3PUKA

Re-refinement of the crystal structure of munc18-3 and syntaxin4 n-peptide complex
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
579
structure length
552
Chain Sequence
ERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFNKIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLEEIPKLMKEISSTKSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTEENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYRTNYLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Syntaxin-binding protein 3
publication title Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 152
structure length 552
sequence length 579
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pukA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 3pukA03
4CCAA 1FVFA 5BV0A 4KMOA 4JEHA 1FVHA 4BX8A 3C98A 5BV1A 4BX9A 1MQSA 4JC8A 3PUJA 5BUZA 1EPUA 3PUKA 4JEUA 2XHEA 1Y9JA
chains in the Genus database with same CATH superfamily
2YOFA 3ASVA 1ZUHA 5A06A 3I5AA 4PBSA 3SWWA 3IUSA 5IANA 1JAYA 1B76A 2ZRPA 1DDIA 3LPLA 5I4CA 1C30A 5J2TA 1KU6A 4PFJA 2JIQA 1HYEA 1ZK0A 2OYSA 4WASA 4JBLA 5KOHB 1BCRB 2OO5A 2YL2A 1ODFA 1RYZA 2KX7A 3AR3A 3KT3A 1J7JA 1H0HA 3N2GB 3BRWA 2RGCA 2OHGA 2NUPA 3IBGA 3NHKA 4BPRA 4YMWA 1K1AA 4OJNA 1UBHS 1T1GA 4TT3A 4B34A 3MS2A 3IBYA 4P9NA 4LXYA 1JIJA 2QSYA 4KTTE 1XU7A 4JOQA 2JHAA 1NZFA 1Y9EA 2ZYAA 1RMYA 3EMVA 2X0DA 2BKEA 1ZJ6A 3BXFA 4BMVA 3FP3A 1H22A 5C2YA 2VP6A 4A73A 3T1YB 4YAFA 4YT4A 2VATA 4ZJYA 1YB2A 4ARCA 2PFGA 1F20A 4L15A 5DSXA 2QR3A 3T94A 5BQ3A 5KOYA 2DYKA 2VYND 2QVZX 5HIKA 4JJEA 4C2BA 4A1GA 2XQFA 4RYLA 1E2KA 1M2WA 4HI0E 1JPLA 3EFBA 1EUZA 1Z35A 3R5JA 5ADHA 5T57A 1R0KA 4IV8A 4ZHSA 3A4VA 3I9V6 3VPFA 3E35A 2CUNA 3F9CA 4H6VA 3ZDEA 2RG8A 4FR2A 2H11A 4OSOA 4EFKA 3ND7A 5BV8A 3DCJA 1Q84A 4N5NA 4U7JA 4K5CA 1BEZA 5IARA 1XMSA 3IBSA 4DYHA 4YO7A 3A06A 1UUFA 4BQRA 3CHMA 3PPXA 2I3ZA 4ESEA 1SUWA 1HKUA 2E4UA 4OK6A 4NU6A 1KY5A 2P9LG 2JGAA 5EESA 3JWHA 3FI9A 1IZ0A 1GQ2A 1LQUA 4ZVRA 2MIIA 1GXSA 3DKIA 4ZWNA 5FLEX 2VUUA 4JLDA 5GONB 2HNKA 3QVLA 1P5RA 1TRHA 3HXFA 2B1QA 1G21B 1T3GA 5JAHA 4GCOA 5HBGA 1ZNXA 4I3FA 1Z2OX 5AM2A 1J8MF 5DRYA 2GEKA 3K1JA 2FZWA 1O94C 4US2R 4Q3AA 4UMVA 1PAQA 3MMZA 4R8RA 4NAVA 1P2SA 3F47A 4XYMA 2HLPA 4D4MA 4UD2A 1KJYA 1N6IA 1Y4SA 3HP7A 1F60A 5DCLA 5ALRA 2VDVE 2D3TA 2EHDA 1XKTA 3T6KA 4CEHA 5E6UB 1ZKDA 3GJ4A 3T4UA 1YACA 1O8CA 3G8DA 1ADYA 4FHKA 2VP5A 1N0VC 4EMUA 2AOXA 4HRNA 1S64A 2YQZA 4DEVA 1I4LD 2VJCA 1WETA 4YJ2B 4HGQA 2TRSB 3MG9A 4J0KA 5M34A 3D8UA 1EUYA 3KBBA 3QY9A 5BR8B 3RIHA 2Q5IA 3DSTA 4KLCA 5CDFE 3GBVA 3IQGX 3G5MA 4O1OA 4ZK6A 3KLBA 5EIFA 2CKDA 1ECFA 5KKAA 3CN7A 1DZIA 2QY6A 5KNDA 2DBAA 3OUUA 3LY9A 4DLYA 4D46A 3W78A 1U5AA 1WUKS 1IN6A 1ONOA 1XVUA 3ZVMA 3FDHA 2QTMA 3RF7A 3V8RA 1UAGA 5TARA 2P62A 4DTCA 1X19A 5EUCA 2AG1A 3G2TA 3ADDA 4DQKA 1Z47A 4RS4A 3Q4AB 2W2KB 4IVQA 1MC4A 2Q3LA 2DPXA 5CDTA 2XDAA 1AS0A 4YJDA 1ABEA 1CUUA 3DL0A 2FMHA 4QRHA 4RPGA 2J8SD 4L8VA 5F12A 5LOVB 3H7AA 1RWKA 1DC2A 4U9HS 1UK8A 3TWUA 1HDOA 3G2JA 5JE8A 1MO5A 3M6MD 4JH0A 1E7MA 4CW7A 5AMXA 3TTXA 4N0QA 1TIKA 3VNRA 4MMXB 2BHTA 4Q47A 4NEHB 5JXWA 4X97A 2YASA 3DKVA 3V8QA 4OEHA 2I1KA 2VJMB 5DM2A 5DBFA 4WE3A 4ZT7A 1TX4B 3SD7A 1U7PA 5K0LA 1G41A 5EE3A 3FUJA 1NUTA 1U0OC 4OFXA 3NYWA 2IEBA 2CFSA 2Q28A 1A95A 4F3NA 4F1JA 3FX2A 2KCVA 5F33A 1HKHA 5KB3A 1F4VA 5ICFA 3WLRA 2GZRA 1CBUA 2JEYA 3T8MA 3QEMB 1YZVA 3PT9A 1JKJA 4I1UA 4BLVA 3PC3A 2BFEA 1MT3A 2Q6VA 4JNKA 4CV1A 1ZBDA 2FMUA 4US1R 1TEZA 1FFGA 4CT4B 3DVAB 3LBIA 5EXSA 4CFSA 4FN5A 2QG9A 3RIXA 3KSDO 1Y5IA 4O1MA 1NWHA 5E4FA 5I7OA 1CUDA 2JLRA 4FD2A 5EXXA 4LBYA 1PG0A 1R0LA 2I66A 3NUGA 1M2VB 4ODIA 4YFYA 2QGFA 4DMFA 2VCHA 4N8EA 4D97A 4U04A 4B17A 2RK6A 4D3SA 3UH1A 4DK5A 3VPAA 5AJHA 5B1EA 5JQGB 1ZNZA 2AOTA 4RL4A 1WSWA 4NCBA 4PUCA 4DMGA 2X58A 1UZLA 1HSZA 3IFSA 3CKMA 3KWJA 1C29B 2WM8A 1PQUA 1U8CB 5I7RA 1PX2A 4WCFC 3HL4A 4YIHA 3A26A 5C7IO 2Y9PB 2P2SA 5BNFA 2IZ5A 8ADHA 1CRLA 1XA3A 4CETA 4C43A 1G9TA 2BEKA 3DM5A 3QKRB 5JAOA 3K73O 1P1HA 4LQDA 1WOYA 4ZV9A 1RRMA 3ANMA 4QOFA 1JR2A 4ZYXA 2QQEA 5ICSA 2NZUG 3BHNA 2NUTA 4RK7A 2IU1A 2EKQA 5IMSA 3GVXA 2Y2VA 2L6BA 4DC9A 3N9IA 2YICA 1HFAA 1PK9A 5BXUA 5D6NA 1RM4A 2XR1A 3E4DA 2I6FA 1G8KA 1YAJA 2ETAA 4U96D 1HDXA 2PM7A 5JTTA 1GU0A 4Q9KA 1BTOA 1ZJWA 4W7HA 4E94A 1LRKA 4MS1B 4Y9RA 2WWWA 3LCVB 3SF8B 2Z09A 3LUFA 4D2IA 3LBAA 4I3HA 2KATA 2R1UA 3NJ8A 1NE7A 3N3AC 3WRYA 5ETJA 4Q21A 3VHXA 1WUIS 5FIUA 1TF7A 4DMRA 3NC4A 4YV1A 1SQ5A 2W6JD 3WYAA 4PYLA 5K0SA 2F9FA 3CZ5A 2XYQA 3LCCA 4IRXA 4B7CA 1HYHA 3W9SA 1RKQA 3E7FA 2WJVA 3JYOA 3RS2A 3OOJA 1RPNA 4GRIA 1KOFA 5KX5B 3EF1A 3BHMA 1FFDA 4RABA 1EFVA 1OD6A 3HB9A 4UWGA 3AVPA 3LGSA 2QVXX 3ZW7A 4BNWA 6REQB 3OQBA 2NTJA 4RDCA 2P9NG 1XFDA 3KT8A 1VIYA 3OJWA 4WFJA 4OO3A 3A9UA 5KYYB 2FFRA 1WIWA 1KVRA 4EDFA 4DV1B 4FR5A 1K4KA 4UU0A 4QXAA 1E99A 3H4MA 3RRBA 1LNZA 2ENWA 3O38A 1DI0A 4TN1A 1V96A 3WWZA 4CDMA 2GPNA 2VHVA 2BGTA 4C6HA 1VLQA 2HV9A 3BAZA 3ABLE 1PFKA 1SVIA 3LP6A 1E6LA 2ONDA 3MHTA 2YV1A 1DIOB 4P5DA 1I2MA 1VHQA 1YVEI 5LC1A 3GMIA 4HZGA 1LV8A 1SQ0A 1CUJA 3G1WA 1WB6A 3A6DA 3AY6A 3LY5A 4ALKA 3PVCA 3D8TA 3HKBA 3ZZUA 4ATNA 3C1TA 2AXEA 1IY2A 