3PTQA

The crystal structure of rice (oryza sativa l.) os4bglu12 with dinitrophenyl 2-deoxy-2-fluoro-beta-d-glucopyranoside
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
478
structure length
478
Chain Sequence
PVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase Os4BGlu12
publication title The crystal structure of rice (Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-glucosidase with significant thioglucohydrolase activity
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
total genus 190
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ptqA00
1UQYA 1HVXA 3F5KA 1E9LA 4UQAA 2EPKX 1W2VA 2WAGA 3RILA 4HMCA 3PTMA 5GNYA 2W91A 4Z2KA 5A2CA 3SUUA 2CPUA 2QV4A 4BQ5A 1ZB5A 2WCAA 1B3XA 2XVGA 1WZKA 2EO7A 2YBTA 1B0IA 1JG9A 2G3NA 4JKKA 4TVCA 1ISXA 4GO8A 4DUWA 5TD4A 4DUVA 2UWFA 2J7EA 4YHGA 4CD6A 2VZUA 4W8BA 4FLSA 5D8ZA 4UQEA 4LYPA 1Y7VA 3VIMA 3WQ4A 2WCSA 1CLVA 1I1WA 5IDIA 1KWGA 3WNPA 1HNYA 5GQBA 3AIBA 1CXEA 2CETA 4B9YA 1C90A 4UR9A 1G5AA 1FP8A 5CGTA 2XPKA 1JD9A 3WMCA 5ABGA 4UOQA 4LYRA 4MB1A 3VIJA 4PUDA 1E0WA 1OD8A 1ECEA 1M03A 2XHYA 2YL6A 1JFXA 2VI0A 1E6PA 1JZ3A 2V5CA 2ZWYA 3KWXA 4PMZA 3LPFA 3QHMA 4CN6A 4A3HA 1VEOA 2DT3A 5IFPA 4UFLA 1BG4A 1GOIA 2D0FA 1CEOA 1GOOA 3MUY1 1UD2A 1J0IA 3NYDA 1VFMA 4WJXA 3SUTA 1W91A 1GOWA 3IJ7A 5I77A 1W9XA 3T0DA 1OCQA 2CIPA 3PBGA 5E6ZA 2J7GA 1V3MA 3UEQA 4MDPA 4JZ5A 3WBEA 3HMCA 2FH8A 3EDKA 1UWRA 3MUAA 1VJSA 4U33A 1UR9A 4AD5A 3AHVA 4B3KA 1HX0A 2AOSA 2O9OA 3OGVA 1JYXA 1V0KA 1M53A 4PSPA 1XSKA 3VGFA 1OWQA 1Q6CA 3N9KA 3AXXA 3W81A 2J7HA 4MNKA 4D72A 2GVYA 3PZUA 4AZ6A 2ZX8A 1US2A 1PX8A 3ZQ9A 3CZKA 1OIFA 1J12A 1BSIA 1ZBCA 4LGXA 4B3LA 3SEPA 5I24A 3BAKA 1OD0A 5EFFA 2FHBA 3ZR6A 2AAAA 4BZYA 1W3LA 3MV11 4E2OA 3LMYA 4PMDA 3WENA 4J7RA 3EDDA 5KEZA 4DWSC 3FNDA 4OZOA 1GOMA 3T0BA 3CUIA 5BRQA 2FGZA 2ZUSA 2WC7A 3ZT7A 1WP6A 3ARPA 3L2LA 5JIWA 5D9PA 1V3KA 1KFWA 1JYVA 4Z2JA 3IANA 4JFSA 1TG7A 4W5ZA 4W8LA 4DWSB 1KQZA 3L4XA 5DFAA 3GTNA 2WHJA 2W4XA 5CZKA 3S2CA 3WL1A 2PBOA 3WMBA 1FHLA 5A8PA 2V3DA 2Z1SA 1HVQA 2A3EA 2CBJA 4DUXA 3QHNA 4AW7A 3RIKA 1E6SM 4FLOA 2XIBA 1UWIA 1U2YA 2W5FA 2E9BA 3BLPX 1VENA 5I5RA 3W4RA 2XVKA 4ZFMA 3VVGA 3KZSA 4AD0A 3RCNA 4D6CA 5A94A 4W8AA 3MMDA 2Y5EA 2X09A 1CGVA 2X1IA 2VQUA 4QLKA 1AQHA 3L4ZA 1CZ1A 2JFEX 2PWFA 3AHTA 2G8ZA 1RD6A 5E0FA 5CLTA 1V02A 5EFDA 3VD7A 1MXDA 1Q4NX 3DYOA 3T08A 3FAXA 5ABEA 4IM4A 3MMWA 2CKRA 2WMIA 3B9DA 3CUGA 3TONA 4XV0A 3O6AA 4FK9A 4MNJA 3OGSA 2E9LA 3N17A 2DT0A 3VGBA 5A6BD 1HL9A 2DGAA 4JCMA 2VZTA 3WNKA 4U5IA 1BTCA 5KZ6A 2YA2A 3IAPA 2PB1A 3ZM8A 1D7FA 3ZSSA 1JZ6A 1E3ZA 1ESWA 2PWGA 4OIFA 4JFUA 1E6NA 2E3ZA 4AZBA 1XH2A 3BCDA 5HPOA 1OINA 1BYCA 2WLZA 3AYRA 5ABFB 3U5YA 4X0NA 4AD1A 3L4WA 4UZSA 1GJWA 1V03A 2XFRA 1SYTA 5EMYA 3TTOA 8A3HA 4TX6A 5A6SA 3F5LA 3WUFA 3AQUA 7A3HA 1EHNA 4H04A 3WFLA 2XGIA 1V0NA 4J3TA 3ZJ8A 4AD4A 1TZ7A 4CN4A 1E3XA 1JIBA 3WNOA 4HTYA 3JUGA 1EH9A 3ARUA 4UQCA 4AIUA 5FKYA 3T0AA 1BYAA 4E8CA 1ODUA 5BWFA 2ZOXA 4U3CA 4W5UA 1UG6A 3IJ8A 4JAWA 4CU7A 3SCUA 3VX1A 2XIIA 2VX5A 3SURA 1JD7A 1CXFA 2BVDA 1BVNP 2ZIDA 4D6DA 4V2XA 3LPGA 4MDOA 3WEZA 2BXZA 5DO8A 4IISA 1FP9A 1V0MA 2V3GA 2WPGA 2YJQA 3WDHA 1MQPA 4U31A 3K1DA 3U57A 2J25A 2WZEA 1IV8A 1L8NA 4HA4A 4W88A 3UESA 5IXEA 2GFTA 3VO0A 4C7FA 1R86A 2JIEA 4UZUA 3MUZ1 4W85A 1UD3A 1C8XA 3DC0A 1CIUA 4PRWA 1J0YA 1S46A 3WDPP 2ZX5A 4ACYA 3BLKA 4AZCB 3A6OA 3MSGA 4FF5A 2WVVA 1E72M 2XWDA 3AROA 7TAAA 3VIFA 3WF3A 3APGA 4KWUA 2DH3A 1GQJA 2J4GA 3VKKA 3FXYA 3WSUA 3SCWA 3GNOA 2JE8A 1E55A 3TA9A 1TE1A 2Y8KA 5A6LA 4Q7NA 4X0VA 1VEPA 4PBGA 4ZE5A 1V3IA 1OM0A 2D3NA 4E4PA 1BHGA 3WFZA 3ARQA 4QLLA 2ZE0A 3VD3A 3POHA 3ZT6A 3J7HA 3OB8A 5I23A 3VIOA 3AS3A 2J8GA 2XG9A 3POCA 5DMYA 5D9OA 4BS0A 2AMGA 4J3SA 8CGTA 1OGSA 4P7RA 5A2BA 2NT0A 2WMIB 5I3DA 1W3JA 3MO4A 1NOFA 2OLHA 3PN8A 4MPKA 1HJWA 1UYQA 3II1A 4ATDA 3W6LA 4CKQA 3L2MA 1HKKA 4BQ3A 4HPHA 1JXKA 3KL5A 1US3A 2FHCA 2RGLA 3S6TA 1PEZA 4GZJA 4W84A 1ZBVA 3N12A 1OT1A 3ZSTA 1JYWA 1C8YA 2XFYA 4AZ7A 1V6UA 3AIUA 3CZLA 3U5UA 2E40A 1UD6A 2PWEA 2X05A 1KB3A 1W1TA 5HXMA 3TTQA 4AD3A 1GOQA 3QOKA 1DWGM 2DEPA 3BSHA 1AQ0A 2A3CA 5CG0A 3SUWA 1V0LA 2GJXB 1E6XM 3UG5A 4YHEA 4HZ7A 3VDCA 2XVPA 2WW5A 1DWFM 2XVLA 1E1FA 4QAWA 4J28A 4OOUA 2F61A 3AIWA 3ZMRA 3VD5A 1C92A 1XSJA 3BAYA 1XH1A 3QOMA 4QFUA 1J9YA 1OGBA 3AMCA 1UD8A 2GDVA 2ZX6A 1BFNA 4NSBA 2G4FA 2OSWA 2WMJA 2FHFA 3EDEA 3SCSA 4K68A 5JIPA 3FY1A 1NH6A 1OIMA 3ARZA 1E15A 2BHYA 4CD5A 1QI4A 1QBBA 1KXQA 2BVYA 1JZ7A 3WY1A 2J8FA 4AEEA 2XJ7A 5IHRA 1A3HA 1O7AA 3CHFA 3WF2A 2O9RA 3CHDA 3L4YA 5A8OA 1BYDA 5A95A 1ZJBA 4J3UA 1XD0A 1JI1A 2WXDM 2VOTA 3NDZA 3AOFA 1QNSA 1HJSA 3SUVA 1E6ZA 3VMPA 2XGBA 4JFVA 2YDRA 5LYRA 4L4PA 4JKLA 4HU8A 2J7FA 5A6MA 1KBKA 5AYBA 1CYGA 5FD0A 3K4AA 4QLJA 1Z32X 1B90A 1XSIA 6A3HA 5A6AA 2WVVB 1VB9A 3AMKA 1EO5A 4Z2IA 4F66A 1JNDA 2WKGA 5BXPA 1IZKA 2QPSA 1WO2A 1E4MM 3PZ9A 2CEQA 3WEMA 4PSRA 2G41A 5LA0A 3UETA 2XSAA 4H41A 4JL1A 1QNPA 4HA3A 1JDDA 4GKLA 2OYKA 1KR0A 4GINA 1JDCA 2O92A 5I79A 1Q6DA 4CVWA 1UWTA 3SCOA 4ACZA 1XV8A 4ATLA 1KCKA 1UHVA 5CLWA 3VDBA 1CTNA 1W9UA 1WZMA 2HVMA 2CBUA 1W9DM 2EPOA 3CHCA 1QOXA 3L4TA 3PTKA 1K6AA 