3PUKA

Re-refinement of the crystal structure of munc18-3 and syntaxin4 n-peptide complex
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
579
structure length
552
Chain Sequence
ERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFNKIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLEEIPKLMKEISSTKSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTEENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYRTNYLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 3
total genus 152
structure length 552
sequence length 579
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pukA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 3pukA03
3C98A 1MQSA 4JC8A 4KMOA 3PUJA 5BV1A 4CCAA 1FVFA 4JEHA 1EPUA 5BV0A 4JEUA 4BX9A 1FVHA 1Y9JA 5BUZA 2XHEA 4BX8A 3PUKA
chains in the Genus database with same CATH superfamily
4J0KA 3T5VA 4EJFA 1M1YE 2GSWA 2TMKA 2D5IA 1GIAA 3T95A 4HGPA 3Q8LA 2W2KA 3IQHX 3LZDA 4W8HA 2AW3A 2QRJA 3L7BA 3ON5A 3ZU7B 5KHAA 5D3QA 2AHOA 3SWWA 3ACBA 3HKCB 4U5XA 3AG3E 3CZ5A 2QYUA 3SYLA 1F4LA 1ZNZA 2LNIA 2WDPA 3R7QA 3NHLA 5E4TA 5EX0A 3VOSA 2GLTA 4Q9AA 3AFGA 4BLWA 3HM9A 1WHTB 5CXUA 2BKGA 5IY5E 2GRQB 2CDRA 4RLFA 2WINI 4Y30A 2JFYA 5FO0A 4EB6A 3F90A 1II8B 3HJCA 1U2GC 1K5HA 1P0IA 3PPYA 4IQ8A 2I7TA 4NV0A 3RVMA 3ZXYA 4F1JA 1IBMB 1S2LA 5CR9A 1VHJA 1LPOA 2D4HA 3OJ0A 1KMMA 2ANCA 2HV9A 1L8QA 1UBSB 1O9BA 2MHCA 5ARFA 3ABIA 5E2BA 4KR9A 4WH0A 1MDFA 3O21A 1IIRA 4G97A 2WXFA 1XP5A 4YDSA 1ZLXA 3DMPA 3D59A 3ESYA 5T41A 1IIBA 1OXSC 1AKWA 2HC9A 4KHZA 3CNEA 4DX7D 2VHZA 1IXVA 2R3SA 3GLFB 4F6RD 3QMVA 4R7ZA 2I2CA 4G37A 4WEOA 1NN1A 4CR6A 1U5CA 5E6SB 5HP4A 1L4FA 3ICVA 4KODA 3LLSA 2HU8A 2AJDA 4MTLA 1T3GA 2FW7A 1IUPA 1FFHA 1G20B 1HE8A 1NRIA 2X9GA 3FUUA 1Z2EA 3IHWA 3HYNA 4ZANA 4NBUA 2PGLA 4CM9A 1NVVQ 2FEWB 1Z0SA 2YJGA 1IHBA 2D2XA 4D1YA 4OYHA 1GUAA 4A2PA 1IJFA 4BQOA 5LMNB 3PLAE 3PK0A 2FSSA 3BXFA 4H2DA 1WV1A 4C7BA 1I36A 2Q0SA 5GM1A 821PA 1DVRA 4MQ6A 3VYUB 4QDUA 3ZU5A 2AQ8A 1EFTA 3R3XA 4UQXA 4EUSA 2EAUA 1M2VA 5FBKA 4MO2A 5A5VA 1G55A 3GVHA 2WHEA 3IURA 2Q27A 3JQCA 1C7IA 3ULKA 5KX5F 3V4VB 5C4GB 4LNGA 2EL9A 1QP7A 1AQ6A 4DX2A 4MA4A 1OPXA 3OJEA 3UPDA 4RENA 2HWUA 3E7DA 5HF8A 1TVEA 1N3BA 4UVDA 2IPAB 3WP1B 1BVUA 1IOLA 3IALA 5B1HA 3TCNA 5IT9A 2SKCA 3EEOA 3PZDA 1R8YA 4LG6A 1WUTA 4H3HB 1DUSA 1YS4A 2R84A 3O2JA 3RS0A 2WMNB 2YTZA 3HCCA 1EUZA 5IH7A 4Q1EA 3FAKA 3ROKA 3U48A 1QYDA 3WRWA 2R7AA 1XZMA 4GI5A 2HIGA 4R1UA 2Q7DA 5J4VA 4CNBA 4XCQA 3CEJA 1FDWA 3AS4A 1R6AA 2OBXA 3JD3A 4UNRA 4TYQA 2A9OA 2X40A 4A3VA 3WB0A 3WYEA 1CK4A 3BXPA 3ZQ4A 1RYFA 3PQ7A 3WIEA 2FY8A 5AUPB 4A03A 3RSSA 1MB0A 2CHWA 4IN3B 2GN6A 3BJZA 1X1AA 3GUVA 3AFOA 3HVIA 3NVDA 3PHJA 3LUJA 4LMBA 4MRPA 1MB3A 4QXMA 4JI1B 4N39A 1TNUA 2AJLI 5AD1A 3RAGA 1VKOA 2VLBA 4K9NA 3OCXA 1LQTA 2F7SA 2NTEA 3Q8WA 4KLAA 4L5JA 5DBGA 2XCCA 2QBYB 1A1VA 5EJ2A 4ZQHA 1ENZA 2CT8A 5IVHA 2H6IA 4OLAA 4FXPA 3ZOKA 3HA7A 1JYFA 3I01M 4HMPA 4AYTA 2NAFA 3U5TA 3I3NA 4XPZA 3AWIA 4QVGA 1XNRB 2X8BA 4JP5A 3C16C 4DREA 5TPWA 1AURA 1U4SA 1QYWA 4XX0A 4EGJA 3OX3A 4HAYA 1Z63A 3BCUA 2XHEA 5C2YA 3CVUA 5HQTA 4FFWA 1P6QA 1Z4JA 2XCOA 1P2VA 3N0TA 3M5CA 3P9IA 2BYTA 4PX2A 3FU0A 3QKIA 2VQFB 1B8PA 4FGSA 4YP6A 1QGYA 3K09C 1N7JA 1IZ7A 3KU1A 2XMSA 3O95A 5IKEA 4XWWA 2VCHA 4BETA 4NARA 2XRFA 4B2YA 5DBEX 4JA7A 4INOA 4LFBB 3V8BA 1I5EA 1N4DA 4WNDA 3O93A 3ZGLA 3UHOA 3T1NA 2XPZA 3DVAB 3UMBA 5AENA 4Q4CA 4KT6B 1ZICA 1B1AA 1SIBE 3RFFA 3RR2A 1BXRA 1UDWA 1XALA 2HJGA 3TBHA 1QU3A 4FDMA 2WSIA 4KI0A 4P93A 1FFDA 3UEOA 3BSWA 5FLYA 3HMKA 3KFVA 2GVDC 3NONA 1J24A 3I32A 2V98A 2XYPA 5HE8A 3CVLA 4Q21A 2M6KA 2H9AA 1AG9A 4N2QA 1G7SA 1YI8A 4QARA 4TL6A 1UM9B 4JQYA 2P9PG 3SF8B 3VMFA 4CQMD 2YZ7A 3I9JA 1O2DA 3EWIA 5GV8A 1NOJA 5BN1A 1D1QA 2W6CX 2JAUA 5H0IA 1U7WA 1VXOA 1KMHA 2KZTB 1TU0A 3KSQA 2NV0A 2QNIA 3E9YA 4UXJA 2WU3A 3LKZA 3ZGQA 2HZ7A 2ZAIA 2XWPA 4P7BA 3H5RA 3OY7A 5CA0A 2VYVD 4HEJA 3I04A 5EHGA 4WEQA 1E63A 1DHRA 4BGVA 4WLFA 4CFZA 4O29A 1TEXA 4LNBA 4V1CA 1WPGA 3CW2A 1Z06A 2HJWA 3FDZB 1QWSA 