2WPDA 1OXSC 1ADCA 4FYHA 3PITA 1MBZA 3BB4A 4UFPA 3WK4A 3V80A 3DOCA 2V4MA 1WUJS 2C9BA 5HS0A 4RKYA 2IXGA 3SEQA 3UEOA 1DUVG 1DCMA 4DANA 2C07A 3B85A 4XQ9A 2RHWA 2CKMA 1AKNA 4AMBA 3LSTA 2BTDA 3ZDBA 4B8WA 1QTNA 1MR3F 3T5BA 5T4HA 1O87A 4FDAA 2EJUA 2Q9AA 3RARA 2PL1A 5JRJA 2F17A 3M6IA 1E69A 1FXSA 3T5XA 2Q9UA 3DE4X 1MAUA 1FLDA 2QW0X 4NCHA 2AX4A 1QR2A 4Y30A 1U8UA 4G1EB 2ISQA 1YHYA 3IHWA 2EFYA 4YRNA 4KQEA 1Q1QA 4U7PB 2MINB 1AN9A 1OWOA 1K89A 2EEPA 2ZETA 2DTEA 3I39X 1W46A 4WY5A 3QBVA 4KXFB 5JS1A 4GBMA 3ZHEA 3G2UA 1YUBA 2XCBA 3CQ9A 3T1QA 3TW8A 3W7VA 1JJFA 1UXOA 2HJSA 1NL3A 4A8JA 5CG2A 2LDBA 4BX8A 3W5HA 4UCQA 3OIYA 4IVPA 1E96B 2KMLA 3ZDYB 2L2QA 2CHQA 5LU9A 3HB1A 5MFZA 4FFNA 4UJ5A 5CBKA 5FR1A 3C39A 4C14A 1FJGB 1WBJB 1S2GA 3P5SA 4KV7A 5K03A 2GX6A 1ISPA 3A3YA 3GJ7A 1WX1A 3I9KA 3RJMA 5EEHA 3KPVA 1CD5A 1ORDA 4G0XA 1A7JA 2H65A 3C5HA 3D4NA 2NXPA 5F9HA 1QP7A 1ZZEA 5JG7A 3S2ZA 2IZ7A 5H81A 5ENPD 3HSSA 2FF7A 1IHYA 4OB7A 5KSWB 3WGOA 4E4YA 2YWGA 2H1VA 3DKPA 3F6SA 3EUFA 2ONZA 3TLEA 1E94E 2VHCA 2VRNA 1WBBA 3B82A 3ITNA 3PDWA 5EERA 4XPZA 1P74A 1NMSA 5EJ8A 4R8SA 2QGNA 4CBVA 4FZRA 4K1XA 2G9QA 2RGAA 5DK4A 2JJQA 3ENWA 1R6UA 1JX6A 5KNDH 4IX1A 4O2AB 5IS2A 2HTEA 5LZ2A 2CJWB 3PUJA 5KYTA 4KQKA 2GR9A 521PA 4DOMA 2O59A 4CG0A 4GWGA 4B2IA 4LI3X 3NHFA 4MO9A 2EG5A 3V5NA 3PDIB 3I04M 2JFFA 5H4HA 2XDYA 3WTBA 3VR4A 1FS6A 1NKVA 3VJRA 3DO5A 1CJUC 1NRJB 5KAMA 1CJKC 4KRGA 1R5BA 2ID4A 2FN8A 3QUSA 3A4MA 3NOVA 1T1JA 2Y1GA 4WA8A 2Q1SA 1UP6A 3DPDA 1TVKB 2D5LA 1IHGA 3FI0A 4ZAWA 5KIAA 5FHQA 2ZSJA 3RYIA 1LA2A 2N1MA 4KODA 2N1BA 1DUSA 3EXHB 4Q3EA 2CSXA 3IQFA 3TLKA 1QHSA 4ALMA 4CR8A 2QNIA 3S40A 2PRYA 4UTZA 2ORED 1XNRB 1XO1A 4FHDA 3WSTA 4NU0A 5K9ZA 4HWPA 1XPUA 3DMYA 4GOKA 3OJEA 3KKMA 1UPBA 4XJXA 4OHPA 5CMWA 3D6HA 1TOAA 1VBMA 2YQ8A 1XAIA 1UN8A 3C1AA 1RXYA 2C61A 3L8FA 4UHJA 1INZA 4HBGA 3IA2A 3AO0B 4YRDA 5KYKA 1DO2A 2Q41A 3R4CA 3URMA 4ZAZA 1JH8A 2H1WA 2W6OA 1YDGA 1YD7A 3RE1A 3JCKC 4A26A 1JG4A 4IKEA 3TAHA 3GR6A 1GCOA 5LLDA 3W04A 3JQRA 3VZRA 2V5VA 4EX6A 4ZI3A 1TMYA 4JLUA 4UTOA 4TSKA 4A2PA 1QGYA 3V4LA 3ERCA 1YR3A 2J59A 1RJWA 4QIHA 5EP1A 3LT2A 3SC4A 5F76A 1WDTA 5I7UA 4YRFA 4GAAA 5AI0A 5EQDA 1R15A 2RE8A 2Z9BA 2R5NA 3EZ7A 1JIIA 1D8EA 5FEMA 2QXTA 3FU5A 2WQ7A 3SHFA 5CEJA 3CVUA 1JAHA 2E7ZA 5CR9A 1H4SA 3E9RA 2Q4EA 2E0IA 3L84A 3BWVA 4KK4A 5DHQA 5BV0A 3W8EA 4P0QB 5IKPA 2P2CA 1NW7A 1NUUA 4WAFA 1YVPA 2JGKA 3V34A 1FPQA 4AJ4A 5TIIA 2QVBA 1A2OA 2Y92A 1R6AA 1WXQA 2BHNA 3CJRA 1XTUA 4DEYA 2P4QA 3C5RA 1V8BA 4R05A 3FLAA 2LSUA 4X61A 4ESOA 3LG2A 1E2FA 4Z0HO 4RK6A 4DM4A 4HYQA 1TTPB 3BMQA 1QK5A 4E5PA 1LRJA 5KBAA 2XSZD 3I3SR 4NJMA 2GD1O 2ZBGA 4OIMA 4G5HA 4OOFA 3UV7A 2AFIE 3SQWA 5CEAA 4ZOBA 3ROFA 5AJWA 3GW4A 3WBFA 2HPZA 4DZTA 4L07A 1DXYA 3L93A 3I72A 4D0NA 1KDYA 4Z0NA 2CBGA 1PZNA 4MV6A 3JCZA 2AZXA 1NTOA 1E5XA 1D03A 4YFVA 3X1XA 4UEOA 2VC2B 4MI6A 3GJXC 3QBEA 4G23A 2FX2A 3KYCB 3Q8MA 3MWLA 3TI9A 1DC8A 3O3MB 3FKSD 4I3GA 1XGKA 2D8MA 5TMPA 2WM2A 1SKUA 1T3LA 2ZBPA 3RAJA 3H1TA 3PWTA 2OY0A 3EN0A 3UK7A 5EJFA 4A8TA 2W42A 1XYYA 4LBZA 4C4ZA 3MOIA 1RZRA 4KR6A 5COBA 1OY1A 4JVSA 2W37A 2M1ZA 3LHKA 2VK8A 1G7CA 1SHJA 3M7IA 2NGRA 2NPFA 4AF6A 1USUA 2BFNA 3I9NA 4WESB 1E2JA 3EZGA 3WLTA 5DYIA 2WDZA 3EPRA 1HF8A 1DKMA 4FI3C 2QTTA 1E7YA 4I9HA 2LNIA 2RI1A 3E7XA 2ZB3A 4MHSA 2VRBA 3E2MA 4Q4CA 2RCYA 1MA3A 3M5CA 4OHOA 2V6GA 3RIYA 3U4DA 1TADA 2Q0QA 4WZBB 2CVQA 4QDOA 5C46F 4UBOA 2AE1A 1GR0A 2FPRA 4YRJA 1DJMA 1IN4A 3JQEA 3KZOA 4B6RA 1D3AA 4I1RA 4KUEA 4B3HA 3QY0A 3HJHA 4JLSA 2AB0A 3MJWA 3FHEA 2R85A 1AC5A 4RD0A 2XWPA 3Q7QA 3QU7A 3KOOA 1SCIA 1HNNA 1FFSA 4CIYA 1SZ9A 3UYLA 4G0YA 3BC1A 2KHZA 3T5VA 1VE7A 5JCZA 4CEIA 3QUTA 2V3WA 2VPWA 2P1RA 3HL0A 2PLNA 3H9EO 3ETJA 2LUOA 3UHJA 4BJ5A 4MUBA 1QF6A 1L2TA 4BUCA 3AY7A 4U2DA 4UDXX 1JIQA 5DWDA 3REQB 4K6MA 3B1KA 4QUDA 1YE8A 3ER8A 3RTCA 4IHJA 3WL3A 2HV8A 4KBFA 1N8SA 3Q6NA 5HTOA 1EXNA 3L6OO 3S1SA 3KHSA 4ZC1A 3DD5A 2O0LA 2BZ1A 4ZQHA 2RGRA 2P6MA 1ZI6A 1ZQ1A 5BSVA 5CFOA 1RXWA 4XYGA 1Z7BA 3SQVA 4GI5A 1YHZA 3EAFA 2IV3A 4MEBA 4MI1A 3A05A 2QP4A 2RFAA 1TXGA 4LSWA 3LXMA 1EYHA 5DISB 1JYEA 3JALB 2WXJA 3CHQA 2DGDA 4HAUA 1XF1A 4BFYA 1XHLA 1YT5A 4HAYA 3PQDA 1N0RA 3C6MA 2GCPA 1A8IA 2JFOA 3KXLA 1GG2A 1G6KA 2IXAA 4HGNA 3EPKA 2EJVA 4TXJA 4AZ0B 1ONPA 5JANA 3BZBA 3WI7A 1HL3A 2ORIA 3UFXA 1DGQA 1ZL2A 5AO9A 4DLWA 1A88A 5GGXA 3MLEA 2P90A 1CY7A 3L7YA 1RVDA 2WWTA 2O1WA 3BBLA 4AJ2A 2C84A 2HH9A 1I7DA 4HVCA 2CLKB 3PRKE 3VPDA 5M7EA 4JBWA 5HHTA 4GEKA 3H87A 2YNMC 1SIUA 1II8B 3IDAA 4Y3UA 1ZW1A 1QB7A 2ERCA 2FSPA 4WLOA 4HXEB 4C5AA 4ZYUA 1TCUA 4R0MA 3PEYA 4LKRA 1S7CA 2EKBA 5IDVA 3NDIA 4KN8A 3L4KA 3HY4A 1W85A 1KR2A 3GG2A 3OETA 5FPQA 3NCTA 3GQBB 3Q7PA 4X6YA 5CA0B 5EIDA 4WWPA 3TLMA 4O4JB 1BS9A 2HPHA 2IYAA 4CI0B 3DR5A 1RQRA 5A4DA 2AKEA 2YJZA 4W4TA 4INJA 2P9QA 4RHFA 1W48A 5FBWB 4JI7B 4Y6GB 2GT1A 2GRJA 1DAPA 5BN4B 8MHTA 4OHFA 4LRZA 5F64A 3K9QO 3WDSA 1ZSVA 5BV1A 1KRHA 3DSSA 4RAQA 2W22A 3EA4A 2W7TA 5EPUA 3D8BA 3VR4H 2TMYA 1QV7A 3R5TA 1PWZA 1MHQA 5FL7D 3K9BA 5B3JC 5HIAA 2ZGGA 2P4HX 3TQOA 3ZKAA 3CKLA 4GOND 3HKCA 4REOA 1LZLA 4K3UA 4Q00A 1BXRA 1ESZA 3ZHOA 1RWWA 1H93A 3N2LA 4P7FA 2WLSA 1KK1A 4I5DA 3CR8A 