4WLCA 3EMQA 1ODZA 2YL5A 2VQTA 1XC6A 2CYGA 3NSXA 3FN9A 1ISYA 5JUVA 3PTQA 2D0GA 3WQWA 1GORA 3AXIA 5CPQA 2XSBA 4GZEA 4AZHA 5BXRA 1NOUA 4PCTA 1KR1A 2QHAA 1Q6EA 1EQPA 1GHRA 1TA3B 5IHSA 5A6BA 4AZGA 2WWDA 3SCNA 4RE4A 1EGZA 1U33A 1PZ3A 2OSYA 4KGLA 1RP9A 1M7XA 3GXIA 1J0ZA 4JKMA 3A3HA 1ISWA 1AQMA 1C91A 2X0HA 3GNRA 3WH5A 3ZO9A 5D9NA 2ZUNA 2GK1A 3WUGA 1C8QA 4C7GA 5CXPA 4P8WA 4J3VA 3WQVA 4PMXA 1HKJA 1KWKA 2YOCA 1GVYA 1CXLA 1CGWA 1K9DA 1VFUA 4DM1A 2VC9A 5DT5A 1QBAA 3WF1A 1FOBA 3VDHA 2WMGA 5DT7A 4XZWA 3M46A 1UKTA 1CBGA 4D6GA 2TAAA 2YA0A 4TVUA 3VTRA 3ARXA 1NWTA 1ZL1A 1R87A 2VZSA 1BGAA 5JBFA 2DQXA 1E0VA 3DHPA 4Q22A 1V6YA 2VX6A 2XVNA 2DSUA 3OBAA 2ZWZA 1HF6A 4CCDA 2G3IA 3N13A 5FCZA 6CGTA 3WF0A 4GI8A 2EBNA 2OWXA 5DEZA 1B3ZA 3SCTA 3NSMA 1DWJM 4DWSD 1QI5A 4AC1X 2IXVA 2ZX9A 1PPIA 5HDRA 1FH9A 1NM9A 3OLIA 5E70A 3T2QA 1GQIA 3SCVA 4CU6A 2VTFA 5A8NA 2ZXAA 1W3KA 4W89A 3NUKA 1UOKA 3ZJKA 2WSPA 1NARA 3RM9A 2BY3A 3BMVA 3WH9A 1C3FA 4P7OA 2DT1A 1CGTA 2VMFA 4RE3A 4D6HA 4JHZA 1B2YA 1OT2A 4HZ6A 4L4OA 4S3JA 1VFFA 3FHQA 4MJ2A 1M01A 1UKOA 3GH4A 3CGTA 4BCEA 4F9DA 2WVTA 1DP0A 4FLQA 1B30A 1H2JA 3VGDA 5E6YA 1I75A 3PZVA 4LXFA 1UUQA 1EA9C 2E4TA 4LQ1A 4P8XA 3AHYA 2XUCA 2VUYA 3W53A 1DWIM 1LL4A 3ECQA 2Q8XA 4ACZB 1EIBA 1AMYA 3ZT5A 1EOKA 2JIWA 1C7SA 1I1XA 3DECA 5AY7A 1C93A 2ZXQA 2W63A 1H0GA 3IAQA 1CNVA 1L0PA 2EPLX 2JALA 3VMOA 1NWRA 1HJQA 3CUHA 3RM8A 1JDAA 2JEPA 1GQLA 2WC3A 3MMUA 5FL0A 3VUPA 5EBAA 4R5EA 1G94A 1RPKA 5M5DA 2DDXA 3WN6A 4R27A 4V27A 2V3FA 1ZBKA 3NSNA 1E71M 1UZ4A 2VL4A 3A4AA 5A8MA 4D6EA 2VCAA 1LWHA 1OSEA 2UY4A 3MUIA 1KXHA 2YLAA 3NJ3A 2EQDA 2J47A 3G6MA 2X2YA 1GONA 2DIJA 2Y8VA 2G3JA 2VRJA 4U2YA 1JZ5A 4RL3A 3GM8A 2ZXDA 3OG2A 4Y7EA 3UR8A 1W1PA 3WUEA 2GK1B 3ZR5A 3K4DA 1J0KA 1B3YA 3WH8A 1R7OA 2WZHA 1UKPA 2PWHA 2J7DA 2YKKA 4UTFA 3VGGA 3U7BA 3KEHA 4CU8A 3UG4A 4PEEA 3AYSA 1J18A 3PZMA 1QW9A 1WAWA 1WDQA 2ZUMA 1QW8A 1MW3A 2WMFA 4A3YA 1UR0A 1ZS2A 3PZNA 1XHGA 1Q6GA 2WK2A 3K46A 1E6RA 1CGYA 1CXHA 2WMKA 3BMWA 1PX4A 4OOZA 2WWCA 3AHXA 1GZJA 5CSUA 2E0PA 4OUEA 3WNMA 2DSWA 1E6QM 4M82A 3VDAA 2CITA 3BGAA 4P7QA 2WANA 3QGVA 3W29A 4PTVA 2Y4SA 1YQ2A 3MANA 3WQ8A 3BSGA 1E43A 1PBGA 3THDA 3SCQA 5FIPA 4H8UA 2A3BA 4WKFA 3W25A 4BQ2A 2J77A 4M1RA 3U7VA 1V6XA 4GIAA 1EXPA 1QNQA 2VO5A 4XB3A 2VJXA 1EHAA 2QPUA 4AYSA 3RPMA 1WCGA 1CWYA 4EANA 5DF0A 1WE5A 4HMEA 1VAHA 4UQDA 4M24A 3OGRA 5LA1A 4J27A 2PI6A 4KGJA 3CUFA 4U5KA 2DSVA 3GXDA 1UA7A 2W61A 4JCLA 1JXJA 1E70M 1NP2A 3VU2A 1EOMA 4NF7A 2Y2WA 1X1NA 4ATWA 3M7SA 3OIHA 4X9YA 1HJVA 3T2PA 2VR5A 4HPGA 1UA3A 3EMZA 1SFSA 3F5JA 1GOKA 3WD4A 4PMYA 3PHAA 1KXTA 5D8WA 2C8NA 4D6IA 1WZLA 4B15A 3GXFA 3WIJA 3AMDA 4AIOA 2DH2A 2GSJA 3PZTA 1MYRA 5BYWA 2WVSA 1JI2A 4JFWA 1V08A 3W0KA 4E8DA 2J75A 3MSDA 4MAVA 3ZJ6A 1PIFA 2QF8A 3M6DA 3TOPA 4TX8A 4M29A 2GUYA 4CVUA 1ISZA 3OLEA 1NWSA 1QI2A 1VBRA 3SCPA 1BAGA 5E09A 4UCFA 2BHZA 1OGGA 1WDPA 1KXVA 4FLRA 4AXNA 3I3DA 3K8KA 2NT1A 1EDGA 1F4HA 3L4UA 3N04A 1UD5A 4W87A 3W6MA 1R7AA 1YHTA 1GCYA 1HP4A 1UH3A 1W9BM 4P7LA 1G1YA 2ESCA 2XM1A 4TUFA 1QHPA 1GPFA 4M56A 4AY1A 4MADA 4KRTA 4PMUA 1QHZA 4EE9A 2WNWA 4MNMA 4XUYA 2ZUUA 3MS8A 5I0DA 3VIIA 1V3HA 3BAWA 2VCCA 4WSJA 2EPNA 1W3HA 3I3BA 1BYBA 1OB0A 1CENA 5I2UA 5F7UA 2YL9A 1J0JA 2CESA 2W92A 2W66A 3GH5A 3CZGA 3UERA 3PZIA 2Z1KA 4P8UA 1JYNA 4UQBA 4CCCA 1VF8A 1KGUA 2VVNA 4FMVA 3KL0A 4XX6A 3W28A 5CJ5A 2IXUA 1V02E 6TAAA 2WZIA 3CLWA 1SMAA 2BFGA 2RGMA 3AZTA 3WBAA 1H11A 1IZJA 4PTXA 2VZOA 2CXGA 1CPUA 3WD2A 3VNZA 3WEOA 4UFIA 2GJRA 1HT6A 1HL8A 2C7FA 2CNCA 4PN2A 5FOOA 1B1YA 4ZE4A 1H41A 1UKQA 2O9PA 2ZXBA 4MB4A 3VIKA 3WD0A 4UOJA 4D1JA 3WDJA 3WD3A 3MKKA 1E4LA 1H0IA 2VR4A 3AHZA 1DEDA 2EXOA 4UFMA 5EB8A 1WKYA 4H7VA 3BXWA 1BVZA 5CGMA 4D6FA 4IPNB 5A6JA 3W24A 3AMLA 4DWSA 2VVSA 1ZU8A 4HP5A 1FFRA 1PZ2A 3WELA 1GW1A 5A3HA 1J11A 3O2LA 5M17A 2FH6A 1LG2A 1V3JA 2BHUA 1LWJA 2GJPA 4WK9A 4MB5A 2J7CA 4B9ZA 1HIZA 1QNRA 2W67A 4GXPA 2WHKA 1GHSA 4OKDA 4AWEA 3ARWA 3AMGA 2WSKA 3AIRA 1CGXA 2CERA 4NZCA 1GJUA 2NSXA 5LA2A 3HU7A 1V6WA 2BV9A 1J01A 3EYPA 5BXTA 3WNNA 4M8UA 2NW0A 1MW2A 3N1AA 5A6KA 3BAIA 1MQRA 3OA5A 3AI0A 4GQRA 2DSKA 1TFVA 2J79A 1XGZA 3HJEA 3LPOA 3NDYA 5AC5A 2PC8A 4HMDA 1E4IA 2YL8A 4HA1A 4PMVA 2VT0A 1WZAA 3CZEA 5HPCA 1FH7A 3B9AA 1LL7A 3FAWA 1W9VA 3WMSA 3WNLA 3VD9A 4NI3A 1CDGA 1TR1A 1LL6A 3VIHA 1FA2A 3VM5A 1V3LA 4AEFA 1WDRA 2OYMA 2VCBA 4Z2HA 2UY5A 3AISA 1LF1A 4GPNA 4PYSA 3GBDA 1FH8A 1UWQA 2E9MA 4OBSA 5JBEA 3PZOA 2CHNA 1F4AA 5ABFA 1R8LA 3RO8A 1JZ8A 1XRVA 1H4PA 1GVIA 1JF5A 5CPTA 3DYMA 4H8HA 3AS1A 3PZGA 3W37A 1C7TA 3WQ6A 1CECA 3VM7A 3WKZA 5JBDA 1CXIA 1RP8A 4JFTA 2BY1A 1QI3A 2X0YA 4KMQA 2F2HA 4AIEA 3AICA 5BXSA 5C70A 3KE0A 4H2CA 1LJYA 1E1EA 4GO9A 4F9JA 1XH0A 3I3EA 4URIA 1MW1A 4YN5A 3VGHA 2OYLA 1UKSA 1D2KA 3CBWA 2ZUWA 4GZIA 1EO7A 3BH4A 1UZ1A 2WM0A 2WYSA 1QPKA 1GUVA 3VINA 4CD8A 1G0CA 3CZ8A 1HXJA 1XCXA 1QVBA 2D22A 5GNZA 3GBEA 3VX0A 4TTGA 2D1ZA 1X6NA 3BCFA 1CXKA 3EBVA 2XM2A 4JIEA 2V38A 3AIVA 5I78A 1XCWA 1UR4A 4CD4A 2WBGA 4OBRA 1JZ2A 1BLIA 3AZSA 4PMRA 2DT2A 4BA0A 3UCQA 3K8MA 5GNXA 4W93A 2X8RA 3T2OA 2VURA 4Z2GA 2XYLA 1VFOA 4HOXA 1FFQA 4RE2A 2MANA 3CTTA 4AZCA 1ITXA 3ALFA 