3PU6A

The crystal structure of an uncharacterized protein from wolinella succinogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
147
structure length
138
Chain Sequence
LKKVLLCVGNELRGDDGVAIALGRLVEEQMPEWSVFFGYDTPESEFGKLRELAPDVIVVADAMSGEIEFLDLSDERTYLYPTPILISYLRGICSKTIFLGISVLLENVLHFSEGLSQGASDSAFVALGRIKELDGMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an uncharacterized protein from Wolinella succinogenes
rcsb
source organism Wolinella succinogenes
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 47
structure length 138
sequence length 147
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HybD-like 3pu6A00
1C8BA 1CFZA 5IJAA 2KMLA 2I8LA 3PU6A 2E85A
chains in the Genus database with same CATH superfamily
1N2CE 1P7WA 2RHOA 3L84A 1C9YA 2FZKA 1RRCA 3O8LA 3U4AA 1L4NA 3QJGA 1NN3A 1QNFA 2I65A 4WI1A 3DL7A 5KYXA 1Q2XA 2ZREA 3NP7A 3O2SB 3R8XA 1BU8A 4BKMA 2BCGY 2DECA 2NSDA 2I6GA 3PK0A 3EPRA 5MGBA 1P2BA 5DGDA 2FPRA 4RO0A 1NONA 2QTZA 2DX7A 4UM5A 5CNKA 4LY3A 1T36B 1XRSB 1KYTA 1QZXA 2VSQA 1U1CA 4KOEC 2RIRA 1Q7TA 3H7IA 1M7HA 1Q1BA 5AK5A 3LW7A 4ZVUA 1FDSA 4HZIA 5G4KA 2PXAA 4MGHA 4O02B 4CU5A 4BB6A 4BFXA 2LXNA 3SNKA 5K0EA 5L3QB 1QIMA 2NNWB 3PQ5A 1T6XA 1NF3A 3B1YA 3AEKB 1IK4A 3SX4A 3LAWA 1YH3A 4IVRA 2HN9A 3L1VA 3KKOA 3ZXUB 2QSYA 3P5BA 5JYDA 2D2IA 1O0CA 4YBZA 3G2JA 1T15A 1YZUA 3C7AA 3OOWA 2PYIA 3D3WA 4DMKA 4I8XA 1KAMA 2VHXA 5HIIA 5J4YA 5L3ZA 3GJTA 1P31A 1V1MA 3HB5X 2PU5A 2DM6A 5J4VA 4OCZA 4V1CB 1ECJA 3GO4A 2O2GA 1BWQA 3AUSA 3WB9A 1T3HA 3VBEA 4G89A 5JJIA 3MWJA 4ESEA 1KK3A 3DKRA 1H6DA 3DV2A 3GRKA 1RC1A 2VNIA 4PR3A 2ZSIA 5JZMA 1TM2A 3CRRA 1X1TA 4O5OA 1W7AA 4OBXA 1IY1A 3KR0A 1XYVA 1Z0JA 4MI6A 1LXCA 3GX1A 3AY6A 5C7IO 2IXDA 2X9LA 4BBAA 2N42A 3C1UA 1XZBA 1ATIA 1HL7A 1GAJA 4JMLA 3MRSA 5G0WA 1M34B 1TQDA 4C7JA 4AKSA 2BVNA 3VPFA 4EBFA 2EKPA 3R76A 5CEJA 5DKFA 5G3ZA 3PNVA 3TJZA 2Z56A 3IURA 4C0HA 4WNCA 4F38A 4A1OA 4F5YA 4M9ZA 2FZLA 4YRZA 2OD7A 3DDOA 3I05A 1I7LA 4IFBA 3FI0A 1KYVA 3OKCA 2OCBA 1KWKA 2P77A 5K8TA 1MPXA 3AHHA 4IJ6A 1CR0A 4EUKA 4C4XA 1G2PA 1MG5A 2HJVA 3IEIA 5K20A 2F90A 1U80A 2A59A 2WG2A 1AU9A 4LSMA 5IAEA 2ZITA 2ACWA 1GUYA 3O8OB 4RF2A 1PT8A 1WKBA 3CF4G 2P91A 1L4GA 2HPVA 4Q4CA 3DTYA 4QUDA 4U2BA 5CH5A 2JFVA 4NHOA 4ASUA 4LDNA 3HUEA 3NCTA 1MEEA 2I7TA 4KKVA 5IAKA 4D3FA 4V1CA 3OJ0A 1Y6GA 3NEAA 3HYSA 5DH9A 3R7BA 4KR6A 3TFWA 2VTBA 1Z0SA 1DEKA 3HYLA 2QTHA 5EZQA 4AB1A 1SBYA 1FP4A 3A3YA 3CZQA 3R3SA 2XUIA 3FVTA 3DKIA 3GK3A 5LA6B 1THMA 5GV8A 1OYWA 2WTMA 1AB6A 4FFBA 2GF0A 4XKJA 4HPJB 3MWDA 1CNEA 3SE0A 3GOHA 2E5LB 2FQQA 3HY6A 3F74A 2VAPA 1UINA 5T3YA 5DK4A 4CHGA 5B7GA 5IABA 3KQLA 2J8ZA 2FB9A 4ZI7B 2RD2A 2Z6QA 3SQDA 3VO2A 4H0NA 4Q1BA 1QU3A 2NSYA 3KFXA 1ZN8A 1EZ4A 4LOLA 2JLRA 1G64A 1AA9A 2NYVA 5H4GA 3UBTA 4MUJA 2JVJA 3CLTC 4RDHA 2G9UA 1W8IA 3TMYA 3OPYB 7YASA 5ICEA 1PHRA 1H22A 1T8RA 1Y98A 2I0FA 2P75A 1K5DA 4QUBA 1H0SA 1W36D 1EXWA 3HM2A 4TX1A 1VSBA 4C30A 4TXMA 2A2ZA 3IEKA 4ZXPA 4C6TA 2Q3MA 4AIIA 1OI3A 4HQLA 5LZ5A 3UQZA 4AMVA 2ASEA 1VJTA 1ICEA 4PZDA 3MJHA 1PHPA 5E6UA 2EFCB 4BATA 4B81A 1WSAA 2QMOA 1EJ2A 4UAGA 5E9AA 4YAEA 4LXIA 4L5YA 1GL9B 3KKQA 1Z34A 2J08A 5MN4A 1R4NB 3U48A 5A9SA 2FZCA 3QJYA 5K99A 1EI9A 3MJTA 3DH0A 1FVOA 3QWIA 4GRDA 2ZDQA 3H2YA 3BJMA 3ETDA 3GLIE 2FFAA 3SI7A 1YRBA 4N0QA 5FAKA 3OPYA 2DPXA 2DUMA 2ZBEA 4RIIA 5ITSA 1V2HE 2ZPTX 4GI3A 2HXSA 2AWNA 2VEOA 3IIJA 4BY9E 5EQTA 4GLFA 3R9KA 4W8GA 3S8MA 1O4WA 3CRMA 3SMVA 3TZBA 4CF5A 1L7MA 1BA2A 1L6IA 1ZNZA 2QDKA 1CUGA 2O3JA 4JKIA 1FQKA 4BV9A 3Q7IA 1TAHA 2I4NA 1SC6A 3K1JA 2E2WA 3DAFA 4XUCA 3P2YA 4ZVRA 2P4EA 1NX9A 1RFGE 1RJ9A 2QF7A 3HJGA 4MW4A 3W79A 5GTDA 5FD8A 5CIWA 2IYXA 4C9BA 5A3RA 4D9CA 2X0EA 1WL8A 1O08A 2VKTA 4XW2A 4ZARA 2FAXA 1UWKA 4CV2A 2QRLA 5EKXA 2IH2A 1GSHA 1V26A 2ZSKA 5ILQA 4MLDA 1E2DA 1KJ9A 2WAMA 9LDTA 3ZDQA 4ARBA 1E1CA 4YX9A 2O05A 2XCLA 4LW8A 1ENYA 1QTQA 2JKYA 3L1KA 2WVAA 2G7ZA 2O4CA 2BLNA 4RD2A 2FF5A 3F3SA 4GQIA 2E6UX 2WSYB 3CGWA 4TMFA 3EGIA 3NGLA 4UE3S 3ZTWA 3W5AA 1H4SA 1CDOA 4UFNA 4OJYA 2QD1A 3ZGZA 5DI9A 3LX6A 4G1BA 3DEYX 3H17A 3OA2A 1M2OB 5DN6A 2D6FA 1EVQA 1J1IA 2ZCUA 3KOZA 1NP7A 2HT1A 3QIVA 2JI8A 2FEXA 5IDVA 4DKXA 4CG1A 2C5BA 2DQ4A 3ZDBA 1P5JA 4J94A 2CV2A 3OJLA 2FYTA 3WOVA 2I87A 4QYTA 3I3SR 2OKGA 2XECA 2G9RA 5KDDA 4CEHA 5DBFA 1OVMA 2X58A 3NTXA 2IF0A 4KSBA 3FKSA 1E6KA 4L3OA 5P21A 3KM0A 4ZT6A 3B3GA 3HXQA 4G6ZA 4QNMA 3RC9A 5FUQA 1QFJA 1RCUA 1VG8A 3CX3A 5L3SB 1YQGA 1VHQA 1XZDA 2FWAA 3BHNA 2RHGB 4UM8B 3Q3JB 4RQUA 4JUBA 3TGWA 1VCOA 2XE8A 1QQAA 3EIOA 1JYSA 3IKVA 4C87A 2M98A 3OEED 4JOQA 4YN3A 1EK0A 3SXPA 3UFXB 2V7EA 1UFQA 4IJVA 5K0CA 3MGGA 3FR8A 5HCUA 1KI2A 1RYHA 4Z3DA 4TKUA 3H84A 3PYMA 4FGSA 1VJ5A 2A5DA 4XDZA 1SUCA 2RIPA 3HI4A 4AY4A 4PLYA 1X1SA 1KI4A 3ONEA 5CD9A 4CQNA 3HZRA 3OUTA 4MUHA 1HTBA 4RTLA 3ZX4A 1R4ZA 2HLDA 3VKHA 1QR2A 1XI2A 3FKSD 3ICWA 3LG2A 5JE8A 1AK9A 1BMFA 1MB2A 2A33A 1HT3A 2PRJA 2VAVA 3OF5A 4BQPA 1LWOA 4MEAA 2NUAB 3P9RA 4DMRA 1B6SA 2J9FA 2JIOA 1IXRC 2YHAA 1N9GA 2OUIA 3N3BC 5FPYA 2WG1A 1IZZA 2IE0A 3TKYA 1HDZA 2WPDA 4KJZA 2R8PA 3IAFA 4BLPA 3WMFA 1H5NA 4MS3B 4LQCA 4UDOA 1KE2A 5CB4F 1J22A 3NUQA 2YC4C 1ECBA 