1O94A 3R6GA 4MCJA 1LI4A 3H9GA 3K8QA 1FU7A 1Q16A 1VHDA 4JUDX 1TEHA 4LJ8A 2WXHA 2AFIB 1ADFA 4QJ5A 3RB8A 4MLPA 4TL8A 2JGNA 4GTRA 1T5IA 2JJ8A 2IYRA 4XYEA 2NSJA 3F6YA 4B4OA 1AQIA 4IDPA 3ZHZA 2WJJA 1YDEA 3GLHE 3H2IA 3BDIA 4C6TB 1HE3A 5LQSA 8ATCA 3DCYA 4YRRA 2GM9A 1GVHA 4WINA 1GCGA 5ALUA 5A62A 1S1CA 3LPAA 3BSYA 1YHNA 1EUCA 2H9IA 2G1KA 4M1TA 4B0OA 5LLSA 1OHHD 4A92A 2Z0MA 4JDPA 4AOFA 2X3UA 4PZPA 2ZPAA 1PYDA 3B6IA 1EIWA 3DQZA 3F4BA 3LJ3A 1MH9A 2GYWA 2BM9A 5ARDA 4G81A 1NA0A 5IUKC 3I2YX 2OFPA 5AW1A 5LUBA 4RCZA 4AAYA 4D9FA 3H6HA 1KJIA 2IL1A 1QRUA 1VZ3A 4MJ7A 1JDZA 1VIDA 4H0NA 4WOCA 3HXMA 4F93B 5K3BA 4X92A 3EGOA 5HKBA 3UT7A 2V58A 1WTAA 3DH0A 2B3TA 1KAHA 5KU7A 4INPA 1CYDA 3TOZA 1UP4A 4I0WB 1O1YA 3H5RA 3NIFB 3GEHA 1NF9A 2H57A 1B0PA 4ZVVA 2FWBA 3A1FA 1XJQA 4OLAA 1IQPA 3LWNA 3KR1A 4RZ2A 1GPDG 3MTBA 4PC1A 4PQGA 4X64B 3MVEA 3HFRA 4PZYA 4FJ0A 1PEDA 4H7XA 1GZ5A 1G7TA 4OQDA 3CT6A 1NOIA 4REQB 4U6SA 4FJZA 3EGEA 1GA4A 4HXIA 1H66A 4AMUA 3ODPA 9MHTA 1VXRA 3V33A 5ADWA 4BQOA 3QPWA 2PRZA 2MDTA 2ZDQA 4L5BA 3OE7A 1WHSB 2NT4A 3MZ0A 1FX0B 5SZKB 3ZR4B 5BQXA 3NAZA 2FHPA 2DVWA 4QA9A 1M1UA 4YQEA 4H16A 3K5WA 3CIOA 1XVVA 1F8FA 3REFA 1UBCA 2JDIA 2WVHA 4IV5A 1ACMA 1UIMA 2XITA 3D9IA 1AS3A 5A6SA 5JAIA 2DCUA 4PAGA 3LQ4A 3SJBA 2F43B 1OT5A 2BKGA 3MJ4A 2Q6IA 3KLNA 4B9EA 1A2BA 4P7JA 1QDUA 5CRIA 2R48A 4B6QA 3JWJA 3UBMA 2Z6AA 4YREA 3DEZA 4Q4HA 4CIAA 3QOWA 2D1FA 1ARZA 2B2NA 2QTFA 4P0PB 2O3QA 3SE7A 2UWJG 3NDPA 1IBMB 4Q4LA 2R1TA 1SWWA 3JXIA 4I9GA 4QPJC 2XGGA 2H0RA 2D5CA 2HWUA 2Z1DA 3VI4B 1HFJA 5LQAA 3MJVA 1V16A 3ABRB 2R8OA 1BXZA 2O14A 3B36A 1GGMA 3RVKA 2WABA 4RZUA 2C0CA 2HDOA 5T4EA 1R6XA 1EGMB 1DOAA 3I01A 3QVOA 2C5EA 4WCFA 3C87A 2Q49A 5AQAA 5AOBA 3HCRA 2WV9A 4EPRA 4LZNA 2J85A 4B33A 3E7PA 3I4FA 2O3TA 4G8CA 5IN4A 1YFJA 5C4GB 4EF5A 5LP0A 4MP3A 2G5GX 1YNOA 1Q0LA 4H4CA 1J7KA 2QRVB 4FX5A 1KMCA 1GTJ1 4J91A 2REQA 4Q39A 1M3SA 3MEKA 2Z9CA 4WN9B 4YT8A 5C5IA 3VPCA 2C1XA 4U8GA 3NTXA 4IDQA 2ZWIA 4COKA 3FPJA 2WKRA 3NTQA 5JO0A 5B64A 2GYVA 4M1SA 4P3KA 2F59A 3EC1A 5AHOA 1B23P 4OJQA 1P4HA 1V7PC 2BL4A 2GN8A 4HGZA 4IIJA 1CFZA 1HK7A 4IXTA 1JFFA 1PRYA 3BIJA 1LY1A 1GV0A 4NDNE 3D6NB 4QVIA 4F9GA 4LK2A 2JIPA 3UMBA 2AD5A 5LIRA 1JB9A 5EXTA 2ATVA 2CDBA 4PX3A 2BUCA 5B3SE 4JI5B 4NAHA 4EZBA 3E9ZA 1YR6A 3W77A 4ZOLF 1UINA 1O1SA 4WH0A 4UTVA 1V1JA 2BLNA 3V1KA 4Y6QA 4EUHA 4AUKA 5KS2A 1TUIA 1CVIA 2O19A 5CDHA 2PMEA 1I7QB 4LNAA 1RHJA 4EBFA 3Q5EA 4FFPA 1MEOA 3OM9A 1YC2A 5IABA 2WJ4A 4HQ6A 4XWKA 5DZSA 3CEJA 1FCHA 4RG6A 4II2A 4Q1BA 5GVSA 1LF5A 3WK8A 1WAO1 5IU6A 1RPTA 4OQEA 1EE2A 1XXLA 1LLCA 1VB5A 3GEIA 1D9XA 1NNEA 3I64A 2GLXA 4AY5A 5JASA 3HRAA 3KTAA 3FJYA 4FUTA 3ONDA 5EP4A 4TLLB 5AQBA 4KQ2A 3S5JA 5GVRA 1L6IA 5KTMA 1E9FA 1MC1A 1HRKA 3DZBA 1JFSA 4UTXA 5HJ5A 1WDYA 3AKCA 3FF1A 1I14A 3B9QA 3A3PA 5F51A 2DFPA 1L7NA 5KDLA 2A0YA 2RHBA 3GLHB 3DLHA 3ZLTA 4DV6B 3PXDA 4BFUA 5TQ2A 3BWYA 1FL9A 4PLCA 1JECA 2W70A 4DT1B 1JPUA 3WJ7A 3LLVA 3NBKA 3NALA 5LCWC 3STHA 4AZTA 2F8SA 5IXJA 2W93A 1PCXA 3DSWA 1Z28A 3EAQA 3CRZA 1ZONA 5FUVA 1N7IA 3N05A 4XLLA 3IV7A 1YZLA 2QR5A 4MPDA 1U2EA 4D57A 5BN5B 2D62A 3ZWOA 2OZLB 1T35A 3ZD8A 3A9VA 4WCVA 2PRJA 3L46A 4MI9A 1AHIA 4BE7B 1E60A 4PLWA 2PKYX 2C3OA 3IVRA 1YJCA 2YMPA 5IZCC 4MZXA 1KHTA 1FT2A 5DM4A 2AFHA 3PNTB 1Z45A 2B69A 3W5JA 1VC2A 5K8UA 4WBSA 1NBAA 4UEWA 4Q9AA 1EP9A 1DKPA 2HSEA 2GHTA 1KYWA 3R8XA 4F12A 3ZGLA 1H0SA 4G0MA 4NZNA 2OHXA 3KPWA 3NRJA 4GQAA 3EEFA 4ILGA 3I2IA 2PX4A 3EGWA 2OQIA 5KHOC 5EJEA 2CHXA 3C7TA 2C1ZA 1J00A 4D9HA 2ZIZA 9GPBA 5EYPF 1W34A 1X7YA 1YK1A 5K3EA 2QSUA 1C1XB 4H7DA 5DV9A 2O20A 3KAQA 1IUOA 4IMJB 1DCFA 1XWWA 1JHAA 3U31A 5AXDA 1SMKA 4ZIRA 4GHWA 1H2HA 1JEQA 2WHRA 4Y9UA 1NI1A 3CLTC 4FGWA 5BV2P 1SA0B 3GUVA 1VI5A 4WKOA 1LSSA 3L17A 1RLOA 1PT6A 3LX6A 1NTRA 3LZ6A 1THTA 1QO0D 5AXBA 1E8MA 2J87A 3OOYA 4LDNA 4Y7CA 2Z2XA 4Z4FA 4CKYA 3H3JA 4F5DA 3L6DA 2XA2A 2B7CA 5A9SA 1N5KA 3DXFA 4OQYA 4M86A 1ZVKA 4HFRA 3MOGA 3FUNA 4D9MA 2B8EA 1EFRD 4GTMA 2AJLI 1IU9A 3OPXA 4R2WA 2IZOA 4FYPA 1I01A 5EJ4A 4ZZ2A 1Z73A 4IHKA 1C0KA 1HYBA 3SVZA 3PC7A 2B3DA 4HUJA 4FFBA 4HP8A 5CVVA 5DYYA 1RRGA 1PUJA 4L3VA 4LF6B 3MJFA 6ADHA 2HJHA 3GI1A 4TVSA 1XZCA 3M6XA 1QDEA 4J9UE 3QK0A 4IZIA 2NU9B 2FUKA 3ORSA 3Q9NC 2PXAA 4I46A 5EZ6B 3OH8A 4PTLA 5CHEA 2NVOA 2GRNB 5A03A 5JO9A 3T9CA 1JA9A 1A9QA 4ENPA 4K5BA 1OI7A 4DUGA 1VL8A 4Q3KA 4MX8A 2NSZA 1UZNA 1KJQA 2WXFA 3OXLA 1O0SA 4OUDB 2W8BA 1V7CA 4Q4DA 5EWLA 2VF7A 3FPLA 3FCOA 1UFOA 1YQDA 3K9LA 3OLCX 1OJ7A 2VA9A 4LJ7A 4NXMB 1L4HA 1RLJA 2WTXA 2XI4A 3PCTA 4OKIA 3AESA 4AJKA 4HMPA 3GRAA 1JHQA 1CZOA 2AI2A 2JAOA 3UTCA 2JG3A 2YWHA 4AV7A 4M6WB 1BA2A 4C07A 1USGA 1O6BA 3C5CA 3GROA 2PUBA 5KUTA 1JQLB 3NBUA 5KNBD 1FDUA 3OTWA 2P5TB 2C4TA 3SSOA 2ZRJA 1NKTA 3BA6A 5DX1A 3U44B 3S27A 1S2MA 5DHFA 3G7UA 1R4ZA 4PXSA 4QU5A 1W76A 5LXTF 3IKJA 5ALYA 4HFJA 2XY4A 4JUBA 2XZPA 3RIMA 3I9MA 1U5BA 1MJGA 2YMMA 2VL7A 1KI6B 4KWCA 4LXGA 3N8KA 2D7DA 3CVNA 3U09A 2PL3A 1YRBA 1L7VC 2VT7A 2XT6A 1IQRA 2EX1A 4LJYA 3OKFA 3Q3EA 3CVOA 2VSXA 1CVLA 2FPIB 1SCNE 3A7EA 3D1LA 3LIPA 3ENEA 2V6JA 4DG9A 1NQVA 4F1WA 4J0JA 4N3NA 2OM2A 4PLFA 1N4PA 3NETA 3PJFA 2CYCA 4LJ5A 1PHRA 5AR1A 4FYYA 3AQIA 