5A6SB 4Y1EA 3VU1A 1DQRA 3ZD9A 4QREA 4MRVA 2X5XA 4JT4A 4CGYA 2ZBVA 2PL1A 4RK0A 1AQNA 3LF2A 2YHIB 5ED0A 4Z7QB 1CVRA 1TW2A 1ZXBA 2CHXA 4PR0A 3HJUA 3ULQA 1CT9A 4LJLA 5FUMA 4JP3A 3FSRA 2WYUA 4KWIA 4HI9A 2GEJA 3BE6A 3RE1A 1GDDA 1K06A 1NVTA 3HJBA 2AT1A 2H3EA 2IL1A 1RBQA 2GKGA 4NK5A 1X8JA 4YV0A 1N9KA 2FWIA 4MW1A 2WIAA 4UC0A 2H11A 4ICIA 1E1QA 1HDCA 1QH9A 1QHNA 1Z22A 2F00A 2FTKE 4H31A 2W6ID 1BHSA 4O4LA 2NTYC 1E79A 4F97A 1IHYA 4D8UA 4CTOA 4OQZA 4GA2A 1QZZA 3FPSA 3VH1A 4EELA 2BTEA 3AZPA 5EJMA 5B1AE 4GMFA 4KSCA 5CRUA 3WADA 2R0QC 3AR3A 2IU3A 3LHFA 1ZEJA 1Q17A 5BR7A 1PZNA 1XZFA 2ALJA 3CEHA 3JQAB 1EVJA 4MV3A 4UOEA 4HK4A 5JDCA 4IV8A 1YZGA 5JTTA 4MHOA 5CERB 2LTAA 4EZIA 4KIGA 3OZUA 4AN1A 3A1DA 4TMTA 3WG7E 5HA5A 3VPHA 3X43A 4X85A 3IUPA 3FLMA 2LE0A 1LY1A 1Y1PA 3KYIB 1Y3CE 1SN7A 4LW8A 4A0HA 4GLJA 1JHZA 3RS7A 4QU8A 3ZK7A 3HR8A 1PAQA 1XJQA 2AZDA 3HRIA 3TSAA 1FNCA 3HJGA 5AIAA 4MIOA 4EHDA 1CVLA 3WMWA 3IOCA 4EBFA 3Q3EA 3I9NA 4MHTA 3U9WA 2WD9A 1VCNA 3M3HA 4X7RA 1OLXA 1QHIA 2QK4A 2W6JD 5D5QA 4QLBA 4C7OB 3T5BA 2E1PA 5ELXA 1V47A 3NHRA 3Q0EA 3WRXA 4ISBA 1KI8A 1KZGB 4MJLA 2ZBFA 3BYZA 3GJ3A 2QBYA 1YZVA 1T0HB 3B1VA 3KD3A 1YB2A 1ZM9A 4NYIR 5HKBA 2QPTA 2R1UA 4MJ3A 2BR3A 2X22A 2QTMA 1EA5A 2NU7A 1OFIA 1LLUA 1SWWA 4RHYA 4MUHA 3HNOA 1CU1A 1TAGA 2ETCA 2HBQA 2J7PD 4JFRA 4Z9YA 1M2VB 1VGRA 2F8LA 3SQNA 2HGSA 3F3SA 5KTYA 1EQ2A 1QBQA 3TWVA 3PNSA 3UYKA 5ALOA 5I7FA 1U1GA 4BVEA 1ZS9A 1MFPA 4BKUA 2ABWA 2OGWA 2FFJA 4CM6A 4Q7JB 4UVGA 4B2PA 5JVDF 1TCVA 3TGPA 2EVWX 2OXTA 1HK7A 2MSDB 4HOYA 3F73A 1QFMA 3I09A 3GQVA 4MXDA 2EKDA 3RB8A 1GITA 3NI2A 4KUEA 3EHMA 2XGMA 1X9HA 1XTBA 1PLKA 3VC7A 4Y2XA 4U00A 2X8LA 4EJSC 3C8UA 4W9NA 3PTLA 3VJKA 3FFAA 2NC9A 5AQ9A 5H9VA 1WJGA 3DNPA 3NGLA 4HUTA 3Q8MA 1JU9A 1JR4A 1E96B 1O94A 1UBOS 3SDSA 3P4UA 2O3TA 3WGHA 2RGRA 1K1AA 1XYYA 1CVIA 1EDZA 1T6XA 3TVYA 5LWHA 2PQRA 1X3SA 1Z12A 2AN9A 3UT4A 4FZ5A 2E4XA 4AECA 1N52A 3NYQA 5GWXA 4X0EA 1KU6A 3CVQA 3FFTA 1T5LA 2QJOA 4YQFA 3FZYA 2ZJAA 4KDFA 1F5NA 1Q77A 1NNI1 4JI0B 1LGYA 1RI4A 1YOVB 4XWOA 2NUPB 5M04A 3URZA 1P5HA 3GG9A 1D2AA 4YI3A 2DUNA 1I0ZA 1KS9A 3HO6A 4CIWA 3B7WA 1R00A 4ENUA 1MP0A 1XA3A 4OVUA 2QE7D 4N0EA 3S55A 4JXTA 3TLMA 2PQ2A 3MRXA 1YONA 2OFXA 4WACA 3BXOA 1DWPA 3IVGA 2RKKA 4LMPA 1TAQA 4MVJF 1M6EX 2B0JA 4MPDA 3RO2A 1WAMA 1PTJA 3EU5A 4MVJI 2QTTA 3CLUC 4ZZ2A 2NXCA 1J42A 2V0NA 3O3NB 2C97A 4C6SA 2CXTA 5IW8A 4EVSA 4JGIA 2H85A 3DE1X 1JG6A 2VXBA 2Z9DA 2ZBEA 2WJYA 3RV4A 1O77A 4KI7A 3RCBA 1Z7GA 1SM4A 2Q4DA 1AGPA 2Q4TA 3ZEFA 3IQWA 3QPBA 4RJJA 2B4YA 1JHQA 4GMKA 4CU2A 4EI8A 1J2UA 4ZT6A 4FQ5A 1YR3A 4B8ZA 2JCBA 1OROA 4P6VF 5LQAA 1EYHA 3VPFA 4XGRA 5BSMA 2JA1A 3P32A 4FFLA 1QDLB 2YFQA 1G0NA 2P5TB 3DV9A 1NUPA 4B8WA 4XIFA 1EFCA 4TRRA 3J80A 4DM7A 1NFFA 2KE5A 4LDJA 4B80A 1JYEA 4BFXA 1FNDA 2GN9A 4G01B 1ZIPA 3WYFA 4F3YA 3JU3A 2CNNA 2CKMA 2HMYB 2XCUA 3GCZA 5FOXA 1UXHA 1QG0A 1KK3A 3HPQA 1KNXA 3ZYMA 5DGXA 1XFDA 4Q7LA 4W8GA 1QC5B 1Z68A 4CGVA 2O3QA 4BNVA 5FD8A 1CWUA 2QAGB 3KBBA 3B6JA 1Z08A 2AZXA 1WKVA 2VF8A 1IAQA 2Z6VA 3PWKA 1BIFA 3L93A 4O63O 3TNYA 5GJWC 3ROPA 4NFLA 4XDGA 4AB1A 4IDNA 3FTWA 4RQUA 4OAQA 5JXJA 4GKJB 4NONA 3PVZA 1U8XX 4LSMA 4BX3A 1T8RA 2CLMB 3BWEA 2VEOA 3RUPA 2IXGA 4YWHA 3UWOA 2GN8A 3I39X 2YXBA 1EU1A 4INPA 4LJ4A 4CF6A 3M6UA 4DKJA 1E3TA 4OOFA 3PCXA 3UGJA 2P4HX 1B73A 1G7CA 1PNVA 1TJFA 3HDGA 1FSPA 5DNYB 3E22A 3H9CA 5A1TA 1T5OA 1V1RA 1YOVA 1GR0A 2E6KA 2L18A 4FGKA 2IP1A 3O3CA 2HPHA 4G0PA 2PDAA 5DHAA 5KDDA 5T3RA 1W76A 4FZVA 3S7JA 2VK4A 3A4MA 4OI0A 1DEAA 3GLSA 1NRXA 2AOTA 4B3GA 3JZDA 1Y1SA 4MUGA 5CHEA 1DCQA 1C3LA 1H8HD 1FMFA 2C4UA 2KBXA 3U4IA 5AKKA 2GGFA 1LDEA 3LSTA 4UBNA 3PI7A 3LY5A 3KXIA 1EFPB 2WKRA 4HX2A 2RJ3A 4WCVA 3U9TA 3URMA 3PRKE 3AI3A 4CCWA 3AG2E 3U7HB 2V0GA 3ZXXA 4DJEC 4W5JA 4WNYA 2P2NA 5J08A 3DL2A 5SV2A 2VK8A 1ZWLA 5M2QA 3P0EA 2Q6IA 4EAAA 4YV2A 5CFLA 4CF7A 3K31A 3PKZA 3HWSA 3UXHA 1GKIA 1A2QA 2ZI3A 2XVXA 1AMUA 2DB3A 3N1UA 4KIFA 1EWTA 1S89A 2PZJA 2V5VA 3D8TA 1RWVA 3A1UA 4U9IS 3RRNA 4HYYA 3BGWA 4RZ3A 5C8YB 5JO0A 