4I4TA 2A5GA 1DUSA 2R44A 3ETNA 4R7TA 3ZE6A 4Q3CA 3H99A 3LF1A 3B38A 2ECQA 4YR9A 1B8VA 4Y6PA 1UPCA 3D0OA 4L2IA 2Y9MB 2QP3A 3GIWA 3L7JA 5E7MA 4C7XA 5IP5A 3B82A 1C41A 2XUKA 3R24A 3G17A 3QW4B 1KO1A 2Z8ZA 2QR3A 3X44A 4DC1A 4IZOA 1JJ7A 3CIFA 1Q3KA 2J45A 1N6KA 1NNUA 3DBHA 1UJNA 3QWBA 5GOTA 3ZG6A 3Q4GA 2AE1A 1KDPA 2WAXA 2CYCA 3A3KA 5DZSA 1NUTA 2NGRA 4BWFB 1E0AA 4QO8A 2NT3A 4F85A 4FNAA 1GZUA 4ETIA 1UDWA 2HJRA 2V58A 1S8OA 3PPVA 2P1ZA 4GKAA 2I2WA 4CMJA 1HNZB 1IZ0A 1BHJA 2H9YA 4NDZA 5KVSA 4A8JA 1YFLA 1ZI9A 2W42A 1WQ3A 4EZIA 2H65A 4FINA 2VJBA 3UJ9A 3T94A 1FFCA 3TTYA 3FPJA 1YL7A 3OZTA 3D4NA 3DQPA 3HA2A 4W99A 4L4RA 4OU5A 4YVFA 7ADHA 1FDOA 1ZGGA 3K9QO 1L5LA 5K09A 2QUIA 1JQEA 1H0RA 3BWEA 3RC1A 1IEQA 3BQ9A 2C5HA 3Q6MA 1ORTA 5BY2A 4MB6A 4BYMA 1TIPA 1VIMA 3A58B 2M6SA 4ZO9A 2Q4TA 4Q4HB 5DTRA 3U61B 1E1QD 3O3CA 1ULBA 3G2LA 3NBZC 3P4XA 3D6AA 5JJ5A 1QAMA 1G8GA 3DJYA 1KEUA 4M0KA 1T4CB 2ODBA 1NMYA 3D7RA 4BFYA 1GU7A 3PWKA 3HA3A 3I0MA 5IKMA 1UMDB 1AQIA 2HHCA 4PSUA 3WO0A 4PEVA 4RTSA 4UATA 2V8OA 5HZGA 3CG4A 5T41A 2GO1A 1NHGA 3F5QA 3GELA 1Z74A 1G5RA 4E5VA 3ESAA 1JQ3A 1BX1A 3HJCA 1XMJA 3LC1O 3OM0A 1WUYA 3DR5A 1S2DA 1WY5A 2XNDD 3I6QA 1QC5A 1EB9A 4I08A 4UCFA 5HBRA 4BNDB 1I4LD 3B85A 1N0HA 4OX9Y 4EQ6B 3FTFA 4MV1A 4ANFA 3BDVA 3D0QA 1OJLA 1CKEA 1A4UA 4D6XA 2PSJA 4IV8A 4PANA 3AV0B 4ND6A 2VTEA 2WUVA 5DN6D 3ZNQA 1VIAA 2FP4A 2R79A 1DQSA 1YMUA 4QAQA 3BBPA 5HMLA 3TIVA 5A1TA 2EKLA 2R1TA 4J7XA 3AEUA 3BE5A 2O1XA 5HKKA 3ILSA 5FA5A 1IQUA 4UM9D 3DJFA 2Y1WA 4MCIA 2G28A 4LOIA 2RBKA 3S55A 1T9GS 1TT5B 1B6TA 1UT5A 3CPHA 1R16A 4GBED 1U63A 2IC5A 3A9TA 3EASA 2DB3A 4C5AA 1M67A 2BISA 2W2PA 4NMMA 1GRRA 1BE1A 1KDVA 5JCZA 2R25B 5LNK6 1MO5A 3T38A 1YU6A 2ATIA 1PNVA 4LXXA 5I45A 2AL7A 2V0GA 6CHYA 3Q3EA 1ZVMA 1NJ5A 3QBDA 4Z9BA 2MSWA 1Z7WA 1SCDA 3BD7A 3FRIA 3LP8A 4XQ9A 3B53X 3BL8A 1NZFA 4Z54A 1MW9X 1QV9A 3ELYA 3CPEA 1JW9B 1Y1TA 2QVBA 4FWTA 1SD2A 2FJPA 2Y2UA 3IIEA 4U7DA 2GH1A 4L4SA 4BTEA 4IO0A 1QIJA 3KLBA 1EK6A 2DWUA 3OMWA 2P8JA 3PD7A 2UZ1A 2J67A 4NOJA 1YVRA 3AETA 5AW9A 1HNNA 1V8FA 1KQ3A 4L2IB 1GPUA 4MK4A 3NATA 2O3TA 2CWDA 2CCJA 4GP9A 2ZIGA 3PC6A 3DZ8A 2PL1A 3LHSA 4PC6A 5EGSA 4KRFA 1SC4A 5GMOA 3ESXA 3MFQA 2PIDA 3RWOA 3G3EA 3U81A 1HNWB 3QSYA 3A1FA 3MZ0A 4EJFA 1NMXA 2P35A 3K6RA 4ZAZA 3V42A 4CNQA 3CFYA 1NU6A 4BNTA 1XRJA 4ENTA 1AKEA 3QU5A 1YR9A 3TSWA 5CXUA 4P4UA 2WYHA 3EIWA 2ID9A 3EVEA 3EDOA 1RABA 3QEJA 4GZ5A 3ZW8A 3U7GA 1VKHA 2EJWA 2DQKA 3L43A 4ENQA 2CL6X 4RK6A 2ZB8A 2CUZA 2ATVA 2JEZA 5CDTA 5T7BA 4BMZA 1FX0B 1MRSA 1XDUA 4HWKA 3IV6A 2GBIA 3U3DA 1T8PA 1LPPA 4JOBA 4UCQA 2ILTA 5LYJA 3STHA 3VI3B 4D0SA 1VG0B 4HWSA 3TFQA 4AN1A 1GQ2A 3AO0B 1W0JD 3UC5A 2Z6AA 2PNJA 4D92A 2Z4TA 4MUYA 1GXSB 3AB3A 2CBGA 1T3GA 3EXHC 3HV0A 4HMPA 2CHQA 5EIXA 1H2RS 3PWTA 1Q0SA 5LP6B 5DRTA 5LD2C 4BEWA 2F3UA 1CJBA 3FZNA 1VXOA 2GCIA 2ZTHA 3D6UA 4J0EA 1U6KA 3ZD9A 2X8JB 1ZEJA 3ND7A 4QT4A 3QVKA 4CCYA 3KEQA 2HW8A 5DU2A 3HUUA 3DTVD 3ND8A 1XTQA 2AG0A 4LZOA 3G1UA 5DNDA 1EUQA 1KDOA 1T2UA 2UYQA 5EJ6A 3PX2A 2RAFA 3I9NA 4REMA 1RBQA 1D4FA 3DT9A 3GLHA 3AG5A 1L9KA 3K32A 3B9RA 2JAWA 4JKOA 2OHFA 3TQOA 3IJ5A 2CJFA 5EP4A 4C3VA 3CEPB 3IJRA 1TJYA 3K1ZA 4EHAA 5IUNC 2YUTA 2G4CA 4KW7A 4ND7A 3KAKA 5DYTA 3OECA 1DJPA 2H4ZA 3V7YA 1DEHA 4QPNA 2BPOA 5B4UA 3WKEA 2K7ZA 1Y9EA 4JP5A 4M8NE 3ZPXA 5AVXA 1NI4A 3U3ZA 5K3BA 3VVMA 5JSUA 4BBJA 2I78A 5AVUA 4R5HA 4MV9A 4DLTA 5HM8A 4TL8A 2R2AA 3U44B 2C7PA 3BH7A 3JYHA 2P1RA 3EWAA 5AW1A 1K75A 4K1LA 4YQZA 1QONA 4EA8A 2PUEA 4MI1A 1CYEA 1ADBA 3ONFA 4V0SA 5FWYB 1CE8A 1KEEB 1L6RA 2JDIA 1KBZA 2XB8A 3F46A 4OLHA 3IAS1 3PDWA 2VNSA 4HNAB 4CIVA 4JXXA 2P3QA 4OM8A 5C5DA 3P26A 1CB7A 3C85A 3HJRA 5K8LA 4GP7A 3ZVMA 2F17A 1LPSA 3N0WA 4EHNA 2AJDA 2J9XB 2YDYA 4P7KA 2WUWE 5SICE 2EX1A 3WRXC 3AYZB 5KDOA 1XMXA 1YFKA 4J7UA 3GPLA 4ZVTA 2PUGA 2EFGA 4TV9F 2I67A 1WB5A 3NTRA 5AOAA 2IXFA 2P40A 4XE5A 2NO6A 2ZJ6A 1MABB 2DQZA 1CJCA 3FX2A 4IOLA 2WF5A 4LXGA 5E6SB 3OICA 4YECA 3ZCRA 3LXMA 4JFAA 1IC6A 2GDJA 2ZBFA 4TUYF 2YBEA 3S5UA 3T4PA 5EY5B 2WD7A 2D62A 1QXSA 1PV1A 1KY4A 2I2FA 1AF7A 1E58A 3WBFA 1NDHA 1THGA 2O20A 4QGSA 5BSEA 2YXDA 3KZ1E 4X45A 4NBTA 3IOMA 1TKAA 3R09A 2OO5C 4Q1VA 5TGDA 2X8WA 4TZ6A 2J3MA 3BGSA 3KJXA 5EP1A 5B3LA 3PJGA 4QOSA 1BXRA 2CZQA 4N9WA 4R1TA 4ZT5A 4LFBB 1ISSA 3A4VA 3CG0A 2EQBA 3WDLA 3SEAA 4DLXA 1AHHA 1GN8A 2Y0PA 3Q2KA 3E84A 3L77A 3STUA 3E0XA 1QRSA 1Y4DE 3GDOA 2V9PA 1L5NA 2PX2A 4LSWA 4XX0B 1Y4SA 4ZJPA 4LZZA 2CBXA 1GGHA 1HMPA 1Z4LA 1ZJZA 4MITA 5C52B 5AKLA 5B1DA 3PF9A 1X70A 2XDQB 5DP1A 1YI1A 5KYWB 5DTEA 5H82A 3GUHA 1K5GA 1M5UA 1LDYA 4OSOA 2NP6A 2ZIEA 4ALNA 2X1HA 1RLOA 3SSNA 2E85A 2Z2ZA 2BMWA 4PZ9A 2MU1A 1Z0DA 3ACBA 4F45A 3KEMA 2DQYA 1LJ8A 1U2GA 3MT9A 3H1FA 2II6A 3B9QA 1GUAA 1CUIA 2G04A 3JQ9A 1DADA 1P72A 2XT6A 3I2GA 1YQXA 1XLTC 4BMSA 4G9EA 4Z1OA 2K2WA 1GNQA 5A3VA 3PL1A 1U3UA 3JQDA 5IVIA 4RWEA 3L6UA 3E9EA 1FQOA 3ZQUA 1TE2A 5EZ6B 3PENA 1K86A 3DYIA 5HE8A 3F78A 3IBCA 2VPWA 4IJMA 2GRJA 3D1VA 1U5AA 3WNVA 5L8VA 1P18A 4BNGA 2QUBA 5KTMA 1EFVA 3M2TA 1W4BA 3F1LA 3IOEA 4Q4AB 3RKUA 2GYYA 4DMFA 3M8KA 2HF7A 4HDCA 2W98A 1I3CA 3UZUA 5LYJF 3EXFA 4EX7A 1W88A 2LV8A 2Z5VA 4O8ZA 2O3RA 4QX6A 3WWCA 3JW8A 