5K7SA 2R8XA 1PR3A 2JJ1D 5ED4A 3ZQ4A 4IV0A 5JYEA 5CCEA 2GJ4A 4MXDA 3LHSA 4KREA 4EHMA 4QEDA 2EQAA 3GDHA 2QDKA 3QNUA 4W5NA 1UXIA 2JRCA 3RI3A 1DKQA 4DABA 1MYOA 1I9CA 4BDTA 3DSXA 1UJ2A 2IHUA 4FW8A 2GN9A 4OV6B 3N6RA 4CQNA 4QU0A 3V6LA 2HYDA 1Z38A 4ER6A 2FUEA 3DDSA 4JLNA 5CBNA 4MUYA 3WWPA 3AUJB 1EPUA 4UBMA 3OEHD 1H6KA 1QE3A 3RIBA 2JGIA 3KFVA 4Y67A 3K09C 1UJJA 1JWBB 3D3WB 3ISMC 1D5WA 2GPWA 3ZOKA 2G04A 2GD0A 2GK7A 2P0EA 5E4JA 5K3DA 3C48A 5CNMA 3LUBA 3VVLA 1XMXA 1GA6A 3VX3A 3PRHA 4QFVA 4LV5B 1Y3DE 3WLIA 1XIVA 3MJCA 1EUQA 3LHDA 4JL5A 2P40A 3Q0TA 1A50B 4YGXB 2ECKA 3WV4A 4XPIA 3KL4A 5ARGA 2JVIA 4PH4B 3UW3A 3JQ0A 4JV5B 1PN3A 1G8MA 1NX6A 1Z5ZA 2W11A 3SKYA 4TRRA 2DPGA 5CCBA 4ZRNA 1K4MA 3FTUA 5FOXA 5C8VA 2X1VA 5DNUA 1W4ZA 2DQZA 3LVBA 3OC6A 4RFLA 4K7JA 2YVUA 4RVSA 4YPFA 3OOSA 1CW2B 1HH8A 5REQB 3TLYA 1CUEA 4GI7A 3GCZA 3OZSA 2EFHB 4HS2A 4CMAA 1P29A 3ACBA 4ZYLA 4N5LA 2XT0A 2ILVA 1J07A 4ZREA 5MGBA 2GLTA 2G67A 1MCZA 2JCYA 2FRXA 4MWBA 3LHIA 4O29A 2F1RA 2GDZA 1EK5A 5CD9A 1PQYA 1ULZA 1EBUA 1C9YA 3BULA 4UW9A 2R79A 3AQ4A 1RWBA 1H8EA 3RABA 5LP6B 3I30X 3IUQA 1I30A 1CKEA 3RTAA 4DLAA 5IHXA 4RANA 1KMIY 1TCCA 4MWGA 2VYCA 1Z8DA 1IBCA 1DIGA 5H70A 2WTBA 3JY6A 5ALIA 3P94A 3CHYA 1I5OA 2FPLA 1WABA 2VDJA 2GFHA 3WKEA 3DO8A 4ZVPA 4J8DA 2L0XA 2A6PA 2VDUE 4ROSA 2AN1A 4DHWA 3VAAA 2J5BA 3DOIA 2HSWA 2IH5A 1P9NA 2ZBFA 3NVKI 1VKHA 4ZOLA 2YC2C 4WWHA 2ZRHA 2ZS9A 4FM9A 4TKUA 4R2MA 3ELYA 3E5RA 2QD5A 4KVAA 2PGLA 2J3IA 4I5FA 4E2WA 3AG5A 1Z6ZA 1RQ2A 2NAFA 1B73A 2UZ3A 1JZSA 1K8RA 3L92A 3QNMA 4D3XA 3UAWA 2WIDA 3QP9A 2GO7A 3V8MA 4M1YA 4OFBA 5HCIA 4B8YA 3TIFA 4U07A 2E6KA 1XR3A 3O92A 1RWXA 1T0JB 4RSYA 1Z25A 1L9KA 1GUZA 1NXSA 4RSMA 2XGSA 1ISIA 3CLSD 1H69A 1Z7WA 3JUEA 4O2BB 3ETLA 1ISJA 3F8WA 4WERA 4BAZA 3P5BA 1KAOA 1Z0FA 1BU5A 4G65A 4TQUS 4LOIA 2EL9A 4CLEA 2OKCA 3OX4A 3BEEA 1RM5A 3D31A 5IJ9A 1GZSA 1OLXB 1HLGA 4MRAA 3VO1A 4CMHA 2JIRA 1EP3B 1TR4A 2BGGA 3DV9A 3HFSA 4OXXA 2ZUCA 4XD7D 5JXGA 2O2YA 5TEWA 5HFAA 3VDRA 3ZVRA 4ON9A 4V0ME 2JS7A 1DWPA 3CW9A 1U0GA 3G2NA 3DP9A 3RJVA 4YC7A 4G1FA 4XH9B 2Q7OE 4ZRMA 5BUSA 1QH8A 5ALFA 1ZX1A 2OV6A 2J33A 3QU9A 1FUKA 3KQLA 3DWFA 1LDYA 3K31A 3SICE 2ZISA 5J58A 5IHPA 1Q15A 3I4LA 2E5WA 1N94A 2XUHA 5BYJA 3AJ8A 1ZGHA 3WL4A 3UT5A 4KZKA 4HSEA 5DN6A 4Y2TA 4WOKA 3VR3D 3Q5MA 2PWAA 4NJOA 3E7WA 3IMEA 3ILXA 4M0UA 1X1TA 5J2UA 3LJKA 5IH7A 4QX6A 3IEPA 4GKBA 1FTSA 4B8ZA 2H4FA 2YNMA 3L1IA 2F55A 1F0YA 3BWBA 1N4SA 5AKZA 1XPOA 1WXFA 1DV2A 4GOMD 4JB3A 1MZPA 1L5JA 1W8IA 4X85A 4YUAA 2QQ0A 5DULA 1EK2A 2PUVA 4KSCA 3QV1A 2CFUA 3TIXB 3P0EA 4HRYA 1IEVA 1NBIA 5FUQA 4TTTS 4C04A 1BD3A 2JKVA 3HB5X 3L0ZA 1AQNA 4N3GA 1O95D 1SBQA 1IY9A 4ME6A 1LZKA 1WW2A 3F96A 5TC4A 2X42A 5LZ5A 3HKDA 4BZQA 1KY2A 4C3ZA 3GELA 1ECCA 2DUMA 3Q5DA 3ETDA 4HLQB 3J81k 5TQVA 5IFLA 3UQYS 4U8VD 4MEAA 4CMIB 3SO8A 2NUAA 4A0FA 4C3UA 4HDMB 4NV0A 2QY7A 3EFHA 5BXOA 2FZEA 1ULSA 1IIRA 4QAQA 4WBNA 1RJDA 1I33A 3Q3HA 3CTPA 3H5IA 3A25A 3ASYA 3IQDB 4TMKA 3HXDA 4QBIA 4LXTA 5B3JA 1BVYF 3TLGA 1CZHA 3ZQ6A 2NOAA 1W7AA 1LW6E 2C8VA 4J76A 4MW7A 4WPGA 2FWIA 2HUNA 3GGGA 4ZPXA 3RSLA 2QD3A 3FF4A 4BMOB 3DT9A 1HDZA 5J1TB 2W6ZA 4M1MA 2BHRA 3GRUA 1PQPA 2YQ5A 3A1SA 3C8ZA 2ZTVA 1C9KA 1L5ZA 3P19A 3ZD7A 2BGMA 4NJEB 4I5IA 3EQZA 2CYBA 2L42A 1Q91A 3WP1B 3THOA 1OXUA 2BJVA 3QRWA 4PG5A 2HCFA 2BDEA 2UUCB 3C41J 3KKEA 5K8CA 3LX5A 1XPJA 4XXHA 4DA9A 2YS6A 3OZTA 3RLFA 2ZBVA 4X1YB 4LNUD 1UWKA 4QXRA 3UGKA 3H9BA 2NO7A 3EH2A 4LN1A 4QPPA 1S8AA 5C81A 4MICA 5EIBD 3JQAA 1N2OA 4F4DA 3N74A 4OQFA 4YRPA 5KYWB 4GZ5A 3HXEA 3N8GA 1NQAO 5FTJA 2XZLA 4URUR 2H4JA 4WZAE 3B20A 4Q05A 4YEDA 5BRJA 2WG2A 3NKVA 3NBXX 5JV5A 4DPLA 1H2VC 4CKBA 4KE7A 4G2NA 1L3BA 1P31A 2Y6UA 2C7QA 2OXRA 3VO8A 3BTVA 2IHNA 4B84A 2EP5A 1P44A 2J31A 4J29A 3HHEA 3AVUA 3TXAA 4MW5A 3TXXA 2WF8A 1QG0A 2BP7A 5T5QA 3AI2A 1F8UA 1HWYA 3WHPA 3ML9A 2G83A 2X76A 3ZNOA 1NYTA 2JIBA 3FETA 3JQCA 1UDAA 8OHMA 3RUPA 3UWPA 3EXEB 3K9NA 3HV0A 3AS8A 2X38A 3FWNA 3MAJA 3C5WP 2EJTA 1DX9A 4H1TA 4PCUA 5BW8A 3CEAA 1E3JA 3VZBA 4RVBA 1TTTA 1SY7A 1ESEA 3RROA 2HIGA 4RKEA 3IKMB 1N52A 1C4KA 1RBYA 3T12A 5L4LA 4MRUA 3IUJA 3S2EA 5LXTA 5LUAA 1Z4JA 1YXMA 5HMMA 4RQAA 2OV1A 3UPTA 4J90A 4LDAA 3ZIAD 5JXIA 2WWRA 3AF6A 5EHIA 3JQ7A 1JLSA 4NTZA 2IYTA 3VBCA 1CF2O 2GA8A 1Y6GA 1XVIA 5IRCD 4RSRA 4IGIA 2JHGA 3U26A 1GG5A 3C3CA 5L3QA 3RSZA 1GU7A 2CZGA 1QANA 3R7RA 2GGFA 3HJFA 1JAZA 1KEVA 1JHDA 2VHEA 3ZI7A 2WG1A 3PQEA 4WAUA 2GKOA 1L4EA 4N0EA 1SD5A 2JBAB 1IHOA 1V9CA 2VP0A 3QITA 4EWLA 4FINA 4NBSA 1H42A 4HRLA 5JLAA 2MYOA 1I3MA 2R7MA 2I3BA 4X6LA 4N12A 3MUNA 1LTQA 1M34A 2BFDB 3DT8A 3UMVA 2AW5A 5IEBA 1CQIB 3PVSA 2CUKA 4KMOA 4JBYA 1M6YA 3AYZB 2X6TA 3K70C 3OHPA 3EDRA 3H65A 3HGTA 1EQUA 3TEMA 4Z1MD 4TZ0A 4M1ZA 4FCCA 4BFWA 2ZB8A 1GADO 3BJRA 1E3EA 4GVLA 5DT2A 5CVTA 2XZTA 1WY5A 4IOLA 4E0BA 2LUHA 3MJSA 3GEGA 3UKUG 2EYUA 4PX2A 4CM4B 2A57A 4DMUB 1TC1A 2OZVA 1OFGA 4D4IA 1QOZA 4V1CI 2XRZA 2H4WA 1RW2A 4QT0A 1QIMA 1G5PA 4IKPA 3AUKA 1VBNA 4I8XA 4FA6A 2B0JA 2WE8A 4KVOA 2C3YA 1VCIA 5IZ4A 2QUIA 4TRQA 4JEIA 4L5CA 4JXTA 3LU1A 2KJQA 4DTIA 4QUHA 3MTQA 1H6DA 4WBXC 3Q9LA 4QVKA 3QPAA 2HQSA 4IR7A 4TSFA 4RETA 1MO2A 4DVJA 2P1DA 4CR6A 3UC9A 