 4FLOA 4URIA 1G0CA 3A3HA 4MAZA 1V0NA 2ZX7A 2J78A 4DWSA 2XVLA 3MV11 1MWOA 4ZFMA 4K68A 3SUSA 1ODZA 4P8WA 4HMCA 1VFOA 3WQ5A 5I6SA 2CETA 3RM8A 1OT2A 3ARQA 3PZ9A 3WF1A 3THCA 2IXVA 1CDGA 3OZOA 3AISA 3CZGA 5IDIA 1WDQA 1UR1A 3UG4A 3VD4A 5JBDA 2Y5EA 2F61A 2OSYA 1NWRA 1BVNP 2GDVA 3N1AA 3AIVA 4N42A 1QBBA 4Z2KA 3UG3A 5BXTA 1CXFA 4ACZB 3G6MA 3VMPA 3VIPA 1OWQA 3CZJA 1KXHA 2WB5A 4PN2A 3CZLA 1CLVA 4GIAA 3CHCA 3IJ9A 2XVGA 2VR4A 2VURA 4PMUA 1GNXA 1TA3A 3POHA 1KFWA 3L4ZA 2A3HA 4CVWA 4U33A 5A95A 5E0FA 4BS0A 1FP8A 4P7NA 4HPHA 1ISWA 3VKKA 1RP8A 2WLYA 4JFWA 3PZVA 4EANA 2VC9A 2DIJA 5BCAA 3L2MA 2V5DA 3L4YA 4JKMA 3VIOA 4D6DA 2XVKA 2CHOA 1QI3A 2D20A 3K1DA 4DUWA 1ODUA 1YHTA 1H09A 5D8WA 4DWSD 4D6JA 3AMKA 2CBUA 2ZUVA 2X05A 1VB9A 3WDQA 3GBEA 2ZWZA 3WMCA 4UFMA 5F7UA 1JYVA 4W88A 3VIJA 1C3FA 2FHBA 3PHAA 1E1EA 7TAAA 2EO7A 1CXLA 4H04A 1GOOA 4PMXA 4OOZA 1MW1A 4W8BA 1CGTA 1DWJM 1ITXA 4IPLA 5AC5A 3QR3A 9CGTA 1BTCA 3GH5A 4B3KA 3WQ6A 1GVIA 1CZ1A 4BA0A 2DH2A 3CUJA 1PZ2A 5CJ5A 1W32A 4FMVA 2WC7A 1K9EA 2A3CA 2NW0A 3UEQA 3OLEA 4CN6A 1HJXA 5JBEA 2VZUA 1H41A 3TA9A 4MNKA 5CPTA 3QOMA 2VRKA 1CPUA 3WDHA 4ACYA 4E8CA 4PSPA 1FHDA 1BYBA 2BVTA 2E9BA 1KCLA 1MFUA 1C8XA 4U5IA 1UH2A 3K46A 4WLCA 1XGZA 1E0XA 1RP9A 1QW8A 4JZ5A 2WMJA 1E70M 5KZ6A 3OLDA 2J7FA 2XIBA 4RE3A 2ZUMA 4L4PA 4W5UA 1C93A 1W9PA 3DC0A 4YHGA 3QHMA 2WVVB 5D9NA 1V02E 2CXGA 2YLAA 2BXZA 4MNJA 2BY0A 5JIWA 4D6GA 1BQCA 1NWSA 3FHAA 3L4VA 2VR5A 1W9XA 3ZSTA 3VM7A 2GVYA 3VD3A 2WLZA 3CMJA 4QCFA 3W81A 3NSNA 4KGLA 5M03A 1BVZA 1OB0A 1V6XA 1WP6A 3NSXA 2J4GA 4GI6A 4W93A 1E56A 1V3KA 4HA3A 1EHNA 1UD5A 1V3HA 4IPNB 2WVSA 2D2OA 3CO4A 4W5ZA 3BAYA 5D9OA 5BRQA 2VX4A 1MW2A 3RPMA 4JKLA 2XFYA 5FCZA 1GHSA 3WMSA 3M6DA 1UWSA 2WZIA 1JYWA 3VX1A 3TTOA 1LJYA 3PTQA 2BHZA 4FLRA 2GDUA 3AI0A 4A4AA 4GPNA 2WMIB 5C70A 3ARTA 2W66A 3L4WA 1DWFM 3RJYA 1GQJA 3VIFA 3K8KA 5A6KA 1RPKA 3AIRA 4V2XA 4LYPA 1JXKA 1VIWA 2VRJA 1H5VA 3GH7A 2OYLA 2X0HA 4IISA 1OSEA 4AZ6A 3EBVA 2G41A 2G3JA 1JAEA 3BAIA 1NOUA 2VVSA 3TTSA 5BYWA 4WJXA 3WD0A 4P8XA 3VINA 3SUUA 4MJ2A 1G5AA 4MB1A 1CGWA 3B8SA 2C7FA 2W92A 1ZB5A 1UG6A 3GXMA 2ESCA 8CGTA 4F66A 1UR0A 3EDKA 1O7AA 4UQDA 3ALGA 1W9BM 4AIOA 1GJUA 3BCDA 2ZUTA 1FOBA 4XB3A 2W4XA 3RIKA 2PWHA 1I75A 4JAWA 4AY1A 4M24A 2XFRA 4PMNA 1TCMA 3W27A 1MQPA 1DTUA 1A3HA 4HOZA 1E6ZA 3SCNA 3N13A 3EMZA 2ZE0A 1JF5A 7A3HA 1H49A 4BF7A 1WO2A 1QI5A 2VCCA 1E4MM 3VOCA 1KQYA 3U57A 2VO5A 1KQZA 1Y7VA 4V27A 4WKFA 5FD0A 2J7HA 1E4IA 1BLIA 4UOJA 5D9PA 1Q6FA 1C8QA 5DFAA 1VF8A 4TOQA 5IXEA 2EEXA 2YA0A 3B9AA 2F8QA 3NSMA 1B30A 2XPKA 4MADA 4GZEA 5A69A 1XCWA 3AIUA 4ZEPA 3T2QA 3DHPA 2PWFA 5I78A 3S6TA 3T0AA 4UTFA 2FGZA 3ZT7A 1DWGM 2JIEA 2QMKA 3SCSA 2EPOA 1HJUA 2A3EA 3AMLA 3PZTA 1UH3A 3PTKA 2WXDM 2VT0A 5HBFA 1W3LA 1WPCA 4OOUA 4PYSA 1J12A 5A8QA 1DP0A 1B1YA 1F4HA 2BHUA 4UFLA 4UFJA 3VDHA 1E0WA 1WAWA 4BCEA 5LA0A 2G3IA 1KXQA 1M03A 5A2CA 2CCRA 3CTTA 3OLGA 3WUBA 3W4RA 5CSUA 1MXDA 2PBOA 5E6ZA 5EFDA 1EO7A 1E3ZA 3VMNA 4HA1A 2CBVA 3SUWA 4H2CA 4XZWA 2DDXA 3EDEA 3VPLA 2O9PA 1UR4A 1H11A 4MTVA 4UFKA 2E8ZA 1F4AA 4LGXA 3W28A 3IANA 3E1F1 3VGHA 3OIHA 3D5HA 1XYZA 1LL4A 4FK9A 2A3BA 2D24A 4HMDA 1DHKA 2A3AA 3G6LA 2YL8A 3UCQA 1VRXA 3MU7A 4EKJA 2VZOA 6TAAA 2ZXAA 2J7EA 1EQCA 1EDQA 1CBGA 4HOXA 1UKSA 3OBAA 4J27A 1E4LA 2X8RA 1EOMA 3WNNA 1HIZA 2WMIA 3ECQA 3WDIA 1PAMA 2WC4A 1UR2A 3N15A 4M56A 2EJ1A 3VDCA 4FLSA 3OGRA 3GNRA 3EDJA 5E09A 2BFGA 3W38A 1LWHA 4AZGA 3AQUA 5LA1A 3W26A 4MAVA 1W91A 1Q6DA 3AIEA 2PWEA 1ZJAA 5FKYA 3FNDA 5TD4A 5JIPA 4PMYA 5A3HA 2ZX9A 2OSWA 2WANA 1BYCA 1FHLA 4W7VA 2D0HA 4AIUA 1X1NA 4ZXLA 1HJSA 2BS9A 3L4UA 4TXEA 1JI2A 4WSJA 2CKSA 3ZR6A 1V6UA 3CH9A 2WMGA 4MPKA 1M04A 4C7DA 1WDRA 5D9MA 4AD2A 3KL3A 1KXTA 1BAGA 4D71A 5A94A 2ZX6A 1GQKA 3AMGA 2E9MA 2EBNA 2JALA 4NZCA 3ZJ7A 1EA9C 4B9ZA 2WMFA 4NSBA 3S2CA 4UQEA 4JCLA 1HT6A 3OA5A 2XSAA 4P7QA 3AXXA 3SURA 2YOCA 1BFNA 2BVDA 1XYFA 3TTYA 4DM1A 2F2HA 1H2JA 2YA2A 5CPSA 2GK1A 1HP5A 2ZIDA 1OCQA 3GBDA 3VIMA 3O6AA 2BXYA 3L4TA 3LPFA 4S3JA 2V3DA 1OD8A 4P8UA 3VGBA 4RL3A 1TVNA 1OD0A 4PCTA 4AEFA 3K4AA 4W89A 5I77A 1GVYA 1B3WA 2E9LA 5D8ZA 1E5JA 1E6NA