3AS2A 2YA1A 3RM4A 5IFTA 1W2PA 4BQ4A 3T09A 1VBUA 4PMOA 2E8ZA 1UH4A 2VZVA 5A2AA 3D5HA 3VIGA 2WLYA 2CBIA 1MVYA 1RH9A 1X6LA 4WIWA 3TTSA 1NP0A 2V3EA 4BF7A 1DHKA 3GYCA 3DHUA 1JGIA 4EKJA 3AJ7A 1E40A 1MFUA 3UG3A 4C7DA 1E4NA 1JFHA 3ZOAA 1LLOA 4N42A 5C8BB 4N0RA 3WH6A 1H5VA 5C71A 2J7BA 4DM2A 3IK2A 4CN1A 2YBUA 1E5JA 3RJXA 9CGTA 3A4WA 5BCAA 3SCRA 2D23A 4JHOA 1TUXA 2QMKA 3KL3A 4PMNA 1R85A 4AISA 1CGUA 3O9NA 4AD2A 4IPLA 1JZ4A 4A4AA 4CD7A 1ZBWA 3WQ5A 3WH7A 1WDSA 1E56A 4UFKA 3AZRA 4XZBA 4P8VA 3TP4A 2D20A 3WDIA 4AMCA 2VNCA 5ECUA 4QP0A 4UFJA 3F4VA 2ZUTA 4ZEPA 3VD4A 1TVPA 4WF7A 4PTMA 2ZICA 1LG1A 1DTUA 5M03A 3M07A 1HKIA 3VGEA 1KGXA 4EAMA 4WKAA 1TCMA 3B9EA 4HU0A 3SUSA 3W27A 3AIQA 3WUBA 1XYFA 2BY2A 2WVUA 1NWUA 1WB0A 3RJYA 1XYZA 3WDQA 2A3AA 3NIYA 2FDMA 2EEXA 4PTWA 2OSXA 1LQ0A 4QCFA 3TTYA 3A4XA 3GH7A 2GJXA 1JAEA 1B3WA 2PBGA 2XTKA 4D1IA 1W9PA 1GNXA 2UY3A 2VRKA 3ZJ7A 2O9TA 1UH2A 3VNYA 1VIWA 2DSZA 1W1VA 1EQCA 4M81A 2WMHA 3OLGA 4KH2A 4V28A 5D4YA 1MWOA 3ZIZA 4UNIA 4PUEA 3VPLA 3WL0A 5A1AA 4AZIA 1AVAA 1TMQA 3ARSA 1KGWA 1E73M 3A47A 3QHOA 1UR8A 2Y24A 4TXEA 4OJYA 3CHEA 1OBAA 4F8XA 3W26A 4J3XA 2VX4A 3K8LA 1MXGA 3QR3A 4GI9A 4TVDA 2WHMA 2J74A 5HOSA 3HN3A 2GDUA 1E5NA 3OZPA 1MW0A 1P6WA 3ARTA 1J0HA 1SMDA 1BGGA 3PZQA 2JF6A 1JAKA 1W32A 1V6VA 4W7UA 4S3KA 1BF2A 2UY2A 1WNOA 1HJUA 5I6SA 1KBBA 3AXHA 4CUCA 2BVTA 3FW6A 1EDTA 2QMJA 2XFFA 3VMNA 2JEQA 3ARRA 1BQCA 2ZX7A 2B31A 1MFVA 2D0HA 1PAMA 1B3VA 1D3CA 3VILA 1BPLB 1XD1A 5A8QA 1VRXA 2EJ1A 2YIHA 4H8VA 1K9EA 3CO4A 1A47A 1B31A 1H1NA 1K9TA 2D24A 4UQ9A 2D2OA 1WPCA 4TTUA 2CKSA 4YPJA 3N15A 5E9AA 2DPEA 4GI6A 5E0CA 1UWUA 3CMGA 3LPPA 1JF6A 4QCEA 2J62A 1M04A 1TVNA 2V5DA 1JNEA 4IUGA 2YLLA 4MJ4A 1QI0A 2WC4A 1UR1A 4UOZA 1QHOA 3MV01 3THCA 1HP5A 2FGLA 1VEMA 2WCGA 3BAJA 3VIPA 5AYIA 1UQZA 3WDRA 5D9MA 7CGTA 4D71A 4PCSA 4ZXOA 3RMEA 2OWWA 4AZ5A 3GNPA 4EK7A 2HISA 4ZENA 1UD4A 1NOWA 2CBVA 1QNOA 4CGTA 3N11A 5FL1A 2YDSA 3E1F1 1N82A 1VJZA 3EDFA 1ZJAA 4HOWA 4MAZA 4F79A 1ITCA 3MU7A 1H49A 3DYPA 2BNJA 3SIMA 1K9FA 4NRSA 4GQQA 1MQQA 1IT0A 1TA3A 3GDBA 5CQ1A 3D3AA 1ISVA 3AIEA 2JF7A 4ML4A 3OZOA 4KRUA 4U3AA 1GQKA 1HJXA 1UR2A 1H09A 4UFHA 4W7VA 2G3MA 4HOZA 3WF4A 3WD1A 3EMCA 2XWEA 5A69A 2W62A 3ARVA 4B16A 1FHDA 2VRQA 4CCEA 4W86A 5M3WA 2A3HA 4ZXLA 3IJ9A 3L4VA 3VOCA 4QDMA 5HBFA 4JL2A 2C0HA 4WKHA 1U30A 3GXMA 1O6IA 4NRRA 3W38A 2J78A 2WBKA 3CUJA 1UWSA 3FHAA 1KCLA 5CPSA 3W82A 2CHOA 3UR7A 2BY0A 4W7WA 3CPUA 3G6LA 4PMQA 3N18A 1PJ9A 1JL8A 4Z2LA 4LPCA 3BC9A 3OLDA 1G01A 1B9ZA 1DWHM 4MB3A 2ZUVA 2F8QA 3NCOA 2WHLA 1CLXA 4HZ8A 1G9HA 2BXYA 5GPRA 1Q6FA 5CSYA 3GZAA 2PWDA 4MNLA 2VX7A 4D6JA 1E0XA 5BROA 4P7NA 4LYQA 1PX3A 3EDJA 4MTVA 5HNNA 1HN1A 2CCRA 4WSKA 5AC4A 2D3LA 1J10A 1H3GA 1DWAM 4J3WA 2DIEA 2YDQA 3RDKA 3ALGA 5ABHA 3BAXA 2BS9A 3CMJA 3ARYA 2OWCA 4U2ZA 1PIGA 1W1YA 1KQYA 2EPMX 5BRPA 3CH9A 4TOQA 1EDQA 2WKLA 2WB5A 2E8YA 1HKMA 2PF0A 3CZJA 1BG9A 3B8SA 3AFBA 2IUZA 4LX4A 4M80A 2QLYA 1NQ6A 1SR0A 3AS0A 3CIVA
chains in the Genus database with same CATH superfamily
2QDEA 1AH3A 3ABXA 3T8LA 4GY0A 5FJOA 1WYIA 3SUUA 3TIMA 2CPUA 1RLCL 2UZ9A 4BQ5A 2AL2B 4ZQOA 3MBFA 2HSAA 4IMGA 2YBTA 4MGGA 2QEZA 4IGSA 4G6CA 2Z1BA 3M5VA 2BZNA 4ORMA 2VFHA 4DUVA 4DEFA 3ZWSA 4CD6A 3NQDA 3MZ2A 5BWAA 3VFLA 4Y2WA 2WCSA 1TQJA 4HCDA 3C6CA 5GQBA 4LOCA 3ITVA 3A3XA 5AZ0A 4B9YA 4BEQA 1QPRA 2OT0A 1JD9A 1SZRA 3WMCA 4L1WA 5C9UA 2V8ZA 3T81A 1JFXA 1PUDA 1T6MA 1E6PA 2V5CA 1G7VA 2PDWA 4IGHA 3R6IA 4NJIA 4PMZA 3QHMA 3T55A 5IFPA 2D0FA 1GOOA 4C60A 3MUY1 1UD2A 3NGJA 1VFMA 3SGZA 4WJXA 3OIXA 1W91A 5I77A 5AN7A 5EMUA 2PWVA 4TX9A 3UEQA 3S5ZA 3HPXA 3WBEA 4GK8A 5K4ZA 4QISA 1A0DA 1DJHA 2DVXA 1SW7A 4AD5A 3E2QA 1WUFA 3AHVA 4RZ4A 1XXXA 2AOSA 2O9OA 3GQYA 5H1WA 2E1WA 4ZB5A 1KM1A 1QRQA 2E77A 5DX7A 4RZBA 3EPOA 3ZLFA 1O94A 1QR7A 3STPA 4NJGA 2ZX8A 3LSBA 3WX7A 2PTYA 1KLYA 4UTWA 5I24A 1EJUC 1OD0A 3R8HA 3NPXA 1K02A 2NVAA 3MV11 4DBUA 5K4XA 3EDDA 2GVLA 3W7GA 1G69A 2PP3A 4G2DA 4UB9A 2ZUSA 3ARPA 1SZEA 1JYVA 1S2TA 1TG7A 2XISA 3QN3A 5D2VA 5IRPA 3LA4A 3I4KA 1KQZA 1SGJA 4G8TA 1KNWA 3L4XA 2QV5A 2W4XA 3WL1A 2PBOA 1FHLA 5A8PA 3EPMA 1JPDX 5KZMA 2EAWA 3HOJA 2CBJA 1GYNA 2F9RA 3RIKA 2GUUA 2J13A 1E6SM 1WUEA 2Z24A 3LBMA 1UWIA 5JH1A 4MIMA 4K37A 1LQAA 2E9BA 2I16A 2PDYA 1VHNA 3R4IA 3OYZA 1JUEA 3RCNA 1OC5A 3P80A 2X1IA 4QLKA 4IGMA 3BV4A 3L4ZA 1CZ1A 1SFLA 3S5YA 1RD6A 1SO4A 4KWVA 5EFDA 3W1LA 2C16A 3DYOA 2PDKA 3WQEA 3MMWA 1J2WA 3TONA 4BK9A 3UW6A 4FK9A 3W00A 2DT0A 3EXTA 5LXEA 1HL9A 4LC8A 4PBFA 1W1IE 2PTWA 1OC7A 1TJ0A 4DVOA 3EX6A 2PB1A 1DJGA 3QC0A 1JZ6A 2ANUA 2AQVA 4JFUA 2C19A 2Y7GA 1Q2RA 4Z1CA 3V35A 3W2LA 4QJ5B 4JGDA 3AYRA 5C5YA 5ABFB 4DXXA 3APYA 1IZCA 4UZSA 3SR7A 3PJTA 3VE9A 1FQ0A 1XP3A 4MY9A 4XD4A 1DHPA 1EUNA 4GYJA 3GUWA 1XKYA 8A3HA 4RE0A 4TX6A 4CNSA 7A3HA 2FZ9A 1GTHA 1RY8A 1S2UA 3WFLA 4J3TA 4ZA0A 1E3XA 1TO3A 3KUMA 3JUGA 1XRFA 2CZ5A 1RA5A 2OZTA 4E8CA 2YPIA 4U3CA 2YB4A 3GYEA 2R91A 3IJ8A 5AHFA 3LY0A 5BMWA 1SFJA 2VX5A 2QCHA 1CXFA 5HNTA 2BVDA 2HE5A 1B5TA 4UNKA 1RXOB 1TV8A 3PNZA 4LYKA 4MDOA 3SIZA 4XZNX 3PP7A 3I6EA 3TQVA 4QE5A 1I8JA 1ZAJA 2MUCA 3VOFA 2V3GA 2WPGA 2P3EA 1VLWA 4A3RA 5I07A 3GX9A 2WZEA 3VUSA 4YLWA 