2IU3A 3TOSA 3EGCA 1CUYA 1R9MA 3NTOA 1UZUA 2GASA 5L45A 2CNWA 2AC4A 4B74A 3CBQA 4WEQA 1JPJA 4JJZA 3N0RA 3CH7A 3ZEFA 5JH7F 2H4XA 1Y1SA 2ONKA 4YJ3F 2HPAA 3QLEA 2J3HA 2ZIUB 4KXUA 2NQTA 2NO0A 3KE9A 3ZY5A 5ENRD 3V79K 1JHPA 2FI7A 3KOXA 2EIHA 5JI2E 3ICCA 4FR0A 1JEAA 4DBLC 4HFGA 3AX6A 3MW8A 4IGFA 4BNUA 2ERYA 3W3AD 3D3EA 4C89A 2H1RA 3DOUA 2GXQA 4RIGA 4CGVA 1H5UA 2J3DA 2VHZA 2I4IA 4YUWA 3H8VA 4B81A 4YXFA 3MHPA 4L5IA 4NHEA 4IRMA 4F8EA 1XK6A 2ORVA 2VTBA 4I9EA 1UJ6A 4TLEA 3U9TA 1PR1A 4IEEA 1TZ2A 3CUSA 2P2DA 1D9SA 4N5CA 4CRWB 4UE6A 4I81A 3ORHA 1G38A 1HDRA 3VC2A 1H8HA 2I34A 3H1GA 1SUIA 4ITVA 4PLGA 4CQMA 2VXBA 1N9GB 5FJYA 3NATA 3TTUA 3CX8A 3VLDA 4LRSB 4QBHA 4KYUA 1YL5A 4WWOA 1PNOA 2ASEA 2WHYA 5LMZA 1FOEB 4C21A 5C8DA 3WO0A 1P33A 1THMA 4QQ8A 4CGWA 3IEUA 2EBFX 2IGBA 2AUTA 1PSWA 4Q19A 3L6EA 4MYRA 2NTNA 4RV9A 4D25A 5ELXA 3M5WA 3FFAA 4D80A 3AUUA 3KQNA 4UI9J 2IWHA 1FU8A 1R0SA 2JLCA 5HTKA 3M81A 4CHTA 4PNEA 3UO8B 3WRWA 2WDPA 5CAEA 3FPFA 3K16A 3F5DA 3HIZA 4UDYX 1U0HC 3ZK9A 5D8DA 3IIKA 3EZLA 5GZ6A 4JVLA 2Z2YA 4QUEA 1ZN8A 4M76B 3C8UA 5CFZA 5IZCA 5GJBA 4ARUA 1DKNA 5FV7A 4NS4A 1IJKA 3O4ZA 1FDRA 4ZJUA 2BSXA 4PRZA 3PQ7A 1C3OA 3TE7A 1GNLA 4ZCTA 3VR5D 3KKZA 1EA7A 2WD7B 5BSUA 3G2HA 3WYEA 5GAJA 3RC8A 1JI0A 4RTKA 2D2FA 3E9YA 1E6CA 5A4FS 2M6KA 2O0MA 1NW8A 3B7WA 3NHSA 1Z22A 3VPXA 2CVPA 2RK3A 1NU6A 4ZAVA 3NJ4A 1KDZA 2X5OA 2CHZA 2FFAA 2R11A 4AKIA 3F5MA 3DWEX 4B73A 1FRFS 1LBIA 3VZPA 3SVLA 4CMBA 1R6DA 1X7HA 2FW0A 4HVLA 5EZYB 5AJYA 1JG7A 1W87A 4KQ6A 1U02A 1SVMA 4JC0A 2I67A 2FG6C 3GJYA 1G1MA 2GCIA 4CLOB 3JASB 1RXSA 4LYAA 1DAEA 4AYTA 1JHOA 3RYFB 1ZIYA 3PXBA 1H2FA 4WXEA 3PNSA 4EHIA 4XRRA 2QE7A 2G5TA 1L5FA 2C82A 3WNDA 1BMFD 2XRMA 4LNGA 3CLJA 1KO7A 3C3MA 1S96A 4M89A 5JSFA 3CNBA 3FB1A 2ZYTX 3KIPA 4BKPA 2P9BA 5LQUA 3L01A 1FYFA 3KELA 4XKBA 2C7RA 1MOSA 1A8QA 4JP5A 1PLJA 2HDNB 2ZQ5A 2ZOSA 4XDZA 1T9AA 1QORA 1PGNA 4DR6B 1K5DA 2J9RA 2BT4A 1SB9A 1QU3A 1XVLA 3BCHA 4NIKA 4RENA 3SNXA 4Q69A 1AUXA 3NZUA 4XR4A 1M8GA 4URHA 3RT9A 3ZQUA 2GGSA 4YRMA 2XE8A 2DQ4A 1CETA 3ZYLA 5KNGA 1PJ2A 1SG9A 1SKBA 1XJ0A 1TNOA 2V9CA 1EGHA 1OYYA 4NPAA 3KEFA 3BB3A 3KALA 2FEWB 4QBGB 3FNGA 2MJLA 4BGUA 3QAQA 1I1HA 4QODA 3BGWA 3TCNA 3Q9NA 1KI1A 4KDRA 3LECA 2CFIA 3U37A 2UY1A 2YZGA 1QH0A 3BWXA 9LDTA 1GZ3A 1VJDA 3MCVA 3JZMA 2X5NA 3H2KA 5DP2A 4DLQA 4PSVA 3SI5A 2Y0PA 5J2TB 1C30B 3G0DA 4BP3A 2XCSB 2P79A 5F4ZA 1YS6A 1PDVA 1ORWA 3LSYA 3TUZC 4TWBA 4U1RA 1YVDA 3B9RA 3EHEA 1TT5A 1ZOIA 4WGGA 5C3MA 5DTIA 2NUPB 3F3KA 1Q5PA 5A4KA 3TX2A 2LE0A 4AM9A 1LDMA 3SYMA 4AKHA 2NW6A 5JIBA 3GXBA 3MV3B 7YASA 5G2NA 3GRRA 1P39A 3Q3JB 1AURA 3KOZA 5KWDA 3AU5A 2OP1A 1YQTA 2RH5A 3PB3A 3EWNA 4XKJA 2IQIA 3PPVA 4HUTA 5KREA 4M37A 1SVKA 1X7XA 5ADUS 1E9DA 4JUAA 3HXKA 1GNRA 1W19A 3P27A 3T06B 2AXQA 1KDOA 3VV2A 3T4XA 2BTQB 3VJKA 3R24A 4QLBA 5ESXA 4RA9B 3KOUA 1YZKA 1QCCA 2QY9A 3MELA 1M67A 2QBYA 4FHJA 1JKXA 1E9VA 3THXA 1UBMS 2XAUA 5E8RA 4GPBA 4MUAA 1PJRA 2LIVA 5LVAA 4XIJA 2P9SG 3W4KA 3DUWA 3HVEB 5AYWD 4FZJA 1WNFA 1GPBA 2EKDA 3KK0A 3ZLBA 4U7GA 4HS4A 1I3OA 1HE8A 3IULA 4G1VA 3SBXA 2Z8ZA 1HTBA 3L0CA 2CHFA 3D9MA 4OGLA 4XB1A 4GM0A 2JGLA 4B1FA 3G6KA 4E11A 4B79A 1NVVQ 3CZRA 1QC5A 1B3RA 1N9KA 2V96A 2VBFA 1Z3IX 4HJRA 3AEYA 5J63A 5HRAA 2FW1A 4PR0A 1OA1A 5EWJB 2G07A 1NQWA 5IPFA 5KJEA 1EWKA 4RA6A 2Z83A 1XCBA 2WT4A 1FNMA 5AKHA 1Q1AA 5ISMA 3GDGA 4LJLA 4E03A 1MB9A 3QX7A 3IAM1 2Q3FA 3H2HA 3PFIA 4JT2A 2Q4DA 2N47A 2ZJ6A 3ESDA 1K0UA 1TD1A 3AWDA 1AMOA 1MOQA 1RHMA 1HG2A 3ROZA 2GF9A 3LMKA 4KFRA 1N2IA 1NRXA 1XTBA 3ZJVA 1VDMA 1L5WA 1OAKA 4JB8A 1F2DA 2A86A 3K09A 4CMJA 4QG7A 3HZZA 4GTOA 1TM5E 4BC1A 1Z2DA 3FTCA 2TECE 3QKSB 4DMKA 2QVYX 4FGSA 1A1VA 4AJ1A 1O5OA 3EJNA 3GZNB 1X9HA 2Q8NA 3K8OE 1PWHA 2RKKA 3UJ8A 3DONA 4K28A 4BZXA 2RB5A 1FQWA 2YZNA 1LDNA 1A8PA 1WQ4A 4KBQA 4L22A 3KQMA 4A3SA 2HBZA 3HVKA 4Q3LA 3HJNA 3ELUA 1BCSB 3P1UA 3WNBA 5IJXA 1MB2A 3HZRA 2A3NA 3S1LA 2VF4X 5AW2A 3OZDA 2P9JA 2CE2X 4JBHA 2PR7A 4R68A 4P22A 1QJ4A 1OWPA 4QNNA 2OD2A 1FUIA 2VQ6A 3OEWA 4MYTA 2X1MA 5U9CA 5BW8C 2B99A 3AI7A 4MBGA 3L7AA 5T8IA 3R9XA 4YR7A 1QKIA 4PZEA 3I8OA 2CL7X 2ZBDA 3KAKA 3MFQA 3AXTA 2FLWA 4PNZA 3TZLA 2FP3A 2CHEA 3PXEA 4OXYA 4NENA 2J6CA 2LAHA 1HZJA 2AR9A 3VUEA 3EX7C 5JHGB 1F1BA 4NKRA 4IULA 3QUCA 4K0KB 2RC6A 3JRNA 4KACA 2PWZA 2DUJA 2K2QB 3D43A 5CITA 1JSZA 1UR5A 3RAPR 3R7FA 2GM3A 1V4NA 3F74A 4HI9A 3IJPA 5D01A 2ZJFA 5BR1A 1A8HA 4CYMA 3TG2A 1T4CB 4U3JA 2GVDC 4IIEA 3IQHX 3T3IA 1CR4A 3I9JA 4GX2A 2R03A 2EX4A 3B89A 4NYMR 3BFPA 3K1AA 3M1AA 3GJTA 3P97A 3RBZA 3COYA 4GE3A 1N4QA 1E4VA 4M7RA 4XX5A 4EYGA 4HNUA 4KZCA 3HA7A 2AKAB 5JH7A 2YHUA 2WF7A 1JP7A 3IP3A 1R10A 4YJ3A 1SUPA 1BVRA 2G76A 4AZWA 2JJMA 3PNPA 3AM4A 5CNJA 1AK9A 4DCPA 3H6KA 2G8LA 1CS4C 2DPLA 4TROA 4LF8B 2JJ2A 3ANLA 3O82A 1Z15A 2C59A 4I55F 2JEKA 1XJWA 4RD3A 2MSWA 4UQXA 4J43A 2HLDD 5L53A 1RDFA 4NEGA 3CPHA 1ZMXA 2B36A 5TDHA 3VR6D 1NZJA 3SMVA 4DLSA 3BMNB 1DCTA 2OAGA 2ZSHA 1OTHA 5A7DB 2OXEA 2RGEA 3FD8A 2OBYA 2XUQA 4GKKB 1JWLA 4MV4A 4Q9NA 1A4XA 2JBHA 4PC2A 2ZVQX 2QDXA 1MIOA 2Q2VA 2Q6LA 4TTAA 3FUMA 1YB5A 4FS8A 1HQDA 3RK4A 4Y8VA 4EZLA 2SICE 4KQIA 5JAQA 3VVMA 1BJTA 1NYQA 2VF2A 2GMWA 4R2LA 3FCUB 1CQXA 