chains in the Genus database with same CATH superfamily
1NH6A 2PB1A 4GD0A 1SZNA 2QJMA 2XIQA 4WSHA 3G2GA 2ODOA 5G4HC 3B9NA 3FVMA 4QG9A 1EEXA 2HVMA 1OG0A 3PBGA 4HK7A 3RHGA 3LD5A 4JHOA 1XLKA 1KKRA 3WQDA 4D6CA 4DQWA 3RUBL 3H2OA 3B0PA 2BHYA 2FH6A 3MTWA 3GDKA 4JCMA 4L64A 4ADSA 4XD5A 5LNSA 3GLCA 3N2OA 3NDYA 3OIXA 3U6WA 2FIQA 3UQNA 1D8WA 2A6LA 3T0CA 1I2OA 4AZIA 4U31A 1ISVA 2ZZ2A 3AIQA 1OC7A 1IZCA 3PN8A 3WD3A 2DH3A 4DJFC 3RR4A 3AHTA 1CEOA 1J0YA 2UY2A 4KEZA 1WKDA 2HNHA 1TPWA 3VUSA 1DXIA 4HYVA 5FJPA 2Q6ZA 2FDMA 4MJZA 5CPQA 4Z0SA 4IF2A 2XWDA 1A53A 3B05A 3GAYA 2J8GA 1R3QA 2YFOA 2XH0A 2WZEA 4S3EA 1LOSA 3MMWA 1EPVA 3W02A 5LYRA 2ZUSA 5C55A 3N4AA 3EOUA 1PL9A 5HNNA 1GOKA 1UROA 1DXEA 3G1YA 2GJLA 1GCYA 1GKRA 2X1IA 3S42A 4PTVA 4IGSA 3VZZA 2YBTA 1KM0A 3H53A 3LCXA 4J3VA 6ALDA 5J5RA 1IHIA 4Y2WA 1SSDA 1JD7A 2ZRUA 4DXKA 1F6KA 3GC5A 1CIUA 3HMJG 4LAMA 3U7BA 1EEPA 1R86A 3QSTA 4O50A 3QOKA 1EC8A 1UCWA 4U4MA 4F0HA 3LRLA 3KBNA 3CUIA 3RCYA 1FWTA 3G1DA 2C1HA 1PYMA 4MZYA 5D32A 4Q7IA 2VFFA 3WBAA 4AIBA 3BV7A 4IPJA 3BH4A 1QHZA 2F9RA 1JDDA 3NO1A 2W91A 3ZVHB 3IIOA 3SCTA 1K7EA 5EB8A 3TV8A 1US2A 3MB9A 4DYEA 4XVEA 2JGQA 4S1FA 2DIKA 3UERA 1MXGA 4CVUA 3R11A 3G3DA 4IJCA 2BGSA 1Q3NA 4KH2A 3WN6A 4FOJA 3TX9A 1XQKA 3UVAA 1Y5VA 3OW1A 1LCOA 3B0XA 4XBJA 4BI7A 3QHOA 1E0VA 1FWCC 1AJZA 2WWDA 4GCXA 3QXBA 4ZR8A 5L6UA 5IFPA 4XUYA 1EF2A 1ICSA 3UXKA 3K30A 1G6CA 4YXGA 5FEZA 1XD1A 3SCPA 1XQLA 4JNMA 1O5KA 4ONVA 1B2YA 3ARRA 1DL3A 1E0TA 3MO4A 5CSRA 4F0SA 4YHEA 4HZ8A 5IRPA 4O14A 1HO1A 2FVMA 3FDKA 4XIMA 2X1TA 3OG3A 1V02A 1CXIA 2ZZ7A 3ICJA 3CWOX 3DAQA 3GTNA 2WM0A 1DEDA 3SCQA 4DJDD 2YXGA 1W9DM 2OLHA 5AVNA 2HBVA 1QMLA 4XZLX 2GL5A 4GUGA 3KW3A 3WK1A 5I3DA 3QTPA 1A80A 4RDZA 4K38A 1Q7ZA 2D0GA 1J8VA 2VRQA 2PF8A 5AZ0A 1AQHA 1W37A 4J3ZA 4GJJA 4WK9A 4KEVA 2I14A 4LAUA 1VYPX 2YW4A 2DSZA 1IEVA 4ALDA 3HQPA 2WPBA 3NYZA 4IPIA 4DJED 6ENLA 3WJYA 5DMMA 2OKTA 4ERGA 5JVLA 1TPH1 3C0QA 4Q8WA 3AALA 5FJUA 5HDRA 1WUFA 3IJ6A 5CEWA 1QPKA 1YBQA 3ANVA 5C7HA 2VQUA 3ZO9A 3KRBA 2X7WA 1NIUA 4C1LA 3TKFA 1Z3NA 1E5NA 4GJIA 1HKVA 1SFTA 2QNEA 1OFBA 3P93A 4EX4A 1MYRA 1TRDA 3HG2A 3IWPA 4UCFA 3FIGA 1VAHA 4Y9AA 2D3NA 3M07A 3W6MA 1J10A 3BUVA 2Y4SA 1LRTA 1XJBA 4QLJA 1X7IA 4WGHA 2OZ3A 3T4CA 2R14A 5JH2A 2TMDA 3E2VA 1W5QA 3CT7A 1LG1A 3GVGA 1RVGA 1KGXA 4PUEA 2QEZA 3G22A 2YIHA 1Z89A 1UJPA 4WY0B 4G5DA 1FWGC 3TOPA 3WQCA 2VWSA 3K8LA 3SN0A 4ZE5A 3UGRA 3UR8A 1JGIA 4HPJA 2W0UA 4NASA 4LJ3A 3MANA 5MKGA 1TMLA 2A6NA 4DWSB 3BZJA 2NT0A 1OY0A 3VGDA 7REQA 3M0XA 1KFKA 3CUZA 1LDCA 1FP9A 3EMCA 3EOLA 3LTSA 2WVVA 2HV5A 4KCVA 3TJLA 3AXIA 3DFTA 2X30A 4GG9A 3E9AA 5CXPA 4L4MA 3U2ZA 2Z7GA 2ZDSA 1CXKA 3H4WA 3PB2A 4C1NB 4AF0A 3EX4A 1WZLA 1QRQA 5CZKA 4ZTYA 2BOEX 4X22A 4QDWA 3W29A 3UF9A 2QLYA 1DJXA 2WCGA 4B9YA 2CESA 2P1FA 5HNTA 3EWXA 3TYDA 3RDKA 3W53A 4DI8A 1VP5A 3PPGA 1SZGA 2XVNA 4R9OA 1GK8A 1JRCA 4CCDA 1XLMA 2ZVRA 1D3GA 1PHWA 3VD9A 3GHSA 4QCEA 3NXFA 3CV6A 3SCUA 3HN3A 1R7AA 5M3WA 3JW7A 3B8VA 5I3GA 4FA3A 5GQBA 1IYXA 2PI6A 1A5SA 1QNQA 2V5BA 1LORA 4C6OA 5A8OA 3MSDA 3L67A 1XCXA 8RUCA 1S3HA 4J3SA 5CSSA 1V8EA 3KTXA 1GTHA 2VQTA 1LLOA 4PMRA 1GZGA 4BQ2A 1FFQA 5BXSA 4Z1DA 1ML1A 3WFLA 4H9VA 3INPA 3QGVA 2QCGA 1I0DA 5BOEA 1IT7A 4A3YA 4EVZA 3WH7A 2F6XA 3KLKA 2Z26A 4JYEA 1K03A 3GVRA 4D1IA 3ES7A 1Q8AA 1TZ7A 1QPQA 5AC6A 1OF8A 4RE4A 3SIMA 2QV5A 4M82A 3UBPC 4MWAD 4XUGA 3ZSSA 1JULA 1MNSA 1XXXA 1YXCA 3L7RA 3ZQ9A 4KWSA 5HR7A 3CPGA 4JTFA 3UY7A 2RUSA 4N9BA 1KLYA 2E3ZA 1IGSA 2J25A 3GHTA 1K3UA 2WQPA 4GY0A 4HQVA 4LQ1A 4O1DA 3PZMA 4UTUA 3IJIA 1RA0A 2J79A 3H2CA 3H7VA 2DT0A 3LHTA 4JIPA 1HP4A 1AL8A 1EL3A 3WL0A 4XQ6A 2QT3A 3WNMA 1I60A 4KRTA 1CGVA 4D6FA 1CXHA 4UTTA 1ZBWA 1Z41A 1HGWA 3NTYA 4I5UA 4JIEA 3H7UA 3ARUA 4PTDA 1XP3A 4AXNA 4C6EA 1KBKA 2VCBA 2D1ZA 3KEHA 4K37A 4W8AA 1U1UA 1RK5A 2R94A 3N9KA 5GNZA 2REQA 3WK2A 5D33A 4B3LA 2BSLA 1GYLA 1QI0A 1ZU8A 4GYFA 3BICA 