1XEWY 1YD7A 2P3LA 3L0OA 3U6BA 1OAKA 3WBKA 1PFYA 5LYYA 1C7QA 4MWSA 3EMKA 1FB5A 1UOPA 3C70A 2F3TA 1O4WA 4R1LA 3FDFA 3SXUB 2EIKE 1GRNA 4KYIB 2I4RA 3CKYA 3GL9A 4I8IA 4GRIA 3IOEA 1DXOA 3I1JA 4GBED 3UJDA 3NT4A 4BB6A 1BW9A 1JFVA 2ZRPA 1E7VA 3EG9B 4E5YA 3PGMA 4F4UA 1UMCA 4JGBA 3VTAA 1A4XA 1ZK0A 3MTIA 2VZ0A 3NIDB 1P4GA 4RGQA 2XDWA 5D66A 1CQXA 4WXEA 5FPYA 4Z8YA 2UYGA 5TV2A 1EGHA 3TOSA 3NASA 4UXIA 1QAMA 2DPLA 4HAUA 2XA2A 4RZUA 4WESB 2Q3BA 5TSDA 2QJFA 1UFQA 2WAMA 4CL3A 2AIRA 5DGTA 4D25A 2TMDA 4U7FA 4Z4EA 4J43A 4WNGA 3PIDA 2RD2A 2XX3A 3IEPA 1GUYA 3GCXA 3GDGA 4F1PA 4ZV4A 3R6DA 4BMDA 4FHEA 6ADHA 2B1QA 1GPMA 3SP1A 3HP4A 4QLAA 3FTQA 4NPCA 1Z29A 1U4NA 4LYAA 6PFKA 4DUGD 1MGPA 1QO0A 1XV5A 3YASA 1IMJA 1RM4A 2Z08A 3AINA 1UFRA 3DVQX 2YRWA 3PQDA 1BCSA 1X1TA 1YHZA 3CVNA 4A8HA 2CFSA 2X0IA 4OHUA 2E21A 3Q88A 5EJ5A 2IS6A 1O94D 2PSEA 3AL0C 4L2LA 4PVDA 1ISGA 3TMAA 1WEHA 4DWVA 1OI4A 1VFPA 5I9TA 3KB1A 3M1LA 1X70A 1P2SA 3HVEA 1Z8HA 5L4SA 2YQ8A 4DG9A 2V59A 3RHZA 1O5TA 1JMYA 3HGMA 2QQGA 1UR5A 2CVZA 5KMGB 4CZ2A 4C4ZA 2QRUA 1H0KA 4TTAA 3VYWA 2BEUA 3Q3HA 4PQEA 5JHHB 2YZKA 3RTBA 4Y2UA 1XKTA 4BO3A 3KSUA 1M0EA 3I30X 1T9GS 2H52A 3GGPA 3UT6A 1M6VA 1ZGHA 2XHZA 1NFIE 4ALLA 4XIYA 3E81A 3RAPR 4MPPA 2WYOA 2Z3ZA 3LAWA 4WZBE 3UUGA 2P9NG 4FDLA 4CTKA 1JEJA 4D9KA 4WERA 4MGEA 5A7HA 3C3WA 3ZVVA 5HK8A 3DBLA 1E8DA 2F1RA 3WLRA 1PNTA 2FKAA 4BPRA 4DRYA 5GJCA 4BNGA 5K4GA 1GWNA 3WISA 3BE8A 1XDZA 2ZM5A 3LCMA 1O6CA 2EYUA 4IV5A 4Q7QA 3O92A 1MV8A 4XRRA 1IRXA 4YLYA 1XVTA 1YRBA 1V9LA 5CDHA 1NT2A 2HGZA 2YIDA 3EPLA 3Q3VA 5EYPA 3GP8A 1XC7A 3E9DA 4DRXB 4WLEA 4G4GA 1GGKA 1SQ6A 1UT8A 2IO2C 1NA0A 3D9MA 1XHFA 3B2EA 3L6EA 2ZBUA 4Q18A 3N6VA 4FNGA 1EMDA 3CINA 2B4QA 3IFSA 3JW8A 4J0FA 4F56A 1HQCA 3R3WA 3VGJA 4AXBA 2J7KA 3IEGA 4MWGA 4UCWA 4CUJA 5KVVA 1N8TA 3DFZA 3E9NA 5AICA 1QHFA 3A6HA 3DNMA 1D1TA 1NW3A 5IARA 3S1AB 3IPYA 1S4QA 3COYA 3NBAA 1GYQA 3FTCA 1PQYA 1F2TA 4OQXA 3ROTA 3RYIA 3EB9A 2VDWB 1Y8AA 2CW5A 4LEIA 1W4CA 2MMCA 2ZULA 1LBTA 2IYAA 1WS6A 1C8LA 4QDOA 2CN1A 3RAJA 2X1MA 3VSAA 5K6TA 4I55B 4UAUA 4BRZA 3VJMA 4EBAG 5CDGA 1V3VA 5KREA 4H1HA 3CO5A 1P19A 3B7SA 3O82A 4O59O 4PRLA 3ZUGA 1XZBA 2ZU0C 1UOEA 3L8EA 2O8FB 1P7WA 2AX3A 4K1LA 1XNGA 3L4BC 3A58B 1Q7RA 1XNFA 2B4TO 2IKQA 3CYFA 4JUAA 4AMVA 4D9CA 4N0MA 4JV5B 5IF9A 3HVEB 3ZJTA 1M2GA 1SKQA 2VWPA 1VCOA 3CRRA 3QLVC 1I5OA 1NVDA 3RHTA 1TCUA 3QX9A 4HGYA 4KYTA 3NF1A 1J0AA 221PA 2V6JA 3BBLA 1L5QA 4B3MB 2GUWA 1RHMA 1YK1A 3HM2A 3B7PA 3HG0D 5F4BA 3TPFA 1B8NA 1P81A 1GHTA 1BCSB 3DEZA 2PL2A 4RFSA 5DBFA 3KOOA 3SC2A 1VLJA 3CNHA 4K6FA 5FHQA 3H1AA 1Y1RA 2FZGA 2ODBA 3BCSA 2PUJA 5ECWA 1HF8A 2NUAB 5BVGB 1ADCA 2I4OA 2PS9A 3NTXA 4QSMA 1SUEA 5COQA 4KGDA 5AHOA 1KYXA 4DMRA 1WY5A 1TT5B 1L5OA 1DAFA 3D0OA 3E3OA 1T2AA 3NOOA 2HPVA 3FYUC 5EINA 1GQQA 3MMPA 3OZEA 4JIMA 4X20B 2B21A 5A71A 3OHSX 5CBPB 3FYSA 3KOYA 4B83A 3ZLVA 4CF3A 1US8B 3ILSA 3EJNA 2OXFA 1SOVA 1ZFNA 4GTTA 2W6OA 4KQ2A 1COZA 1I6MA 3ITKA 1M1NA 4MARA 2YNQA 3BCHA 3GFBA 1LFAA 1G9SA 1ZK1A 1IQRA 2WFLA 2XA1A 3FWYA 3IR6A 4XVQA 2Y4UA 2NZUG 4IRMA 1X7XA 4ZCQA 1ZUNB 1GOTA 2DKOA 1OF1A 2P27A 3JAKA 1OH5A 4IS3A 3SSAA 4KBYA 3CEAA 2EG9A 3M9WA 1GQFA 2NNWB 5B3JA 3B53X 5K0NA 4QGHA 3D9OA 2VF4X 1GCOA 2WUVA 1K92A 3GBVA 1GQRA 3OIYA 3R8CA 3SG0A 3QKSA 1YA4A 4YQZA 1UK9A 3M2PA 4HDMA 3HABA 4IINA 3Q7RA 4LTMA 5LQKA 1JXAA 3CEMA 4BFRA 4HORA 5HUJA 4I2WA 2QE7A 4PZPA 2Q5CA 4DCPA 1C9NA 4G56A 2HB6A 1A5BB 1HM5A 4GBMA 5I8ZA 3EF0A 5LYJA 1YFJA 1WMAA 5M5BA 3BVPA 1YC2A 4FT4A 4ZOCA 4YRSA 4IBOA 1JZQA 3DZFA 1C81A 2DWZA 1FJGB 4U95D 2VPZA 3D2BA 4OQYA 1YJAA 4UM5A 5GY7A 4YRPA 2JFPA 4FD3A 5EOVA 1EGAA 3ED5A 2XMGA 3AF4A 3PRHA 4KNVA 4RA6A 2IU0A 5CX1B 4B4WA 5K0FA 4A36A 3D9QX 5HIIA 2QTZA 4BLTA 1HETA 3R8FA 4LFAB 3K2EA 4QNMA 5FFMA 1AV6A 3UB3A 4RAQA 1DIAA 5EKUA 2HF8A 1OE0A 4TL8A 2JATA 2IOFA 2VSOE 1UDXA 2IZ7A 1P1BA 4FMDB 3KUDA 4K2HA 3G2WA 1M54A 3FDXA 3AF3A 4RD6A 3JZAA 5FAKA 1M72A 4KXKB 3DHNA 2KHZA 1I13A 2CF5A 1D2NA 1M6WA 2ZSHA 2OC4A 2A0UA 4MAFA 5F21A 3IODA 4DMUB 4E12A 3R24A 2ZJ6A 2PWYA 