3VR3A 1OXKB 1EUDB 4KIJA 3SX0A 5F9FA 1DTWA 5IZCC 5AD1A 5F2NA 4NBVA 4MZDA 1ACJA 2CZCA 1T3ZA 1W0JA 2DHCA 2JH9A 2HIGA 2ZIAA 2FDXA 1VLQA 3OWOA 4FX2A 4G1EB 4HLCA 4EIWA 2GN1A 2ZE8A 3G2MA 3IPAA 4JY7A 4MW9A 4WOPA 5DM1A 3M89A 1YKFA 3PHIA 4PFKA 1NRJB 4KH1A 4ZU1X 5CT4A 1NVVQ 1B00A 4HMOA 5IW8A 4BQEA 3LFTA 5IMBA 2KJQA 2GBPA 2JIQA 3B2EA 5JHGB 3CT6A 3PFWO 1KPIA 3KB6A 5JD4A 4IVNA 4WSOA 3ZDDA 1P1FA 2OCYC 2OXCA 2VS1A 4S35A 1P1BA 4F9TA 4MA4A 1RI2A 3A9CA 3U44A 4NENA 1P6QA 1VGQA 1R4NA 4DIUA 5IHPA 2RHRA 4D9BA 4HL6A 5AK6A 5BNTA 4LJ4A 1SHLA 3AL2A 1K27A 5FTNA 4E22A 7REQA 3CZPA 1JU9A 4QTYA 4YXWD 2CHEA 4WEOA 1V47A 3CN7A 3PB3A 4LTNA 4BFLA 3KAQA 4MUIA 3ND5A 4U2DA 3CPSA 3RAJA 4FYHA 3ZHVA 1DQYA 1W93A 1LC3A 1ZA1A 4CMKA 2R68A 2QZ4A 3IP8A 2XMDA 4GOMD 1AUQA 3C6ZA 1OFVA 4BQRA 4F60A 5JXWA 2PUBA 1A3CA 4OG2A 1K9VF 2CGEA 3SHOA 2K7FA 1D1TA 1QPGA 1ZRMA 1TO1E 4WCFB 4CCYB 3IB6A 3R20A 5GZ1A 1XC7A 3T95A 1AQYA 4F92B 4OLBA 4PRLA 1QIGA 4HSGA 5CIQA 4MINA 3VU0A 4PWYA 1SUWA 3HL4A 1XRRA 1C0EA 1Z4MA 3TOSA 5IX8A 3H2JA 1P0CA 1EWRA 1Z0UA 2VDJA 4FP9A 2NVUB 2UVPB 4DDTA 4ZOAA 1IN1A 3I01M 2JGDA 2B8JA 2W4QA 3B8EA 1V5EA 4BECA 2FSUA 4ARIA 4AXBA 1I2ZA 3RIMA 2F1OA 3C4QA 3OQ1A 4CTNA 2WJGA 3GFGA 4OMDA 5LP6C 4HEQA 3ZU2A 1X7HA 1BHQ1 4Y2PA 3STWA 4Y1GA 1Z5PA 1U3CA 3HVHA 4GYKA 2R96A 3FPCA 2BKAA 1XGKA 5CYPA 1SKUA 1IPEA 4NICA 5FPTA 3I58A 2REXB 5T4BA 1SOAA 3H86A 2PSDA 2Q6OA 3UHAA 4ENPA 3IP3A 1YI8A 3KAPA 4LF6B 3V4PB 1XZKA 3MTBA 2NU8A 1CLEA 4Q0MA 4DWOA 3WLJA 4L08A 4N41A 2GX6A 4N18A 3WC4A 4HNUA 3AGQA 1GG8A 1AUXA 2XIQA 4HUTA 3AU8A 1K89A 5E1BA 2BDTA 1K8YB 1QGUB 1L8AA 3G89A 2XCSB 3ZW9A 3A6LA 1LLUA 2IU0A 4OJKA 3NG1A 2UZIR 3JVIA 4DMCA 4K8RB 4UTRA 1MB3A 2BZ1A 4IRUB 4KN8A 5CGQB 1CZHA 3AUTA 5HIAA 2EW1A 3LECA 4XD7D 4DQXA 3IAUA 1JG2A 4XCVA 2QTGA 3RVQA 2VP4A 4OQYA 4E2XA 5K1ZA 1N6NA 4GUAA 4LGVA 3RRJA 1SWVA 3N76A 4L5JA 4O4HA 5I01A 5GINE 1OASA 4FFOA 2EBUA 5EESA 2HEIA 3WK4A 4H7FA 1RM4A 5AVVA 3ZTYA 5C53B 3ZWXA 3RK0A 5B2ZA 3N2YA 3SJBA 5E95A 4YAKA 2DH6A 4I3GA 2WJIA 2MR5A 1SKYB 1CU1A 1YIAA 4M1WA 2Y1LA 3MPOA 4MR7B 2O0HA 4EFMA 4XSVA 4MYDA 1P39A 4U2FA 5JYEA 2VYQA 5IVHA 4HGOA 1PL0A 4ZQHA 4MS1B 3DTNA 421PA 4AMBA 2OZKA 3OC0A 1KFEB 2J4CA 1QH8A 2Q2WA 3OEWA 1XXHB 2PQ2A 4QQ8A 1KI9A 2OKCA 3K0SA 3GJ5A 4R9SA 1GZ6A 3SF0A 3IO3A 2CXNA 1HT0A 2EGUA 1OHHD 1MEOA 3LIIA 4POAA 4E6EA 4DQVA 1I3OA 5AQEA 4MQMA 5TGZA 2CUKA 2BFNA 2RC6A 5DM4A 2J3EA 4ND8B 3CISA 4D42A 2GETA 2R8XA 3U80A 2PKCA 1GCGA 4LQLA 3TCXB 4C0WA 3ER8A 4YMIA 3AWDA 1A2QA 2JLWA 2LWIA 1AOXA 4D0RA 1QP8A 1S3FA 3C7CB 2E3JA 1JB9A 1N9KA 2Y9PB 3Q7SA 4ZTUB 4JI2B 3ZV7A 4NH0A 2VYVD 4WDQA 4NBUA 3BFKA 4CG2A 1FFWA 5AXCA 1O0BA 9MHTA 3KJNA 3HRIA 3ZGYA 1PYDA 3O8QA 3IJEB 3TFOA 4M7PA 4C29A 1R74A 5L53A 5KOYA 1E59A 2PMEA 2HBQA 2ZAYA 4MPDA 1AVTA 4EGQA 4Q66C 4ZQIA 1XL0A 2XB6A 3SXUB 1UP6A 3CLVA 3RFVA 4K86A 4XWTA 5B1HA 2ZBUA 1OQAA 2D2FA 3DMTC 4Z4GA 3SKYA 5ALRA 4G0ZA 3DS8A 4IHJB 3RBXA 2FZ5A 3UMBA 2VP5A 2A0KA 4ALKA 1Z2PX 1B43A 3AR6A 3RFFA 3A0RB 1B1CA 2AX3A 3UJPA 4D8WA 1YXMA 5DHFA 1KKMA 2HSJA 1GZ7A 1P3JA 3U4QA 1ZM3A 3NO4A 5BUSA 4XFDA 2GXUA 1J25A 1PJSA 2FP4B 1CJVC 5F2KA 1GL7A 5TJ9A 3TTWA 1J8QA 3VH1A 2O59A 1FXSA 2VHJA 4JT2A 3TSYA 3MQ2A 1RRGA 4L1KA 4X1YB 1P2GA 4JYZA 3UFBA 4ZZ3A 5LUAA 4P0QB 1ZGHA 3ETGA 1JLSA 1D03A 2FA9A 2V54A 3B9BA 1LGYA 3OFND 4NFSA 1TCAA 1V95A 1QO0A 1YR8A 2EBWA 4CMHA 3OKAA 5ITVA 4A8JC 2GM3A 1QE3A 3H05A 4X8OA 3VVLA 1QANA 3WL7A 1N78A 2O8BB 5GJVC 1DAFA 3N0VA 5ECDA 3GEMA 1YL5A 3HNPA 2W6OA 1W46A 2X13A 4P84A 3HO1A 4HATA 3WGIA 3AF3A 5LMZA 2CKDA 3OG9A 3BL5A 1B8NA 4JUCA 5IH7A 3DL2A 2ZJ8A 1W96A 2A5FA 3HO8A 4CV0A 4QPPA 1XVTA 2XLBA 4MIEA 5DGHA 5BQOA 1Q91A 2UKDA 5BSMA 1DU4A 3AV3A 2PQ6A 5HZMA 3AESB 4HAXA 3PGLA 3GAZA 3GEHA 3LRPA 3TTSA 3H4TA 1ZN2A 3H0CA 3PHLA 4X62B 1E6WA 4R40A 3O4HA 3BB1A 1L5RA 3GCGA 3QM1A 2YQZA 4D4MA 5FR1A 4Y30A 3RV4A 3SZGA 1K08A 5K9ZA 1N2HA 3HDYA 1U7WA 4L0QA 1NJ6A 5JBNA 4CM9A 1IQRA 3N0RA 5CNMA 5LMCA 2Q3LA 3BXZA 3BB4A 5CYFA 5TS3A 1PR9A 2XD4A 1EFHA 4DREA 3C3EA 3IR5A 3OT4A 1IOZA 3RYHA 3GVHA 2B8EA 2C97A 2EDCA 5DLEA 4H2DA 5HJEA 4DCCA 3OO0A 4JDPA 1ZINA 3GGGA 2RE8A 2IYLD 2BEWB 2R1VB 4QFCA 1A7JA 2XMBA 3LV8A 4AJIA 4BIIA 3G6WA 4Q4JB 5HF8A 2VCEA 1PGOA 1JMKC 3GEDA 1BKSB 3H6KA 4GH5A 3TJMA 5HK9A 4WBNF 1H94A 1PL7A 4FHDA 1RQ2A 2PKEA 4FDLA 4WXHA 4IV0A 1JFFA 4OMUA 2C07A 3IA7A 5IMSA 1QLHA 2WQZA 4RH0A 4FBLA 1NQWA 1YGYA 1I5RA 2PLWA 1EGQA 4L0MA 4PAGA 2X1LA 4L5BA 2AHRA 4E5KA 5LYJB 1YVUA 3LUHA 1UH5A 4PLVA 1DTEA 1KO8A 5EE9A 2R1VA 3BRWA 3R7AA 4JA0A 1NJ2A 1H2AS 1EA7A 3A04A 4Z53A 3I12A 1DTSA 3QBTA 4LVOA 3OQMA 5DOZA 1W36B 3RABA 4HPWA 1ISRA 2A35A 3GDHA 5AHXA 3PJRA 2OV6A 5KZMB 5A71A 1FK8A 1G18A 3ND9A 3EW9A 2YQ4A 1P45A 4GXNA 4BTLA 2QLJA 1DAKA 3L6BA 3RF6A 4QEDA 2N9UA 4RMNA 5IAOA 3BMOA 3OU7A 5FWDA 3TLZA 3IESA 1RLUA 1XHLA 5B55A 3RQIA 2VZ8A 3GUZA 2FUG1 4Y9TA 3QXSA 3RVNA 1KMHA 3X1JA 4BLQA 1P29A 3QHAA 3UJ3X 4ZRDA 1QZTA 1RTTA 4DUPA 1PUXA 1S9DA 4J0IA 1RWQA 4M99A 3HY4A 3QVJA 4LOHA 4Q9IA 3UWMA 1LK7A 2RONA 3VVBA 3EDCA 2XBLA 3CRNA 3UG6A 5B58T 4TRRA 3KDAA 1TUBA 5IYZA 1FZTA 2A9KA 5LB2A 2LRHA 3DB2A 1FCJA 1K97A 1O87A 2Q3DA 4IQFA 1PGPA 2AE2A 4MVJD 3VZRA 2NP7A 1L0BA 