3TXVA 3M44A 1XIHA 4YL2A 3R58A 3W22A 1SUXA 4J2MA 5AHLA 1XRFA 1QVBA 4N02A 3H8AA 2GFTA 4LUSB 3OTRA 4ZVJA 4RE0A 1RVKA 3EMQA 4LRSA 4MLJA 2OFJA 1XIDA 3BLEA 1DORA 3WK0A 1W0MA 3WSUA 3QQWA 4UWMA 4Z1CA 2PGEA 3W6YA 1XG3A 3BOFA 1OINA 3MHFA 3STFA 3GHRA 3K8MA 1O6IA 3SRDA 3H24A 4E2OA 2D22A 4JD4A 3KL5A 2HXTA 3DU0A 1BGAA 1S2WA 3N6QA 2JKAA 2WYSA 2DVUA 3H2FA 1ZZMA 3VFCA 1B3ZA 2HE5A 4X9YA 3M0LA 2J66A 1JEZA 2PF0A 3MMUA 1UZ4A 1UUQA 4PRRA 4RPQA 5LA2A 1JYNA 1XG4A 3M7SA 4AEEA 4PMQA 3NO3A 3BW4A 3UJ2A 1XIIA 4GO9A 4XAGA 4LYRA 3NQ2A 1HL9A 3BG5A 3ZWTA 3BMWA 2HSAA 3TDFA 1J96A 1JDEA 3WJWA 2V82A 1OFOA 3T05A 4A3QA 4UOZA 4O19A 4B5UA 3P0XA 1UYQA 1Q8JA 3CGTA 3I3BA 3P7YA 3ZJ8A 1BSIA 3HV8A 5LNUA 1V7YA 2CHRA 3N73A 1QW9A 1QNSA 3NOYA 1VBUA 1VLWA 3F4WA 4LPCA 1E1CB 1T0OA 1DJNA 3ZWSA 5BWFA 5FAJA 4HA0A 4QSFA 1BEUA 4P7RA 3S1GA 4L9ZA 3ZM8A 1PVNA 3VDGA 3GNNA 3CHDA 1LL6A 4XK2A 3VGEA 2ZFAA 4E38A 5HMSA 4M7SA 2J6VA 1XYCA 3N04A 1A0EA 1I2PA 4XZBA 5LXXA 5JUVA 3IV3A 1EDTA 1ONRA 2XN1A 4CD8A 1KBBA 2OT0A 3TH6A 3W25A 1SPQA 3FJ6A 2R8WA 3HMCA 4KIEA 4NJJA 4R53A 4QQUA 2CBJA 3PZGA 4CGTA 2CC0A 3XIMA 1BWVA 1P1MA 1TWZA 3CUFA 3TQ0A 1QOXA 3R4IA 2OWWA 4A3UA 2Y8VA 4L6HA 4JR5A 5FF7A 3LGEA 3E2SA 3CU2A 1AD1A 1H7WA 1B0IA 1JZ5A 4HA4A 2BLEA 1R2RA 7CGTA 1ITCA 3BAJA 4O1EA 2XVPA 1UA3A 1E51A 2Z6IA 2JKPA 2OZ0A 5E1QA 1YQ2A 3WFAA 1UPPA 2ZRVA 2UZ9A 1SJAA 2Q8XA 5F4WA 4M6PA 4C1KA 3UZYA 3BQ5A 2PP3A 2Q09A 4KCTA 2VX7A 5HNUA 3VNMA 5CLWA 1KCKA 4YWIA 3LV5A 1XR2A 4KCUA 1PXGA 2ONEA 3BLLA 3ORWA 4Q8NA 4KMQA 4PEEA 4ES4A 2VEPA 3SCRA 3NQBA 4MUPA 4R5EA 3GM8A 2PGWA 4UC5A 2E8YA 4AEOA 4YPJA 3A9BA 9XIMA 5HUOA 3WUEA 4F9JA 3MUIA 3WY1A 4IICA 3M0HA 1GQNA 4MG4A 2VFIA 3TAOA 1XSJA 5BXPA 4UTKA 1KRCC 4XSMA 2XGIA 1EKOA 2PZ0A 3L65A 4HNLA 1GOIA 3UPMA 4J3TA 2R24A 1NY1A 1ZAJA 1XRVA 3KCOA 3NYDA 5A2BA 3OPSA 1M68A 5KSWA 4G1KA 2Y24A 4F8XA 1B9BA 1KFCA 2GQ9A 1V3MA 2BNJA 2BY1A 3AXMA 4BWLA 1TVPA 4GRSA 1EUNA 4QRNA 4L6OA 3QHNA 4BFAA 3LYEA 2WK2A 3IJ7A 4NJKA 1V0KA 1XH0A 3ZT5A 5FJTA 3Q58A 2PMQA 2E67A 3HGRA 2A4AA 1W3IA 1GGOA 4JNYA 1WDPA 1FFRA 1F2JA 3N14A 3WLJA 3S5SA 4C6MA 5I24A 1PEZA 1KBJA 1O5XA 1VFSA 3L2IA 5EY5A 3M46A 5HWJA 1GJWA 3TYZA 1WZKA 3CM4A 4IQEA 1EP1A 3REQA 4ZE4A 4NG3A 1J18A 3MCMA 4Q4PA 2OGYA 3TROA 1Z48A 4A6GA 5CKSA 2PRMA 3CV2A 1EGMA 1SVDA 1JZ7A 3E3HA 4M8UA 4NYUA 2HRWA 1VBJA 1A47A 2HS8A 3S8HA 1A49A 3ITCA 3MW7A 4FPSA 1MI3A 1WKYA 1CXEA 2QCCA 4B5NA 1W1YA 3M16A 3VD5A 4D2JA 1TA3B 5BMXA 3RM9A 3N34A 1QXLA 1KRMA 1CYGA 3C86A 1PIFA 1J0JA 2R1NA 4IFKB 4N2YA 3UZ5A 4DUVA 4ZSUA 1V6TA 3U7VA 1HKKA 4QSHA 2WC3A 1H5YA 4R9XA 4OBRA 3R12A 1TR1A 3PZNA 4Q7BA 5FF4A 2H9AA 4L1GA 3E12A 2DZVA 2DZWA 1UP0A 2XSBA 4HU0A 3AIWA 1M41A 1R3WA 1UIOA 2YBUA 2Z29A 3RN6A 3QR0A 1FWNA 1OX4B 2CLHA 4Q8OA 2ADAA 3F5LA 3CMGA 4Y9NA 3SO7A 3A12A 2CNCA 1OGBA 4Q4OA 1UA7A 4S3BA 1ZL1A 4H2HA 4UTWA 3QJAA 4F2TA 1EZWA 3S6DA 3WQFA 4GMEA 5CQ1A 2OWCA 1MFVA 3P3BA 3OQ8A 4I9JA 3W7OA 3LPGA 1S39A 4L4OA 5IBXA 3R94A 3UWZA 4LX4A 1MQQA 3GC4A 4U5KA 3VE9A 3LLXA 3G1FA 4YN5A 3A22A 1B3VA 5K4XA 5CPMA 2DVTA 5D4YA 4K7YA 1RXOB 1GYNA 3BJTA 3V35A 5C9UA 1JPHA 3AMDA 3SI9A 1E6PA 3U3HA 2YLLA 4IP7A 3LCGA 3BCJA 1OJXA 5A2AA 4LV9A 4FNSA 2GSHA 4RW3A 5AHIA 5I0DA 2PLKA 2XGBA 4LUJA 3ATYA 3VUPA 2I7GA 3PK7A 3WF2A 4JL2A 1DOSA 4ZOCA 1KW1A 3AYVA 3VNDA 4DF1A 1OIMA 3C56A 4YVVA 3U5UA 4GINA 5EPDA 3EX3A 1P0BA 4Y90A 2OB3A 4X0VA 5D2WA 2AMXA 4RR4A 3A3HA 1GVRA 4MAZA 5DELA 4MY8A 2J78A 3MV11 3SUSA 2RFGA 3GXTA 5F1UA 2J24A 4O53A 3H4GA 3R89A 3HFTA 3W7MA 2RHGA 4YYCA 5I6SA 1Z7AA 3UZZA 3I65A 4JQ3A 1K8YA 3W83A 1TV5A 3CXOA 3LHZA 1X38A 4XZHA 4B5TA 2EF9A 3DX5A 4GX9A 2GDVA 4N42A 3E38A 2BP1A 3C2EA 1MEIA 4LUTB 5BXTA 1CXFA 4XKYB 5J5DA 3VIPA 3TXZA 4M3PA 1DBTA 1OYBA 2WB5A 3SRFA 4FNPA 4GIAA 2XVGA 2VR4A 4PMUA 3AC0A 1RBOB 2FQIA 3POHA 4LEFA 3L4ZA 1O95A 4B5VA 4E2DA 1XLIA 3W1LA 3LZ5A 5D09A 4IGMA 4P7NA 4HPHA 1RP8A 1TV4A 2INZA 4D8AA 3ANUA 4H6RA 1GTEA 2QAPA 2D20A 3K1DA 1ODUA 1H09A 5D8WA 4DWSD 3DI1A 3MT1A 3W7CA 3CASA 3T8QA 1YBQB 2E28A 1PV8A 2CBUA 