3IHKA 2BFWA 4KR0A 4Q4JB 4YAEA 4ER0A 3SNXA 2IY0C 2DLNA 3K96A 3Q73A 3ONEA 1JKXA 1YDFA 4FFBB 3RSHA 3SQMA 5IUKC 2R5FA 2XNHA 4POOA 5FT9A 1KDPA 3PUKA 2CDCA 3HU5A 4IMRA 5LDGA 1NVGA 3Q9NC 5ANRA 3WBJA 3GPIA 4UHDA 4GMRA 3FRHA 3KEQA 4KH0A 4LNUD 1JHYA 2QM8A 2G9NA 3EIXA 4UTXA 1PFQA 4ND8A 1JEOA 4F92B 1N57A 3A1CA 3JQDA 4BFZA 2RGEA 3G82C 3PJDA 2VYIA 4FYXA 2UVPA 1TC2A 4HFNA 3UJ9A 2ZS8A 4DSZA 2IEZA 3OPNA 4MQ4A 4WZBB 1HNNA 1TLTA 3LYHA 4E22A 3CXRA 1S70B 3WLOA 3CSFA 3MLEA 5AVYA 4X90A 2QAGA 1HUQA 3EIOA 3GFQA 3IIKA 3ND9A 1IQPA 4PLPA 3CHYA 2A7QA 5DGIA 3LPCA 2EXXA 3JV7A 3D6AA 4G0ZA 4CDRA 521PA 4TKLA 1DQZA 4B0ZA 2OHXA 3K2QA 4UTRA 2VCYA 3E9QA 3E4BA 1L7EA 1NLZA 2G8NA 4JJ8A 4G0MA 4Y9UA 5ABPA 5KYXA 4WOBA 4E1BA 1ZESA 9LDTA 1KAMA 2EWVA 2GJ9A 5FOVA 4BMSA 4DLSA 3T1TA 1NPTO 1GNVA 4UM7A 1H9AA 4MMYB 5CJJA 3UB2A 2PXCA 4IF4A 5AQAA 5REQA 4J3FA 4CHTA 2DIWA 2JD2A 2JIBA 3QMWA 4PYJA 3W5IA 1RZRD 3FUJA 5HRYA 4ZYWA 4DR3B 3AHHA 4KXMA 4PFKA 3CNLA 2ZE8A 2AG0A 5HIMA 1CERA 4CKCA 5ENNA 1S3SA 5JJ7A 2E2WA 2FPLA 2I67A 2WTMA 3LUBA 4LJ6A 4MCIA 2ARKA 4O2AA 5JROA 1GL7A 3KWJA 4N0PA 3E27A 4GBJA 3UW3A 5EJEA 1EVLA 1U0GA 3MWGA 3TSYA 2FDCA 4IIYA 3G2TA 2A86A 1U28C 2QM3A 4O2RA 3FCOA 1A9ZA 3TDNA 1HPLA 3K6JA 2VRWA 2X2EA 4JDUA 3PEYA 3F2VA 3T3DA 1G6OA 3UT5A 1FFWA 1U1FA 3TE7A 4BWFB 4I1OA 3BMOA 1RWXA 5FXMA 4GTPA 4A0FA 4F4FA 8OHMA 3NPAA 1FQKA 2QT1A 5TVGA 2HZBA 3W3AH 4ZVQA 2QLBA 3II6X 3B13A 4E21A 2O4UX 1UMBB 3X2QE 4E6HA 1DUVG 1GD1O 4DBLC 3W1VA 1GARA 2F1IA 3GCWA 3U3DA 3C5VA 2VQ2A 3F5DA 3GAAA 5IJ9B 2NVOA 2FMIA 1GTZA 2O1XA 3KKOA 3VLEA 2O7QA 3B51X 5LN1A 1CJSA 1XXHB 1PZFA 1T2VA 4PG5A 2F4NA 1HSZA 5LL6P 4BWRA 4UFOA 2C61A 2C98A 4CJXA 3DEOA 1WD5A 2R6JA 2JLUA 2NQ8A 3F47A 3TQSA 3FAZA 4KLRA 4Y6WA 7REQA 2CJWA 4W7IA 1GL6A 5THXA 4DZTA 5EKQD 4O4IF 2JGDB 5DWVA 1GNLA 4BUJA 4EPVA 5DGCA 3R3JA 2NZWA 5KSYA 1FFXA 3ESKA 3RIHA 2QTVB 3A9UA 3ESAA 5LQUA 4GMDA 4AEZC 5AI0A 4P7KA 2OENG 1ISPA 3VDXA 4XWKA 3MCXA 1QCZA 2QX6A 4WJZA 5KNCD 4JUFA 1EK1A 1FS4A 1RBMA 1HYEA 1QZ2A 1NXWA 4ZO8A 2L6JA 1U8UA 3IAM6 1KDYA 3G0DA 3BXXA 1IDOA 3RYHB 1ULSA 1WZUA 3IKLA 1JUQA 5AW9A 1FU4A 3HBAA 4TMVA 3EY9A 5EE5B 3R9XA 4JL0A 2JCXA 3ETJA 4NZ9A 5LZ4A 5CH5A 6ABPA 4I1OB 5L95A 4TVSA 1F0YA 3D0KA 2WIDA 3D8RA 3EZ2A 4B0PA 2HSJA 4D74A 5CGZA 2A59A 4G4SO 1SHKA 2C59A 3DUFA 1F12A 1TMKA 2P79A 3LW7A 2FZ5A 3UKJA 4P7GA 1OQAA 1YBFA 1DV2A 1PJQA 3KEGA 2BFBB 3GD7A 1PSDA 2UYOA 3N0RA 3WI7A 4C0HA 2QPLA 3FCEA 3DWFA 4BOYA 2Q5LA 2A94A 2FPRA 3I6BA 4O1HA 1RIIA 2O0JA 3LXMA 4L5IA 2MINA 3DD1A 5HQ3B 4EB0A 2H6EA 2PA3A 4CKYA 2UZ4A 3DZCA 5IN4A 4DKXA 2JFOA 3UV7A 3EA0A 2R7LA 3LLCA 3VDQA 3UPUA 1TRHA 4WUTA 2QMOA 3IKVA 4L2IB 2AHRA 5KWJA 2WUDA 4LVOA 1HXHA 3KJZA 2GEBA 4PWZA 1QDEA 3SIRA 3KSZO 2WXMA 3DTYA 1EVZA 1M2JA 3L16A 5H16A 5KKAA 1UAAA 3I76A 2JIOA 2YHUA 1ORVA 3OT1A 4HJRA 1K7SN 4YJ3F 4WKBA 3ZZ0A 2FVYA 1BEUB 1LD3A 1LWNA 3LS8A 1E4EA 1AQUA 1N6RA 3SEZA 1E4VA 3W4IA 3P2BA 4U7EB 2W2NA 4LZPA 5KYYB 4JYBA 4IL5A 3UJHA 4D9NA 5LP6A 1QONA 4ZXPA 4EYEA 2HT6A 5ED4A 2HEGA 1P8AA 4XFDA 5DHQA 3THRA 1NRWA 2R85A 1R4ZA 1WU8A 1ILEA 5ALGA 4CKZA 4FOTA 4QPCA 1N2IA 1NNUA 4UBLA 5NULA 4DCJA 1RXYA 3KQOA 3PITA 4U0UA 4OLJA 4E5NA 4OQQA 2QE6A 4XEHA 1UDBA 1YH3A 2WZCA 4YB8A 1GJRA 1H2BA 5HK9A 3EGXA 1ZMOA 1CETA 1YBHA 1GPNA 2AR0A 2ETXA 2MR6A 3IELA 1NRJB 4KYVA 4ZXFA 4CKEA 5JRZA 5KQRA 5FPQA 3U4HA 2UUCB 1C30B 4ATGA 2FEZA 2QX8A 3KWLA 5CEFA 5JFOA 1MG5A 2LSUA 1QYCA 1Y42X 4X3CA 4MGZR 3A4IA 1E18A 4BMNA 5IXSA 2N3ZA 1IN5A 2BFFB 3H1BA 4NMMA 2B6HA 1GZ5A 2E4YA 4HH3C 4F9FA 1NJ1A 1JEYA 2YJ4A 3EWNA 4GBGA 2FHSA 3IUNA 3TL2A 1J8QA 3KR0A 2QUIA 1JIXA 3NATA 2R17C 5EPEA 1VLMA 3OLYA 5FBVB 1CNMA 5A5EA 4EJ2A 1U3UA 4LFCB 3ZHXA 1WBDA 3Q15A 2H57A 4YT2A 3Q41A 3C3MA 3UH1A 3ZQUA 2ZT6A 2BVNA 4LA4A 1RXUA 1DRVA 1O1YA 2G4LA 2QZZA 2F64A 4BCDA 1J00A 4XASA 5KHOC 4ARIA 4NCBA 2CBXA 3BA1A 5J5VA 5C80A 4LSGA 2Z04A 5JBNA 2CL7X 3LHKA 3C5HA 1Q0PA 3E61A 4CMEC 3RU2A 1SVLA 4DUGA 2AXNA 4N1AA 2I4IA 1RLTA 4R54A 4AIRA 2HNBA 4WOKA 1A3CA 3OTHA 4IUCS 1XG5A 4YDRA 3MZ0A 3QKSB 4MYSA 2W00A 