1IV8A 4HA4A 4RV3A 5IXEA 2GFTA 3TZFA 4HHPA 1K03A 3GS6A 4E38A 2VDGA 4IMEA 3O16A 2FYMA 1J4EA 3H2EA 4W85A 4XKYA 4PR4A 3KBJA 4PRWA 5CPLA 4C6PA 3WDPP 4ACYA 4KPLA 2ZDRA 3LNMA 1E72M 2XWDA 1AJ0A 7TAAA 2XIJA 4DBDA 2DZVA 1FKWA 1DBTA 4PC8A 3APGA 3VKKA 2PLJA 4PMJA 1ADOA 2DQWA 3DHDA 1E55A 2PDHA 1TE1A 2Y8KA 5A6LA 4JICA 3TUUA 6PTDA 4GXWA 2SFPA 3NA8A 4XISA 2I5GA 2ISWA 3ZT6A 2C71A 3J7HA 2WJFA 5K2ZA 2VGIA 2BODX 1OK4A 4DI9A 5D9OA 4BS0A 3GUGA 3PM6A 1R2TA 1U1HA 2OQLA 1OGSA 3PWAA 4P7RA 5A2BA 3PWIA 3V0UA 4H9XA 4HZMA 3MJYA 3PN8A 4MPKA 4L64A 3TLLA 1HKKA 3TYCA 3E02A 3PPGA 2RGLA 4R9XA 1PTAA 1PEZA 4GZJA 4O54A 3P74A 4NAFA 3TE9A 5AOUA 3THAA 2XFYA 4AZ7A 4NXKA 4ZQPA 3R79A 3O6CA 3GC4A 1EJXC 4XIAA 2VWSA 5HINA 3GTIA 3QSTA 2PDCA 4E4UA 3UCCA 1XLIA 3FDKA 3BSHA 5CG0A 1V0LA 2P76A 3W23A 3MPGA 1G6CA 4HNUA 3UG5A 3VDCA 1DWFM 1S5WA 1K7EA 4E3VA 5BMXA 1C92A 4LAMA 2QAPA 4NQ1A 3T0CA 1J9YA 4DO4A 2V81A 3SSJA 1UD8A 1Z7AA 2FTPA 4DJDD 4NSBA 4DZIA 4DX3A 1O60A 5HJXA 5K7JA 3R1ZA 1IEVA 4AQLA 3FEQA 3RX2A 7PTDA 3CWNA 2E09A 1OIMA 3BQ5A 2BHYA 3THUA 1OCJA 4E2BA 1AJZA 4Q4QA 3S2MA 4MG4A 1IT7A 3OEXA 5DCBA 1XUZA 3TROA 1F5ZA 5KZDA 5EMMA 2HXTA 1SZGA 3BMXA 2ZZ6A 3FYPA 3NDZA 2DUAA 4NKCA 4N9CA 1QNSA 4JTUA 1VJIA 3SUVA 3VKJA 2XGBA 4IJCA 3FJNA 4HJWA 4XKYB 2J7FA 2CU0A 4C6LA 3PNUA 1WXJA 3OO2A 4QLJA 1XSIA 6A3HA 5A6AA 3GW0A 1VB9A 3AMKA 4ECLA 4F0KA 1X96A 4YCOA 3N19B 5REQA 2GZXA 4DPQA 4F66A 1JNDA 1XPYA 4UXDA 1YKWA 2QPSA 3H6OA 3PZ9A 1X6UA 4PSRA 4UNLA 3WEMA 4CEXC 2G41A 1MO0A 2RDWA 2XSAA 4PB4A 3VKDA 3NZ1A 1EJRC 1QNPA 1XG4A 1JDDA 2FQIA 1JCLA 3LM3A 1QK2A 4DNHA 3SCOA 2OCZA 3HG2A 1TR9A 4A22A 1XYAA 4GFIA 3C2YA 4ATLA 5I09A 3VDBA 1TV2A 1W9UA 1I0DA 1WZMA 2HVMA 2CBUA 3VKBA 3E0VA 3PTKA 1Y5VA 3LYEA 4JPGA 1C9WA 4C6QA 1V79A 1ODZA 1DKWA 3NSXA 1H62A 1NY1A 5LIWX 2D0GA 1GORA 2XSBA 4PTDA 3C2VA 1KBJA 1NOUA 2QHAA 2QT3A 1FY6A 3BV7A 3QTGA 1GHRA 4DN1A 5IHSA 3GDKA 3SCNA 1PXGA 1LBMA 1V4YA 1PZ3A 3FOKA 1RP9A 4JKMA 4NAFB 1AQMA 1OFAA 4TV6A 4ILSA 2ZUNA 2GK1A 1A3WA 4REQA 2NX3A 1GYMA 1KWKA 1VFUA 5I3GA 2ZZ2A 3UZJA 1M5WA 1QBAA 3NURA 2VWTA 2EG8A 1YPXA 4LUSA 1GKRA 3NO1A 1UKTA 2J9XA 4D6GA 4GNJA 1XYMA 3G22A 4ZOEA 2Z0IA 4FXSA 1MZRA 5HNUA 3Q58A 3E2SA 1EUAA 1R87A 3IRSA 4O17A 2VZSA 5JBFA 2J88A 3DHPA 3QW3A 2CXEA 1I6NA 5LIYX 2Q09A 2DSUA 3GRIA 4XSLA 4DYEA 2Y7DA 2PU0A 4S39A 3R89A 4HD5A 3P61A 5D03A 2BXVA 3BLLA 4GVHA 4WDTA 2OWXA 1FKXA 8XIMA 2E28A 3CUXA 4DELA 3SCTA 3NSMA 5F2LA 4EVZA 1JRCA 3UZXA 4AC1X 2IXVA 5I02A 3PB0A 1PPIA 1NM9A 3OLIA 5E70A 3CPRA 4CU6A 2ZXAA 4W89A 1DJIA 3RGTA 3TTEA 2Y8UA 5J04A 1FDYA 4IMDA 2EGZA 4C1NA 1LQ2A 2OTDA 4LALA 4MWAA 3BMVA 1S1RA 4O18A 4DO7A 1KD0A 4Q8VA 4FIRA 1JRBA 4D6HA 3I68A 4US6A 1OT2A 1WXZA 4S3JA 2XIQA 3B8DA 3FHQA 1K77A 1M01A 4JYDA 3R94A 2I14A 3E9AA 3AJXA 5CSSA 4FLQA 3VZXA 1H2JA 3VGDA 1I75A 2H8XA 1A5KC 4LXFA 1UUQA 5AHIA 4LQ1A 2QDGA 3AHYA 1JDFA 3BE7A 1ZNNA 2XUCA 3H21A 3K2GA 3YPIA 3W53A 4B2DD 4O11A 1LL4A 2NUWA 1AMYA 1WQ5A 1YE6A 3DECA 2W63A 5KZEA 1TPH1 1L0PA 2FPTA 3EOOA 3KTSA 3DHFA 2GWNA 1K6WA 3FX4A 5AVNA 3VUPA 4QBXA 1G94A 5M5DA 2QJNA 3TR2A 3WN6A 4L4MA 4M5PA 1IE7C 5CZSA 1UZ4A 2ONEA 1NIUA 3A4JA 1OSEA 2UY4A 1KXHA 2YLAA 2IPFA 3NJ3A 3WK2A 1A5SA 3TJXA 4X63A 4N4QA 2VRJA 4LUTB 1DJXA 1JZ5A 3VNJA 3M0KA 4RL3A 3WQGA 4IXXA 3MUXA 1RA0A 4F3HA 4L56A 2GK1B 1J0KA 3H54A 4REQB 1UKPA 1FHVA 1ICQA 4UTFA 4FNTA 1SUXA 3U7BA 4FXJA 4YTUA 1J18A 2Z2UA 1QW9A 3PZMA 4LUSB 3ONBA 2BBFA 1MW3A 5G1TA 3GU9A 3NPUA 2F6XA 3S5NA 3IGUA 1PX4A 4PB3A 3VYLA 5CBJA 3W01A 3FCPA 1JCXA 1X1OA 1XYBA 2QPXA 1D3HA 1PHQA 1LOLA 1J6PA 1OFBA 4OGZA 2PLCA 3M4HA 2IS7A 2E0PA 1T96A 1JUBA 3VNMA 3MANA 1YQ2A 3WQ8A 8RUCA 3UWZA 3BLIA 3C8FA 2GSHA 4DB7A 4LWWA 1YE4A 5FIPA 3QBUA 4NASA 2A3BA 4GIAA 3VXGA 1EXPA 3UBPC 1X98A 2VO5A 2F6KA 5CJMA 2AMXA 2B4GA 3NWRA 4EANA 3OGRA 4J27A 4MWAB 3BK0A 2ZC8A 4I5UA 3I6TA 2DZXA 5T9CE 3MP4A 1HO4A 2Y7FA 2C14A 1YYAA 2DUXA 3W2KA 1MEIA 5FJTA 2ODOA 1X1NA 3M7SA 3OIHA 4X9YA 2YR1A 4Q4OA 3C2FA 3L5AA 3EMZA 3F5JA 4H83A 3V1PA 4PMYA 1XGEA 4GQGA 2YCEA 3B40A 2C8NA 3PY2A 1XIGA 2ZZ1A 3IJLA 3GXFA 1JCJA 4IG2B 3QYQA 2V68A 2GSJA 4IX2A 4CQ8A 2NZLA 2WVSA 1JI2A 3W0KA 3FGCA 1PIFA 2C0AA 5AHNA 1UW9A 4HBKA 5D2YA 1DXIA 3E6EA 3ANYA 1Y0EA 3OLEA 1PDYA 3CC1A 4POCA 1V77A 1RJQA 2A4AA 2BHZA 2DZSA 1WDPA 3S9YA 4AXNA 2ADAA 3S2JA 4HNVA 3IJQA 2F6UA 4L9YA 3N04A 5G4WA 1ICPA 2QIWA 2ACSA 3V5FA 1UH3A 4P7LA 1G1YA 2XM1A 1BEUA 4TUFA 3ELFA 1U5JA 1WDDA 4M56A 1R9XA 1QHZA 1TJRA 2WNWA 4Q6XA 1VYRA 3Q2DA 4XUYA 3MS8A 1W5PA 1TV7A 3NFUA 5D32A 3HG3A 1JUKA 3BWWA 4YVXA 3FA4A 3UWEA 1YBQA 2PCQA 3UERA 2Z1KA 4P8UA 2ZA1A 3PPFA 1F9CA 4CCCA 4UMCA 1VF8A 3WCZA 1KGUA 2VVNA 3L66A 4H8NA 1O5XA 3KCOA 3QZAA 1SMAA 2BFGA 3ITGA 2XH2A 3DFQA 3URBA 3VNZA 3W7NA 1XLAA 3CV6A 3E0WA 1XFBA 4XO7A 4CQBA 5LIXX 3IRDA 1ZENA 1J93A 2JGQA 1XIMA 4N9BA 2NV1A 3WLJA 3F7JA 5J5DA 3B97A 3BURA 1DJZA 3FVMA 3UFYA 4PUNA 3EOEA 2KX9A 1OYAA 1PZ2A 1XM3A 4Z1DA 1NQKA 2FJKA 3MZNA 2BHUA 2EHHA 1L9WA 3QQ0A 3L0GA 3UJRA 1HL2A 4MKSA 3IJIA 4OKDA 1ZRQA 4KWSA 4Y9AA 2I1OA 3WLSA 1CGXA 2XU2A 4NZCA 2NSXA 2A3LA 2G0WA 1WDWA 5BXTA 2YCLB 1KRMA 2QVNA 3N73A 2VDIA 3OA5A 4UR7A 2AAMA 4AFYA 3HJEA 3LPOA 2D2JA 3RR4A 2DZBA 3TXZA 