3K94A 2HGSA 3GR6A 1E4EB 2QTLA 1EJ6A 3E3MA 3FDZB 1LBTA 2AQHA 4RETA 3TQCA 3V7WA 3KZOA 1BOOA 1ID1A 1L7RA 1FFYA 4EG5A 2J6BA 3FXAA 5CX1B 1YSCA 3TQHA 2QMYA 2X42A 1X1QA 2I33A 3C98A 3COYA 3JQEA 5AYVA 2O8CB 1XNGA 2RGXA 5FBRB 5E3HA 4X1KA 1ZISA 2OC9A 4FN4A 1BE6A 4M1SA 2W6IA 3C7DB 1TYBE 1XYYA 1YBAA 2DY0A 4FDMA 5BUQA 3I30X 1AMOA 2Y2VA 1N57A 1ZOPA 3THYB 1N8KA 3PFNA 1GKYA 3R2JA 5KI6A 2ZWMA 4QG3A 2R1TB 3PNPA 3EX7C 4W9RA 1KSJA 3OZCA 5FNZA 5ILGA 3V8NA 3MWFA 1X1AA 4MWEA 2G63A 3WGTA 4EUHA 4PAWA 2GZSA 3D3KA 3CMMA 4EI8A 4B5LA 4US2R 1TGYA 3R5FA 1SVMA 3EGXB 3SY8A 3KFLA 4J4HA 5DWQA 4D81A 4HI0E 1V7CA 3I3OA 2IXEA 4NZZA 4UHBA 2SKCA 4R05A 5DBHX 3WIUA 3L1IA 2YJNA 2QLBA 1Y5LA 2P69A 2ZUVA 3I52A 8AT1A 4NYIR 5K6TA 3HDVA 5KTPA 3VA7A 3RLFA 2IWHA 3QXHA 2AFHA 3OQIB 2AFRA 4DEVA 3O3OB 3EVBA 1GRCA 2PAAA 3OKFA 2PZKA 5BR1A 4IDDA 2C98A 4CIYA 3KQNA 4GM4A 3TCKA 4K81B 4DQUA 3CKMA 3FSRA 4RL6A 1TIKA 2O0LA 2RAUA 1MXHA 2AG1A 4LV5B 4F91B 4RPJA 3LDUA 4Q3KA 3UWPA 1QYVA 4G65A 4RIHA 1M6VA 2EWWA 1OXSC 1YR6A 3PC4A 5EEGA 3AQIA 2XUFA 4YONB 3VUFA 1UK8A 4XVCA 2Q1SA 4GYYA 1SKQA 1CRPA 4CCWA 1TCUA 3KJEA 1V45E 1ZCAA 2HCJB 4TTQA 3KQTA 4WKOA 3FWPA 4KMMA 5B37A 3W6ZA 4BNMA 4UCWA 1P8JA 4B4VA 2WTUA 5FL7D 3MG9A 1DC3A 5T8KC 5LDDC 1NVXQ 1O9HA 2CVZA 4ITRC 1LB1B 4G67A 1V96A 4MRVA 3HXKA 3H4IA 5EC8A 3S2IA 3L40A 3RVBA 2HRRA 4RELA 3RUIA 4ON9A 4MS4A 1ZJJA 3WNQA 1UMBB 3IDQA 3NH6A 4R69A 4TWAA 4CMEC 3BH0A 4D3ZA 4XIJA 4F84A 2MOKA 4CW7A 1YOBA 1RI1A 4JEHA 3H83A 5EERA 4FYJA 4MP8A 4FOOA 1QR6A 5JVDB 4HS4A 1C9MA 1JU4A 5TSDA 1VA4A 4L85A 4RPCA 4AECA 1OLUA 2A9FA 2QM7A 1T6ZA 2PGNA 3EIXA 1DLIA 3ZI0A 5FBKA 5JC1A 1IQPA 1OIXA 1F6WA 1U8ZA 1IUKA 2C82A 4OHMA 5HPYB 5JDCC 2XE6A 3TG2A 1Q0RA 2IHTA 2VAXA 3PE6A 4CIAA 1OC4A 3U3KA 1HETA 4NPAA 1JZQA 4XJTA 3W2TA 3BWMA 1UDXA 4M7OA 1GRVA 5GZ3A 5JHHB 1ZUWA 1W48A 3HNRA 4ZOBA 5DMXA 3HPRA 4PTZA 1K5PA 1Z2EA 5L4LA 2OBMA 4CLXA 1KAQA 2XNSA 2HQOA 3SC4A 4YJ2A 1EDOA 1X80B 2EP5A 1AE1A 2RJNA 3BCSA 2VZ9A 2WVJA 4GPBA 4OLFA 1W94A 2NX2A 3ZZUA 1O2DA 3OIGA 5BPFA 2ZBRA 1BDIA 1G8FA 1E9DA 3PHBE 5H02A 3N2ZB 3KR2A 1FX0A 1RADA 2ZRJA 2HMAA 3HVUA 5HTKA 3Q2IA 4ES6A 2GJ9A 4KVZA 3OCVA 5ALFA 5JFTA 5F3WB 2V9ZA 4CWAA 3EEIA 3KFVA 2NUTA 2XBUA 1J39A 2A57A 3BZBA 5CVEA 1PNQA 1WHSA 2YJ4A 5D7NA 3UJBA 3ZCVA 3NIDB 1UXJA 2CFIA 4MX8A 2YW9A 1UC9A 1GNPA 4Q4HA 4MWCA 1LPMA 1YDEA 2NVBA 2ZTMA 2ZYWX 4UDNA 2HHJA 2JATA 3DQZA 2R6HA 2W6PA 4IHQA 3O93A 1XNRB 1Y6QA 1DJMA 2GPYA 1FY2A 1X9HA 1XNHA 3AJDA 1VE9A 3BGIA 1SELA 3KRTA 1RQRA 5PGMA 2OHOA 5DHTA 1RWXA 2G0TA 1IQ0A 2FUEA 2VHUA 3GCWA 4ND5A 1TYAE 2ADOA 1MJGM 2FX5A 1JZSA 1ZBQA 4PLZA 2W6JA 3AKYA 3FFTA 3H2GA 4GGMX 1JEOA 1WRBA 2Q6IA 4FQ7A 4M0CA 2BFCB 4XOUA 1KH2A 1ECPA 4BZXA 1WETA 3CTMA 3A1TA 2FEOA 3EF0A 1HE5A 4H0FA 3HTXA 1NL3A 1L3BA 1OA0A 2WIAA 4P4LA 4QTXA 1O95C 3MVEA 1M1UA 2GZMA 4UHKA 4MUEA 4AY2A 3WGKA 4FBMA 1J2UA 5FWNA 5J2TB 1RXWA 2Q8QA 4UREA 1KJNA 1Q14A 3B1XA 3GAAA 4PSAA 3CEMA 2AI2A 1XZFA 1SXPA 2CDCA 3HHEA 3UG7A 4KLZA 3UKDA 4JK3A 1YF3A 2VWPA 3I9MA 1UMCB 2AH5A 1TVCA 1C3JA 1JTFA 1HXHA 1J9GA 1EESA 3CKKA 3PD0A 4TYPA 2GCOA 4L8VA 1US8B 3I4CA 1HT2E 1E6UA 3L9XA 2EQ5A 4N0EA 4N6OA 4YP7A 3N8DA 3HM9A 1UQUA 3S1AA 1N2XA 3SQOA 3AU9A 1O6CA 5CUQA 3WX0A 4KR7A 3O4VA 3R3XA 5L4SA 3FFAA 1A9XA 2VK2A 4P32A 4RMJA 4O3MA 1U3GA 4CUKA 3C5EA 4CR8A 2XXAA 5F9MA 4DCSA 2NXWA 3CQ9A 3IE2A 4W8HA 3SS8A 5HGXA 2KX7A 2DBYA 2HWKA 2GPBA 4TWJA 3KZCA 5JBIA 1R8SA 3PNYA 2HRBA 3KOYA 1Z6ZA 1XK6A 4ZICA 3ROQA 3EHEA 4MB0A 1UBTS 4NDAA 3MTQA 3AZPA 2IF2A 3RU2A 4HB2A 5KJFA 3CLHA 5HFAA 3M4ZA 4INPA 2XRZA 1ODIA 1WF3A 1PWYE 2ZIFA 3MT8A 4IS3A 2R8YA 2GKGA 3V9AA 5CU7A 4HEA6 2PWBA 2V6FA 1NWCA 4GOND 4DJJA 3PQ8A 4MQ5A 2H0QA 4BZQA 4CMBA 2VHYA 1GGFA 3TTTA 1NM5C 4NBNA 3DWEX 3WGUA 1YJCA 3HU2A 4R2WA 4QYIA 1JE0A 3TW8B 4E5PA 2JGAA 1F2UB 3LUJA 3GVIA 3JAKB 1KJJA 3L0ZA 2COUA 4UEWA 5L3SA 1QAQA 4HDSB 4CM8A 3NP9A 4BNNA 2AR0A 5BSWA 4RACA 2E6KA 1MO6A 2FWJA 1JI3A 4ENRA 4DIMA 4UBIA 4BP3A 2Y0CA 3B7PA 1Q57A 2O6LA 1VI2A 3QE0A 2JHGA 3CUYA 3F1KA 3LT4A 2W2XA 2F48A 3DL4A 3E9CA 4L02A 2PO7A 1EAYA 3COWA 3R23A 1NM5A 4HAIA 1NOIA 1AXEA 2NU9B 3P5SA 1R5OA 1YDHA 1OIVA 5KYGA 2VHQA 1QGUA 3AVVA 4FKBA 4F21A 4ZT4A 5IUKC 1JLMA 2PQ0A 2XI4A 2A9JA 3E8SA 2B92A 1OWLA 3KSDO 3MCZA 3WYEA 5BSKA 5IZCA 1DIHA 1G98A 3WL3A 1JIQA 1YDFA 2YICA 2H57A 1FSZA 3OURA 4FYMA 4QVGA 2GI4A 1L2TA 1C3OA 3VOAA 3OOSA 4DCGA 4NZYA 1ZEMA 1JLHA 1FYXA 2M32A 2P5YA 4DOMA 3HCNA 3L0IB 2VDOB 5C3MA 1A8IA 3ET4A 1GV1A 3BTOA 1B0AA 1ORDA 3QMMA 4QPCA 5DTQA 1ODJA 1SCNE 5FPSA 3RS3A 2DERA 4D02A 3DVRX 4GGPA 3M6UA 3WA7A 1Y89A 3QE3A 2CXHA 3CO0S 4LDJA 4PFJA 3P4UA 3GWGA 2X9VA 3LVFO 4TVOA 2BMJA 2C4MA 3OMLA 2R2GA 3BKWA 4AJ1A 1E4YA 3L8MA 3Q3CA 4ZU3A 1KVUA 2UUBB 4PFSA 3D2BA 3LT5A 5DRYA 2W11A 5BXYA 4JLWA 1JDZA 4E4YA 5BRAA 2VK1A 2QIOA 4LISA 1FSPA 3WADA 1C7RA 1IEVA 2IITA 2Z0MA 4JXJA 2F62A 4PYIA 4P98A 3GFOA 1J2JA 2OM6A 1FTWA 2YVLA 1XZLA 2B78A 4LEIA 1JHOA 4OHRA 4DQ0A 4F04A 3KLMX 2F1KA 4MW7A 3VR6H 2Z4RA 5H59A 1OXBB 1L7VC 4KVFA 4R2KA 3UBMA 1FVHA 2I4RA 4L8WB 1JPVA 1EKXA 1B8UA 2GPWA 3JD2A 4P3PA 5D7BA 5IRCD 1ZR4A 1CQZA 3QFRA 2PCJA 3O2NA 4NULA 4XVUA 1DI0A 4YRTA 3PKIA 4RFSA 3WLMA 1EM8B 4TLCA 