1FWSA 3QY8A 2X05A 1QK0A 1VB9A 2QPXA 1FWDC 4K8EA 4FNUA 4C6PA 2QKFA 1GKQA 3VIJA 1JCTA 4JX4A 4Q8QA 7TAAA 1P5BA 1PWMA 3E0LA 1FRBA 1EIXA 2VEIA 4H04A 5KITA 1DWJM 1W3TA 2ACRA 5EKYA 4J1OA 1BTCA 4H9YA 4V15A 1PO9A 2YCEA 3DESA 3HF3A 4J4KA 2BBFA 3RGTA 3L68A 4GZ7A 4AH7A 2PODA 3C61A 1ZCCA 2XN0A 3OLEA 4RV3A 1UC4A 2VZUA 3T8LA 4LRTA 4AX6A 1Q66A 3DIPA 4TQTA 4I8DA 1R0MA 3WDHA 5MHBA 1DIKA 1AA1B 3PNZA 1BYBA 2BVTA 2E9BA 4U5IA 1UH2A 1UUOA 2WV8A 3L9CA 7REQB 1E9ZB 4YHGA 3KOZA 3WLRA 4O17A 3I6TA 1EB3A 2WVVB 5D9NA 1A0DA 3EB3A 3EWWA 3NO5A 5JIWA 1NDZA 4D6GA 1NWSA 2WJZA 1O5RA 3FHAA 2HPIA 2GVYA 3VD3A 1VPQA 3CMJA 1RR2A 3NSNA 2C18A 1W1B1 5M03A 1OB0A 3NSXA 4W93A 3BK0A 2XU2A 4HA3A 5D2XA 3CO4A 5U7SA 3SSJA 1MW2A 2PDPA 3RPMA 4PL2A 4S3AA 5FCZA 3WMSA 3C6CA 1LRNA 1DIEA 4NJIA 2YZRA 1DJQA 4FIRA 1FTXA 2Y7EA 3AI0A 4GPNA 4DIAA 5DBUA 3PJTA 1HZYA 1ADOA 1SO4A 4QE5A 3B0UX 3C0SA 3FA4A 3NZGA 1XLCA 2FMOA 1DWFM 1QWKA 1AZ2A 4FX8A 1JVNA 1GQJA 2X7VA 3LXBA 2FZBA 1BSLA 4FI4A 1SO6A 3NQ7A 1XDMA 1VIWA 4C90A 3QBUA 2ASHA 1PB0A 2X0HA 4IISA 4RKAA 2CWXA 5AHEA 3MKCA 1HUVA 4PULA 5AC8A 5XIAA 3EBVA 2PWUA 2G3JA 2FVLA 5E5CA 5DRIA 4I9AA 3TTSA 4LBUA 5BYWA 4YMZA 4ICMA 4HYRA 5LIWX 3WD0A 4B2DD 4I6KA 3C3NA 4PGLA 3VINA 3W84A 1G5AA 1L9WA 3BW3A 3E96A 3B8SA 4WEVX 1G7UA 3FXGA 2ESCA 1ELSA 1VR6A 3EDKA 1O7AA 1Q85A 3UU0A 2V5JA 2ZUTA 1FOBA 2KX9A 2GLKA 2W4XA 3RIKA 2PWHA 1I75A 4FXRA 5AB3A 2YR1A 4JAWA 1KFEA 2O55A 2XFRA 3KBMA 1MQPA 3TN6A 1V93A 1VFHA 7ODCA 3EMZA 3SSZA 3OODA 1JF5A 4KF1A 1RD5A 3DKJA 1H49A 4GABA 1QI5A 2VCCA 3W2MA 1E4MM 3CL7A 3T9PA 7PTDA 2VO5A 3KCLA 4MHBA 4V27A 4WKFA 3TK7A 2J7HA 1E4IA 5D9PA 1Q6FA 2X41A 4R33A 3OOQA 3TAKA 5T9CE 1SFLA 3HG5A 3P62A 4EF8A 2CFFA 2EEXA 3B9AA 4DPPA 2F8QA 2WNNA 2OJPA 2XPKA 4MADA 4XAZA 3SRHA 5DCDA 2X1SA 3AAMA 3MBFA 3DHPA 1N55A 3GK0A 3QW3A 3T0AA 2D2JA 3ZLHA 3ZT7A 3GYEA 1DWGM 2JIEA 2QMKA 3NVDA 2EPOA 3PZTA 2ANUA 1RSCA 1SJBA 3BJFA 5LHFA 2A7NA 2VT0A 2C79A 1H1ZA 4LCRA 1IIGA 3WLIA 4YNGA 5FACA 1F4HA 1PHQA 5HQEA 3VDHA 1E0WA 3CH0A 4XZMX 3G1HA 2G3IA 4FZIA 4GYJA 1J93A 5A2CA 1AK5A 3LHUA 1XIBA 3W4RA 2ZRYA 4C6FA 2PBOA 1TPFA 5EFDA 4TR9A 1F74A 5JMUA 1B3OA 1FDYA 4XZWA 3VPLA 2VDIA 3RITA 5LGXA 4MTVA 4UFKA 2NUYA 3W28A 3QYSA 3VGHA 4MPQA 5SWUA 3VI2A 1LL4A 3GVQA 4FK9A 2EG8A 1QDSA 2ISVA 4GISA 2Z0IA 3CAKA 2A3BA 1DHKA 3G6LA 2YL8A 2W27A 3S83A 3MU7A 3LBCA 4O4VA 6TAAA 1TB3A 2ZXAA 2J7EA 1WOBA 3HURA 1UKSA 3RLGA 1FWRA 1TTIA 4JIIX 3ECQA 3WDIA 3N15A 4M56A 2QIIA 3V5OA 1H62A 3PVFA 4BI6A 2V81A 5AHFA 3EXSA 4AZGA 3AQUA 3W26A 3ZVIA 4JDBA 3AIEA 3M5YA 1ZJAA 5G2IA 4F0LA 4M6VA 5JIPA 2OU4A 3G8EA 2ZX9A 1BYCA 2ALDA 4KW2A 4WSJA 1H51A 3NPVA 3KHDA 3ZR6A 1OFQA 4IQDA 4OECA 4MPKA 1M04A 2IS7A 2YZ5A 8XIMA 3IK4A 3AMGA 1GQKA 2Q01A 4L1WA 2EBNA 4O15A 4UTJA 2JALA 4IMCA 3WLPA 3HGSA 2YXOA 1G4TA 3ZJ7A 4LC6A 3N2TA 3NZPA 4LC8A 3NM1A 5AZ1A 3TW6A 1ZJHA 4JCLA 5BU6A 1L6FA 4AY8A 2Z28A 4DNHA 4Q6XA 4HYWA 3VNIA 1BFNA 1WQ5A 4P61A 1OHLA 2WSQA 3PAJA 1H2JA 5TBOA 1HP5A 4HN8A 3VIMA 3O6AA 4S3JA 4EPBC 3RX2A 1AMKA 4RL3A 5T91A 4HSHA 1OD0A 3GU1A 3LHVA 4UTTC 5HWMA 1NDVA 2Z24A 4QDPA 5I77A 2E9LA 5E9XA 3K4WA 3URBA 2DFAA 1KBLA 2F7FA 3KBVA 3O6DA 2FHFA 2XG9A 3VMOA 4CQ9A 3G0UA 5J04A 1J6PA 1IF2A 1W5NA 3GW0A 3GXFA 4O1FA 2OZ8A 3UY8A 5AYBA 2V3GA 3OGSA 1HO4A 3VM5A 1C90A 4PUWA 4DO5A 1EGVA 5EFFA 3NL3A 1F9CA 2QVHA 4JQ1A 1YW1A 3GR4A 3AOFA 3DCPA 3H21A 2JQXA 1C7TA 4QJ4B 2Z2AA 1QOQA 1GVFA 3O63A 3AU6A 4JY8A 3GNXA 1JXJA 1RCQA 4WY0F 1Q45A 1GORA 1REQA 1UKOA 3S6OA 3AYSA 3MKVA 2V69A 3DG6A 3EOEA 3F03K 5FF0A 4QGCA 2CIPA 4W7WA 3BL3A 4QBXA 1K9DA 5DT5A 1R3VA 5G4EA 1Q4WA 3LA4A 1I0BA 2VEGA 4PMVA 4DJFA 4YTUA 3L5MA 5DO8A 1L6SA 5KINA 1B9ZA 5CGQA 2J8FA 4CD7A 4O28A 4DI9A 1IWBA 4DPQA 4KRUA 1WV2A 3MSGA 3HPAA 2WCAA 1AZ1A 2X40A 3PB0A 3GKFA 1C92A 1K4GA 1JG9A 3ARWA 3HOJA 3BCFA 1YTDA 4J28A 2VFHA 3GRIA 2DT3A 3H6OA 4UIOA 4GUHA 3U2EA 4AX7A 4NJGA 3UJFA 2PBGA 3WBXA 3GIPA 2Y7GA 1JCNA 4RDVA 4F40A 3RK8A 4I90A 5HPOA 2YKKA 4QAWA 3CWHA 3FHQA 1UR9A 4GIEA 2VD8A 1AODA 4EWJA 4ZO8A 1XPYA 