5CZTA 4PMVA 1EYEA 2VT0A 3CZEA 5HPCA 2A0NA 2GVJA 1R3TA 3FAWA 3WMSA 4NI3A 1VKFA 3ZFHA 1G67A 2V6AA 1E9ZB 4I90A 3S47A 4CQ9A 1TR1A 4RZ5A 4EXQA 4Y9NA 1GT8A 4LVGA 1XQLA 2UY5A 3EA1A 4GPNA 4YJ5A 2B81A 3PBVA 4LAUA 5JQ9A 3ABOA 4GHRA 4PRTA 3PBUA 4OBSA 4MJMA 4IJRA 5EMJA 3C2EA 8XIAA 3G1VA 1JZ8A 1XRVA 1JF5A 3WQ6A 1AA1B 1K8XA 1CECA 5JBDA 2QUUA 4GBDA 2BY1A 4Y6GA 2F2HA 3OTRA 4AIEA 1H63A 3GDRA 5C70A 4FNSA 1IXQA 1LJYA 1KV5A 3TCEA 1EP1A 3DFOA 1UROA 4R7JA 4YN5A 3VGHA 2OYLA 4IIGA 4JN6A 1D2KA 4HSHA 3IUDA 5C9WA 4QR6A 1YNPA 3NZGA 3ITTA 1UZ1A 2NVCA 1GUVA 3VINA 1UIPA 1XCXA 2D22A 5GNZA 2FVLA 3GSMA 1Q85A 4LW7A 2Y88A 3H2OA 2XM2A 3AIVA 3LCXA 2WJZA 1R38A 4N02A 1FX6A 3CAKA 4LF1A 3GG8A 2V5KA 4BA0A 2FTWA 3K8MA 3G1XA 1XQKA 1XRSA 4W93A 3M0YA 1SR9A 5KTLA 2X8RA 3T2OA 4GUFA 3B4YA 3LLXA 4Z2GA 2TPSA 3LGGA 3LRLA 4HOXA 1EC7A 2MANA 5AB3A 1IF2A 2ALRA 2YA1A 3LB0A 1W2PA 2BOFX 4C6IA 5G2HA 2NQHA 4PMOA 3R43A 3BLDA 2VZVA 4FXRA 4K7YA 5B80A 2VELA 3VIGA 3IIVA 2CBIA 1MVYA 5AC6A 1RH9A 4L4LA 4HPJA 3GLCA 5C9ZA 3R13A 5G1MA 4ENLA 4EKJA 1W1A1 5GJNA 3G5EA 2BB0A 2P88A 1E4NA 3FSUA 2XGZA 3V5OA 1LLOA 3EAUA 5C8BB 3ITCA 3WH6A 1H5VA 3WZ0E 4D2JA 3UXKA 1V93A 3NO3A 4EOUA 3RJXA 3SCRA 2C1HA 2QMKA 4XD3A 1R85A 3W7MA 1CGUA 4Q32A 5G4HC 4B90A 4IPLA 1T7LA 3IWPA 3GKFA 3T8QA 3LENA 1L6FA 4P8VA 2QCLA 3KHJA 2D20A 3A21A 3WDIA 2HBVA 4AMCA 3R12A 1LM1A 3VD4A 2DORA 2PLKA 2PC4A 3ORWA 3TYUA 4NZ3A 3M7WA 3KOYA 4V15A 1DTUA 3M07A 1KGXA 3NGFA 3IGHX 4EAMA 3B0UX 2PAJA 1XLKA 1TCMA 4EPEC 1VFHA 8TIMA 1UJPA 5HWJA 2I17A 1TWSA 4L80A 4PTWA 4Q4PA 4QCFA 3A4XA 4H6KA 2WNNA 2DW6A 3WBYA 2PBGA 2XTKA 4E0CA 3FYYA 3NG3A 2UY3A 2VRKA 5XINA 1UH2A 2REQA 1W1VA 1EQCA 2EG6A 1M6JA 4MY8A 4K1WA 3ZIZA 3R0UA 3QSRA 4UNIA 4G7FA 3UCDA 4YTRA 4GVIA 3ARSA 4Q4SA 1OK6A 4TXEA 3U2ZA 4KW2A 1FWSA 4KCVA 5HMFA 4ERIA 2VX4A 3G1FA 3HGOA 2J9YA 4GI9A 2WHMA 5HOSA 5XIMA 1HGWA 1P6WA 1EX5A 1BGGA 2HZGA 2JF6A 2A85A 1BKSA 1W32A 1V6VA 1A0CA 4AWUA 1XBVA 4DXKA 7REQA 4S3KA 3IACA 1NFGA 1BF2A 3FIGA 1K7FA 2ISFA 3HBLA 3C4UA 5FJUA 4ICMA 3GY1A 3PBWA 4NNAA 2X0SA 3FW6A 1IYXA 1I2PA 2QMJA 2H3BA 4K36A 4ADUA 3VE7A 4JTCA 2B31A 1MFVA 3VILA 4DJFC 1LUCB 2EJ1A 2UBPC 4WXYA 4K7VA 5DY3A 3K5XA 2HS6A 3N6JA 1I9CB 2QUNA 4DLFA 3N15A 4QG9A 4Y90A 3CMGA 1LBLA 3VC6A 2VOMA 2DZTA 3DAQA 5CAKA 5CAHA 1JNEA 4IUGA 3MW7A 2A79A 4UOZA 3P14A 4IICA 3BAJA 3VIPA 2J6XA 1UQZA 3VAVA 4C6DA 4ZXOA 4IFOA 3RMEA 3B9NA 1OVDA 4KQNA 3LHTA 1NOWA 2CBVA 3EDFA 4O0KA 3NXFA 4F79A 1H49A 3USBA 2ABBA 3W74A 1TJ1A 1HGYA 3KLLA 1Q2SA 2PU1A 1MQQA 5EYWA 1TA3A 3GDBA 3D3AA 3LK6A 3W07A 1ME8A 2JF7A 2E5CA 4ML4A 1HJXA 1UR2A 1DIDA 3IVSA 4W7VA 4HK5A 5F2IA 2BLEA 3WD1A 3M16A 3A3WA 2XIMA 3ARVA 4CCEA 1AZ2A 2A3HA 4JIRA 1Q63A 2IMRA 3QPZA 4R85A 3SAZA 5F1UA 3OJGA 1UBPC 3BL3A 4WZHA 4O1BA 3IUHA 4LV9A 2PD9A 4O0QA 5CPNA 3FHAA 4JY8A 1EBGA 4FX6M 3IIPA 1KCLA 3LG3A 1AMKA 3UNTA 3W82A 1DIKA 3UR7A 1G7UA 3CPUA 1V51A 3N18A 1PJ9A 4EP8C 1JL8A 2OZ0A 4Z2LA 1ZJHA 4PE8A 2ACUA 3O0KA 4MB3A 3EXRA 2ZUVA 1RLDA 7XIMA 2QF7A 3ZVIA 4L6DA 3TC6A 2PWDA 4MNLA 3U3HA 3VOIA 1QDSA 3IGSA 4TO8A 1PX3A 2QULA 2QUMA 2VC7A 4MTVA 3LCFA 4EX4A 4TMCA 2CCRA 2D3LA 3M0MA 3GG1A 2JKAA 5DCDA 4K8GA 4EXBA 1PSCA 5IOBA 3RDKA 3ALGA 5AC8A 2YXXA 2OWCA 4CEUC 2VFDA 1PIGA 1W1YA 4AYGA 3SDOA 3HPAA 3G3DA 2WB5A 3WLPA 4M80A 3HQNA 2QLYA 1NQ6A 3RUBL 3KBSA 1XCFA 3CIVA 1UQYA 2Z2BA 1HVXA 3F5KA 4KEVA 3TKFA 3E96A 4JTJA 2EPKX 1Z44A 3DU0A 2V69A 2WZTA 1CI1A 4HMCA 4OT7A 2AGKA 3TFXA 5A2CA 2OOGA 2QUTA 3KBVA 2WJEA 4EIVA 4H7ZA 4MUZA 2F7FA 2WCAA 1B3XA 1IT8A 3H4XA 2LLEA 1MNSA 4J3ZA 4KT2A 2J24A 2BWGA 1W1ZA 1VBHA 3R8RA 4GD0A 1B0IA 1JG9A 3RLHA 3BJTA 2V2HA 4GH1A 3SGGA 4GO8A 4DUWA 1V7AA 4MYAA 2UWFA 4GACA 2IQDA 1EP2A 2VZUA 4JIHA 1RK6A 4UQEA 2ZBTA 4J35A 1R3QA 1Y7VA 1I1WA 2DFAA 1KWGA 3E2RA 2CETA 3KAOA 4PB5A 1Y5WA 1FP8A 5CGTA 2XPKA 5ABGA 3H2AA 2RKXA 3UYIA 1E0WA 4FNRA 1ECEA 2YL6A 2ZZ3A 2VI0A 4YIWA 1TJPA 3KWXA 1ZLPA 4ZGYA 3SN0A 2QCFA 1WAUA 4JTHA 4UFLA 3HIJA 1CEOA 5TAOA 3BO9A 1IGWA 2GGEA 3NYDA 3W73A 4GC4A 2QJMA 3IJ7A 1BXCA 1W9XA 1OCQA 3T6CA 3QMSA 4JTLA 4XTIA 5HMEA 1RCXB 1SO6A 4RPPA 4GCAA 5BOEA 1EF2A 1LLZA 2F38A 1TWWA 4LAZA 3MUAA 3UJFA 2QQ6A 1RBAA 3QKEA 4HIBA 3URAA 2NX1A 3MQTA 1FDZA 4GNVA 5HUPA 2OLAA 3OGVA 2OX4A 2DZUA 2PSNA 4PSPA 1XJBA 1OYBA 1GZGA 1ZGDA 1Q6CA 3N9KA 3AXXA 1UP3A 3VCRA 2GVYA 3LCGA 1PX8A 3ZQ9A 4GKTA 3BJFA 2HNEA 1R3WA 3QPEA 3RCYA 1EJTC 1HQTA 4OE7A 4O1CA 2FHBA 3FEMA 3ZR6A 1YRRA 2CLLA 3FV9A 2RJHA 3P0XA 3GE7A 4JIQA 5KEZA 4DWSC 3FNDA 1GOMA 1POKA 3CUIA 3M64A 5JIWA 2H8ZA 3MB9A 2BGQA 3AO0A 4NAEA 4R34A 4Z2JA 3IANA 4JFSA 3KBNA 3B0VC 3AUOA 3GTNA 2WHJA 2X2GA 4F2TA 2E5BA 4X60A 2A3EA 2Y62A 2E1DA 2ZVIA 1E1CB 1NELA 3DC8A 1BWLA 4AHQA 1W56A 1IIHA 1Q8AA 1VENA 3ZXWA 3W4RA 1GTEA 4MOZA 2XVKA 3VVGA 4AD0A 4D6CA 3GZ3A 1RCOB 2VQUA 3RLGA 1R5YA 3AHTA 2G8ZA 3BQ6A 1F07A 1V02A 5CLTA 3VD7A 1DIOA 5ABEA 2CKRA 3CUGA 4MKVA 2ACQA 3O6AA 3ICJA 1SM9A 1TPDA 1GZ1A 3T4WA 2E9LA 1US0A 1FWEC 2GJNA 3N17A 5A6BD 1X8FA 2VZTA 2PZ0A 4GBUA 5GJMA 2DP3A 4XVEA 5HMDA 3IAPA 2ZA2A 3T05A 3ZM8A 1D7FA 3ZSSA 9XIMA 1GEQA 4C6JA 1RVKA 3A5FA 4KCUA 4DQWA 2PWGA 2H6RA 5G2IA 2QCCA 1OZMA 4AZBA 5HPOA 3LHYA 1OINA 2FZNA 2PTDA 3BZGA 