4TV8F 5BRNA 1GGHA 3I9V6 5IYZB 2J33A 3ED1A 4G81A 3ZK9A 3KSBC 2MIIA 1CZOA 2YJNA 2G1KA 3ETNA 4M9UA 3OQHA 2YWJA 3PENA 4G85A 5BQ5A 1Y5NA 2Y66A 2E3JA 3JQFC 4HLQB 1XLTA 4PICA 5CDSA 3P9YA 4IMIB 3NAGA 4QUGA 1XZKA 3T5CA 1KR5A 3L79A 3TLJA 3W8NA 3QU2A 1PJ8A 1N9GA 1XROA 5BT9A 5AHRA 2PJZA 1F38A 2B98A 2XGOA 2FWBA 1X19A 2JLSA 3NJ8A 1G5FA 4FD2A 3LGXA 3MUOA 4JP8A 4R83A 3MWDA 3KXKA 5IVDA 4BNZA 5JNLA 1YUMA 1PL7A 1CSEE 2AFIA 2JI9A 3HYTA 1H4TA 1W0JA 2GXQA 4P33A 4BE4A 1JG3A 3QNWA 4XE5A 3ZVMA 2L2QA 2LKCA 3T52A 3NVKI 4DYHA 3WWDA 1QQTA 2X0EA 1JB9A 3BTVA 4LPKA 1M8FA 2Y0CA 4LF6B 4AUEA 1P44A 3BCRA 4KQCA 1E3MA 2O2XA 2WM3A 3CRMA 4O0LA 1PAUA 3VTXA 4H4DA 3B9QA 1E2NA 4PE5B 3VZBA 5DV9A 4DSNA 1XZNA 3FOBA 4EKDA 3WQRA 3HP7A 4GT1A 2J4FA 3N0VA 2WIFA 4IO0A 1SOMA 1CZHA 4KCGA 1NXQA 4C6HA 4ADSG 4D44A 1EA7A 4TUYF 2OECA 3QU5A 5HF9A 4FEAA 1A8PA 1Q3TA 3DWLG 3GGSA 1E2MA 4IJQA 4KFTA 3BL8A 1PI3A 1AKVA 3MKRA 4A8JC 2A9KA 2PRYA 2Z3WA 2WWGA 3F71A 2BHNA 3H5AA 1W36B 2V8BA 4I2VA 1J2YA 2ZBGA 1JDTA 3GHYA 1TDJA 3MC1A 3ELDA 5TGTA 4J8EA 3BL6A 1IY2A 4YRIA 2E87A 4AVXA 1GT91 1UQRA 4IZ6A 2C58A 2OGUA 2WXIA 4IPTA 1D0VA 5L45A 3KQSA 3PVCA 3ORYA 4M22A 4O2BB 2VF7A 2BKLA 5CJPA 5BNFA 4DLRA 2A0XA 5AVQA 1E7MA 1USWA 2GTHA 3ZWAA 4EFLA 2WXLA 4LYHA 3VKWA 4G2TA 2CXPA 1YMUA 3DFFA 1GCGA 2XWSA 4DV6B 1P1RA 2G8LA 4B79A 1IHOA 3NHYA 1NOKA 3PC6A 4NBNA 5K8IA 3RASA 3BFXA 4XLLA 1Y9ZA 1FNSA 5BPPA 4TGLA 3R09A 3TI9A 2Q5HA 3FZQA 1RMQA 3WFJA 1SMKA 3FUVA 1LTXA 3W7VA 5HFAA 1TO2E 2FW6A 1N8SA 2C00A 1PJLA 4HVCA 4XVUA 2B30A 5NLLA 3V6LA 3OJWA 2VDOB 3WGJA 5A04A 4MV7A 5BW5A 2PA0A 2P9IG 2PLNA 3NKFA 4MJ7A 1M75A 3PS9A 5B2EA 2NO9A 4QG7A 1A50B 1IZ0A 5CYGA 4YAGA 1CUAA 4JEIA 1XU4A 1XTIA 3D6MA 3K09A 4D56A 4ZGBA 5LDHA 1CEYA 4PPFA 4JD5A 4F5ZA 1VCHA 2QRQA 3HJRA 1YS2X 1TJPB 3L1HA 3NBXX 3EVZA 4PXAA 5BN4A 1PUIA 3COWA 4D8XA 2P9JA 1V45E 3GH3A 3PFGA 3O4JA 3OZCA 4HGQA 1UANA 1E2FA 2DFPA 1H6PA 4EPZA 4R81A 1OC2A 4GZ3A 1GRVA 4L76A 5EGSA 2BKAA 4AFNA 2J9XB 4UTOA 1L5FA 4HWKA 5AM1A 4C0EA 1V16A 2DPMA 1PR5A 5IF3A 2BELA 4MR9A 4K5AB 1HV8A 1G38A 2GYYA 1X80B 4QSHA 5FTPA 2YFHA 2ZB7A 4EHLA 2DWPA 2DHQA 1SXJE 3BGOS 4FUTA 1S2MA 2RIRA 4ER7A 4XM0A 3N8GA 1QGAA 2QSZA 5FR1A 3UMRA 2D0IA 1R0WA 4WWHA 1PDWA 2PSFA 3ZV3A 1XPUA 4NZNA 4PGHA 1RACA 3GLUA 4LXGA 4JR1A 4M0UA 2GFHA 3GHHA 4Y6LA 4MA5A 4TMXA 1NVKA 1DTWB 3L07A 4U63A 4NFSA 2VXOA 3QVUA 2IZOA 4BBAA 5LD2C 1KYVA 4ILGA 4KXNA 1GNRA 3EZNA 3I8SA 2NPOA 1ZCZA 4RQBA 4JJAA 1CUCA 4UVHA 2FCAA 1AX9A 3E70C 2Y1WA 4DA4A 1QRTA 1TQ4A 3D4IA 3DEIA 3L9WA 5F3WB 1KI7A 3MYRA 5HX7A 1K5DA 1VE6A 5KNBH 4WADA 3GGGA 1SXJC 2I3DA 2VSOA 4EKNB 5G05C 3IH5A 1RRVA 2C0MA 2PJDA 3G5AA 2WHPA 3COSA 4Y9TA 1XPRA 1KQFA 1F8UA 1UPAA 4JBIA 1U2QA 3N6RA 3G79A 5AW7A 5LIRA 3EEQA 3E35A 4S2EA 3TCXB 3UJ3X 3QTBA 3R9WA 3OIGA 5T8KA 4B17A 1VMAA 4LCBA 1HE1C 1Q1EA 3UBMA 2OCXA 3QWWA 1G1AA 4B6JA 4EI9A 4BTVA 3WRYC 3JD2A 3D1VA 3AP2A 2O7NA 5KVAA 3CX3A 3HN2A 3EDOA 4DNXA 5CTAA 1G9XA 3PB3A 2CNWD 1YR1A 4WNAA 4EX7A 3V8NA 2PL3A 4GPBA 5DW0A 3AP1A 1KEUA 2QQEA 2MINB 3H2GA 3KB6A 5JHBA 1UH5A 2VKQA 3BAFA 3R3VA 4WAUA 5G04J 1WRBA 4NENB 4NV1A 4PLWA 4C5CA 1ESMA 1G3QA 2XE7A 3IJRA 4H6VA 3VPXA 1H1TA 4OYLA 5CDTA 3IB3A 2Y68A 3APCA 1V0JA 1LDNA 3JQ8A 2QMZA 2D06A 3EVNA 3FPHA 3FPBA 4JJIA 1OBVA 2Z43A 3EZ7A 3CUYA 3GRCA 3QY9A 4IIJF 4ZU3A 3LT0A 5AOBA 5DM60 4NCAA 4MUYA 1N78A 2VJMB 2GCGA 2WHRA 3FSJX 2DFKB 5CG2A 2WVAA 1G6Q1 2BZGA 1A4RA 4RPJA 3TB4A 1AD2A 4RJTA 4IZOA 4MEJA 5KCMA 1LJLA 2NTVA 2V4ZA 3ENQA 1E3WB 4MVWA 4WNIA 3L1VA 4LXYA 2K87A 1SCKA 4ZREA 2FSVA 2WJ3A 4WNEA 2H0QA 3LP6A 4CF5A 4KTVE 3UAOA 3DEPA 1M5RA 1WSDA 2A9QA 2Q1YA 1JHUA 3L54A 2BP7A 1NA3A 3EMDA 3PNYA 4ITVA 2X2PA 1G98A 3ZWKA 4D6XA 1PYOA 4N5QA 3NEJA 3SIXA 2XUAA 2ZUVA 5M34A 1C4OA 3TFWA 4BFUA 3T3PB 2QUHA 1WVMA 4LC0A 1UBHS 3CU5A 5K6RA 2MDTA 2PD3A 1QLJA 1OX5A 3I0MA 3K72B 1LXCA 1Z0KA 3DAGA 3RADC 5DTEA 3DZBA 3LT5A 4BKRA 4V0MA 2IDMA 2JJ2D 4MP3A 3AEUA 2H5LA 3FGOA 1H85A 3RTAA 3RSZA 1AUXA 4WKNA 1F7UA 4JI2B 1XXHA 3LDGA 3CK9A 2XSZA 3BE4A 4E88A 3AS8A 3K7EA 3PJFA 1PJAA 