2Y85A 1S2TA 1W31A 4JTTA 3QC0A 1FH8A 3I4EA 2J9XA 2OG9A 3UNTA 4NAFA 1K6AA 3B9EA 3EA1A 1XC6A 1D3CA 4Z1BA 4KGJA 2VFEA 4XBSA 4ZQPA 1XBZA 1WE5A 2QPUA 4ERAA 5CBJA 4XG1A 1M1BA 3WLMA 2VNCA 2OR2A 2GVLA 3CHFA 4HCHA 2QJGA 1DWHM 1A5NC 1UD4A 4O18A 3AXHA 4WDTA 2ABAA 5LKYA 1GPFA 1G1YA 1BWLA 2I1OA 1NELA 1F8IA 5D02A 2ATMA 3HQOA 3FV9A 4JQ4A 4GFSA 1CGUA 1J9YA 3DBNA 4I7WA 4MB3A 2NWRA 3CQHA 2ZUWA 4O1BA 3W7DA 1RBLA 3KZSA 1UWIA 2WM1A 1ONWA 3AS2A 3QYQA 3L0KA 1KCXA 1O12A 2HEJA 4XV0A 3MSRA 1SZEA 4XVDA 3O2LA 1DV7A 3BZGA 5AYXA 3GTXA 3KOWA 3WBEA 3GR7A 4GI8A 3BC9A 2H6RA 1Q2RA 4CNTA 2QGYA 1UD8A 1R47A 1TWDA 5XIMA 4O12A 2OX4A 5HPCA 1T96A 1F3TA 3GDBA 1VYRA 1GG0A 4AD0A 4IPPA 4LXFA 3B4YA 1TO3A 1UWTA 1H7PA 4GZIA 2HS6A 4XBKA 3WBWA 3WYZA 1R85A 3CAVA 2PRHA 3FCPA 4PBEA 2FPYA 1UQZA 1DJGA 1MRQA 1AW5A 3DFSA 3P84A 5HJLA 4H9XA 1MW3A 1TYGA 4ACZA 4ORMA 4YS1A 1XLEA 2X2YA 4RK8A 4ZBCA 2ZCGA 2V2HA 4GNKB 2O9RA 3CZEA 3ZJ6A 3ARZA 3WQPA 1QT1A 3NOEA 3D47A 1WXZA 3KBSA 4PMZA 4DNMA 1PPIA 2VFDA 1XWYA 2ZRZA 4ENLA 3SR7A 3KOYA 4PMDA 5XINA 5KZDA 4L56A 4LCQA 3PSWA 3E02A 2XFWA 2VD9A 4GGHA 5BNKA 2WMHA 3W00A 3RCNA 3ZT6A 1KB3A 1OZMA 2YB4A 4JFTA 1T40A 1SGJA 2GGJA 4NZFA 1SMDA 1OM0A 4JFUA 4TVCA 4NUWA 1EQPA 1DIOA 4BZYA 2ZA3A 1R87A 1IEXA 3PZQA 4KEUA 3W9ZA 3L4XA 2FYMA 2YYTA 1HKWA 1XX1A 2B31A 3R1ZA 2XM1A 5BROA 2ZXQA 4R7OA 4GI4A 1F3EA 2XIJA 3TZNA 1ADSA 3ZZ1A 2CXEA 4EF9A 1F6PA 1UQYA 4DYKA 4K8GA 1E0UA 2FFCA 3FJNA 4IH3A 3USBA 1GQLA 5BXRA 3LLDA 3T78A 3AYRA 1IZKA 4U2ZA 4KPLA 4NNAA 4YLWA 4DVOA 4Q7NA 1BHGA 1OABA 3VZXA 1N82A 4L1XA 1RCOB 4MJMA 1UZ1A 1ZS2A 1PKYA 4GVFA 1XHGA 4DBWA 3W2LA 2PFHA 4BQ5A 4JBRA 1RAKA 1OK6A 4RDWA 3MUAA 1I6NA 4LY8A 4Z1YA 3I68A 3CK5A 3AIBA 1JDFA 1CGXA 5K2ZA 3PG9A 4UR7A 1UR8A 5CG0A 4PH6A 3ITOA 3VKJA 3O07A 3UPBA 3VU2A 2VL4A 2OCZA 3CJPA 1D3HA 1WBJA 1V3JA 2IKGA 4TO8A 4KIRA 4O8AA 5BWAA 1NWTA 2J9YA 2V5CA 5CG7A 3TUUA 2I5IA 1XRTA 4ZO9A 1TMQA 1U5JA 1UP2A 1GEQA 4C6DA 2QV4A 5AY7A 3I3EA 1N8WA 5HXMA 4MYAA 7XIMA 1NQ6A 1TPB1 3WEMA 2V30A 4WZHA 2QDEA 3BSHA 3ZYZA 3E0VA 3GC2A 3WLSA 5BRBA 3APYA 3WD1A 3MI2A 5I02A 2DT1A 2GJNA 3WLLA 1VJSA 4MVAA 4UTIA 1XINA 3N4FA 4B16A 5DY2A 4X60A 4IUGA 4IJRA 5D03A 2DW6A 4OJYA 3LSCA 1XKYA 3P8JA 2OTDA 1HNYA 2W79A 2B4GA 3EWCA 5I07A 4N9EA 2OOGA 4WOZA 3D3AA 5F2GA 5U4NA 3PC0A 3Q45A 2ZXDA 3IIVA 3B8TA 3EWUA 3LNMA 3EPNA 3Q65A 2AGKA 4UTWC 3TYUA 5IM51 3QLLA 3RMJA 3HG3A 4XD4A 5FF3A 1R3RA 3GD6A 1AQ0A 4RXFA 4B4HA 2E09A 4PB3A 2NUXA 3THAA 2EAWA 3NFUA 1ZAHA 1DWAM 3TVAA 3I6RA 1C9DA 3GDLA 5F4SA 3KE0A 1C29A 4QLLA 1O66A 4CQ8A 1UOKA 3VIHA 4LYKA 4GC4A 2WNZA 4R85A 3O15A 1VHNA 3VNLA 4GXMA 2PE4A 5E0CA 3NPXA 2I17A 1TREA 4LBRA 1ZBCA 2H8ZA 3C3UA 3LHYA 4S39A 3GVWA 4E2BA 2GUYA 5EL1A 1JR1A 3GYCA 2DEPA 3A4AA 4PRWA 1P7TA 1E1FA 3A3XA 4A8RA 2ZBTA 1C7SA 4QG6A 2C6QA 4Q4SA 2IPGA 1AH3A 2JEQA 4OBSA 3J7HA 5GJPA 1JF6A 1YTKA 1GYMA 3UVIA 1G7VA 2MUCA 3FGCA 4WY0A 1OBAA 2E68A 3N12A 3W37A 4LF1A 5BRPA 4US5A 3N2BA 1AW2A 1F07A 3FN9A 2GPTA 4Q22A 4NZ1A 3WLNA 4GVGA 2YDQA 2E4TA 4ZOEA 2J7CA 4X2RA 5I2UA 3NNTA 3M43A 3GUGA 3HZ3A 3TFCA 1Z44A 4AVFA 1E6SM 4HN4A 4IP4A 3MUZ1 1XYBA 1XLJA 3KS5A 3GY1A 1NP2A 5BU9A 3EDFA 2QQ6A 1XBYA 1X6LA 4H3DA 3GNPA 4C1NA 1U30A 2EQDA 1BYAA 3ZXWA 2TYSA 5CSYA 2PDMA 4GIRA 1TUXA 2AGTA 3E6EA 2QCHA 3PUGA 1TE1A 1WXJA 4Z17A 4S3GA 3G3MA 1PIGA 1K77A 3FYPA 1GKPA 1ZBVA 1ZY9A 1ICQA 2FGLA 1LT7A 3MV01 3AUOA 2R1PA 3ITYA 3DECA 4MJ4A 2GJXB 1WDDA 3T2OA 1POKA 3F4NA 4HNTA 2ON3A 1ONEA 1YKWA 3KL0A 4ATWA 1L8PA 2DZXA 1I45A 2ZZ3A 2O9TA 3NQDA 3DYPA 3JUGA 5HAOA 1JDAA 3SCVA 2A85A 1OQFA 3CZ8A 1H50A 4LW7A 4AVNA 1B3XA 2XIIA 1LM1A 1JCYA 2NUWA 3SGUA 4LS1A 5EMYA 5I3JA 4PSRA 4WCJA 3H22A 1FHVA 3MY9A 3B8IA 2CBIA 1SZRA 4QISA 1OEPA 3A4WA 3P0WA 1VPXA 2J77A 1P0DA 2Y8KA 1EP3A 3P81A 4FNTA 4MDOA 4WJEA 1S5MA 3SUTA 2O56A 4V1YA 2BY2A 5I3KA 5GNYA 1TQJA 2V3EA 3KWSA 2QJHA 1J5TA 2E1DA 3NG3A 2X09A 1KGWA 3S47A 1XUUA 1F05A 3N17A 3LB0A 3UFYA 3GB6A 1J11A 4YCPA 3WNKA 3TR9A 3LV6A 2G97A 3POCA 3C2OA 3VOFA 4M80A 4GFIA 5CH9A 1L6YA 3IIPA 