3LTYA 3LQLA 1IQ8A 4X0NA 4NJHA 3RX3A 3PFRA 3L4WA 1SJBA 2PDNA 3SRKA 3T7VA 1TREA 2E6YA 2XFRA 1SYTA 3CQJA 5EMYA 3KCJA 3TTOA 2DW7A 3RO6A 3SFKA 4GX8A 3F5LA 3WUFA 3AQUA 1H50A 2D69A 3G0XA 4ZSTA 3EOUA 3ZJ8A 4AD4A 4DNMA 4FS9A 4AIUA 1G4TA 5FKYA 3T0AA 3G77A 1QOPA 3ISIX 1ODUA 2ZOXA 1UPPA 3FJ6A 3AUJA 4CU7A 1KM3A 3EEGA 1BVNP 1TQXA 3STEA 1T41A 3WEZA 3D6NA 2PDJA 2PRMA 2GL5A 2WPBA 9RUBA 2A5HA 4O1AA 1FXPA 2YJQA 2PMQA 2Z4GA 2INZA 1YXDA 2ABAA 3K1DA 2J25A 4PUMA 2OR2A 3WJYA 3VCNA 3FK4A 1KC7A 3OG3A 3VO0A 3TZNA 2Y61A 2JIEA 2ZC1A 1OABA 3OOQA 4UZUA 4ZQCA 3MUZ1 5GVJA 3E12A 4GXMA 1C8XA 3DC0A 3VNIA 1CIUA 3FSTA 1JDEA 4R7OA 4IMFA 4ZSUA 4AZCB 2WNZA 4FF5A 2G95A 4DJFD 1GKQA 3PSWA 3G8RA 1M9HA 6TIMA 4Q8OA 4O8AA 3S83A 3NPVA 3GNOA 1K8ZA 4BF5A 2E25A 4Q7NA 3CIXA 4PBGA 3SY5A 3UZ5A 1V3IA 5C7HA 1AH4A 2D3NA 3CL6A 3GIYA 1BHGA 3ARQA 2QCMA 4QLLA 1EEXA 3H26A 3PUDA 5FI8A 4EWJA 3CAVA 4ZTXA 3C52A 3OQ8A 3DENA 4IFKB 2AQOA 2J8GA 2ZRVA 3WJXA 1F3EA 3CTLA 1O95A 1FWNA 2Z28A 3H70A 2W79A 3UA4A 4HT3A 2GSEA 4GQ0A 2CLMA 2H90A 3BG9A 1TE6A 8CGTA 5HULA 2CLPA 3U2CA 3SN1A 2ASHA 1P7TB 1RD5A 3MO4A 2OLHA 1EGVA 4AY7A 1UYQA 4ORIA 4ATDA 3W6LA 4FF7A 4MZ1A 1YNYA 5BOFA 2QCEA 1DQXA 4JTTA 1VD6A 1AL8A 3N12A 2OGJA 3K30A 4NZJA 4X3ZA 4V1YA 3OQEA 5F2MA 2PRLA 3CZLA 4GYFA 4Q4MA 2E40A 1UD6A 3M9YA 2X05A 1KB3A 4RLIA 3TTQA 3I7RA 3LHUA 1J2BA 2QS8A 1GOQA 5CC7A 1AQ0A 3TAKA 4AH7A 3SUWA 4LVFA 3R25A 3A13A 3CYJA 1J5TA 3S6DA 3MI3A 1QPNA 3BUVA 3WQPA 3ZMRA 3PF3A 1KFEA 1VFTA 4KETA 4JN8A 1QT1A 3BAYA 1XH1A 3QOMA 2IPWA 1OGBA 1AW1A 3AMCA 3KOFA 2GDVA 2ZX6A 1D3GA 2OSWA 3DN5A 5JIPA 4J2PA 1F6YA 3KS6A 3FY1A 1GG1A 1NH6A 3RYSA 3REQB 4CD5A 1Q5MA 3KFTA 1QI4A 4AX7A 4GIYA 2BVYA 4ZOBA 3WY1A 3QMRA 5G5IA 1QO2A 4AEEA 4ZOCA 2VFIA 4YTQA 1CW2A 4PA8A 4HSNA 4M6VA 1Q7MA 2IPGA 2BDQA 4PCNA 1E6ZA 3KDOA 2YDRA 3UY7A 5LYRA 2HBXA 2A2IA 1KM2A 4HU8A 2WSYA 2R94A 1KBKA 3GAKA 1QWGA 5K9CA 2IPJA 4EXAA 3K4AA 3MKCA 4WDXA 1B90A 4JNMA 3PC0A 3S5OA 2XSXA 5BXPA 1WO2A 3P84A 4O16A 4KF1A 5FSEC 2H9AB 2GPTA 3NAVA 2ISDA 5LA0A 3MP5A 3PBYA 4HA3A 4CQDA 1KR0A 3E2VA 4PH6A 4CVWA 3CYVA 1UWTA 4ACZA 4O19A 4PUWA 1KCKA 1MDLA 2ZZ5A 1OQFA 2EPOA 1K8CA 3NVDA 3APTA 1RZMA 3SBFA 1M3UA 3VI2A 3DGBA 1XC6A 2CYGA 3FN9A 1ISYA 1VS1A 3THQA 3PTQA 3AXIA 3RCMA 4DAIA 2ZKMX 3W88A 5BXRA 3UZWA 1IEWA 4B92A 4S2BA 1TELA 2C15A 3R10A 3KLKA 2PGEA 2QJGA 4O15A 5DY2A 1XR2A 3FS2A 1AD1A 3SSZA 2OSYA 1A0EA 3GXIA 1J0ZA 1KRAC 3A3HA 1ISWA 2X0HA 3GNRA 3WH5A 3D47A 4Q8PA 1A5MC 5D9NA 3V1HA 3ZR4A 4KWOA 3N2BA 3WUGA 1C8QA 3CWOX 3EZ4A 2AGTA 4XD6A 4J3VA 1HKVA 3AU2A 1GVYA 2QZRA 1K9DA 2VC9A 3W71A 5DT5A 2Z1XA 3WF1A 3VDHA 2R1NA 3O05A 3GD6A 4XZWA 1AW2A 4C1LA 4KEUA 1QATA 5PTDA 1LT7A 3UWVA 2TAAA 1ZFJA 3NXLA 4H9TA 4TVUA 3VTRA 5CBIA 1DIEA 4IX0A 1ZL1A 1JJKA 4F0RA 4I8YA 4WRHA 3GVGA 4W9TA 1BGAA 1W0MA 1PO9A 2P8BA 1E0VA 2UV8G 5HR7A 3W7OA 3G24A 2G3IA 3PAJA 6CGTA 3WF0A 4JIPA 1OFRA 4GI8A 4NZ5A 3UWQA 2Q71A 4G7EA 4JXCA 1B3ZA 1NTHA 5CH9A 3SB0A 1DWJM 3TXVA 4DWSD 4U4MA 3QPYA 1TV5A 4K39A 4U28A 1POJA 4QDWA 3TSDA 3I7QA 2HPIA 2QUVA 4JQ1A 1W3KA 3ZJKA 3CWHA 1Q66A 5ABTA 2BY3A 2Q8ZA 5BW6A 3V4BA 1SJDA 2DT1A 3Q45A 3OBKA 1QW7A 4HZ6A 1SZNA 3IGXA 2CW6A 1Q65A 3VZYA 1F3TA 5DMMA 3CGTA 1EC8A 4OBTA 1DP0A 4D8LA 1ZPTA 1GK8A 2E4TA 5EU9A 3VFCA 2VUYA 4HCHA 5I3JA 5HUOA 3S2NA 1Z69A 5FF7A 4K8EA 4ACZB 5CC3A 1JPKA 1XPGA 3ZT5A 1TIWA 3N2OA 4ZQNA 4WDUA 2JIWA 1C7SA 1I1XA 5AY7A 3HA1A 5I3HA 2F2KA 2KAUC 2W3ZA 3LTPA 4I5XA 5LNRA 3LBOA 4UTTC 3VMOA 1NWRA 3CUHA 2OB3A 1GQLA 3GTFA 5G2WA 2WSRA 5FL0A 4Q33A 5EBAA 3TCSA 4X9SA 4R5EA 5AFDA 4A3QA 5EA9A 1ADSA 1RPKA 3W85A 2V3FA 1GQNA 4C1KA 4MUPA 1VCVA 1E71M 4GUGA 2G50A 2NQZA 2VL4A 1EB3A 5A8MA 2VCAA 2PURA 2EQDA 3AYTA 3G8EA 4YWIA 1GONA 2DIJA 2Y8VA 2X40A 4YS1A 3BOFA 2CLFA 4YTSA 3GM8A 2GQAA 3OG2A 3UR8A 1IR1A 2YGYA 3WUEA 4AG0A 4LEFA 3UVAA 1B3YA 4HN4A 3WH8A 4JX5A 5M1TA 2PWHA 2J7DA 3CT7A 4HVXA 4H6RA 3IK4A 4CU8A 5T9BG 1WDQA 3LQGA 2ZUMA 2QGHA 3GK0A 3TW6A 1UR0A 3L68A 1QO5A 3VZZA 1Q6GA 2WSQA 3RF9A 3VC5A 1AQFA 1CGYA 1LZOA 1L6YA 4WDWA 1W3TA 1G4SA 3V7PA 5I3FA 2BGSA 2ALDA 4YWSA 3EA3A 4RW5A 2QCNA 3W2JA 3WNMA 4X61A 2DSWA 1Q13A 4OTKA 1W1B1 2CITA 2OZ3A 2XIOA 1BSLA 4PTVA 1TV3A 1F2JA 2E68A 2Z7GA 3S2LA 3CQIA 3SO7A 2A21A 2R1LA 3THDA 4ADTA 1VYSX 3SCQA 5EKYA 3W1XA 3SZ8A 5KMYA 3W25A 3TNBA 4BQ2A 1NJJA 2J77A 5CJNA 3M5ZA 4UBPC 3TX9A 1IEQA 1EHAA 4AYSA 4J1OA 1UUMA 2WOQA 4Q3MA 5DF0A 4HMEA 1VAHA 1SJAA 2P53A 4UQDA 3I65A 5JU6A 3LLDA 5LA1A 2EG7A 4KGJA 4U5KA 4D8AA 2DSVA 2JK2A 3GXDA 1UA7A 2FZBA 5D2TA 2W61A 1JXJA 1E70M 2NX9A 3VU2A 3N34A 1U1JA 1B9BA 3LHZA 2Y2WA 1IXOA 2YCJA 1DV7A 2AL2A 4HMNA 3B04A 1UA3A 1WKDA 2HS8A 1YDOA 3ZZ1A 3PHAA 1KXTA 4CQCA 3HMJG 1LRQA 4D6IA 4WY0A 4B15A 3NVTA 3WIJA 3BGGA 4TR9A 2X7WA 4LEQA 1JVNA 3M6DA 3ZJ6A 2RDXA 3TOPA 2DVTA 1TRIA 3QV8A 2BVWA 2GUYA 4CVUA 4OWGA 1GVRA 3AU6A 3W2MA 3TK7A 1VBRA 1TPWA 3SCPA 1BAGA 1F05A 3VA8A 3H2NA 3SQLA 1OFQA 1OGGA 2NWRA 4FLRA 3LRMA 2X7VA 3I3DA 4LV4A 2OQHA 2X42A 3WLIA 2NT1A 5HJYA 5D2WA 3L4UA 1YPIA 4DY1A 3HV9A 1GOXA 3DFHA 1D8WA 5EPDA 2CZEA 1YHTA 4IHCA 2OT1A 1HP4A 1W9BM 2ESCA 3VKAA 5L9FA 5I7GA 4MADA 4WOQA 4XZHA 1OC6A 4JIIX 5IBXC 3GFYA 4DBWA 3ITLA 2Y1HA 1E51A 3T40A 