2EYQA 2ZKIA 1MHPA 2TYSB 4D26A 4ZI7B 3RUIA 3ZHRA 3CHPA 4WZ6A 4M53A 4XIJA 2R7MA 2CF6A 4P32A 1FX1A 1Z25A 2Y0BA 4HZIA 4X24A 5D1HA 4A0RA 2PUBA 3WOVA 4G89A 4QJ4A 3SSMA 4EA8A 2DG2A 3SZGA 1V48A 2Q8QA 3O9VA 4L28A 4OP1A 4RW0A 5JLJA 1O1RA 1DBIA 2YUTA 3GRPA 1JPJA 4GOLD 4HQ6A 4QOGA 4B7ZA 2YINC 3ZBTA 1J1UA 3EXG1 2ZRMA 3AUXA 1H2XA 3VNRA 2Q3CA 5KX5B 4FADA 2GEUA 4DLLA 3T5PA 4I1MA 1FFAA 3SGLA 2J46A 4D96A 4MR8A 1KTIA 4FLFA 1DC6A 1XJ5A 1KXZA 4COOA 1YMPA 2DWCA 1VOTA 3B7RL 3REFA 5JSFA 3LBFA 5FLEX 5EMLA 4WQMA 4RLQA 3PUXA 3Q7TA 5BNWA 5JXGA 1UF9A 4RJLA 4OK5A 3W5SA 1FUYB 1QCYA 2QYTA 4ID3A 3BRSA 2P6OA 2W2LA 3I34X 3RVOA 5LQNA 3PNLA 3EXG2 3MGGA 1TXGA 1HT1E 1Z0AA 2H18A 3MB5A 5FFFA 3WRYA 4DB2A 1PS8A 3R4CA 4XLTA 2DVMA 2JLQA 3ZGYA 1MVLA 5AKJA 3DTNA 4HLCA 4CM8B 5HMMA 3CMMA 2RK4A 5DRTA 1SGWA 1WW2A 1ICEA 1ILWA 1MOQA 1CDOA 4FC6A 2O0MA 5CA1F 1BOFA 1FP4B 1F2VA 1IBKB 4BSZB 2X0NA 5DTIA 5I8WA 4ZT4A 5IH3A 3A70A 1G291 1M3SA 5CA0F 1W581 1EDOA 1TF5A 2EGUA 3M5WA 3I2IA 1R0SA 2HLDD 3G88A 4PAGA 5K0CA 2VDQB 4XVRA 4UMVA 4BX9A 4PBRA 2Q9UA 5CP8A 4RKQA 1SFRA 1YCGA 3ZWMA 1XA0A 1EGVB 3GYGA 4DXDA 3HFJA 3C41J 2XB8A 2IFTA 3VOBA 3FJYA 2E4VA 2HV8A 4F7DA 1BLXB 2PV0A 1L5WA 4ZAVA 3RVBA 3UAGA 4AZ3B 1TPYA 3F46A 4O4HA 4R05A 4BLOA 3AYXB 3QI2A 4R9NA 2OHOA 3BG0B 1AO3A 3ET5A 2VJ8A 4GOMD 1MX1A 1GN8A 3S5JA 1A8UA 3ONVA 4B5KA 2CVFA 5EMHA 3VOTA 3OKFA 1B4DA 1QKKA 2Q2OA 3SF4A 2O3SA 3L7CA 5DB4A 1YWGO 3L6DA 4P0QB 3OC6A 4RG6A 2O5VA 4NPAA 3AV0B 2ZANA 3X1MA 4FB4A 2GAIA 2ETBA 5ETJA 3UJ6A 1RJDA 3QGMA 4B3CA 2VRCA 1AXRA 4BS9A 4GZ5A 3A06A 3BWXA 3I58A 5E0OA 4B0OA 4MVJM 1L5SA 2YW2A 4MRRA 2G25A 4AJWA 3ETEA 3THYB 3QWAA 1KZ4A 3E34A 2HRZA 5K45A 2YWDA 1WNFA 2JPDA 3PR3A 4FE4A 4NZOA 2V8OA 5J59A 3PHLA 3RT9A 3W6UA 1IY0A 3H2SA 4J8PA 4MS4A 4DZZA 5GINE 1PVDA 2WQ6A 2E6UX 1U9CA 2Q5EA 1KC3A 4W5HA 1JFRA 2G67A 3F8WA 4M7CA 1NTRA 4EPTA 3DBVO 1BS9A 2WJZB 5E7MA 4C05A 4I9UA 4ZO6A 3S40A 1ANKA 2WWYA 4PUCA 3R5SA 2OBNA 2O5RA 5F7JA 3DMYA 1K8YB 3NC0C 3QFTA 1OXJA 1KJ9A 5JDIA 4HAXA 1JG1A 4HTFA 1CY7A 3DG9A 1LTHR 2DT8A 1TVCA 1GLGA 1ZN7A 3ADKA 4NNPA 4RKEA 2AC7A 4QOJA 5BOSA 1P75A 3QQ5A 3BGVA 2PNNA 4H7HA 3RJVA 4YFYA 3D3KA 3JRXA 3SJ7A 4MBGA 4BZXA 2WF5A 2ZQYA 2YMQA 2HXGA 5JPCA 5F12A 1KFCB 4HT3B 1C0IA 5C52B 4GOOD 3OAAA 2H06A 2HY7A 3HYSA 1AK2A 2FLKA 2JAOA 3PSAA 3DC2A 4MNTA 4MPJA 3KSMA 3FGNA 2KXPC 1KKMA 5IBQA 4HQNA 1IPFA 3USES 2W6JA 1L8AA 2WTBA 1ZNYA 4RYLA 4OJNA 5BN5B 1O5IA 3BFPA 3H4TA 3ITNA 2PKCA 1HE4A 1SOWA 4K6HA 2Y69E 4EABA 3L82A 2BDTA 6LDHA 5K8JB 2JLCA 5JS8A 1NQTA 2H1VA 2AQKA 1Q1QA 3KR9A 4MR7A 5IC6A 1RMYA 2C0PA 1WKBA 2Q21A 3GVPA 2CHZA 1QORA 1E69A 2E5WA 4HFJA 3ZXPA 3HUDA 4II2A 3TLGA 1RT9A 4KGXA 1YFLA 1QX4A 3PV0A 1MAHA 1E9BA 3RIEA 4HADA 1BDJA 3WLEA 1XL1A 3KBOA 4LZWA 4JZYA 3H97A 4LZAA 4S1OA 5L6MB 3GPDG 5K2MA 4HF7A 4ZAYA 2ZU6A 1JPVA 1A7UA 2WP0A 4EFKA 1OKKA 4ZVRA 5H8WA 3TVTA 2F8SA 4QYTA 4NH0A 2K2WA 4RFSB 5TMPA 1E6LA 3OFKA 3QPUA 3R5XA 2R1VB 1JAYA 2WXRA 4CUZA 2WT4A 1OB2A 3OQPA 1ELRA 1L7NA 2F9MA 2P6UA 3AU5A 3CH5A 2ZSKA 3OQIB 3SE7A 1SCNE 3G0IA 2C07A 3GMDA 3HIZA 1JCSA 4KFRA 1OFGA 2IYLD 5HKPA 4OI1A 4MCJA 4BNLA 5U4QA 4PPNA 2P9SG 1LS6A 2Q5IA 3UV3A 2HI0A 3SY2A 2P90A 2W22A 3L41A 1KP2A 1WDWB 3DGEC 4IQGA 2ZCVA 3NHSA 4REQA 4W1PA 4BECA 4HNAB 5FKJA 2G1AA 2BEVB 5FV7A 4GCNA 3WJ7A 1VL8A 5FAXA 1TT7A 4KXXA 3CEPB 4LGYA 1KVQA 3IO5A 5E3JA 5ADUS 1FNBA 1L0BA 2XVYA 4UCQA 2O8EB 2ZYHA 5D1NA 1BDHA 3HJHA 1BWPA 2BFDB 2DULA 1W88B 1M2EA 2OOKA 4RDIA 4XFJA 5AVOA 3WTCA 1RYEA 1XDUA 4L7TA 4O6VA 3U61B 3CX7A 4TMKA 5SZIA 1B23P 1G8JA 1DDGA 1DOHA 3AJ8A 4D0SA 4NRHB 1K0UA 3GZTB 1P2GA 4OQMA 1SPBS 3TR5A 4EL5A 1Z4IA 2C5HA 1TJCA 4R8VA 1SK9A 4YDYA 2G0AA 2Q2QA 3BA6A 2FR0A 1F5SA 3L8MA 4P3OA 4ZHQA 4MOWA 4G5QA 1TYCA 5EZQA 4CLRB 1Z07A 4E31A 3SBSA 3EU9A 4KAAA 4YASA 1Z6TA 1VTKA 5ALYA 4AWAA 3QOXA 2C42A 1FPQA 1OBOA 3LZ6A 3MJ4A 1R12A 4IVRA 4RVCA 4UNSA 4CQMA 2NO6A 2PS3A 1AKTA 5ADVA 1TADA 4E7PA 4FONA 1O95D 1TN7A 1N34B 3GEEA 2A3NA 2OCAA 2SNIE 2AQHA 4N6OA 4RVSA 1MOSA 2XF2A 3LT1A 2GPNA 5CEAA 2B61A 1TQ2A 3D8BA 