3VABA 3T0BA 2NQLA 2C71A 1F8MA 1K1DA 3VVGA 1HVQA 1PDZA 5K9CA 1RJPA 2YL5A 2G4FA 3PS7A 1EFZA 2OMAA 2XISA 2I16A 3F1QA 4OU1A 2AMGA 3AZTA 2EGZA 1FCBA 3HTWA 3E2QA 2ZZ6A 3OU8A 3R0DA 1OADA 1BYDA 2GGGA 5G1MA 2GGEA 3BLPX 3P8IA 3OHIA 1TKKA 1EIBA 1YDNA 1I9CB 4HSNA 3S1XA 3F7JA 4D6IA 2Q3OA 2WBGA 5A6LA 1XFBA 3M5VA 4GZJA 1VENA 3CPUA 4YYFA 1HF6A 3PPFA 4AC1X 3N3MA 3S9IA 3CUHA 5F4XA 3LENA 1EF3A 2DJLA 1XYLA 2VCAA 1PJ9A 1YYAA 4UUIA 2IKHA 3SW6A 3OLIA 4ZOBA 2TAAA 1L0PA 4HBKA 4AZBA 2DSWA 1US0A 3JRKA 4LUIA 4OWGA 3ARVA 3LPOA 4HK6A 3MP3A 2ZOXA 3BLKA 3BGAA 3MQTA 1KR0A 2X1RA 2DZAA 3AICA 2OQHA 3NQEA 5CJMA 2DY3A 3UYCA 3DEQA 2ZYFA 5C6MA 1MRAA 2QCDB 1JDCA 4ASTA 4B3ZA 1T99A 4FXSA 3W1MA 2OX1A 2VHLA 4KWUA 4JGDA 1EZ2A 4ZO6A 2FMNA 2XIMA 4XTDA 4QM1A 4K7VA 4LUSA 3W2JA 2A21A 3WO8A 1UMYA 3K4DA 1E9YB 2Y2WA 5HMFA 4ML9A 1QPRA 3EB2A 4QLKA 4C5YA 1UIPA 4O1CA 1PDYA 4UR9A 3KBJA 5B7ZA 1FKXA 2PC8A 2YYUA 1A5AA 2PDLA 3UW6A 4A35A 2CWNA 2G3FA 3ARSA 4X9SA 4LB4A 3VDBA 1E9IA 5JU6A 3A4XA 3UZWA 3WENA 4E0CA 4M51A 2Z1XA 1IT8A 1GVSA 3CUGA 2VOTA 3MUXA 3NQMA 2ZVIA 2YDSA 2JFEX 1UD6A 3ABRA 4UR8A 1PZ3A 4F2UA 2QDDA 1THFD 4PUJA 5ABHA 2MANA 1GVOA 2W5FA 1W2VA 4KESA 2EXOA 2VELA 4MM1A 1JZ8A 4G7EB 3GDTA 2R1MA 1O1HA 3APGA 3KP0A 2VP8A 4LVGA 3LMZA 3C0JA 1VFTA 5J8LA 4UZSA 1PS9A 2KZHA 3TCSA 1UKQA 4B5WA 4HZ7A 2PPGA 3BAXA 2VZTA 4S3KA 3PTDA 2VR2A 5FJOA 3UWQA 1RQEA 2PWVA 3QV8A 3II1A 4GQBA 3GE7A 1KNWA 2BY3A 3GG8A 2V6AA 2C14A 1HX0A 1BF6A 1LF1A 1VEPA 1U1HA 1S2CA 1TV2A 2X2GA 4JFVA 3F4DA 2ZX8A 1AH0A 3NCOA 8XIAA 3EOSA 1J0KA 4CEUC 2GGHA 1D8CA 3R6IA 6A3HA 3PWIA 3EXRA 4CNPA 4REQB 1WB0A 2H8XA 1XDLA 4B4FA 4YU1A 3R10A 3LQLA 3FA5A 1RLCL 3U8GA 5H6HA 3WDRA 3MYOA 3DUGA 4E8GA 1YXYA 1REQB 1ZALA 2OEKA 3SBFA 3DGBA 3IIXA 1XIFA 4NRRA 1YDVA 2FTPA 4Q4KA 3TEVA 3KVMA 5IOBA 4HPNA 3B8WA 1XISA 3BLOA 1DQUA 2WWCA 2Y5SA 2CKRA 3C8FA 4DBEA 3DHDA 3GXPA 4G9PA 4AD4A 4CNNA 4DM2A 3FAXA 1C9WA 2UWFA 3CTLA 1JRBA 1HVXA 2ZDRA 4AD5A 1YE4A 3RR1A 3VIIA 1QHPA 2Q71A 4LNCA 2V3FA 1OT1A 1A0CA 1QFEA 4GQ0A 1YX1A 4GO8A 4YVPA 2UV8G 4P2VA 3SIZA 2VOMA 4ZCWA 3W1NA 3EKGA 2PDNA 1JQVA 2VMFA 1LBMA 4AW7A 1BD0A 3VTRA 4IL0A 4GXPA 4ZFCA 2QVNA 1PCKA 5FIPA 1EJVC 1K9FA 3WUFA 2B0MA 2UY4A 5LNWA 1K7XA 4NAFB 4KS0A 3ARXA 3HPZA 4GH3A 1QO2A 3TLLA 1HN1A 3W07A 4BEUA 3WF4A 4D8ZA 4D1JA 3MMTA 3UZJA 3LZ3A 3EYPA 1TPEA 4FX7A 4QHRA 4AMAA 2QCEA 3W73A 1U2YA 2BVWA 3B3DA 4G7FA 1L8NA 4FNRA 3PBMA 2NXIA 1EA0A 4UZUA 4C6CA 4HIBA 1J0ZA 1Q6QA 9XIAA 4LWWA 3IVSA 3H2AA 2CYGA 1Q6RA 4AY7A 3BSMA 1Q6EA 5AN7A 4BR1A 4HHHA 1FY6A 2IPJA 1TMHA 2EPKX 1BRLA 3TC7A 4O0QA 3ISIX 2XZ9A 3VOHA 3QZAA 2PLJA 3TE9A 2YL9A 1E71M 3NPUA 1N8IA 1Z8AA 4WKHA 3S0CA 1Q7MA 3QY7A 4GIYA 2EPLX 4Q8MA 1FUYA 4PL1A 4DO7A 5A8NA 2KAUC 4NY2A 3CWNA 1KTCA 3A5VA 4NHVA 4HOWA 1W5MA 2ICSA 1I1WA 4JHZA 1YDOA 3U5YA 3S1WA 4WJ8A 5ABEA 4YVXA 2JF6A 3GVVA 1IXNA 4HNNA 3V5FA 4FLOA 4URIA 1G0CA 5AVHA 2PA6A 2ZX7A 1XLLA 1MWOA 4WXZA 4ZFMA 4K68A 4P8WA 4HMCA 2CETA 4XAYA 3ARQA 3THCA 1NF7A 3AISA 1IQ8A 1UR1A 4Y8EA 5DY3A 5JQ9A 5JBDA 1A5MC 3HPSA 4POCA 2F61A 4FSAA 2CLMA 1S38A 1AG1O 3FEQA 3HQ1A 1CX9A 4ZO7A 4XD6A 1AUSL 2EJAA 2ZKMX 3OYZA 3ELFA 4NIRA 2B7NA 4ACZB 2GOKA 5HNRA 3ABSA 4Y9MA 4RJEA 4FAMA 1FQ0A 4PUMA 1CLVA 2X42A 3CHCA 4DZ5A 3FYOA 3QKEA 1QNVA 1GNXA 2XH2A 1TA3A 3UCDA 1KFWA 5E0FA 3GIYA 4IFKA 1ISWA 3VKKA 5TF0A 2VC9A 5BCAA 2VDHA 2V5DA 3L4YA 3VIOA 4EOUA 1PTDA 1K8CA 4JTJA 3UXIA 1SW7A 3GQYA 2CHOA 2ACQA 1N8FA 3NL2A 3SB0A 1RY8A 1PTGA 4KFOA 4IL2A 2QCMA 3O06A 3IUDA 3TMQA 5EMKA 1J5SA 2ZWZA 3WMCA 1OX4A 3LI1A 5F7UA 4GVHA 3EWBX 3MUCA 4DY1A 3UJRA 3K13A 1BXNA 3PHAA 1VFLA 1E1EA 3E5BA 2HE8A 2PU0A 4W8BA 1TWWA 5AC5A 1P1XA 4AXKA 3T0TA 4PODA 3FYYA 3QR3A 1UZDA 3MSYA 4OGZA 3WQ6A 2DH2A 1PZ2A 3IPWA 2ACSA 4CN6A 5JBEA 3LXCA 2R9RA 3BWWA 4J2PA 4LCSA 3HJZA 3W2NA 2ZTJA 3QOMA 2VRKA 4ACYA 3CUXA 4E8CA 1J79A 3R8RA 3S1VA 4OE7A 3KM8A 3VCNA 1VRDA 2V68A 1XGZA 1QW8A 1QUMA 2E6FA 2ZUMA 4L4LA 4W5UA 1TV8A 5HMEA 4JTCA 3QHMA 2DV0A 1VCVA 2OKOA 3SECA 4C6LA 4FF7A 3TYEA 2YLAA 4MNJA 2BY0A 