4D9FA 3VU1A 3CWZA 4A6DA 2OV3A 1ADFA 1NI4B 4XX0A 2PX3A 1L5HA 4FIZA 5EWLB 3I01A 3R8FA 2OZPA 3MBIA 4JLSA 4NNPA 1UEJA 2O5EA 4QFBA 1Z2CA 2A8YA 2FWNA 3EIHA 4IILA 4YLEA 5L3VA 4LYHA 5BMVB 1E2EA 1KETA 2CMHA 3QUTA 1ILEA 4OKNA 2QN9A 2FX2A 3HA5A 3W90A 1AKQA 2PA0A 2YWDA 4K28A 2BUBA 2O0JA 1MAUA 5TQ0A 1APBA 3V9PA 3GZ4A 5ENDA 2IPOA 1K5HA 4G24A 1P4AA 2O8NA 3AKZA 2BN4A 1QTRA 1JEEA 1FDTA 2JK0A 3B3JA 3Q3GE 4YRSA 1A8SA 1TJ4A 1ULUA 1ZMBA 3FDZA 3GCZA 3HGTA 3IEXA 5CT8A 5IYZF 3DE3X 3IUJA 2NSHA 1W0CA 4IMRA 5K3AA 3TXYA 3TRKA 1XKXA 3C3MA 4YPOA 1HDXA 1DG1G 5GJWC 2ESRA 4DM3A 4E21A 2FWMX 3EXHA 2ZE5A 3PQ7A 1ZKMA 3KJHA 3B9PA 3KO8A 1IZ7A 4DPMA 2J59A 4L6AA 4CTMA 2JFOA 3DHVA 3KQOA 3KPYA 1R7RA 4N8DA 3FNHA 2HWUA 2WTEA 2FK8A 3M6AA 5A6SB 2AFIB 5HYVA 3QKUA 3TTUA 2R97A 4DMGA 5K6RA 1HG0A 1JR3A 3N2GB 1W59A 4H7PA 1IIRA 1TPZA 2E4UA 2X7HA 3DO6A 1RSZA 3L06A 4ILKA 3EY4A 1J0AA 1W2WB 1M0WA 1V25A 1XVLA 1Z6TA 2JJ1D 3MPUA 2W00A 3E5HA 3GJ8A 3K9WA 1K8QA 1D6MA 3GA7A 2XWSA 1MUUA 3BWXA 3PDJA 3MUOA 3IEMA 1QQ6A 1UR5A 1XDWA 5H7XA 3UJ7A 3WRWA 1FUEA 1U7HA 1Z06A 4M22A 2WHYA 2SKDA 3PHGA 4LE2A 5F7OA 3UMYA 4QTUB 16PKA 5GGYA 3WLSA 4UEQA 2JLYA 1L7AA 3B8HA 3SM9A 4V0RA 4IJKA 4JUFA 1QP7A 1XX6A 3X2EA 1J2YA 1NTOA 4LE0A 5DVZA 3W9BA 3C5CA 1QNLA 3O75A 2H1HA 4UVGA 4FCCA 3VQTA 3WFIA 2MYTA 3X43A 3N28A 4R54A 3GV0A 4OAPA 4C0KA 2G4LA 4X1IB 3C5WP 3GZJA 3UANA 1O57A 3EXG1 4C2TA 1C30A 3LE8A 3NORA 1RKXA 4BLWA 1C3VA 2BFCA 4URYR 3ZZNA 3FOEC 1GTZA 3BT7A 2R8EA 2QN1A 2ZZMA 4KJXA 4OAOA 2V59A 1LDBA 4KYUA 4FWBA 1AKRA 1I10A 4XI9A 3ZY2A 2YN4A 4OSPA 3C87A 4UJ5A 3WSTA 1K2WA 1FDUA 1TFRA 1ZVQA 1TI7A 5DX0A 1NP6A 3U4GA 3FFBA 3ZK8A 1GSAA 4YCAA 5D3QA 1QZ3A 5FEUA 4TM7A 5IFLA 3SKXA 2YHBA 1HZZC 4Y98A 1QO9A 4CKEA 3AOEA 1XVIA 3CEJA 5A06A 5COAA 2XGMA 5I7VA 1RHMA 3CNLA 4PS1A 3U7QB 1PS9A 2QTVA 3OEYA 3HVIA 3IQHX 3QEMA 5ALSA 1X74A 3RYCA 3L7LA 4MIKA 3FDFA 1JAXA 2PPVA 4JA2A 3LOUA 3GLHE 3U13A 3GT7A 5CITA 1BFKA 4ESVA 2DEUA 4QLAA 4CF7A 3WS7A 2V65A 3HCOA 4AJOA 2HRZA 1ISHA 2QT0A 2ZIXA 3A6EA 1BXGA 1Q0TA 3NBAA 3UB3A 3HS3A 2BZGA 1CUJA 3NM6B 1NVTA 1IH8A 1VPTA 1TUGA 2QRPA 3R75A 2BAGA 1EFPA 2NO7A 2V45A 1R88A 4F12A 2RH9B 2P5UA 3UTCA 1N8SA 4DCJA 3AEKA 3O4FA 4FYKA 4FIDA 4RZSA 3T7IA 2C59A 3X1XA 3I8OA 5CLGA 5CDYA 3BWYA 1O96B 3MRTA 4DLNA 2JGNA 2D74A 3F6RA 3W9UA 3THWB 1ZH0A 3DDCA 2CVHA 4HVAA 4JYMA 2H31A 2J07A 1P5RA 3RFUA 1T43A 3RRMA 2O50A 4CYMA 1ZA2A 4G4SP 4ND1A 3FF1A 4HDKA 3MRVA 4MICA 1UEIA 2N1MA 5JSQA 1EDDA 1KIAA 5LR6A 5J2TF 3M5DA 2OCKA 3CLKA 1M6HA 3RE1A 2BRUA 4OUKX 3Q8KA 3R7SA 4DC9A 1YS2X 3T9BA 1ZH8A 3EARA 4NPCA 4Q1CA 3BXHA 1C1DA 1BWPA 3COPA 4NCKA 2G09A 4FDVA 4GMXA 3ILXA 3UN1A 3URKA 1CUZA 3A9RA 5IJ0A 3ULKA 4Z0HO 2M6KA 3BF7A 4HFMA 3GEGA 4KPEC 5KPJA 1RS0A 3BD9A 1XZPA 4DEXA 1FLVA 3QLJA 3PNQA 3VSCA 1GYQA 2RGDA 4OK6A 2PGDA 5IDQA 1CZNA 2R5FA 4BMOB 2O2ZA 3IUYA 1V7QA 4U9IS 5FUBA 3STYA 4GF5A 3E9MA 4CV1A 1U8UA 3NYIA 4UM7A 2IYSA 2PJDA 1ULTA 4MI9A 1EGHA 2Y1DA 4DV1B 4OYLA 2FKAA 3PIRA 4PVDA 3ESZA 1AXRA 1GGVA 4JYCA 3WGYA 2FTKE 1UBEA 3NBUA 1XQ1A 1F12A 1DLJA 1UC4B 4H3VA 2WJZB 4MVJA 1E5XA 2C1ZA 4S1WA 5LWQA 4BGEA 3QYPA 1M83A 3SYMA 3AIIA 2PMKA 3VJRA 1NOKA 2EKBA 4HB0A 4ZREA 4YUZA 1SOMA 3JZFA 4MWDA 3MD9A 2FJ0A 4N3AA 1ZICA 2HMSA 1YR3A 1GTSA 1TNDA 4NCXA 2OCXA 2HC9A 2CFCA 4WKGA 3UQYS 2GWHA 4OQLA 2BTEA 3CX6A 2MYNA 4I1YA 1AQUA 1H5QA 5K0BA 3EXFB 2IPLA 4JITA 4Q7LA 5GQSA 1LCIA 5JALA 1P2UA 3IEPA 2Z2IA 4JB8A 4PG4A 4DV3B 3BEDA 3INTA 3OZUA 4J07A 3ZWWA 4DAEA 2H5LA 1CJUC 1YUBA 2IZ6A 1DJQA 1T10A 3O1HB 4NFLA 1O97D 1QVAA 2FNAA 2IXAA 1CRZA 2OVFA 2XA2A 3DE0X 4QU0A 5JQGF 2QGZA 4YJKA 3A7DA 1SXJE 3L8YA 1NUSA 3EXHB 2REBA 2UVDA 4U9UA 1ZGAA 5F1KA 3VBCA 1R0ZA 4KLAA 3WOHA 2E9SA 1RPNA 1XEAA 1ZCZA 1MU0A 4X44A 1SUEA 5BSFA 1XN4A 3JARB 3QKSA 1UWLA 1NVVR 3AF2A 1J1ZA 1H9AA 1SBCA 1T35A 4II3A 3WBKA 1KFKB 4LHVA 1GY8A 2RGCA 4IQ4A 1T6NA 3B1FA 3JQGB 2R6JA 2ODPA 4JGBA 4JP1A 1OLUB 2AYYA 4GZ6A 4WZ6A 3OE5A 5JMOA 4RTMA 1U02A 2QR5A 3JWJA 1ZLYA 1NVFA 5BQXA 2RK6A 4FPXA 3WWDA 1DKQA 3ZWDA 5C8YF 4BZPA 2JBAB 2VJAA 3J80A 1E1DA 1XQ9A 4QYMA 3QOFA 2ZGVA 3JZMA 4AJJA 5HQJA 1EEHA 3KE8A 2JEYA 1Y9DA 1QHSA 2G08A 2I6SA 1M2JA 1SOUA 1P9WA 1N2ZA 4Y0AA 1GNTA 4IEIA 4ZVMA 3SICE 3EOBI 1VA5A 4F6CA 4QOHA 4LF9B 3IUEA 1EP3B 4OX9B 3TNYA 5I9NA 3DF9A 1F9AA 1JAZA 4G0XA 4UQPA 2L18A 4ZDWA 5AUQA 3LDFA 1CF9A 3TQIA 1K9SA 1RQNA 1U2DA 4EMUA 1M2KA 1G4AE 1X19A 5LLTA 3ACDA 1K68A 1PSDA 2EVWX 2Y76A 2JGJA 1L7PA 2HDHA 4U7TB 1LX7A 2YNMA 3C3AA 5E9QA 1Z56C 2NQ8A 2XDAA 2FVYA 4LHYA 3DZIA 4TSKA 5T4HA 2J5KA 2ZZNA 1C0KA 1UXKA 2GEBA 3H6HA 4Q9JA 3QVLA 5I7UA 3I4FA 5LIRA 3NPMA 4YCNA 1IXZA 1A8UA 1O9GA 4I9FA 2IYFA 1WY7A 1KZ4A 2VDWA 4WZAA 1JKIA 4EHLA 4TRJA 1UDCA 2YWFA 4QREA 1O9BA 5SZHB 1JIJA 1RLIA 4CQMA 2P4UA 3AR7A 3P19A 1ODSA 2BGNA 5ALWA 1UBGA 3RIGA 3DOIA 4WV3A 2XY4A 3FKJA 3TLAA 4XQGA 3CF0A 2AOUB 1QRTA 1DBVO 2A7XA 1MR3F 1WPGA 2XADA 1YJAA 1NUUA 2D0DA 4FQ8A 4KV7A 5E9JA 2X4DA 5C7LO 4OHCA 4J6FA 3QFSA 2WNSA 1F5SA 4M98A 4PBRA 5BOSB 2COEA 1V3VA 2HXYA 1QK4A 2JZCA 3DM9B 3JQBC 3KTAA 1RYNA 3KVYA 1EHIA 3OJOA 1KI3A 4JDUA 1VZ3A 4PCAA 4QIHA 3WGQA 3VKWA 5INTA 1GOTA 5I9IA 3TB4A 2WLTA 1XKTA 3EH2A 3EE6A 2JLAA 2X15A 1MA3A 