4BMOB 3FOWA 4D3YA 3F7MA 4TUYA 1J5XA 3EHEA 2XXAB 3H3JA 2V6GA 1ULZA 1S64A 2GN0A 3CKMA 5BMVA 1QRSA 2AXZA 2CVHA 4EEKA 1YB7A 3C4QA 1M74A 4X8HA 4B47A 1UFVA 1I6KA 4DR5B 5C8XA 5BSFA 3WK9A 2YCBA 1Q92A 3CZAA 1ODKA 1NNSA 3CR8A 1M1ZA 1E4OA 4UW9A 4EUFA 3UFXA 2XKKA 4JH0A 3ASOE 2HA4A 5CAEA 4B3RB 1EIWA 1TD1A 3QKYA 1M8KA 4YDEA 3EGOA 1KVRA 2H7YA 2Y2VA 4QU0A 1WXGA 3TWOA 4W5NA 2BUGA 3HCNA 2D59A 1QYIA 1XRNA 1DBQA 1G8GA 4LERA 4I19A 3W3ZB 1DDIA 2XUHA 3O91A 2X0FA 4UQZA 1ZVJA 3WL5A 2D1QA 4EHBA 3KZOA 5KYGA 2BF7A 3NHJA 2GWRA 1MO2A 1Y9AA 4LXQA 2V7XA 4XX0B 1GY8A 1UP6A 1Z18A 1Z39A 4LYGA 3UXGA 4IILA 5KJCA 1QVZA 3AIMA 4ER6A 1BKYA 1A2OA 1TVKB 3LDAA 1A77A 3N2EA 4HNQA 4MP6A 2PU5A 2GZHA 4Y2QA 1WZ2A 2B20A 1Q6ZA 1IYZA 1U4OA 3GRYA 2N47A 1BFDA 4OYRA 4RK6A 3K6RA 4XEIG 3T1QA 4EUNA 1XDWA 1DWUA 2BDEA 4GS5A 3QEMB 5E6UB 1LDMA 2PJUA 3IX7A 3O1LA 4RWEA 3ZX5A 2ZIVB 2V6MA 1SWVA 4MH0R 2FEKA 3GXOA 5CTJA 5FNZA 5IDYA 4YY3B 4EG0A 5JAPA 1C41A 1XAIA 1XEAA 5CRIA 2XGJA 4IEEA 1P9WA 4YJGA 3DE5X 5BW6B 4RPHA 4ANUA 3CPSA 3N07A 4BY9E 2J5RA 1AS3A 1VKZA 3NYIA 2XWQA 1Z8DA 4GSYA 5FNVF 1LPAB 3W9GA 2IOFK 3LOPA 4MEAA 5AXAA 5ILQA 4Z9FA 5HRAA 3D3NA 3IUMA 4BN5A 3TWSA 5HJ7A 2RC5A 1KKLA 3H6GA 4FEGA 1ND5A 4JL6A 4EENA 3CSUA 5EIWA 4CMBA 4DBZA 1U3FA 3QLTA 1MW9X 1S3GA 3ZDYB 3WO1A 3SQWA 3OU2A 2QG9A 4HAOA 5D84A 5AW6A 5JJ6A 1PK8A 1P4HA 2HQ1A 3ASNE 3JQ9A 1W47A 1KP9A 4N2SA 3CLVA 3D7RA 3OLQA 1AA6A 1Z7WA 3KALA 3X44A 1N32B 5JCZA 2GSDA 2PKWA 1JH8A 2TS1A 3FHCB 3MHPA 4M98A 2YXEA 3STYA 2ADMA 3UCXA 4KZCA 4K87A 1J5EB 3L7IA 4X7MA 1VIYA 1R3DA 2AFHE 4D81A 5E4FA 1T3ZA 1SK8A 1IPHA 3SHFA 3GFGA 4DRXE 2F48A 3AKYA 3KPYA 3NGMA 4IVNA 5KX5A 1EFLA 4EY8A 3DPDA 2LAIA 3K9GA 4ENVA 5HDQA 3U7QA 4WZZA 1U2PA 5DMHA 5B2FA 1M1XB 4IHJF 5AJYA 3OIUA 1D6MA 4OGLA 1NP7A 3ZW3A 1BD3A 1X0XA 2VJDA 1KI2A 3AOEA 3GRAA 3NJRA 4R3NA 1DKRA 2J3QA 3DDUA 5A62A 3LPDA 3V42A 5K9ZA 3BKWA 3DPIA 4MS1A 1AKEA 3HR7A 5G0UA 5K0BA 2C9DA 2YYAA 3P27A 2QYOA 3EVAA 1FDRA 1QH8B 2CD7A 2Q3HA 3EVTA 4P86A 5J2UF 5EMNA 5GJVC 5JD4A 3I2FA 1B26A 4GB9A 3Q72A 4JDPA 1HT0A 2ZI6A 3DAPA 1J0BA 3BXZA 4IEIA 2ZSUA 1NQ5A 4ABNA 2DPHA 3NEPX 1PTKA 2PWZA 3RIXA 1B2LA 4D3ZA 1OGYA 3A9WA 3DZ8A 4EEXA 4R1NA 5EJ9A 1TPZA 1T3LA 3FUMA 1C0EA 1R5JA 2PD4A 1MZVA 3DE2X 4WGFA 3OX4A 2C5SA 2VYND 4M9RA 1IRIA 3ECCA 3DVSX 4YXWD 1ZMRA 3A0UA 3ZV6A 4B48A 2EFDB 1ZN2A 2HQSA 4IEFB 4PSAA 1WSWA 4YRRA 1Q16A 3NP7A 2AF3C 2QLLA 2WTXA 2I87A 3KOWA 4RF4A 4Q1AA 1UBMS 2GAOA 3O3OB 4YUYA 5G0WA 2OM2A 2VJLA 2Z98A 2X9QA 3G9ZA 2EJUA 3H9JA 2CD9A 4BZQA 5IAAA 1G7RA 1P4RA 1GAXA 1BMQA 3N2LA 4ZI3A 1IDN1 3AEUB 1IVNA 1GL9B 3F9CA 4OB8A 4PNZA 5AXBA 1A8IA 2XI4A 2WEKA 3ONDA 4JBLA 4W1SA 4D2IA 1PQ4A 5IDQA 1E7QA 1B0PA 3IBCA 4P3PA 3W2EA 1RI5A 1XMIA 2P1DA 1Y5LA 4DXHA 1A9SA 5FOTA 1PR0A 1TZ2A 3SY8A 4GZLA 4RM3A 3U40A 4Q4LA 3WKEA 4Q12A 1E8ZA 2X3UA 3G89A 4RVDA 2G7ZA 1IHUA 4CM8A 1WP9A 2XCLA 1E2IA 1NU6A 2QQ0A 5FUBA 4QM6A 2IS2A 2H7XA 4Y2HA 5CDUA 2WF6A 5FUXA 2AN4A 1T26A 3KYJB 2FGJA 3DDWA 4LEUA 1E5QA 3ZK8A 4E70A 4ZI2A 2CLCX 3LT4A 2X38A 3PFIA 2XZDA 4HB4A 4ZMRA 2ZYIA 5HZMA 3WSTA 2JFBA 1D8TA 1IY1A 3WV5A 2FQYA 3UINC 3BIXA 1ZWKA 3CTMA 1JBEA 5FBQB 4EW3A 5I7SA 4TLMB 2C7RA 3PEFA 5TPZD 1FIUA 3LLUA 1H2ZA 1DRJA 4V3BA 2OCDA 3RNOA 5K0TA 1E9SA 1DQSA 3P4XA 4YC7A 4CL0A 4EDHA 3CISA 4IICA 1ZINA 4QGAA 2J0SA 2OAGA 3BH7A 3IULA 2FWAA 3ZCVA 2QZ4A 2ZRDA 2OG2A 1V11B 5ALNA 3OJCA 1EE9A 1OV6A 4E94A 1IEWA 3S2IA 1YAHA 4CIYA 3FUKA 3HB4X 3ILXA 1AXGA 5TQJA 4PX5A 3E1KA 1XL0A 2VAXA 16PKA 1MH9A 2PCJA 5BT8A 3TLEA 2CNWA 1ZIOA 1M6YA 4KMOA 2BKEA 4OM8A 3W78A 1BDMA 5LQRA 4AOFA 1OD6A 4Q3BA 1UWLA 2I1WA 2ATEA 3E53A 4L3OA 3KYCB 1FDSA 3C6YA 4TTRA 1KI6B 1ZH8A 4W99A 4YI5A 4RD4A 5FCDA 3AHIA 3QA9A 3OF5A 4XJTA 1FCJA 3OO1A 5BNTA 4L08A 2BGIA 4OP3A 1F0NA 1Y81A 4HGNA 4JNKA 1V7PC 2JF0A 4FFOA 4D80A 5JT1A 5KDOA 1HYQA 4DNFA 1TZCA 1YIDA 1E8NA 1T34A 4NQZA 3OZRA 2CLEB 2A9JA 2JGNA 1VP3A 5LOVF 1V54E 2C1ZA 3MTEA 4H4CA 4U2CA 4K03A 3RSFA 1DIHA 4WXPA 2DUUA 3AHGA 2PPVA 2Y9MB 1D4ZA 1XQYA 1E60A 1A04A 5JHAA 5ENDA 4RSYA 4Y9SA 1LH0A 4YUWA 