1P0EA 5D37A 3LU2A 4PFMA 2VR5A 3VM7A 3TOYA 3TW7A 2WJEA 3QV7A 2HMCA 2Z2UA 4NZ3A 3GDMA 3H12A 1V6XA 2J4GA 4GI6A 1E56A 5H91A 4BI5A 1V3HA 3MDUA 6TIMA 4LVDA 2OOFA 1EBGA 4W5ZA 3BAYA 5BRQA 3N2MA 4A2RA 4WOQA 2E77A 1Z69A 3O7UA 3PR2A 2WZIA 3UWVA 3UXLA 3TTOA 3LBMA 3PTQA 4FLRA 1TWIA 2GDUA 4RV8A 5C70A 4PUKA 1P43A 3BMXA 3STEA 5C9XA 4L7ZA 3M0MA 3URNA 3LHWA 3L4WA 3TC6A 4RNFA 3K8KA 1RPKA 1UR3M 3AIRA 4V2XA 4S2BA 1JXKA 2VRJA 3DFHA 1H5VA 4LUTA 3O3RA 4XKYA 1S1RA 1DE5A 4MY1A 4Y8FA 3IS4A 2QR6A 5LIKX 1M7PA 5LGZA 4ZL1A 1JGMA 2ACUA 3IUIA 2PTYA 3SUUA 4MJ2A 4EAYA 2Z1VA 1W8GA 2C7FA 1UG6A 4AU0A 3VXGA 4XO7A 3DDMA 4UQDA 2Z00A 3FSUA 3CQKA 4MY9A 4PMNA 3W27A 3SJNA 1M6JA 4HOZA 4A2SA 2PTZA 3GZ3A 1VPYA 1QOPA 1PCWA 4X2PA 3VOCA 3GFXA 4S3CA 1KQYA 3U57A 2L5HA 1KQZA 3A5FA 1VH7A 3H54A 4QJ3B 2NZLA 2PS2A 1C8QA 2CZDA 5DFAA 4DHGA 1VF8A 4TOQA 4BF9A 4L61A 1U22A 3NSMA 1B30A 2LLEA 1P7TB 3VAVA 1V79A 2FTYA 3GFZA 3AIUA 4B5SA 3P67A 4ZEPA 3RLVA 3U2CA 3GSMA 2AQWA 4ZQMA 4JTAA 4C6KA 4GVIA 2POTA 1PKLA 3SCSA 2YB1A 1HJUA 4WXYA 2WXDM 3FGCB 3MZNA 1Q5MA 3TMLA 1KM3A 4AWTA 3M0ZA 1WPCA 1MZRA 3MO7A 4PYSA 4G6CA 4NAEB 3BURA 1HW6A 1WYIA 2BHUA 4H9TA 3UJEA 4UFLA 1FX6A 3KDOA 4R88A 1WAWA 1XLGA 5LA0A 1FCUA 1M03A 3W76A 3WBYA 2CCRA 3CTTA 3EA3A 3OLGA 1TZ9A 4MWAE 4P5UA 3R8HA 2F2KA 3CB8A 1XBVA 1ALDA 2FPVA 1WAUA 5T26A 4JOMA 3SUWA 4IJBA 1PSCA 3W70A 2P0IA 3V0UA 2O9PA 4IIDA 1UR4A 3CIXA 3PSVA 2NQHA 1F5ZA 3QH2A 4CQAA 5DMLA 4F2BA 1B4KA 3E1F1 2EPHA 3OIHA 2VXNA 4AUBA 1M9HA 1X8CA 2HVNA 4DB7A 5EMLA 2JBMA 3TQKA 4EKJA 3SY8A 2VC7A 1EDQA 1ZPTA 4UCGA 5A6TC 3OBAA 1E4LA 4DEFA 3UCCA 1EOMA 4GBUA 1UR2A 3P74A 2EJ1A 3KBWA 4K1WA 2D2GA 2INEA 3EDJA 3UXDA 3V1PA 5E09A 4GUFA 3VOJA 4KQNA 4ICNA 1LWHA 2TODA 1JUEA 4H7CA 1W91A 1Q6DA 4IGHA 5TD4A 1TRIA 5JXQA 2D0HA 4AIUA 3GU9A 1X1NA 4ZXLA 1HJSA 2BS9A 4DN1A 1JI2A 3CYJA 1EXBA 3W75A 2D73A 1V6UA 3PUDA 1T8QA 1SR9A 1WDRA 5D9MA 3KL3A 3H2MA 1KXTA 1BAGA 5A94A 2ZX6A 3BG3A 1TTQA 1C8VA 3QW4B 2PP0A 4QG8A 3WZ0E 2J13A 3UXAA 2VGGA 2WMFA 1LUCB 5FESA 4K8HA 4RX0A 4UQEA 3OA5A 5CZSA 4ZQCA 1DXFA 1XYFA 4HNOA 5C2GA 5CPSA 2GK1A 1GEHA 3G18A 2BXYA 3L4TA 4Q6JA 5HJXA 1OD8A 1SSGA 4LANA 3VGBA 3F2BA 4WRHA 4PE8A 4TIMA 5D05A 2Z7KA 1X96A 4PCTA 4KWWA 4AEFA 4W89A 2PUZA 5D8ZA 1E5JA 4H8UA 3ATZA 2EKCA 3ZFHA 1PWLA 4IZGA 3W74A 4MKVA 1TZZA 4FALA 3GNOA 3CL8A 4FOKA 3NUKA 2NSXA 2XN2A 1HKMA 3QV6A 4CN4A 2W61A 3AJ7A 2NQJA 4RNHA 1F3WA 1Y5WA 2FFIA 2RAGA 5LZLA 1U5VA 1XYAA 4G2DA 2DUZA 5AYIA 1EP2A 2OELA 2VGBA 1LLZA 1S5VA 4RE2A 4ZXOA 4F79A 4DUOA 3DFYA 4W87A 1JZ4A 4JYDA 2D3LA 3BLDA 5HOSA 1CTNA 1UB3A 2EG7A 4PCNA 3CL6A 2VWTA 2V2CA 1ISZA 3NR0A 1TJ0A 2X0YA 4A22A 3OZPA 4IQLA 1EYWA 4GKTA 2IXUA 2G5WA 1VBGA 1KFJA 5G4WA 4Q8PA 3RPDA 1XGEA 3CO8A 2ZWYA 3CQ0A 5G2WA 2C16A 4GNVA 5LHEA 3L5AA 1NP0A 1FDZA 3MDWA 3KVLA 4DLFA 3VCRA 3VDAA 2QUVA 3LM7A 1LLWA 4TTGA 3LY0A 2YW3A 1VD6A 3WF3A 4QIUA 3O9NA 3Q4DA 1Q6CA 4RUBA 1XD0A 1MDRA 3C4UA 3WH8A 1R3SA 4JXCA 3R0KA 5AC4A 3S5NA 1Z42A 3HJEA 3IAQA 2H3BA 1UASA 4D6EA 1ZHAA 4LB3A 4HU8A 1NDWA 5L9FA 3ITXA 3LPPA 2HK1A 3RM4A 1TELA 4G1NA 3S2LA 4EE9A 4JIQA 5T8GA 2V63A 1CECA 1OF6A 4H9ZA 3AS1A 2Y62A 5FOOA 4PUUA 4MGGA 5M17A 1QPOA 3THDA 3VOIA 3H70A 2IPWA 4UXDA 5GPRA 3TWBA 4WDXA 4D6HA 4TX8A 4LU0A 1EJRC 3O8AA 1W1IE 4X63A 2Y89A 2TPSA 3APTA 3MHUA 2HBXA 1QPNA 4YTRA 1WBHA 3KHJA 1XSIA 5GNXA 3OB8A 4ATLA 2QPSA 4LAZA 3XISA 4Z42C 2Z1BA 4GH1A 1HJWA 1TE6A 3C0LA 1EBHA 3LTPA 3QPEA 3CHVA 1PBGA 1A50A 1CT5A 1P4CA 4JTHA 4MZ1A 4HZ6A 5I7GA 3WKZA 4DAIA 4DJFD 3DH7A 3LCWA 4BF5A 3LX9A 1Q6GA 4A3HA 1T6MA 4DJDC 1VS1A 3H23A 5AHMA 5C54A 1HQTA 3MVIA 4WUIA 3WQEA 2CZEA 3WJSA 3QQ0A 5FF2A 4MOZA 3OA3A 4MF4A 3WLOA 1S5NA 4OUEA 5CC3A 2JKEA 3CV7A 1X6NA 3LSBA 1E55A 2NX9A 2AOSA 3VX0A 2VZVA 1V6VA 4ZGYA 4DJEC 1GUVA 4KWVA 4V28A 3USZA 1ITQA 1P48A 3RYSA 5BOFA 2RDXA 3RLHA 1GW1A 4CNUA 1VEMA 5I00A 3EWDA 1FWFC 4HSOA 1R9ZA 2W3ZA 1XYMA 1BWKA 3R8GA 3DOPA 3G5EA 4AISA 1JFXA 4DRSA 1BXBA 2PD9A 5DN1A 3KXQA 2G3NA 1RCXB 3PANA 3N25A 4U3CA 4IMEA 2YCLA 3AUJA 2J7DA 2PWDA 