3GFSA 3IS3A 1DZIA 3L8FA 3PCTA 2RK3A 1OPRA 1XTVA 4KNVA 1I6KA 5AJXA 4HP8A 4Z7OB 3WL5A 1CHNA 4UW9A 8LDHA 3GPCA 1VIYA 5AKKA 3FMGA 3ZE1B 4EKDA 3GD7A 1Q20A 1UPTA 4EGAA 5JSYA 3PBKA 4XYLA 4M38A 4RTJA 1AQ6A 1CQIA 2OY0A 3WJ2A 3H1BA 4QJ5A 2HDOA 4R1PA 1ISFA 1X7WB 3EGDA 4B3TB 1NHWA 2ZSJA 2OC4A 1M1NA 2Z3WA 1NYRA 3KTAB 1O7JA 1ZY2A 2GD1O 4HTFB 4HH4A 4J2HA 1NX6A 4EH1A 2R62A 2XEDA 2PSEA 1NA5A 3LLCA 4UFPA 1H8HA 2IBMA 2B21A 2CEKA 3GG2A 1MJNA 1RRFA 1KHTA 1L4LA 5DNAA 1XWFA 5AI0A 1FTQA 3T3OA 2I1LA 1U7PA 2YFKA 1NE7A 3BJZA 3G7NA 4KFSA 2ISQA 3QYAA 2VT2A 3PS9A 1BCRB 3RVSA 2YJZA 3ZUGA 4BAUA 5F1OA 1KDRA 1KEKA 3GCXA 2OGSA 3KTOA 1NG1A 2ZPUA 4FLFA 4R81A 2ZM5A 4IDNA 5JG7A 4C05A 1Q1QA 3R3HA 3MJFA 1JSCA 5SZIA 5G0SA 3DFIA 2X22A 4M0EA 3TG8A 4CZ2A 4FYYA 4DRZA 4J29A 3D1LA 4D57A 3TL2A 2ZSUA 3PQDA 4G0MA 3AR2A 4NCJA 3G2QA 3IQXA 4AZ3A 4N4AA 1XAJA 2WWGA 2CB9A 4OXKA 1PGJA 5CDFE 1B2LA 3KLPX 4PX2A 1FXWF 2OYSA 3AZOA 4WOKA 3UOGA 4EG8A 5TQVA 2H1WA 1FP4B 4DQKA 3UMVA 2WIDA 2VQDA 3RTGA 5MFZA 3ZS8A 6YASA 1TF2A 1C1XA 4J4BA 4PF1A 4J0KA 5CVCA 1MAVA 1ZNYA 2Q49A 4ZCRA 4QXQA 4NRDA 4DJEC 4D45A 3WL8A 2X9GA 4IWXA 4QNNA 4B3HA 2XOKA 4PRZA 4QPZA 5GADl 1E4OA 4YREA 1G19A 3A6KA 5ES3A 3VDMA 1JFFB 2G9NA 1T34A 4CIDA 3O1JC 5AJUA 4KL8S 3GGSA 2J0EA 2FPPA 2PBRA 3B78A 5ARCA 5IH3A 2WQ7A 1XTBA 2FV8A 2OHGA 2GPAA 1VCHA 4IJUA 3CR3C 4BNYA 3A27A 1FOEB 1TTPB 1U2EA 4QJ3A 4NH4A 1PQUA 1OREA 3L93A 5A9TA 4EYKA 1XPUA 1J09A 1S2NA 4PGGA 3HCWA 4UBLA 4PLTA 5DXJA 2X8JA 4PYRA 3WQHA 1JDBC 4N03A 3LQ2A 3BX1A 4R3WA 2F59A 4AF6A 4D9GA 3K0CA 3LQKA 2J7PA 3W5SA 2EWMA 4OTZA 2WICA 3KUDA 2VHZA 5F3RA 4AROA 3DSRA 4XPIA 3VR5D 3C3YA 4I2NA 4BNVA 4LOAA 2UZAA 1ZI6A 3OX4A 1Q21A 1ZJYA 4G36A 1R6VA 1JA9A 3CM0A 5CBPA 3F6EX 4EB0A 4EY6A 4QOGA 4PR0A 4BNDA 3GEBA 3E03A 2ZJAA 3PG5A 3VNQA 2YXBA 4RDCA 4ZO6A 1DC5A 3BXGA 4RTRA 1GSIA 1JR3D 3OIWA 1P5ZB 3NI2A 4XIGS 2GCNA 5L7TA 2WEKA 4FLEA 4JJ7A 4NZNA 4IHAA 1U3DA 4YT5A 4ABTA 3QV2A 3C3XA 4HEA1 3LGSA 3P97A 2D1QA 4GWLA 1WVGA 5EZYF 3DXXA 2AXNA 2QN3A 4JC8A 2FPUA 4TT8A 1GLNA 1MDFA 2OESA 2VJKA 3AH8A 3II6X 4XA8A 3VPAA 3ER9A 1BX3A 4S12A 5BUCA 5LQUA 4OF4A 3JQAD 2MCFA 3T06B 4YK7A 4KNWA 1J8DA 4HNGA 3AB7A 1XCBA 3CVJA 3NHJA 4AJ4A 5DXFA 2BIFA 2DPLA 2VI5A 3C6KA 1OTHA 2AZMA 2AZXA 1ZMTA 2VCHA 1YJ5A 2RBGA 4ZTBA 1CHDA 2JFNA 3EEFA 1JS1X 3MQ4A 3D0RA 3CCFA 1J5PA 1I51A 1NYQA 3GFTA 4Q02A 1GARA 3RHTA 4EELA 4EQZA 1J2TA 1M2EA 4TZKA 5JANA 1SR8A 2C03A 4GHWA 4P35A 2QL9A 3DHEA 2HLPA 2ILVA 3ETLA 3FWYA 3P9QA 4NJMA 4DUZB 2VPQA 1IOLA 3K9BA 2V7WA 4R0VA 5DYIA 3VU9A 3PA6A 2CD9A 1UJ4A 4ND4A 4UXIA 1T0PA 2SICE 4JODA 4RY8A 3NUGA 3HN2A 2XUOA 4JLBA 1BO6A 2F64A 3VZDA 2Q3JA 1NMSA 4U7PB 1LPAB 1M7BA 3FVRA 3ORQA 3G9ZA 5B6IA 3DDHA 3DBVO 4FFNA 1RKBA 3CW9A 3OM8A 1F0PA 2QN7A 3T1TA 2JCYA 3CR7A 3KQSA 4TYMA 2ZJYA 4U39A 1CJTC 1JFRA 3L8HA 4YQFA 4CQLB 4QODA 1SUIA 2Y1OA 1Y8RB 3EBOA 3EFHA 4Q47A 5BW6B 2F3PA 1G20E 2C58A 2FEMA 5M29A 2O7NA 1IY8A 4HLQB 5C51B 3AW9A 1A71A 2IDMA 4B3SB 3VU9B 1RR6A 2IH5A 3Q0TA 1E2NA 1E9EA 4EVRA 2J33A 2P5TB 5BXQC 4WMLA 1S2IA 5FHQA 1D4AA 1KAOA 1GPNA 1SU4A 4LDPA 3VH4A 2FPLA 3QPDA 4ZI2A 3AEUB 2FFRA 2P68A 3MC1A 5A6SA 4YAUA 2X4IA 3EEBA 3WK7A 5FBHA 3RNOA 5KNDD 3ENZA 3JQAB 4DV4B 3DONA 4JI3B 2GHIA 2QSZA 4TRNA 4GDMA 2GPTA 3CJTA 3RSLA 3BXXA 3KJFA 1OKKD 4QGHA 5B7PA 1JHYA 5HKOA 2OZLB 1A5TA 5I7RA 5EXSA 1I3LA 1D0VA 4QFDA 2ZYHA 3GNSA 1L8LA 3LFHA 5CIYA 2OPBA 3TKAA 3CT4A 1Q19A 3CW8X 1JILA 3BIOA 1NR7A 3HSYA 3PXDA 1AQNA 3A36A 1I7PA 4LMAA 3HR4A 2ENWA 1AMNA 3RU9A 2XXJA 4FYIA 5FV7A 1ZQ9A 2VDUE 5BN5B 2XMZA 1C9EA 1PYOA 4G23A 3OZSA 5BV0A 1J8FA 2QD2A 2V7GA 3B1WA 3RVLA 1SQ5A 1R4MB 1C2TA 2W4MA 2WWTA 4N48A 3AIOA 4OQQA 1P1JA 2XA9A 2CYAA 3P9XA 3QGMA 3U09A 3PV0A 1Z29A 1QKJA 2WZDA 1RWKA 1UKCA 1FVXA 2IGBA 3D4OA 5EVJA 3DNFA 4IQ8A 5B1SA 4RQTA 2I6FA 4GE3A 3ML1A 3VPCA 3NBKA 1KJIA 3JRWA 4E12A 4ERXA 3RJMA 4Z4CA 2X4LA 2ID8A 5JLJA 1N1DA 2QB5A 3ASVA 2I3DA 1FFDA 4V0KA 2WU1A 1W8DA 3FDJA 1XALA 3ZWCA 4Y2GA 2EZ8A 4QAJA 3B52X 4FC6A 1E8MA 3ZGNA 2EERA 3IP1A 4CUJA 4PX5A 2AG8A 3K8QA 1TMKA 3M9XA 3PJFA 3RS0A 2GTHA 2XCTB 2H2FA 2W2LA 4OBBA 4GSKA 1QZUA 1WXWA 3DE1X 1BGXT 4Q6WA 1AKMA 3NBYC 4QPDA 1L4EA 2P4QA 5BVHB 2IHYA 4YQYA 4MUKA 1FFBA 3RASA 4BU0A 2PZ8A 3SXUA 3DVQX 2VH1A 2A3NA 2IU4A 1XQWA 2IZOA 5CYOA 3TVDA 1RMTA 2WU3A 2HDWA 1II8A 1X7XB 4O33A 4Y1FA 4B44A 3OOYA 4CM1A 1AIPA 4CJXA 1W47A 1T0IA 5FOVA 1TKRA 2KW5A 4R01A 4ZYXA 5FOQA 4IPTA 1EUCA 1FC0A 3OMXA 1B42A 2ORYA 3FNEA 4FX5A 1E1CB 1PWEA 2Q07A 1CIVA 3PX3A 2Q6VA 4OXIA 4X97A 4JR0A 1U11A 4LFCB 3SEQA 3HKEB 1D7AA 3NCHA 4IR7A 5I9LA 1HDRA 1X1BA 2OBYA 3PI6A 3TQSA 2WAYA 4C4AA 1IHOA 4O4IA 3PI7A 3IPLA 4Q15A 5KTRA 4RQAA 2Q45A 3T99A 4BPBA 3H5AA 2F6RA 5DXAA 1P33A 1XR3A 4M36A 4WXEA 2HSWA 5J23A 2Q5FA 3AW8A 3LI2A 1A7UA 4YYEA 4M86A 5BUZA 3NNSA 2ZI4A 2YV5A 1JKMA 3GUUA 4D3XA 3WSWA 1VP9A 3GA0A 3NNDA 4O08A 2QU8A 2FEPA 1YR1A 2WDPA 4QUGA 3ILHA 1B41A 2YQ5A 5F21A 3WE7A 1H2EA 2GJSA 2JRLA 4YJHB 2J9GA 3Q6IA 3UF0A 2Z6UA 4DBLC 3ZBPA 1USGA 3LXRA 4PHGA 1JVNA 3REGA 4RE6A 3RUFA 2ZWPA 3TNJA 1Y8RA 4OVKA 4BO9A 5DLYA 1B3BA 2WPNA 3CNQS 5IDYA 3ZJUA 1GTVA 4EJMA 3OLWA 1GPMA 1XA0A 5T6BA 3ZU6A 1YHZA 2UUOA 2WJAA 3WZ2A 1VPVA 