1GQYA 1MAAA 3I28A 1JKMA 3P2IA 2WIJA 1YJBA 3CX3A 2JGJA 5JCPA 4RZ3A 2ACKA 2Y27A 4HQ0A 2GTHA 3FPBA 3I92A 1NUSA 3GVCA 3N71A 1FMCA 2BBWA 4QYXA 2JKZA 4G4IA 5K1ZA 1W5EA 3R9MA 1UT6A 1K08A 2FEKA 3FWZA 2BSAA 4R31A 1DJQA 2IVFA 4N18A 2UDPA 5HZGA 1IWBB 1VYVA 1XRNA 4U5QA 4BVAA 2AMJA 1OASA 1ZCFA 5A4JA 1QFSA 1N54A 5AW7A 5A23A 2QG4A 5LX8A 2O7VA 2R6JA 4IWNA 1KVUA 1EDBA 5FBRB 2NYAA 4AO7A 2EF0A 1TRKA 2PX8A 2P2ZA 4ALNA 2EKLA 3NWJA 3VR2D 1T2DA 3Q7TA 1K86A 2BE7A 5AN8A 4US0R 1ZEJA 1UN9A 4PE5B 1WZUA 2JIDA 3L8HA 3G9QA 1W581 3PIDA 5CM9C 3EIWA 4KYTA 9ATCA 3VHXB 3PZDA 4N76A 1QQ7A 4Q7JB 1M73E 1JJBA 4EJ6A 1DJOA 4ANWA 4LJKA 3WNZA 4B3IA 3MWGA 1HLDA 4OPMA 1LTKA 4GPZA 1RRPA 3BK1A 3LOQA 3A2LA 5BWLA 3L1JA 3D9PA 3TNFA 4BVHA 4FFRA 4HWKA 2VJLA 4ARSA 4V2IA 5L6MB 1F7VA 1GO2A 1QKKA 1AKEA 3QIAA 2WAAA 3W7AA 2PSHA 3WGLA 4CU5A 2KE5A 2DKFA 2L0TB 1CP2A 3BERA 1YZTA 2L17A 1H2YA 4AROA 5HJ2A 4GKAA 3GGSA 1ZUNA 2QZAA 3MBIA 4BMCA 4B5KA 1JVNA 3H9CA 4Q37A 4ZCQA 4Q1VA 2ISSD 4GX5A 1Z6QA 3C14C 4HAZA 3ENKA 2Y99A 3H8JA 2EHJA 5ICCA 1NDQA 2ATIA 4U9IS 1CFJA 1XEWY 1GNQA 1R8XA 2FVXA 1TU0A 3AUXA 2JFNA 2R6AA 3U2QA 1ORTA 1XTVA 3IMKA 4U0KA 5LSAA 4TMZA 1PNVA 3CG0A 3HXOA 1MXFA 1QYXA 1W36B 1DNPA 1B1AA 5BYBA 1RWQA 3A1UA 3OU2A 1L7BA 3H05A 4ENSA 1WV1A 1SPBS 3NUQA 1YR9A 3K6KA 1OX5A 1UK7A 3ASOE 4RULA 3F98A 4MP6A 3AB3A 1ELWA 3QPDA 2R59A 3CONA 1P1FA 2IDJA 2Q5OA 5HIJA 3K5PA 4EJMA 4PS3A 2XTMA 3LYUA 2DLNA 4BNDA 1E62A 4HDQB 2HF7A 4EA7A 5DVZA 2G6BA 1ACJA 2E5LB 3WNVA 4YV0A 3AONB 3OPNA 2VFAA 1I8TA 4YH1A 4KBGA 2IT1A 1HG5A 2B4KA 3DDUA 3VLEA 2XD4A 5K5EA 3P0FA 3NC0C 2XDQB 1T8RA 5FOQA 4C29A 2WM3A 4HPWA 1I2BA 5AK5A 4L0CA 2DBVO 3KQWA 2JFHA 1BEUB 1ELOA 4B87A 3W2TA 3KQPA 5HZKA 2AI3A 4Y6PA 4RPJA 1V6CA 4JT8A 3F4KA 3RFUA 4OQLA 5CB4F 3BE5A 1T0UA 3OQ6A 3EWIA 3IAUA 3BH6A 1XZPA 2ZYRA 4AY2A 1B89A 1J20A 4KYVA 3RODA 4ZKEA 2YS7A 3G1TA 2Q62A 1AY0A 4WZ6A 2P0AA 2WJZB 3UAOA 3FJ1A 3DBOB 3ZK7A 4ILHB 1ECGA 2A1TR 2OE2A 1V41E 4ENVA 2H29A 4H17A 3BMOA 1RWOA 1VJ1A 3TW8B 4P38A 4KNVA 4CE6A 4PHFA 4BMYA 2ZUSA 2XPIA 3SDZA 2BGLA 3ZJYA 1UDXA 4EMBA 2H31A 2QUAA 3PXCX 5FADA 4LXHA 2VYQA 1UDBA 2ZYUX 3OF2A 5GY7A 2GWHA 1RC0A 4PO8A 3S7BA 5EL0A 4D3FA 1AMNA 4FCWA 1P0PA 2BKVA 2JL1A 1GYPA 5CRUA 3GG9A 3OT1A 4KQFA 3OD5A 1XZNA 3ZI0A 4F9TA 2I78A 1KEPA 5D0QD 3E22A 4CM9A 3M1LA 5HM8A 1PLKA 4LOKA 4P31A 3PWZA 2RI0A 4JITA 4YQYA 4IN3B 4WDRA 1NVUQ 1EFDN 4IBOA 3CEPB 1T5HX 3ZOZA 1MC8A 2CBXA 1IZYA 4HRVA 5JSZA 1G8YA 4CUKA 1N32B 1SJ9A 4DW8A 1QH1A 3FUHA 4PC7A 4QL3A 4RELA 5ALTA 5KCMA 1B7GO 1KLXA 1IULA 1I36A 2CV1A 1NBMD 2BI4A 1VLJA 3NT4A 1FCJA 4P32A 5TEVA 4MPPA 3QF4A 3B1FA 3WQRA 1KAEA 5FQ8A 1D2HA 3OQNA 3NW9A 3VU0A 4F38A 1LUAA 3T7KA 1N2HA 2I7XA 2OCDA 2O6HA 2WEKA 5C37A 4EIWA 2Q50A 1KK2A 2VNIA 4ILEA 3QU2A 3WIUA 1Y3HA 4BO6A 3OZAA 2F1JA 4WXMA 1RWPA 2BFBA 3LRXA 2XA9A 1AUVA 1DVPA 1VIAA 4KXXA 2MCFA 2PZ8A 1LJ8A 3RYIB 2PMCA 2O8BA 1L9XA 3O4IA 3TNJA 5CXUA 5CYOA 2XBMA 2R5FA 1QGUA 1H2AS 1TK3A 1SA5A 2ZUTA 1XD9A 4B83A 2GZ3A 4GI2A 1NFFA 1TNZA 3AFHA 1G16A 4ZK2A 2PMBA 2QJRA 4B7AA 1DAIA 4URZR 3EGDA 1H0AA 4P93A 2J41A 3AZOA 5DIZA 4NBWA 1ODJA 4ZZ0A 2VHUA 4FT4A 5I4BA 1EFLA 5LJLA 5F1KA 2PLFA 1G5RA 4F3RA 2OFXA 3FUIA 4DEXA 3EVZA 1J9EA 1N1GA 3UQZA 5K3OA 3Q98A 1U9ZA 4P4LA 2GARA 2AF3C 3M3DA 2QAGC 1CJCA 1EJBA 1RD4A 3CLRD 3WIOA 3E8XA 3KHKA 3MS7A 3AVVA 1LVHA 2JVKA 2M63A 3USES 2HOQA 4ARBA 3KJGA 1NVXQ 1WG8A 4Z8XA 4KQWA 4UAUA 3HBNA 1GTSA 5T6MA 2V7VA 3I4CA 4F5EA 3Q7RA 1DQPA 1PF7E 5F77A 1J0CA 1ZH8A 2A5YB 2D5IA 3KQVA 1YL6A 3FMPB 4HAOA 2GESA 3Q1LA 2Z1MA 2XNSA 3MTEA 1EA5A 4CL8A 1JSRA 1N2SA 3SK0A 5IC5A 4E6PA 3DVSX 1XCLA 2B82A 4FGUA 2BGUA 3CNQS 2EIXA 3ME5A 4ZGGA 1BJRE 2O8FB 4QGSA 1AB5A 4J7AA 5IBRA 3BWMA 1XU4A 1BWRA 2Z58A 4BECA 1QV9A 5KJ6A 3GB9A 4LHEA 2Y0EA 3ZV4A 3VHQA 1G8JA 3VH1A 2CXUA 5JRDS 1BDBA 3GK3A 3LPMA 4CKWA 2RFMA 3TGWA 1QUFA 5AVKA 4TXPA 3VU9A 2C97A 3EHMA 2YR0A 1SUCA 4QRIA 1AKTA 5J4YA 2E4XA 3L18A 1ZMOA 1ANKA 3CF6R 4EEXA 4D6YA 3KM0A 4UVHA 3PUWA 1YBVA 3LXXA 4BKRA 2IPNA 4NMHA 3M82A 3BMQB 1R4NB 3L77A 2C95A 1O6FA 4CIBA 3RRNA 3O8OA 1TYAE 2X2PA 5TB5A 3RVPA 3G82C 4UHHA 1EVLA 1DWQA 4UREA 3IAM6 5HPYB 2P9CA 5ELMA 3TL3A 4P5PA 3B6MA 3KSQA 1W5BA 4F85A 1KYZA 1XDDA 1RQLA 4A1OA 1T8TA 4KI7A 1KIAA 3HBLA 3OPYB 5D3QA 2J9ZB 1VE1A 4ER5A 1FUUA 4PO1A 2O05A 4O3FA 3H2JA 4H6XA 4N8SA 1H2RS 1ISHA 1HE5A 2J5KA 3SYTA 4BS9A 2IYZA 1BHO1 5B6PA 4DPKA 4R16A 1O96A 3DO6A 4ETIA 4L6IA 3UJPA 1UAAA 4WNAA 4JVSB 1N7GA 5TR9A 1KWKA 4ZQEA 2DKOA 3UB2A 2Q1XA 4X8QA 4YJKA 3L82A 3AT1A 5H4GA 5DXJA 2O4CA 1EGQA 4IINA 5FRDA 2MR5A 3K15A 1JLHA 4CM6A 4DMCA 1P3JA 3ETHA 4M8KA 1PR5A 2EDCA 4AIRA 4P84A 1WB5A 5KWVA 3UNXA 2PT9A 1S2OA 4GZ6A 5AENA 5EXEA 4D9BA 1P2TA 5EKTA 1HRDA 1N3YA 3HJTA 1M2OA 2DLDA 3NH6A 3OO1A 3SS8A 1SZPA 2FJ0A 5JYDA 1TAQA 1JDNA 4OA5A 1UADA 2OO3A 3TMYA 1WMSA 4FQ7A 5CLGA 4RGBA 4ZGBA 2HMSA 1E9CA 1NQOA 3OZGA 1SBYA 2BW0A 2IQCA 3EXFA 3PQ6A 2QYOA 3ADBA 2HM8A 4CEIB 3OURA 4F6RB 4INAA 1FLNA 4DSZA 4OK3A 2GKSA 5B4TA 4EATA 2NT3A 3CINA 3IAS1 1XZ8A 4QO8A 4BNJA 4WUYA 3AZPA 2FDCA 1E2QA 4ISBA 2HBRA 3O31A 4A82A 4IHJB 1RCTE 5IBPA 3AM3A 3VR0A 3LC0A 5BWBA 1KI7A 3NYQA 2CT8A 1A76A 2BMWA 3ZDZB 2XCCA 4DN6A 3QWBA 2ZPUA 3SDBA 