1QNOA 2B81A 4RNIA 3WDJA 2OO6A 3IVUA 1XLFA 3MI3A 3JS3A 5KZMA 4HT3A 1JPMA 1JZ6A 3JZEA 3U4FA 3DG3A 2ZA2A 2GDQA 2YDAA 3FJLA 2B7QA 4TUFA 4NILA 5K4ZA 1F76A 1POJA 4ZMGA 3CEUA 1Q63A 3GWQA 3IUHA 4LAKA 3W24A 4HJWA 2PTDA 2Z2BA 1SZFA 3VIGA 3DYMA 5DMNA 4E3VA 3ABXA 3E49A 3FS2A 3T08A 1GT8A 2EKGA 1IV8A 4XAPA 2Y6ZA 3P60A 2E6AA 2NSOA 1VGAA 2VYOA 1LWIA 6REQB 2OODA 4Y9PA 1P0KA 1BF2A 1QJWA 2PDWA 4CN1A 3NIYA 3A9IA 1TIMA 3CB3A 2HWGA 4UFIA 4LYQA 1W54A 4O0KA 1B54A 4CU7A 2WCSA 3GHUA 4FXFA 4K1GA 1OYAA 3VNJA 2NLYA 3WNLA 1HGYA 4JTKA 3GS6A 5AOUA 3M0VA 3OO2A 1RPXA 1KM4A 3RG6A 1KM5A 4QS5A 3LNPA 1E6QM 2DZTA 1FDJA 4O16A 4AZHA 4J3UA 3LG3A 1Q6OA 2ISSA 3C8NA 3QF0A 1GOXA 4H9UA 1BRLB 3QLDA 3HGOA 1Y0EA 2HJPA 1XW8A 4JFSA 5IHRA 4TU1A 3W71A 2XINA 4RZBA 2FH8A 1E3XA 3DI0A 5D30A 1J2WA 2WMKA 3O6CA 1H0IA 1XLHA 1KGUA 3BMVA 1W3HA 3GZAA 1TJ2A 3V3WA 3TZFA 4J40A 1EJTC 1OCJA 2HTMA 1RLDA 1SU5A 2BZNA 5D04C 4XO6A 2Z6JA 1V5XA 3RRXA 1F6YA 3T09A 3EPMA 3AHVA 1B4EA 2A5HA 1FWHC 4LVFA 3WFZA 3WJXA 3MS8A 1DJIA 3URAA 4RXGA 4UQ9A 5E6YA 5LNRA 2CPUA 3PZIA 2ZUUA 1R3TA 2R1KA 5ABTA 2RJHA 3V0TA 2IKIA 3DG7A 3BAKA 2PDKA 1UKTA 3NJ3A 2AAMA 2WVUA 4LH8A 4X0NA 4ADTA 3JZUA 1R38A 4JTDA 3E0WA 1U5HA 1TX0A 2J62A 1T8XA 1VEOA 3WEOA 2JGYA 3N6HA 4S3FA 2VKZG 1E72M 4WF7A 2Q3RA 5F2MA 2P50A 2XWEA 1H7NA 4EXBA 2P0OA 4MWAC 4EIVA 2Z27A 4DBSA 2G96A 3WNPA 1FH7A 3PFRA 3KFTA 3UA3A 2QJIA 1AW1A 3SQLA 1EHAA 3QFEA 1LG2A 3N18A 2RGMA 3LUTA 4MB4A 4PCFA 2WW5A 1LQAA 3BG9A 1VCGA 4QX4A 4V33A 3W82A 1YNQA 2AQVA 2NLIA 3L0GA 3T07A 4D72A 2GZXA 3TFXA 3QMTA 4XSLA 4DZIA 4P7LA 3D3FA 1W1A1 1M7XA 2A7PA 3ARPA 4NX0A 1BG4A 3NZQA 2CLIA 4NRSA 3AZSA 4FXJA 4M5PA 5FA5A 1B3YA 1K9TA 1A3WA 3S1UA 5I5RA 3OG2A 2HK0A 1SO3A 2OGJA 3UA4A 2ZICA 3MVTA 1B31A 1NWUA 3PM6A 5K9XA 3T55A 2OSXA 1CW2A 1JUBA 4M19A 3QMSA 4QNWA 4JN7A 4IX2A 3PBYA 4H41A 2WSPA 5BW6A 1Q7QA 2NQ5A 2W63A 3V7PA 1AMYA 1E9LA 2DZBA 3BSGA 2JIWA 5TQLA 4JX5A 3S5YA 4IIEA 4RDYA 1R46A 1JD9A 1EH9A 1MQRA 2E25A 2QAFA 4OV4A 4B91A 2YFNA 3BLFA 1R2SA 3FKKA 4QE1A 2VZSA 5CBIA 1EOKA 2HZGA 3Q94A 3H4XA 3LCHA 1MZHA 3ZIZA 3F2CA 4RZ4A 2DPEA 2GQ3A 3ALFA 1QAPA 1YNYA 3FW6A 3M0JA 2IPFA 3SEPA 3OBEA 2I56A 3CAQA 4GQQA 1S2VA 1UPMB 2E6DA 2PDFA 3SRKA 4E8DA 1XM3A 2PCQA 2ZZ1A 1JZ2A 3MKKA 3P5YA 5I79A 4I7VA 2CLEA 2INFA 4ZSTA 1DVJA 4US6A 4ZODA 1QK2A 1SYTA 3W1PA 1AQMA 4NZJA 3FLUA 1XL9A 4KT2A 1R5YA 2WHLA 1L6GA 3WQWA 3PTMA 4HP5A 3WQ8A 2P3ZA 3MZ2A 3UR5A 2SFPA 3N9RA 4H4IA 2CLFA 2O4QA 1LL7A 1JPDX 4CD6A 4C91A 1ZGDA 3WNOA 4PRTA 4OT7A 3SADA 1MW0A 3NM3A 2PDYA 1OGGA 5IFTA 3OVQA 1SFSA 3LS9A 3WH9A 2OYKA 3FVDA 4Z2GA 1NOFA 1XH1A 4Q4QA 4YWSA 4NI3A 2CLOA 4IIHA 4X3ZA 4CUCA 1VYSX 1XPGA 1OK4A 4RNJA 4W86A 5C71A 4Q8VA 5FAGA 4JN6A 1BGGA 3KVKA 4Q4RA 3HPXA 4MFDA 1V3IA 4HHMA 1MO0A 4DUXA 2CLLA 1DYSA 2IKJA 3GX9A 4IFOA 1TUFA 3DBPA 4H6KA 3V36A 5EU9A 5DXYA 1H61A 4US5D 4ROPA 1E40A 1X8FA 2FZ8A 2PDHA 4CNOA 3SY1A 2XTKA 1DJHA 2EPMX 2YA1A 3IJQA 3LCFA 3WQOA 3STCA 3NDZA 3TONA 4BY3A 2OZTA 4ZZ9A 1XI3A 4TX6A 1LYXA 3KUMA 1OCNA 1IT0A 4U3AA 4AC7C 4BHYA 1WZMA 3YPIA 3NGFA 4GGBA 3BARA 3VILA 4EAMA 3WDPP 3S2MA 3ZR5A 1NARA 2G4JA 3F5JA 1J01A 4CCCA 5CZ0A 4JTLA 4EP8C 1X39A 1GONA 4FS9A 3G0XA 2DSKA 4AYSA 2XYLA 4OUIA 3QQ1A 3B04A 3IIZA 3SJ3A 1QI4A 3I7SA 1R8LA 1YEYA 5AYZA 5A6BA 1FH9A 4NI8A 1S46A 1CENA 4XISA 3W7PA 1IEQA 3S9ZA 1UUMA 4ZB2A 3VA8A 4JQAA 2Z25A 1X97A 3IJLA 4AZ5A 1ESWA 3V4BA 1H60A 4AD3A 1UD2A 4Y6GA 2D0FA 4N4PA 4KKXA 4PCPA 3ZMRA 3RU8X 1TPC1 4G8TA 3S9YA 2WKLA 4ZTXA 3IV8A 4LOCA 3GUWA 1EJ7L 2VEKA 3URQA 2Y5JA 1W1ZA 3O6YX 3BE7A 2GUBA 4IM4A 2FHCA 2ZRWA 4N6EA 1YTEA 3N6JA 3U4AA 1S2UA 1W9VA 3GXDA 1JAKA 1V3LA 4L9YA 2ISFA 4MIMA 1JNDA 4DXVA 3DGRA 4F48A 2J47A 1I4NA 1BG9A 5CBBA 4S38A 4NZ5A 2FPTA 2DT2A 3LOTA 3QV9A 4GHRA 4PTXA 3GH4A 4UTHA 1K4HA 1W3JA 4ZB0A 2YL6A 4LFYA 2DUXA 1H7XA 1G94A 4NX5A 4IIBA 3A6OA 1EWEA 3OGVA 3IRSA 1YLVA 1G4PA 3TSMA 4JEQA 3N4EA 2E6YA 4JX6A 1US3A 2JE8A 2V67A 3MJYA 4IIGA 1SJDA 3Q2DA 3UETA 5ABFB 4AVOA 1HXJA 4F3HA 4J3XA 1ZFJA 1JCMP 3AZRA 1Z6KA 3U0HA