3JYQA 4QTZA 4WNAB 1QH0A 1E9SA 1YJQA 3AERB 1XZEA 3NHSA 1GCOA 1IDN1 2HIAA 1NFQA 4QLBA 1OH7A 4BUCA 1GQOA 3PLAE 3V97A 4GXQA 3T9FA 3MINA 5HQ3A 5B1EA 4IDBA 5KAPA 3MJCA 3OZWA 2Q6LA 1DV2A 5CDUA 1C8BA 3TM5A 4EUFA 1HDYA 1KOLA 3I6MA 3IRUA 4LY0A 2Y1KA 4N12A 1QB7A 2ZT8A 1MG0A 4PFQA 4GPD1 3HBLA 1TZBA 4YCLA 3SYRA 1XLUA 5JVDF 1C9DB 4JI7B 1JVSA 1WNTA 5KWSA 3AJEA 5I4BA 1F1BA 1XZIA 3IKLA 2EBFX 4FOPA 4C2UA 1E3DA 2J85A 2WU8A 1RMYA 5KNCH 1O89A 3WXMA 3SSOA 4EHIA 1BDBA 2R6ZA 5EYPA 2A1TS 1UXGA 3MBOA 4H7IA 3ESYA 4JJKA 4OI2A 4C5CA 1S1CA 2XGSA 1OT5A 2G9VA 1P1RA 4N5MA 1NAIA 4GLLA 5D2CA 2O5CA 4KAFA 1CUXA 1EWYA 4MVJE 4N5LA 1QTIA 5GIOE 5FWAA 2UYOA 3L0DA 4XR9A 4ZI5A 2PN1A 5JYCA 3VI4B 2NYRA 4E5MA 1HE4A 1ZMXA 4R8RA 1XVUA 3C3JA 2C9CA 2FX3A 3EEYA 4UNNA 1CUHA 2HM7A 4DXHA 4U6SA 1FE8A 1RYBA 4FXPA 3AT1A 1NIJA 1RPJA 1U0EA 3LQQA 4KO1S 2PS0A 3PL5A 1Q92A 2ECFA 4Q4LA 3UTDA 4UPEA 1OBOA 1WMFA 4G84A 4PPYA 4UUOA 3WLPA 2WQ6A 4YRLA 3KSUA 5F4BA 1UJ2A 4QUJA 1SZPA 2ZT5A 2XGJA 5LP1A 3TK1A 3K30A 4ZOEA 3M82A 1SD5A 4YEDA 1RXIA 4RMIA 1KF0A 5HIJA 1U2TA 3FCOA 3H16A 5JI2E 3LCVB 2GCGA 3K6SB 5LQNA 2P9ZA 3AFIA 4JNKA 4JU9A 3TPZA 5JPCA 1CFJA 4MVXA 1BW9A 2CXXA 1NW9B 2BV3A 3FH0A 2E37A 4L8YA 3W3ZB 2VYCA 3FVWA 1UJBA 1I7SB 4QEKA 2BI7A 4J49A 1Z35A 5FTWA 1YUMA 2Y6UA 3K7EA 1ESMA 2IUUA 2I4TA 4XASA 3R7WB 4RD0A 3RBAA 4F1KA 3QNUA 5JSKA 4YCSA 4JB3A 4DE5A 1EP2B 1KJ8A 5D5HA 1TCCA 2BM9A 4YCBA 721PA 5C37A 2EKQA 3ND6A 3FPEA 1MKYA 5ESXA 3AERA 3U7IA 2F8TA 1JXMA 4IDEA 1UADA 2AOUA 1Z8NA 2XE7A 3M81A 1EHYA 5EP2A 4BOYA 5KWJA 2O8EA 4WN3A 3WP0A 3F5MA 1QF9A 3VPDA 2C4TA 4CMAA 1Q7EA 2CLIB 2C77A 4PHHA 3VR2D 2VYVA 4UC0A 3H9QA 5DYNA 3ZCUA 2C4HA 3DLCA 2YINC 3C6YA 3OAAD 5E3JA 2NUTB 1YKSA 1F14A 4Y6LA 1XTZA 2I6TA 2D8AA 5GJCA 2EC5A 5GJBA 2FN3A 1E3WA 1NBMA 3PXUA 4XTRA 1MABA 4R16A 4B7AA 2A9PA 3PGJA 5ICSA 4NYMR 1DARA 3OJCA 4NYJR 4MW6A 3UVEA 1WMAA 4MDEA 4PBTA 1IMJA 3DTTA 1L7DA 4KHZA 1FDIA 3OPQA 4DSNA 1DBSA 1OWOA 1WQ4A 3WLNA 4FGZA 3GFFA 2ZYAA 4ENVA 2JFUA 4BIMA 1YZTA 3A70A 5TX7A 1JHVA 2QYTA 1K7SN 4MVJF 821PA 1E2BA 2VPPA 5CJPA 4PC1A 5AXBA 4JB0A 3FCUB 3E7XA 1U4OA 4UBKA 1F7VA 2XVXA 5ADHA 1SXHA 3HKEA 3NLLA 5L51A 1SCQA 2WVGA 2Q29A 1JJFA 3R7DA 3CVWA 4WLNA 4OI1A 1FTYA 1R6TA 2CL0X 2H1OA 1A95A 3IKTA 2W2MA 2YVKA 1WBDA 1UANA 5JSZA 4JLNA 2ZBGA 2ZQ5A 2DPYA 2H18A 1KDZA 1CK4A 2IP1A 3CKYA 3LC7O 1YDGA 1CRQA 5EE3A 1XUOA 3LUKA 3GT0A 3PDCA 5DI3B 1VLMA 3KOOA 3GLGE 1DPGA 3NT5A 3E58A 3IILA 4JNCA 2BKLA 3MT0A 3HCFA 5KDLA 1G63A 1QKKA 1QHGA 4JBLA 3T41A 3Q5DA 2MMCA 4EFKA 1QHYA 1GAXA 2DJ5A 2OO5A 4UAVA 3SS7X 1E2FA 1W19A 1X7ZA 3DEHA 2WVHA 3V1LA 1IRXA 1GL6A 1LWNA 4ND2A 3BGVA 2YV1A 4WCVA 3UCXA 4EB3A 1LSSA 1YE3A 3M2PA 3THXA 1UZAA 2G5TA 4FGWA 5FNVB 4EYOA 4TWIA 3TM4A 1NQTA 4QL3A 4CN9A 2JASA 5HFNA 4DMMA 3N2KB 1K3UB 1Q74A 2J3HA 1EDBA 3ONWA 3F4KA 1LH0A 4NFYA 3FF4A 4CIWA 2OFWA 2G5CA 4WCDA 2OFOA 1EG2A 1D9XA 3FUTA 1KARA 1IIBA 1RPTA 3JVEA 3V00A 2FHPA 3QMVA 2PL9A 5TJHA 3EWSA 2CUTA 2UYYA 1KAGA 3NOVA 3QI7A 4H59A 4BTVA 4IEEA 5KQMA 4UU1A 3DMFA 3SZUA 2BGUA 2AK3A 2H3EA 3VTFA 2WE8A 5J63A 4W1RA 5E4YA 1T0JB 2BOVA 3LWZA 4AN4A 4O6VA 1SQ6A 4PGMA 1T8UA 3AI3A 4EITA 7AT1A 5ALYA 3F73A 4I1PA 3UHFA 5TV2A 3ABIA 5GIPE 3RC8A 4OD0A 3DV0B 4JBIA 3QSGA 4TRMA 1LK0A 2CXQA 5JWHA 4PZUA 1P7CA 2JJQA 3P20A 3ZJ4A 3OBIA 4KXFB 4RTKA 4ZYTA 5ADWA 2YW2A 1A5AB 1NU8A 4I8DA 4QXAA 1LLFA 1REQA 3MS2A 2EJVA 5J47A 4C01A 2FR1A 3D7SA 1D7OA 1T1JA 1DQRA 1R0LA 2V0CA 3AP1A 5P8WA 3A26A 4BZZA 4M87A 5IS2A 3KV3O 2WYVA 2GAJA 3HWX1 3P0FA 4FBGA 4TXNA 2B94A 5HUQA 4WA8A 3B1KA 2AMLA 4BNLA 2F55A 2J6CA 2P7HA 4LRXA 3AK4A 4K2HA 1SY7A 3DV9A 4B8WA 5K0FA 1RNLA 4FSDA 4UHDA 4NHEA 5FORA 1P9RA 2PZFA 3H1EA 4LCJA 3O8CA 1QX4A 2VTKA 1IULA 2V7UA 5EMNA 2K2QB 2P9GA 4MS1A 5I4IA 1FRFS 1UFKA 2HIHA 1KJWA 1YWGO 3ZDRA 3TECE 4JSRA 2QE7D 4DIBA 1PJLA 2LVBA 1QFZA 1XQVA 4GLJA 3DUFA 4ARVA 3QEAZ 3URMA 2J5BA 1AO0A 4AURA 1ACLA 2QPTA 2GSDA 5DBEX 1LZKA 1BX0A 2PU7A 3M5WA 3ITKA 4QDJA 3B6ZA 4B6RA 1QIEA 3FM9A 3JQGA 1KO4A 2BFOA 3FNBA 2V7VA 5AR1A 1V5WA 1MX9A 4H7EA 2B3DA 3P45A 3ECSA 3W05A 3D6TB 1ESCA 4LF4B 5GP1A 1Z8HA 4YP6A 4ECAA 4Z3OA 1FZQA 2CLDX 3DDUA 2CF6A 1O6ZA 4B6FA 4F71A 3W8RA 1BE0A 4W6QA 4ZCTA 2FSVC 2VBFA 1N2CB 2AN1A 1USWA 5BSHA 4XR4A 1OZGA 5YASA 1XMOB 4IWYA 1YACA 2XB2A 2Z8YA 3LPAA 4YGXB 3ICOA 5B58C 1E2UA 5JCOA 5KSYA 3KR1A 4QXMA 4YRPA 4ZI7F 3QKRA 2RGYA 1UAYA 2QZ9A 2WHPA 2Q8NA 4R1SA 1CY1A 3ZNNA 2VJCA 4OLJA 5CURA 4EBBA 1RYFA 4URXR 2C4WA 1AT1A 1A9SA 3BJEA 4M1YA 3PFCA 1CB0A 3PXXA 3ES9A 3PFHA 1GZDA 2CMFA 1AUPA 3LJKA 2XV1A 2GM4A 5ITWA 4R8SA 1KS9A 4F2PA 2DT8A 1U5BA 1LVUA 3IBTA 1E0DA 3WLKX 3GXBA 3RIEA 4FNGA 4YJ3F 3ONNA 1JDNA 1OWPA 3RADC 1J4AA 1VC2A 1E5VA 1D07A 1Q0PA 1TFUA 1U0NA 2OEPA 2O3SA 4ZVPA 2YN0A 1T9AA 1ZGJA 2FG5A 1VRWA 3GGCA 1ZHFA 1X80A 3B6JA 4WA7A 4YYZA 2YZMA 1I6WA 4G3XA 4RDIA 4WINA 2JBWA 1GQRA 3HB0A 1YJ8A 3PNMA 1VMEA 3ENNA 4FMCB 4GU5A 4Z9FA 4RJKA 4C1BA 5B2EA 1ZMOA 1U81A 1XEXB 2BEVB 3VDQA 2WYOA 5A5GA 5J1SB 3ORRA 3SJAA 1IY2A 2YHIB 3B7WA 1G42A 2FR8A 1YRAA 3G68A 4LTDA 3PHHA 4IJWA 1Q5PA 5EIBC 4ZK6A 1XF9A 4X1IA 3KUXA 4R9VA 1KK1A 2BJWA 1V8PA 1PR0A 4I14A 5BYKA 1XJ5A 2N46A 1BWSA 3TZHA 4F4CA 3L6CA 1V11B 4TWZA 