4QM7A 3S7ZA 2QN9A 3F97A 2L82A 1N78A 4FILA 1GL7A 1Y6IA 3ANNA 4JGGA 3MA5A 3RO2A 2JASA 4MROA 2V7XA 4WK4B 1JG3A 5FBHA 4WK6A 5IULC 5AVXA 2IHVA 2RD2A 1KBOA 1HYGA 5E7MA 2QZ9A 1N4DA 1O6GA 4E7PA 5BRAA 4GF5A 4RO0A 2ZUWA 3CTMA 3GQVA 1FYVA 4R9RA 4EMSA 2YHAA 4FYXA 3JQ9C 3BM5A 5IK2A 5J59A 2C2ZA 4E4TA 1AQUA 5B1YA 3CNEA 1BI8B 2BGKA 2ZJOA 4A03A 1P60A 1A4IA 5IAGA 3CCFA 3SGHA 2BRUC 3MWJA 1GGEA 2WE7A 3UFXB 2HA5A 5BQ5A 4OQ4A 2QHXA 5IM4F 1E3TA 3SZUA 5KYVA 5AVYA 3LL7A 3M83A 4JXXA 2KBEA 3IYLW 1GZDA 3U1VA 1FRNA 1XPRA 5TS2A 3MGAA 4WJZA 1S8FA 1FFHA 3OCZA 3K5HA 4S0ZA 1GYQA 2Q7DA 5G0SA 4O63O 2YXNA 3SGLA 2YV4A 1K8QA 3ER9A 3EY4A 1T8YA 2CEKA 5DYTA 1PR9A 4TS4A 2CUZA 2HRRA 2OHHA 4FPXA 4L72A 1Z4PX 4FC7A 5EYPA 1CF4A 4YDEA 4O02B 5HUJA 3ABQB 2OGSA 2HIMA 4NICA 3GZTB 2FV8A 3RUCA 4J0FA 2PBFA 5JBNA 1XJ5A 3ITDA 1OE0A 2DIWA 1AKWA 2CMDA 3BJMA 3H9UA 3UICA 3LO5A 4HPJB 1OT8A 2VP4A 5BNTA 1NRWA 3F1LA 3LQ1A 4JJGA 3D9JA 1TIBA 2I71A 4G85A 2ODBA 5CLQA 4QD3A 4WOJA 3B38A 4PSKA 4KVGA 1OZAA 4C5BA 2FZCA 1M2EA 4QDTA 4MVJM 2NTYC 3VR1A 3OFNA 3FW1A 5FAXA 3S8YA 4JP8A 5CTJA 2VDLB 2CY0A 3DHEA 2VZ8A 1TAHA 3PUIA 1RXCA 2ZSKA 3WGVA 2VLBA 3T9BA 4EABA 2NYUA 3D5EA 4G0OA 5FNVB 2YHCA 4M0EA 3P9SA 2WKPA 3G0CA 3HKCB 4QGFA 4I2ZA 3BUAA 4B6PA 4I5GA 4XEUA 4HEJA 1AP7A 3I0NA 2WXMA 4C78A 3Q1KA 1VGQA 1I2CA 1TA0A 1ZOSA 4RCVA 4D92A 2LTAA 3GFFA 1UL1X 1FU4A 5CEFA 1PEAA 4DAEA 3DTVD 4Q4JA 1RYHA 3ONWA 5ERGB 1MKYA 3ZDFA 3HI4A 1ZXXA 2FG5A 3JXJA 4Z4IA 3A31A 5FZRA 2CNDA 2D6FA 4D43A 1QFJA 3U4QA 2NXEA 4I1MA 1PVVA 2GJSA 2VJDA 3L7OA 1H3FA 2B61A 2R60A 1NY5A 2VT6A 1OWNA 3TPCA 1Q95A 4R2JA 3GMTA 5C4MA 3KKPA 4MB2A 4CT0A 2ZTLA 4PYIA 3QE3A 1EZZA 1GRCA 5BR4A 2X5KO 2HX1A 5D84A 4BE9A 3SYNA 4MWCA 1G3UA 3TL6A 4X3CA 3RHSA 4X9XA 4NQ0A 5DH9A 4LV6A 1NBWB 2QM0A 1Y5MA 3JVIA 5DE3A 4FVTA 5DBGA 2BUAA 4GMXA 2KPOA 2WNIA 3KCNA 2MU1A 1X7ZA 4ZN6A 3WGZA 5ARFA 1T6YA 2PZAA 4MGHA 3ZV5A 1UWCA 4QELA 4B3GA 1XP5A 1WXIA 5ADVA 1LB1B 4C7KA 4AT1A 2AFHE 1ZD1A 4AI6A 2V5QC 1RAEA 1XX6A 4ZT6A 2FB9A 5JJLA 2WWIA 1QOPB 1G5IA 4DBZA 4B8AA 3W9GA 3FMVA 4FHCA 2YXLA 4YXWD 2Y2UA 4EA8A 4NBTA 3C24A 1TM3E 1J39A 3DEAA 1PT5A 5CX1A 4IWXA 5BOSB 4WOBA 3W0LB 4HWOA 2R87A 4EBBA 3FROA 2HMYB 1BU8A 4LJRA 4RHYA 3DQPA 4M1OA 2F0YA 4ZV7A 1COWA 3T3OA 4TRNA 4Z4CA 1Z18A 4OBBA 4I1IA 1Z5WA 5CA1F 3QNWA 1U63A 1XRLA 4BOYA 4EJFA 1PJAA 2GZHA 4MARA 7ABPA 1CV2A 3NYRA 3DOFA 2ECPA 3PE4A 4YCMA 3AR4A 4J0DA 1QYVA 2QP9X 2AHOA 1FLVA 3WMXA 3HZHA 1ZJ5A 4TS3A 3AUYA 3W9FA 3KSAC 3WAGA 2RHHA 1I7PA 5CLHA 3PE6A 4L85A 2XHEA 3I0ZA 3I04A 4FB4A 2ZJAA 1AF7A 5FTNA 4L95C 1E4OA 4H7KA 2Q45A 3FYTA 4KGXA 4MAAA 1KZ6A 4MUXA 4X91A 3U3MA 3FYUA 3T4PA 5EKSA 5KTPA 4QGBA 4GWKA 5EJ2A 3WGYA 1SKQA 2R8PA 5CT5A 1UBNA 1ENPA 1NYRA 4F1SA 4LJ6A 2LXMA 4G09A 2OP0A 4RZQA 4JWKA 4UMFA 1DOHA 4LAFA 1A71A 3RKRA 2ZAGA 4OHWA 4INOA 3RVRA 4A0HA 4C1BA 3PU6A 4DR1B 3HBJA 1XLTC 2XXBA 2C99A 1NMEA 3C1OA 4Y0NA 3WC4A 2K4MA 2BC9A 1RI5A 3EFOB 1JFTA 5ERXA 4TGLA 3SY8A 1XOIA 3DVQX 4IZOA 2QAJA 4MB0A 3JQGB 3RJ9A 5HOEA 1GEEA 1F06A 3AEUA 4X8HA 2AQHA 4FYIA 1SVNA 4UU8A 5DNWA 3BE8A 4G84A 2D4HA 1ZSYA 3GYGA 4PLHA 2V9PA 4G2VA 5AAOA 1BX1A 5FWYA 2F4NA 5CHEE 3Q3IA 2P6PA 1XRRA 2BVNA 4WCFB 3ABSB 4HH0A 1LXCA 1ML3A 3K96A 2XYHA 2YUIA 3BDAA 3AEQB 4OQXA 4AJEA 2C57A 2H4HA 4XM0A 4K0RA 4L73A 1T0HB 1UDWA 2R6FA 2REQB 4E31A 1TYQG 3CEMA 2MYNA 3IIMA 3TVTA 3T1NA 1MW9X 3S0JA 3U3RA 2XX3A 3HG7A 4POAA 3PE3A 2B0CA 1GTMA 3RFTA 4Q7EA 1JIXA 4MTCA 3R7WA 1SQ6A 1E18A 4KC0A 1BU9A 3THYA 5EVCA 3V4SA 1QZ3A 3IESA 1JN0A 2IFTA 3GGJA 2UYYA 3NM5A 3NM4A 3MIIA 4IIJB 3JVVA 5EE0A 4L75A 4RK4A 3RT7A 3IC5A 1BW9B 2W2XA 1JXOA 4LYHA 1QYCA 1Y34E 3D6AA 3CLUC 3PJDA 1EX1A 1SVXA 3H1EA 1UM9A 2E82A 1CRPA 4YDOA 4CWAA 1J2TA 3L4SO 2X6JA 4OAUC 4LWPA 1KP9A 3K72B 5DFAA 3ICQB 5L4SA 3GRPA 3MQ4A 1ZK4A 3AU9A 2AK3A 2O7SA 2PGXA 4R8VA 3GL9A 4HOQA 3EVAA 1Y5RA 1TIPA 2KLBA 1Y8RB 4GX1A 4OGKA 3NV9A 3NCHA 3DZHA 6CHYA 2Q3EA 2OBNA 3Q3CA 1VHJA 4LNBA 2ODPA 2I7VA 5H7PA 2VSXE 4GEGA 2HRQA 3TW6A 4IWYA 3B12A 3X2SA 2ADOA 4F0JA 3OPVA 5BVHA 4E2XA 4K9SA 1U2SA 4ANVA 1B43A 3KTAB 4LC9A 2UUBB 3UM0A 4XDGA 3Q87B 4RVUA 3RS8A 4FLEA 4CMEC 3JQPA 4UE3S 3A70A 5FWXA 4MJ3A 1SOVA 3OQIB 4PU0A 3NH9A 1NN0A 5TQ2B 4J16C 3TB6A 1XU9A 3WA7A 3UKRG 4MUIA 2I2XB 5AUQA 4TTVA 4WZAB 4C3OB 2P27A 1D8TA 1DBPA 4MQEB 2YJ3A 1UKCA 1YS4A 1UJNA 1E2BA 13PKA 4BTEA 5CCLA 1MMFB 1V6SA 3OI7A 5I51A 4MKHA 1N8KA 1WF6A 1TDJA 1D1TA 4KITB 2IEJA 1TJ4A 2E21A 5KTRA 3I73A 2Y1XA 1VPEA 2BMAA 4V02A 2ZXFA 1BKSB 2WT8A 4JEMA 4HV4A 3AJIA 1S70B 2YHEA 2CL0X 4MGYR 4ZOEA 1FBTA 4RSHA 3V7FA 5HQ8A 1KY4A 3VC3A 3SSAA 4M49A 5F3WB 1M1YA 3FNHA 3R74A 3OM8A 1SVOA 3HSYA 2P6OA 1V2HE 2RC5A 3S1AA 5KTKA 3E05A 2WXGA 1N33B 4XVRA 3OLWA 1AGYA 3N07A 3LK6A 2D7JA 3WICA 2NU8B 2MSCB 3P4UA 2W43A 1J2UA 3TTVA 5DHPA 3OT4A 3RSCA 4Y6WA 2QX4A 3ZKWB 1GL6A 1OLSA 3W6NA 3NUZA 4WK0B 3QENA 1Y0BA 1N2XA 3VSEA 4OQMA 5JA4D 4L28A 3LTNC 1HV8A 4GH5A 4I4NA 1MX5A 2FI1A 2PYDA 2DF8A 4N7MA 5IM4A 3T95A 4TUYF 4N9WA 1RAAA 1Q7RA 3QWAA 3DLAA 2FEOA 2VCEA 3O73A 2A4MA 5FOUA 3Q0IA 5DGXA 3DZJA 4FZ3A 2D1SA 1HQKA 2ATEA 2B8TA 3M2PA 2BN4A 1SR8A 1IAVA 4PSUA 4C05A 2I4NA 1XVTA 4OGFA 4ZIRB 3UMFA 1VKOA 1JEQB 4B85A 1DELA 4HNHA 