1K3UA 2VCCA 1W3HA 4LCSA 2O56A 3STGA 1TPFA 5I2UA 2YL9A 1JQVA 2W66A 3CZGA 3EB2A 3TW9A 3PZIA 1HG3A 1PKYA 4LF2A 3EWBX 3M0VA 3KL0A 4H9UA 3W28A 1SW3A 2QVHA 6TAAA 3V75A 3U6WA 1KV8A 1LLWA 4AUBA 5SWUA 5C55A 1GWJA 3LI0A 1W3IA 3BOXA 1CPUA 2C91A 3EKZA 4UFIA 2HV5A 3WQOA 2E67A 3C56A 1B1YA 3JU2A 3OYXA 4H9MA 5IDZA 4MB4A 3VIKA 3WD0A 4FOKA 5CGQA 3E0IA 1Q7QA 5JMUA 1E4LA 3MP3A 1MEHA 5H8MA 2VR4A 3UD6A 1DEDA 2EXOA 1Q3NA 4UFMA 5EB8A 3KWSA 3O0FA 3BXWA 1BVZA 4Z1YA 3IV3A 4HCLA 2VVSA 2V5LA 2VFGA 4JTDA 1NDYA 3NTYA 1FFRA 1GW1A 1J11A 1DE5A 1P6CA 1QCWA 3NZQA 2X1TA 2OVLA 1N8FA 1N7KA 3C3UA 1XWYA 4AWEA 5BU6A 3ARWA 2WSKA 2Z2AA 4XZLX 3B0YA 1V6WA 3EYPA 2NW0A 1MW2A 3N1AA 5A6KA 3BAIA 3ENLA 4IJBA 3RRAA 1MQRA 4OV9A 3AI0A 3IIOA 2DSKA 3NZRA 3NEVA 1XGZA 4O8RA 3LD5A 3W1UA 2O7QA 4WY0B 1UPMB 3TWAA 3UA3A 3O6YX 3LOTA 1T5AA 1WZAA 3G1RA 1ME9A 3Q37A 3DBPA 1LP6A 3UPBA 3KTCA 3WNLA 1O5QA 4C6FA 1LORA 3OVGA 1G4EA 4J9JA 2NV9A 1LROA 4WVXA 3VIHA 1V3LA 2NV2A 2R82A 2J8TA 4CQAA 2OYMA 4Z2HA 4QSHA 1XLCA 4A29A 4UTJA 4RDVA 4JS3A 4PYSA 2X1SA 2RAGA 3DBNA 3GBDA 2IKIA 1FH8A 5D05A 2CHNA 1PE1A 5ABFA 4AIBA 4CNOA 3W1PA 3QJAA 2VGBA 3K13A 1H4PA 1R0MA 4QROA 3M0LA 2ZRXA 1ADDA 3DYMA 4MZYA 1LWIA 3KHDA 2DV0A 3G1HA 3WKZA 5CZ0A 1RP8A 1VCFA 4KMQA 1VBGA 1DPMA 4RJEA 3KE0A 1E1EA 1XH0A 1S2CA 4FNUA 3I3EA 1MW1A 3XINA 5H91A 1UKSA 4DLMA 3GVRA 3CBWA 1GKPA 3W7LA 1WV2A 4ERGA 2WYSA 4CD8A 1HXJA 2PDIA 3GBEA 2INEA 2D1ZA 1X6NA 1Y8BA 4Y9MA 3WLNA 3GFXA 4DPPA 3O07A 3P5ZA 4I9AA 2WBGA 5CG7A 3E49A 4R9OA 1A4LA 1YPFA 3AZSA 4FZIA 5F1VA 4A8LA 2DT2A 3MYOA 2XH7A 3UCQA 5GNXA 3GU1A 3TQPA 1A5OC 3TQKA 1VFOA 3B8IA 1FFQA 5LHEA 1RHCA 3HPSA 3B05A 3AWOA 3Q65A 4RE2A 1EJWC 4LTSA 3EWZA 5EY5A 3B8UA 3T09A 2QCDA 1UH4A 5A2AA 4DJFA 3M41A 2BTMA 4NT0A 2WLYA 3GHUA 1W5NA 3EWDA 2PD5A 1X6LA 3TTSA 3TMLA 3W84A 3R11A 1B3OA 3GYCA 3WO8A 3DHUA 3F4DA 3HQOA 5KETA 5LNWA 4MYXA 2YFOA 3N3TA 1MFUA 2OFJA 1R9ZA 1JFHA 2P8CA 3IJ6A 3ZOAA 4NZ1A 3WK3A 1BTMA 3IVTA 3O8AA 4CN1A 1P1MA 3HG4A 4OVXA 4QE4A 4UTIA 9CGTA 3A4WA 2D23A 4GA8A 1Y65A 4IXHA 4PMNA 3INPA 3WK1A 1S5TA 1TPEA 3O9NA 4FX8A 4A4AA 2V63A 3LXBA 4CD7A 2PDGA 3WQ5A 1B4KA 3WH7A 1WDSA 3AZRA 1GW9A 4G1NA 2VNCA 4QP0A 1VBJA 4ZTYA 3F4VA 1TVPA 4GG9A 4WF7A 4PTMA 5FACA 2FB2A 1LG1A 3VGEA 4WKAA 4XZ9A 3SUSA 4HU0A 1IHIA 3W27A 2FPYA 1ZP3A 3AIQA 1NWUA 4A8NA 1XYZA 3TC3A 1R6WA 1L2UA 3MCMA 3NIYA 4YNGA 1REQB 1LQ0A 1O4UA 1EC9A 1JEZA 2RUSA 3GH7A 4L5ZA 1JAEA 2B7PA 1OX4A 3C0SA 3TVAA 2ZZ4A 3ANVA 1OY0A 3A9IA 4D1IA 1W9PA 1GNXA 2O9TA 3VNYA 2WMHA 3OLGA 4EF8A 3C86A 1MWOA 3QR0A 3W02A 2JQXA 1KGWA 2A7PA 1E73M 3QHOA 1A3XA 4RK8A 1Z48A 4MM1A 2Y24A 4OJYA 3CHEA 3W26A 4J3XA 3K8LA 3MBDA 4TVDA 4JTIA 5MKGB 3VOHA 4L6HA 4JHMA 4N6EA 1N8IA 1E5NA 1MW0A 3OZPA 3R58A 3L23A 3PZQA 3LZ5A 2ZTKA 3H24A 4C65A 2HMCA 1S2VA 1NVMA 2TYSA 2HROA 3AXMA 3FFSA 2UY2A 1WNOA 2ZVRA 4ZBCA 2O55A 3GXNA 3RXZA 3S6OA 4NJJA 1I2OA 1MI3A 3UZZA 2JKEA 2V2CA 2XFFA 3ABZA 4MLJA 2CLIA 2R1MA 1OX5A 1YXCA 1XLFA 2B0MA 3ARRA 1P1XA 3QMTA 1FWTA 2D0HA 2A6NA 1PAMA 5A8QA 1VRXA 2YIHA 2YDAA 3VNDA 3CO4A 1A47A 3V5CA 4FPSA 1XIBA 4I7UA 2QCGA 1DXFA 1WPCA 2QCDB 4TTUA 4YPJA 2DPEA 4GI6A 3ITYA 2HE8A 1A5NC 2R1PA 2DZPA 3BG5A 4PUJA 3DFTA 3ERPA 2JBMA 1OFEA 2J62A 3FKKA 6ALDA 2G3FA 3MHUA 1UP2A 3MKVA 5F2GA 3HPFA 1QHOA 3MV01 1VEMA 4A2RA 1EEPA 1WBJA 4MJZA 3GWQA 5D9MA 1W54A 4QQUA 3P7YA 3V18A 3W72A 1GG0A 2OWWA 3N9SA 4O10A 4QJ4B 1QNOA 4CGTA 2V9DA 4AVOA 3PUEA 1N82A 2OOFA 4HOWA 1ITCA 1HO1A 3JS3A 4FIQA 4JQ2A 4KS0A 3SIMA 1K9FA 1HW6A 4GQQA 1FCBA 5I03A 1IT0A 1H1ZA 2VEFA 3P67A 4GJIA 4JR5A 3PJWA 1FWCC 3OZOA 1YTEA 5LNSA 5I3IA 3QRHA 4UFHA 1KRCC 2G3MA 3KVMA 4HOZA 2A7NA 1BWVA 3FLUA 5A69A 5FF2A 2W62A 1H60A 1PDZA 5DLCA 1FHDA 3VCCA 4I5RA 5HR6A 5FESA 2NXGA 5M3WA 4ZXLA 2QNEA 3L4VA 1J6OA 4I6KA 4NNCA 5HBFA 4NZFA 4YU1A 5BRBA 4O28A 2V2DA 4WKHA 1O6IA 2J78A 2WBKA 1PV8A 1YIXA 1SPQA 1OX4B 4FB7A 1YMYA 2CHOA 4I6VA 3BCJA 1AZ1A 3A12A 1XICA 3MVTA 4LPCA 3OLDA 1XINA 1I4NA 4DIAA 2WHLA 3A24A 4GYKA 4HZ8A 2BXYA 1Q6FA 1ALDA 5CSYA 1NFPA 1PYFA 5BROA 3C0JA 4LYQA 4HHHA 3MHGA 2BX7A 4HK6A 3OVPA 4C6MA 1HN1A 3M0XA 4WSKA 5AC4A 1J10A 1TWZA 4UMBA 1H3GA 1DWAM 3KTXA 4J3WA 4JYEA 5ABHA 2BS9A 3TJ4A 2PTXA 4IIEA 4MSSA 2PDPA 4IGNA 3SRHA 4LB4A 3CQKA 4TQTA 1EDQA 2D73A 1QUMA 2WKLA 3NDOA 3NQVA 1HKMA 2PF0A 1AG1O 2Z6IA 5XIAA 1MDRA 2PDBA 3HQ1A 1ZTVA 4O1EA 2NLYA 5AZ1A 1DJYA 3ES8A 2VDHA 2J66A 2WAGA 3R7MA 3RILA 1LT8A 1OF6A 3W1NA 1XLBA 3TAOA 4C90A 2W91A 4Z2KA 3UYCA 1T0OA 2QV4A 4JTQA 4XZIA 4NX0A 4K8HA 3L67A 1EPVA 1HZYA 1QPQA 2EO7A 3G1YA 1U1UA 2PGWA 2PWUA 3W1QA 4DJEA 4ZL1A 3UQNA 4JKKA 1ISXA 1TIMA 5TD4A 1GVQA 2J7EA 4QGCA 4W8BA 3NL5A 3E3HA 3CEPA 5D8ZA 4LYPA 3VIMA 2I56A 3WQ4A 1L6WA 5FJPA 1XRTA 2GGGA 3AIBA 4KCWA 1CXEA 1XDLA 1FWWA 1TX2A 4PUKA 4UOQA 3VIJA 1Z6KA 4PUDA 1S38A 1OD8A 1M03A 2XHYA 4Q4RA 2B7NA 1ENUA 4B5WA 1SSDA 2GJLA 1EXBA 2OU4A 4CN6A 1VEOA 1BG4A 1GOIA 3B8VA 3FYOA 1OG0A 5TNVA 5BNKA 3UXDA 3SUTA 3QYSA 3ZLHA 4A35A 4LUTA 3BLEA 2CIPA 1A5BA 3PBGA 1V3MA 4MDPA 4JZ5A 3KRBA 2BSLA 3HMCA 4GC3A 1QTWA 2B7OA 2FH8A 1UWRA 3QV9A 3GO2A 4UCGA 5FJRA 1K7XA 1HX0A 2BASA 5E5CA 4B3KA 5FF3A 3LHWA 1QOQA 2DJXA 3IEBA 5HNRA 1YDYA 4GWEA 5F4XA 3W81A 2J7HA 