3JAMA 5CX1A 1USIA 3ODPA 2PO5A 3IKJA 4Y6QA 1IZ9A 5I9TA 3LDGA 1VOTA 1ZD9A 2V97A 1IEWA 5D3MA 1C1DB 1N6RA 1PJ4A 2QRQA 2PZEA 1QU2A 4BVAA 2ABWA 1X9IA 3D31A 4CU2A 1P1CA 2WSBA 4V0OA 4DM7A 3EMBA 1UMBA 2PVCA 5JMTA 1DEAA 2WB4A 1MH9A 2W2QA 1SRQA 1SC9A 3P0RA 4TZTA 5JSZB 4OHKA 5JZSA 1XFDA 3C48A 3H8SA 3HJNA 4LC1A 1F7UA 5KUTA 5JPDA 4BNHA 2AN5A 3A14A 4GE0A 2QIPA 1JIIA 2OCPA 1GPYA 2SCUA 4YIHA 5F76A 2IW1A 1DT5A 1KP2A 4NZ9A 4UMDA 5AKIA 3AXTA 3NIWA 4LFAB 1LLDA 3DTVA 2FMIA 2H08A 1XAGA 1P7YA 1U0JA 2ZR8A 3AUJB 3G2KA 4CMEA 3LU1A 4JLPA 3ZZMA 1K6XA 3BF8A 2A6PA 1AX9A 2HQSA 3FHCB 4B75A 2GK4A 2X19A 2ZATA 3OZIA 4TV8B 2ANCA 2WSIA 2EHDA 1QCYA 3IP7A 4MQBA 4RL4A 4S2UA 2P2CA 3N2EA 1LJLA 1QC5B 2QTAA 4JI5B 1IY0A 3DV0A 1W4CA 2FXVA 2VH2A 4M46A 1PX0A 4KG7A 3OU6A 5DHAA 1H9BA 2B30A 4PZLA 2AN4A 2JKZA 2RKBA 1F4PA 1YNSA 3LD9A 2QL7A 2XCUA 4E3ZA 1WCYA 3EXEA 4H1TA 4X93A 4F96A 2DJIA 1R0CA 5K45A 2JGLA 2XNCA 2PGOA 1PEAA 2BGMA 1SQ0A 4EPTA 4PYLA 1B7GO 2Q4OA 3R0IA 5ANRB 1B74A 2A1UB 5KNLA 1HK7A 1ZG3A 2O2IA 2AMYA 4GVXA 4R1MA 4XX1A 5E4TA 5K0TA 4BLSA 4WOBA 5DNUA 4Q37A 2FMKA 2I4LA 3MINB 5DCYA 3NT4A 5HQ3B 1E96A 4LAFA 3T3GA 1N36B 3EVGA 1QGYA 4HFNA 4KI7A 2GXSA 4C06A 5T5QA 4V0QA 1R0YA 1N92A 1WKCA 2CY0A 4J0GA 5DHQA 1TOAA 3TIFA 3WIEA 5JFOA 1HTWA 4MV3A 3WIBA 3I34X 2P4SA 4OHWA 1C7IA 1GEEA 1YE8A 3IELA 2GR9A 3L02A 4HK4A 3V1KA 4TSRA 5FF9A 1ZPDA 2IWRA 1AK1A 3C1OA 3LBYA 2PXHA 3MWGA 4JLMA 1SXJB 3W3AH 3AVWA 5DYYA 1K66A 1N6OA 1DJLA 1NF2A 3RTAA 2UZ4A 3RH0A 2CDNA 2AC4A 1UBSB 9GPBA 2D4AA 1BHSA 2PNFA 1OX4A 4PZEA 2F3RA 3BFVA 1EH5A 3NRJA 3S40A 4AO6A 3ZWPA 1Y80A 4TWBA 2XBMA 3LXXA 2RGBA 2WABA 2DBVO 3D8NA 5EA2A 2QWXA 3H9GA 4QASA 4DR7B 3WWYA 2ZI5A 2TMKA 4L9RA 4OQMA 4WK0B 5EUCA 3QXGA 2H2GA 4V1CI 3LPMA 5AJWA 1ZJ6A 3BS4A 1FFEA 3RK1A 4FFLA 4PTLA 2VNJA 3QBVA 3KOXA 5DCUA 3DPSA 1Z62A 2G6TA 3C6XA 1B0ZA 3CC8A 3K0FB 1QM5A 2B7CA 4EGJA 4POOA 2GFIA 3RAEC 1JQJC 3K73O 4L8GA 2EP7A 1LBHA 3HPQA 1QRRA 4WJZA 3F97A 3GRZA 1E9BA 1GT6A 1QGZA 2XNKA 2DFKB 4UUPA 3T1NA 3VYWA 5ELXA 5BQPA 2XH8A 1ZK3A 5J2UB 3SQLA 4E2ZA 1NUAA 1M6VB 3T9EA 4EUNA 5TLSA 3KYJB 2FZ4A 3QITA 5BT9A 3AKCA 2CNWD 4TLAA 2JIRA 3G5MA 2GYUA 2NO5A 1X87A 4DR5B 3DEZA 4MVCA 2CW5A 5T57A 1DQNA 3N8GA 4QGFA 4B7UA 3CUVA 1BDHA 1URPA 2WR8A 3AB8A 3ANMA 3OFJA 5ERGB 2O8BA 2CN1A 1ISIA 4NAHA 5JAIA 1YC5A 1Z6YA 3HCRA 1MOSA 1N0UA 1OX5A 2UUPA 4J76A 1F0YA 4R6WA 3NETA 4JLKA 1XO1A 2PSFA 3IUPA 1ZGZA 4NV3A 2X0NA 4O2AA 2DWOA 4NP6A 4AZWA 3LM8A 1H6CA 3UH1A 3WDSA 5JRJA 1Z16A 1I7DA 1Z12A 2BTQB 1VIVA 3HDQA 3IBFA 3L1JA 2FSIA 1E2HA 4C0LA 4QZVA 2HJWA 3IMKA 3PC8A 4P4GA 2M6LA 2ZSFA 2VJLA 2OLJA 1I14A 4GXRA 3BJRA 4MAMA 5AJYA 4BFUA 4KXQA 4CM4A 1WA5A 5AM2A 3T5CA 3EPKA 3SXJA 4C03A 5G40A 4AMGA 4CF6A 5A9SB 2W9XA 3KU4A 3P96A 3T1OA 2VLBA 1Q2UA 3FROA 4EO7A 1NATA 2PL3A 4O4HF 1MFZA 1C9NA 2ACEA 2EYUA 3F7NA 3WR5A 5BNFA 1A4RA 1N2EA 2JIBA 3I9JA 2VLIA 2ZZKA 3EZ6A 1ZVJA 3ZHUA 1IZYA 2WJ3A 5KX5F 6ADHA 1EM8A 2A1IA 2C5GA 3C6MA 1F2UA 2XKAA 4MI3A 3L8ZA 2WUGA 3LWBA 3RT9A 4AZ0B 3PZBA 4ZAGA 1PCXA 5BN3B 2O7SA 3FCCA 4WK6A 4D9HA 3OM9A 3DBLB 3PFKA 5ALQA 1QK5A 4ZPXA 2BEWA 4KFUA 3JQ8A 2N0SA 4GR4A 4YMHA 2MYUA 1YCFA 5B7NA 3DYVA 1J6UA 4GX5A 2PLNA 2BP7A 4IF6A 4OH7A 2HFKA 3IDZA 4I81A 3MYYA 1W4RA 1X8XA 3U7RA 1NW3A 3HUTA 1TEZA 2QLMA 1VHLA 3A1WA 4I3HA 1IUNA 2XOKD 1V1MB 1HRKA 1EWVA 3EISA 1Z0FA 2NXEA 4KDCA 4Y2RA 1ZP6A 5EXTA 2D1SA 5TDHA 2RI0A 1CQPA 1J00A 1UBJS 5ERYA 3GMTA 3AM4A 3L8GA 3CXUA 5FAXA 5IKXA 1CF2O 5A5VA 3CUKA 2A0YA 2Q50A 5HA5A 1E9RA 3WHIA 4J0HA 3T52A 4BC1A 1PR4A 3LYAA 5AMXA 3ISJA 1RQPA 5HCNA 1LNZA 4EEKA 2HPZA 3IPRA 3C6QA 1EUYA 3DAOA 2YBDA 4QJIA 5IN5A 2ZK7A 5HR5A 5JCJA 1U8FO 3FZQA 5E8JA 4EJSA 1DINA 1N1GA 3H2ZA 4OQZA 4D6PA 1KGDA 3SLKA 3EZ9A 2QGNA 1TEHA 2H8GA 4O2BF 4OUDA 2MMGA 4EPVA 4NMWA 4UZFA 2VOEA 3DP7A 1EWQA 3EIEA 1TUEA 1FSGA 2C9ZA 5HXAA 2QTNA 3GFPA 1VB3A 4ZYZA 2BD0A 1QB8A 2VT7A 3VYVA 2JLBA 5DLQC 3HJFA 5CFNA 1DAHA 5FA8A 2O2DA 1D2RA 1O6BA 4D80A 4RTNA 4OHYA 2XUZA 1TYDE 3PR2B 1FW8A 3NMUF 4G26A 1QH1A 2A4KA 3AHJA 5EWMB 4EYEA 1YC2A 3I0NA 4IV5A 3T5AA 1OY1A 4FM9A 3ODGA 1RRVA 1XNJA 4RDXA 2XOEA 4G81A 4EHHA 1SOVA 1J7KA 4G0QA 2GN2A 1V4BA 4Q9HA 5EHZA 1BEUB 4LBVA 1SHZA 4ZVNA 2L17A 1S1MA 1IONA 1E77A 1GG2A 2I6QA 2R7AA 4B45A 1F38A 3K2QA 2FEKA 3LNTA 3U2QA 3ZY6A 5CFPA 1HEIA 4NEGA 1IB6A 2G82A 4UFOA 4BB5A 5CA0F 1MB0A 3GVPA 3FUCA 1J5EB 2RCNA 3GH1A 1YOVB 2O06A 3ADCA 3H5TA 1N3IA 2D06A 1XPOA 2J3KA 3AZQA 3EB9A 1F20A 2DBQA 3BIJA 2HU5A 3IGFA 2V98A 5BORA 1ARZA 1GTG1 2FGKA 1SUFA 2PUHA 3GRAA 1O77A 3LHDA 1W2GA 4RSRA 2LKDA 2IVZA 2XUGA 5L3RA 1KWGA 1S89A 5FBQB 1JH9A 1VBKA 1T2FA 2ODNA 1HURA 3FRHA 4XZ3A 2OVBA 2W93A 4BVFA 1V8BA 1HFJA 4UNIA 3QUSA 2JZNA 1EX7A 1Y5NA 3HJTA 4YBRA 4K26A 4KN5A 5FPQA 2X8AA 4DW8A 4GMDA 3LKVA 5GM2A 4QRDA 1ENOA 2BGJA 3JWIA 4KE7A 1DB3A 4LN1A 3MIIA 1NF8A 1SIWA 5EMHA 1W35A 2NU6A 2YV3A 3KBBA 1L8QA 4JWTA 1Z83A 1KI8A 1NBEA 3AOEC 3OLZA 1ONSA 4PX9A 5GPBA 1JJBA 3A2LA 3WHKA 4B3GA 4S3MA 3SP1A 5EFOA 4AKGA 1LI7A 5EJ4A 1DXQA 1ZRHA 1XRPA 2AZ4A 2BBTA 2FVXA 2OCIA 3PDIA 4NXMB 3WYAA 2XA1A 2PY6A 4RV9A 2HYDA 4Q00A 2P90A 3SFTA 2W6JD 4DN6A 1PFQA 3NC1C 4H1VA 4MZXA 2X8LA 4OK3A 4DDMA 1RZVA 2VCYA 5LB4A