5GV8A 1EZ1A 1W1UA 2EOAA 5A0TA 2FKAA 4YAEA 3A4NA 1YMQA 4O1HA 1D6SA 2WHPB 4X1OA 1AV7A 1L8XA 2PFKA 5I9LA 2Y93A 2PEYA 4NE9A 2IIBA 4LDZA 3RBXA 1E63A 3SIPA 1N36B 2W6IA 3EGXA 3B7RL 4PQYA 1T9ZA 4BQSA 3E03A 4W1SA 4MJXA 4YDSA 1P80A 5A9SB 4ABTA 4XSVA 4BNTA 4R2XA 1C9JA 3NFYA 4YMLA 1D2AA 2QYTA 4OXKA 4KIJA 3UJCA 1VE3A 3T1HB 1ZIDA 4YJHA 1GLVA 1T2NA 3DCIA 1KZGB 2XUJA 4D56A 4ID9A 2X2EA 3OFKA 1PY1A 4FFBB 1CQWA 4FC6A 4DJEC 1HZ4A 3ZUGA 4D3YA 1PWXA 1K6MA 1OB5A 1LCIA 2HU2A 3BCSA 3VHLB 2ZZKA 2QD2A 1CRQA 3TLJA 2O1SA 2I54A 3DV2A 4GSKA 3SQNA 4C4SA 4FJ1A 2EV9A 1CZRA 3C3PA 3LW7A 1VB3A 1MX6A 4O0LA 2Z95A 1IAQA 1SCUA 3U6KA 4BETA 1DWUA 3REGA 1C2TA 1YB6A 5F23A 1NIPA 1JFRA 5D2MC 1FJ2A 2IUUA 3GFSA 3A6LA 3BD8A 5DW0A 1U3DA 5ILOA 3IAS6 3L0OA 1E1NA 4WLEA 1I7LA 1SPXA 3KDAA 1O08A 4IDEA 4ACKA 2W8BB 1I2ZA 5AOAA 4BNGA 1RAHA 3C8MA 3PEUA 2ZB7A 3P0HA 2GPSA 4A6XA 4CF3A 3B1VA 2FWJA 1KWGA 1NVKA 3LLCA 2Z9DA 2C31A 1FQOA 4X7PA 3AESB 4B94A 3W6ZA 4YQFA 3C6QA 1F17A 1OX6A 1GU1A 3JWPA 2QW1A 5EZ5A 4FMDB 4JROA 4RZXA 3P2YA 2QZSA 5JY1A 4NF2A 4NYIR 5L3SA 1H1DA 2JZCA 4MW2A 3EU5A 3LEWA 1WPQA 3GEPA 2J3QA 4TTIA 4UWKA 4C06A 1K2VN 5AW3A 2D2VA 2NZYA 1XZHA 3FUWA 4M1EA 3QVTA 2OCGA 4RV4A 1BMDA 1QTRA 4L27A 3R5HA 4P7KA 1TMKA 3GGOA 4R40A 3A1WA 2B6NA 4NWIA 3QWFA 2R6DA 4GBGA 3U16A 1QTIA 2UUPA 3DEOA 2I4MA 4NOMA 2QPOA 1BDMA 2JIZD 1U5BB 2JCGA 4EB8A 4DIFA 2QAGA 2H2WA 3GFRA 5JARA 1YU6A 2EZ9A 5HGXA 2MYPA 1CQPA 2F8YA 3S4YA 3TTSA 2QMEA 1I80A 2ONJA 1GTVA 2RH4A 3A7DA 4LXXA 1GXSB 5CDUA 3V2UA 1MAWA 2QN6A 5GJCA 2P68A 1Z06A 4BFLA 4F2HA 3PNOA 5EXPA 3EZ2A 4KXWA 2YN0A 3KO8A 2R84A 4GM1A 5CH8A 5IKOA 2VP3A 2ZE7A 4HBZA 3MFYA 4AEZC 3DMPA 2ENUA 4FEGA 2XNJA 3WGJA 2WUGA 4CKEA 3SQDA 4JA9A 5CA1A 4JB0A 1SU7A 2O5VA 2XPYA 3D0RA 3B53X 1QG2A 3BXHA 1E3DA 4HO1X 6ABPA 4YLYA 4CEHB 3UAZA 3B6ZA 2TMDA 1A8UA 2NZ8A 3CB2A 5ICEA 4FLMA 2B8NA 1Q20A 1KAGA 2JAUA 5CNIA 3L8GA 1LNQA 1VRWA 4RLFA 4W5JA 3SHTA 1BXKA 1VOTA 4WSOA 1IYZA 2REXB 3OCXA 2L6JA 4BVGA 2PAFA 4BYGA 4IFEA 2C2BA 3KR0A 4OM8A 3KAJA 4KKVA 1LH0A 5SICE 3U3OA 5AJZA 3TSAA 2ERXA 3E82A 4N5MA 2VWPA 3K0FA 3D6FA 5D66A 3OIGA 5C31A 5A7FA 3NIBA 2WZBA 1XL1A 3C7DB 1EIZA 2ACWA 3L8ZA 4ERXA 4A6EA 1TW2A 2IO3C 2M6RA 3P9NA 1VKRA 2O5RA 1OZFA 3I45A 4BBAA 1RRFA 1ELKA 1N2BA 4L3WA 4PLZA 2V98A 2WSIA 1UZAA 2F1KA 1ZI9A 2CNNA 4R8LA 2BIFA 2G88A 3T35A 1WJGA 5BW5A 5FI3A 1F5SA 3WXXA 4YX9A 1E2DA 2OL4A 3OVMA 2QT1A 3WE7A 1J0DA 4IQGA 3FWVA 4Q6BA 4GZCA 3A0RB 5DOVA 4HOSA 1ZXLA 4XFKA 3W79A 1O97C 3JARA 1LX6A 5F5NA 3INRA 3TL2A 3QW2A 5L6LB 4KX3A 3R77A 3HYTA 3EA5A 3OE4A 5J5AA 1WBDA 2XZTG 2QGZA 1SM4A 4TLAA 5CG1A 4KJZA 4EI9A 3ZDCA 4JENA 4OKNA 1Y5LA 2UZIR 4MMYB 2WXLA 4BB6A 1U6KA 4AM8A 5DNDA 1EDDA 4BNFA 2UUOA 4BWVA 2B94A 1ZMRA 2Z08A 1W0KD 4R9VA 1ND5A 1VCHA 3N39C 4BESA 3ESKA 2ARKA 4UEQA 4CM5A 3TJMA 1Z37A 2I6TA 2AOWA 3TIIA 1QQAA 1R5JA 1P6UA 4KXVA 5DWVA 2IOSA 2GEBA 3BQNB 3CJQA 4PYKA 4KAFA 1IN7A 1EWVA 4WFQA 5JZVA 1YBAA 1BMQA 3A3NA 3DEYX 4MVXA 1NQTA 4X0EA 2PKCA 4A63B 1GILA 5CFPA 4GDMA 5E9QA 4FJYA 1JKJB 2VZLA 2ZYVX 2JK0A 2BFEB 4KUHA 4LI0A 1BMTA 3T3PB 1QZUA 3B5EA 4R2IA 5HK8A 2QR2A 2FN4A 5FDFA 3FYUC 3DHYA 5G04J 3O90A 5LD2B 3TQSA 3CEHA 4B4VA 4FBMA 4EB3A 3TFOA 1A72A 5DK6A 4B9AA 4UUCA 2OMKA 3D6UA 4OKSA 3GFQA 1YGYA 3HA2A 1XCOA 1ZRNA 2OUKA 1TN8A 3O4RA 3E2IA 5DM0A 2XPCA 4LCJA 3EHRA 4S0XA 1I6KA 1FPPA 1MHTA 4BERA 4YP0A 1ZH0A 4DV3B 1Z5VA 2FGJA 4KDFA 2B9EA 4ZMRA 5KYXA 4QQIA 1K88A 4ATGA 2AOTB 1E2MA 2HNAA 1EJ6A 1X94A 1X1SA 4G1TA 3TR0A 3PQFA 4QDZA 1X74A 3WLMA 4BXOA 1FS4A 1AA9A 1EVIA 1RM3A 3FUXA 2P9PG 4Q7KA 3NT5A 3H8WA 2ZT6A 2M9MA 2CXNA 3AI3A 2V0NA 5CCMA 4QULA 5JBQA 4JLAA 5J4LA 1AKRA 3G9UA 3S2YA 1UXKA 3VSBA 1X1DA 4KWTA 3FYHA 3CH6A 4Z5XA 3IILA 1PR6A 3I12A 2NUTB 1E8WA 4RTPA 3EXIA 3ANSA 1ZCJA 5BURA 1M34E 3O2NA 1OCCE 4DLVA 2KS6A 1YE3A 5ALKA 4RM3A 2DX7A 2OHVA 3JQ9A 4OHUA 2J3LA 1P9WA 4CFZA 1GTL1 2FNAA 1DBSA 1QH8B 5AQEA 4DC0A 2GRQB 1D7AA 1MFPA 2R6GA 2NV2B 3L1UA 5TS3A 1EESA 1A5AB 2C00A 2BRUA 1NIJA 2A9JA 5C1OA 5D1HA 2NSLA 1YKGA 4DBVO 4U00A 3UT5B 2PBRA 4KI0A 3OE1A 4W5WA 3HA3A 4DDTA 2IZ6A 5J2UB 3H0CA 1HM5A 2VSYA 2N9UA 1CC1S 1GUYA 3MS4A 2BKXA 5JSQA 4GG1A 5TQ0A 3HB7A 2GCOA 3N87A 5DB4A 3TSCA 1PFVA 2VBGA 3M0EA 1HEUA 2JD2A 2C04A 4B4KA 3ER6A 2MSLA 1EMDA 4JJ4A 4GYJA 1EFVB 4IMPA 3HLKA 2RBKA 3AJAA 3VMMA 3R0JA 2WIAA 4ZJZA 2I1WA 1SZJG 4XI0A 3J7AC 1W1WA 4X1IA 2I65A 2CCKA 4TUYA 4AS3A 1POXA 3GJ3A 2AMLA 5BWOA 1UOEA 2GS9A 5A2QA 5FI0B 1HE4A 1RTKA 5ALNA 4TL7A 3AF5A 3LGXA 4X7MA 3F7TA 4UVIA 4ZXFA 5TMBA 2LAIA 1K4YA 2NUAB 3U7JA 2DH6A 4BZPA 4RMGA 3UJAA 1S2DA 4Z54A 3HFGA 4N82A 5K2OA 1FYDA 2VTKA 4NATA 4DARA 1TK9A 3HY3A 1P19A 3HBMA 1EBBA 4WBNB 1NDUA 4RQIA 1K6JA 3NKLA 2VUIB 3ZUVB 1UMBA 2HZ7A 4NURA 2IU4A 2ZE6A 5KQSA 1RJEA 4PFSA 4ZI5A 4B93B 2VUTA 3LS8A 5FYDA 3QXJA 3PGJA 3TJPA 1E9AA 2XB2A 2VI5A 5DYNA 3HABA 3FPKA 3HKBB 4PXYA 3EVTA 3PJEA 3OE5A 2VYVD 1IH8A 1FNCA 3M4XA 4HX2A 4ZC8A 3AS5A 2IA5A 3KHUA 2QROA 3EQ9A 4BB9A 5F1OA 5LQKA 4BVJA 3SOPA 4CQLA 3G2SA 2KM1A 1GNTA 2XLBA 3EG5A 4MVWA 5BSWA 1CB7A 2LSVA 4KCGA 2CLSA 3WGIA 2ZBUA 5AKYA 3OZCA 5LKRA 3DEIA 1BGWA 1U9IC 4PV7A 1D4OA 2ZJYA 1OI4A 5BQPA 1S9HA 4IAOA 4FE7A 1XAJA 3I05A 1IVSA 3WB0A