4AZ6A 1VR6A 4N9EA 4M19A 4GVGA 4B5TA 4J4KA 2D2HA 3R2GA 3RK8A 3MC5A 4HNCA 4KESA 4ADSA 2CLOA 4IQLA 3U9IA 4B3LA 3SEPA 3BAKA 3F2BA 1YTDA 4NHVA 4A3UA 4E2OA 3LMYA 4PMDA 2YCKX 3WENA 4G1KA 4J7RA 4S3CA 4INFA 4OZOA 2GLKA 3T0BA 5BRQA 2FGZA 2WC7A 3ZT7A 4LS1A 3L2LA 1KM6A 3W1MA 3P2VA 4IQJA 2JGYA 2NVDA 3CPGA 5EGRA 2VKZG 2VENA 4DWSB 1KLZA 3GVVA 3S2CA 5CZKA 3UGVA 4YCPA 5A6TC 2V3DA 4QNEA 1KTNA 1DXEA 1HVQA 1RV8A 1TV4A 5AYZA 1KKRA 1ZCCA 4DUXA 3UGRA 4AW7A 4J5NA 2P1FA 2QDDA 3VABA 1U2YA 5I5RA 4O13A 1NU5A 4NVTA 1VLIA 4RNIA 4AX6A 4NX5A 4ZFMA 1FTXA 3MMDA 4WGHA 2OEMA 2X09A 1FWDC 5LGZA 4GIRA 4M7SA 3N25A 4S3BA 2Z7KA 4PULA 5DCEA 4IFRA 1AQHA 4IG2A 2DZAA 4L6OA 1Q4NX 2P5NA 1W8GA 4N6FA 4LCRA 1XLLA 4A21A 1TJ2A 2WMIA 3BLOA 1BQGA 3NOYA 3WMLA 5DMNA 3NM1A 4LFYA 4MNJA 3OGSA 2QYGA 1TMLA 2C13A 3VGBA 4PRRA 2DGAA 2QXWA 4JCMA 3AYVA 4HHMA 3WNKA 4U5IA 5C6MA 5KZ6A 2YA2A 2CLHA 1E3ZA 1ESWA 4I7WA 4OIFA 3PANA 3EOSA 1SO3A 2PFHA 5E9XA 3W86A 1Q6LA 1FWFC 1LYXA 2D2GA 4MF4A 4AD1A 2Z29A 4FOJA 4C6OA 1F8IA 3EEZA 1GJWA 3LCHA 2PUZA 4A8IA 3OW1A 1V03A 3LSCA 1UUOA 4JNZA 3S42A 5A6SA 1A50A 3IIXA 2XGIA 3RHGA 4FP1A 1TZ7A 2Q3OA 1GVOA 3PUGA 3V0SA 3KM8A 1EH9A 1N55A 4UQCA 1BYAA 1DJNA 3TU9A 3CU2A 4JAWA 3SCUA 3C0LA 2XIIA 2ICSA 1JD7A 1VQTA 2ZIDA 4XAPA 4D6DA 3C3NA 4V2XA 3KOWA 1S5VA 3LPGA 4ROQA 2BXZA 1FP9A 1N8WA 2GDQA 4W4QA 1ZCOA 3WDHA 4DXVA 1MQPA 2C1IA 1WA3A 3W7KA 1XKJA 2FGBA 1L8NA 4HJFA 4W88A 3G3MA 3QQWA 3LHVA 3UY8A 1NF7A 4H6EA 3JRKA 1R86A 3FA5A 4UIOA 4H9ZA 3D46A 3DOPA 4YVVA 1OADA 3B8WA 3TYBA 3MSGA 4XAYA 5G1YA 5LIKX 2EPHA 4NU7A 5AYXA 3VIFA 1Q6QA 1XDMA 4IIFA 3W2NA 3WJSA 4JEJA 1GQJA 2J4GA 3FXYA 4F40A 3DEQA 3M5XA 1YADA 3HV8A 1VEPA 3W7PA 4ZE5A 2Q01A 1OM0A 2XN2A 4DUOA 3WFZA 2YCLA 4ZOAA 2ZE0A 4DBSA 3VD3A 3POHA 3H8AA 3CAWA 1EIXA 4JDYA 3CV2A 3OB8A 4QG8A 3VIOA 3AS3A 1XDJA 4FEZA 4H9YA 2XG9A 3POCA 1UP0A 4NNBA 4KBXA 2YX0A 1M41A 1FWRA 3QC3A 4J3SA 2DVUA 3R0DA 4FI4A 4Z0JA 2NT0A 2WMIB 3L5LA 1W3JA 4IPPA 3W1AA 4KEZA 2GUBA 1UCWA 1BWKA 2PCEA 3O6DA 3W7CA 3L2MA 2ZA3A 4BQ3A 2NQ5A 4L7ZA 2VM8A 2OEJA 1ZBVA 3BARA 4U10A 1S2WA 1OT1A 3UJEA 1CX9A 1OFOA 1C8YA 1AODA 1I2RA 1ICSA 1CCWB 3U5UA 4ZB2A 3VOJA 3GR4A 1Z3NA 2PWEA 2HK1A 5HXMA 3C2RA 2ISVA 5L6UA 2PDQA 2OJPA 1DWGM 4Z42C 2A3CA 2GJXB 2PZNA 2NQ9A 3QV6A 4IIHA 2XVLA 3GTXA 2PEVA 4QAWA 1V8EA 5FEXA 1HFBA 3CV7A 1KFJA 3SECA 1KCXA 2CZDA 5IM51 4JQAA 4QFUA 3H4WA 3MYPA 2G4FA 1MEWA 3SCSA 4K68A 4LVBA 4QRNA 4HNNA 5AVHA 4EACA 3ARZA 4OECA 4NYUA 1M7PA 4AY8A 4BR1A 5FF0A 1KXQA 1TPC1 1X38A 4WGXA 2J8FA 5BOOA 3PPCA 2QGYA 3OZMA 5IHRA 1A3HA 3NQAA 1O7AA 3WF2A 2O9RA 3L4YA 4KIEA 5A95A 1ZJBA 2WV8A 2OODA 3MO7A 5CPMA 5C2XA 3AOFA 1HJSA 1VRDA 2FFCA 3N3MA 3FXGA 1BRLB 5A6MA 1SQ7A 1OCBA 1RQEA 2FIQA 3PWGA 5FD0A 3U48A 3C5QA 1Z32X 3DZ1A 2RJGA 2YCIX 1EO5A 4LBUA 3CM4A 3W1TA 3KDNA 5H2ZA 2NQJA 2WKGA 2C6QA 1IZKA 1E4MM 1AJ2A 2G96A 3OPSA 3T42A 3OVQA 3WQDA 3UETA 3WBXA 4RDWA 2XZ9A 4KFOA 3UXIA 4GKLA 3W7QA 4QTGA 4GINA 5I79A 1S3HA 3OVRA 4L9XA 3CHVA 1LDCA 3GW3A 1RR2A 1CTNA 4LUIA 1W9DM 1A53A 2E6FA 3AC0A 3CHCA 1QOXA 4N4PA 3GFZA 1HKWA 4G9PA 1K6AA 3P8JA 2VQTA 2FVMA 4DF2A 4GYPC 5J8LA 4K3ZA 5JUVA 3T4CA 5CPQA 4UTTA 4GZEA 4AZHA 1EQPA 1V5XA 3MUCA 4PUUA 1MUCA 3EOLA 5D09A 4RCXA 1U33A 5DRIA 2IKGA 5KSWA 4QDPA 2IKJA 3F2DA 1C91A 3ZO9A 2PA6A 1FVPA 1OZQA 3KX6A 4C7GA 4I9MA 5CXPA 3WQVA 4IT1A 1HKJA 2G37A 1QU4A 2YOCA 4DM1A 1PHWA 1CGWA 2DU2A 4PZVA 4O14A 3N2TA 1VZWA 2WMGA 5F4SA 2TODA 4RW3A 2V30A 3IPWA 1W37A 3M46A 3QR1A 1QAPA 2VR2A 1DVJA 3TLQA 4FOUA 1EZWA 1C8VA 3GXTA 2YA0A 2YFNA 1XISA 3H7UA 4NL1A 4DBEA 4KCTA 1KFBA 2DQXA 1K1DA 4AF0B 1FUYA 2R14A 2YXGA 1V6YA 2VX6A 2XVNA 1TCDA 2OZ8A 3BJSA 2ZWZA 1HF6A 4CCDA 1UC5A 3CJPA 3EX3A 3N13A 5FCZA 4GLEA 3SJ3A 1AK5A 5DEZA 1PL9A 1I2QA 1QXLA 3TDFA 5F4WA 2BG5A 4XD5A 2VXNA 4GGHA 1FH9A 3GC2A 3T2QA 2GGHA 2VTFA 5T26A 5A8NA 3NUKA 1H7RA 3PTDA 3DCPA 1NARA 4ASTA 2OQYA 3RM9A 1HUVA 4HN8A 3S46A 3NEHA 2YSWA 1W17A 4GE8A 1XF0A 4LVAA 4ERAA 4P7OA 3NZPA 1LUCA 1CGTA 2Y0FA 2VMFA 1K4GA 1P0KA 3HPZA 1B2YA 3QM3A 1AD4A 4DI8A 4L1GA 3F2CA 1UKOA 4RPQA 5CPOA 4TU1A 3GG7A 3RPTA 1B30A 1M68A 2ZFAA 5E6YA 3PZVA 1EA9C 4P8XA 3MMTA 1NDVA 5RUBA 1DWIM 1FRBA 2XH4A 1XG3A 2Q8XA 3CO8A 4QQ3A 1EIBA 2ZRWA 4O52A 1EOKA 3CL7A 4QEHA 1H0GA 3W3OA 1JCTA 3OU8A 3LDVA 3P81A 2EPLX 2JALA 2V5JA 3UR5A 4LC6A 5LIUX 4IPJA 3RM8A 1JDAA 1XIFA 2WC3A 3MMUA 4IH3A 1TSIA 1UWAA 2V0TA 4O0ZA 4R27A 1A80A 3ES7A 4QJ3B 1ZBKA 1PVNA 1X7FA 2RHGA 4P2VA 5FEPA 4M6PA 3A64A 2VGGA 3A4AA 1YNQA 4D6EA 1M65A 3MUIA 3M44A 5FA5A 1VFSA 3LV5A 4U2YA 4PFHA 3IUIA 4GH3A 1XIDA 2ZXDA 3S0CA 1W1PA 3N9RA 4IL2A 1ZP4A 1R7OA 3C8NA 4KIRA 4MZ8A 3MDWA 2YKKA 5IBXA 2J6VA 2RH9A 3UG4A 4PEEA 1XLJA 1FBAA 3LCLA 3QTPA 4M51A 2JKPA 2WMFA 1XL9A 2PDXA 3I4EA 1ZS2A 3PZNA 4I9JA 3CB3A 6REQA 1E6RA 3MTWA 2WMKA 4OOZA 4BI5A 4YTTA 1WKEA 2E5DA 2PGRA 4JQ3A 3WLQA 5CSUA 1BXBA 4EWND 4OUEA 2Q6ZA 1E6QM 2FKPA 4DJDA 3TC7A 4Q8WA 3BGAA 1JR1A 3QGVA 3W29A 4HNTA 2Y4SA 4Q7BA 3FVDA 1E43A 1K4HA 1VP5A 3W7RA 3M0JA 3U4AA 1CT5A 1MMFA 3B0XA 4WKFA 3TQ0A 4M1RA 1V6XA 4WCJA 4UTHA 1QNQA 4XB3A 3RFAA 1XLGA 3P62A 2VJXA 1NSJA 3RPMA 4LS0A 1WCGA 1VC4A 1WE5A 3O3RA 4M24A 2PI6A 3M1ZA 3CQ0A 4WQ6A 1EWEA 4J2MA