4NCXA 2W8BB 3RRYA 2GAJA 4NESA 4J03A 3OZTA 1E1KA 1U3GA 1V16B 4J2HA 4M8IA 5TJHA 5JANA 2X0JA 4BE7B 4OBBA 1ZKMA 1CUIA 2OMEA 1QKJA 3DAHA 1G9TA 3HYRA 2FMFA 1JDSA 3BSYA 5AM4A 1L3CA 4CT4B 3SFTA 4RA6B 2JW5A 3FSGA 1Z5UA 3I04M 4YP1A 2KSQA 3A6JA 2IHYA 5E9JA 5F7XA 5J2TB 4FR0A 3HKDA 5FWDA 5JEDA 4XX5A 1G7TA 4PGAA 1QYRA 1M83A 1JE0A 1KGDA 4ACLA 1PSWA 1OWMA 3JYLA 3U1TA 3IMGA 5F78A 3ZCSA 4PYRA 3TG2A 1XELA 1VKNA 1E0DA 4AZ0B 3PUJA 5CK4A 4E51A 1KSHA 2KMLA 3KE9A 4KE9A 2PK3A 2QL9A 2V3WA 5MHTA 1QO0D 4J1TA 1EP1B 1UPXA 4TV8B 5IYZF 4UMEA 2YV2A 4X1OA 5F1YA 5TE9A 4UE6A 4I2ZA 3D5QA 5AI4A 2ZJZA 2EZ9A 1DJLA 1HH8A 3HCRA 4IO1A 2V6FA 1TNBA 4P82A 4QXOA 1FVXA 2OWEA 5FPHA 2CK3D 2YQ5A 1MC5A 2ZJ1A 1UBKS 3KZCA 4DQXA 4IV0A 4RPKA 5K3AA 2HHLA 5K3CA 1EX1A 3AI7A 5K3DA 3IBFA 2GN4A 1NLFA 3G0GA 2ONZA 3GY0A 4Y6PA 2SICE 2AOUA 2K6GA 4DHWA 4E5PA 4M0KA 2AFVA 4ABTA 1GLNA 1U5AA 1O96A 3GEPA 1B6GA 1J20A 1US8A 3IXMA 3M8KA 3OE1A 1NLMA 1ZVMA 4U39A 1SUSA 3ZWDA 2QTCA 1WU7A 1OAOA 3VPGA 3SIPA 3LJ3A 1UKCA 4LJSA 1AP7A 3G2UA 3ITEA 2F3RA 2W0MA 3HGQA 5EMKA 5BYKA 3TN7A 3ID6C 1F6BA 2DKNA 3K9QO 3BL5A 1SBTA 1E0JA 3MJTA 4JSYA 1VRVA 4OHBA 4RG9A 2IONA 2WMOA 2Q8NA 3IOYA 4H7KA 3KHTA 4F21A 1LX7A 2IHVA 1K6EA 1MH1A 4UNNA 1T15A 2C4MA 4L8VA 1FMTA 1XN1A 4YRBA 3GFPA 4IH1A 4RK5A 3PEWA 2G28A 5AYWD 3H9GA 3P26A 4DV2B 2ON6A 1G8SA 2XXBA 4Y6QA 4Y2YA 4GPMA 3UXMA 3G17A 4LHXA 1K86A 1JIQA 1YRHA 3ET4A 3OZDA 2XUKA 4JJKA 2NZ8A 4OHWA 5ALZA 5SICE 2YS6A 5CCMA 3ZTYA 4TUUA 3VI4B 2C0CA 2DMRA 4XKJA 3W5UA 2B1JA 4C08A 3PDIB 3IHYA 1ZOLA 2YHSA 4G5RA 5HZGA 3OFJA 2WXHA 1HORA 4WHMA 2W6MA 3I42A 3PHCA 4NZPA 4UUNA 2FF7A 3FKSD 3KIPA 4ZCRA 4F6CA 3GP5A 2B8WA 2CXSA 2V4UA 3EXFB 2HSZA 4A3TA 3QU7A 2WVGA 3JUEA 3QWVA 2RHOA 3OQ6A 3GFOA 3MT8A 3A26A 2CLSA 3KOMA 1CQPA 4H4EA 1JDBC 1MABB 1XQ6A 4MRMB 2ZVQX 4UNQA 4BLPA 5C5EA 2XUPA 3O4GA 1CY2A 3AB3A 1U7UA 3DV0A 4N49A 2QVCA 3FNEA 3JASA 1FRZA 2J6BA 2HYZA 5JDIC 1MU0A 2OV4A 1D09A 2GM3A 4JEMA 4KLZA 4ZVLA 3O0TA 5SYMA 4ESOA 4JWKA 2PZLA 5KKCA 4N76A 1ZRSA 2NUTA 1ONBA 2FO1E 1OVMA 4G41A 3E5RA 4I9HA 3STUA 4BDTA 5BRAA 3N5KA 3T3OA 1RRKA 4BMXA 2G63A 2R8BA 3CVVA 4JBHA 1BZYA 4LE0A 5GJBA 2CHUA 3QOYA 4FX2A 3FWVA 2WHXA 2Y9PB 3OP1A 1U2ZA 4GU5A 1UT5A 1ZU2A 3IVRA 3ZC3A 2A9VA 5FUQA 3UOGA 2YN0A 3P9QA 5CECB 2GFIA 5F73A 1SKAA 3ML8A 4BX8A 3HXDA 3AW9A 4KQWA 3AJAA 3QMMA 1P1KA 3U7IA 1JLSA 2I8CA 3ETDA 3O9MA 1TNYA 4OQPA 4U7PB 1R9JA 1MEEA 1QZUA 1R9MA 2HA2A 2RAPA 2CNLA 4QLOA 1EFVB 2WKSA 2YYYA 1L3IA 3LKVA 3L13A 5EA2A 3RFXA 4GXNA 3UTCA 3FKJA 1J0CA 4AF7A 4BZZA 4YT8A 2QX7A 3BZWA 4WZAE 4YFVA 4HBDA 2QVLA 5J9FA 3Q9UC 1KSFX 4UJ5A 1C30A 3BIWA 4Q4HA 1GZUA 1ZUWA 5JAUA 1X0VA 3W2GA 1NHWA 4MYHA 3K5HA 1YNOA 3FOZA 2PUAA 4JEUA 1QVAA 1FA9A 4JB2A 4JFAA 3IV6A 2Q3MA 4MQFA 5J23A 2PX8A 2VJCA 1G3IA 2V54A 3EVGA 4M1SA 4WX2B 3T5TA 2QUBA 1W5SA 2C9BA 4PXYA 3AT1A 5EWMA 4R1QA 1KVSA 1PW5A 3E1GA 3FNRA 3ML1A 4I8DA 4B31A 5K8VA 2AW6A 5IU6A 3X1ZA 3SOPA 2W8BA 2F55A 1I6LA 1JZTA 3O48A 1O9GA 2FXVA 2GXAA 2WD8A 4OGGA 1GSIA 1VDMA 1XQ1A 4EGSA 1CFJA 2WJWA 3T7DA 5IBRA 1LVUA 3ONKA 2ZYUX 3FUIA 5ICMA 4GA1A 2PT7A 2Z9CA 1KI1A 4ACAA 1AUOA 2GPAA 4FNOA 4QAJA 3KTAB 5JCOC 3RROA 1MIHA 3L7DA 2IX3A 4RX1A 4YJHA 1USVA 3MJWA 5LA6A 5CFZA 2B6CA 3H6HA 4U0KA 2GPJA 5LXTA 4TTVA 3BSFA 2EX0A 1K2WA 3VHLB 4Z1MA 4LOJA 3D8HA 3O4IA 2JJ1A 3FTYA 3WS7A 4LDAA 3MJCA 3LBAA 5FLKA 3U39A 3D54D 5FYDA 3B1JA 3EJ6A 1KPSB 2R8YA 1U11A 4Q96A 3KJXA 5C32A 1H4QA 3BD7A 2GYUA 4C4YA 3X2FA 1B89A 10MHA 4D5GA 1OLSA 4P4LA 4WIAA 1G8FA 4ARAA 3O47A 5JXIA 4L4ZA 1O6BA 2QMEA 4HHEA 1E2LA 2C4VA 2R6DA 2PZMA 3FTUA 3GPBA 4BEPA 1CR4A 2Q3JA 5DM70 3DR3A 4D57A 3NRJA 3FYTA 2AW5A 1UODA 3U3RA 1FYVA 4A1GA 1JFFA 2YJTD 1NE7A 3CRNA 3T7TA 2GARA 4ZVUA 4I5IA 2WMDA 4HLUC 1BMTA 1GFIA 3GZ1A 2DJIA 3MS7A 1MO3A 1MENA 4EQ6A 4YP7A 1QPZA 2JHPA 4KKVA 3I61A 5DSZA 3CHSA 1GZDA 1O9HA 1QIKA 2C5LA 2ISSD 3P5SA 5EP4A 1RQ2A 5DCWA 3WDLA 1V95A 4BO7A 2QD3A 1DO0A 1W5BA 2F8XK 1XCMA 2KJQA 3VR1A 2J4BA 1P62B 3MERA 3THOA 5H1YA 5HS0A 1U2GA 2W6ZA 1VBMA 1ENOA 2ODWA 4Q6WA 4B6RA 4E2XA 2AEEA 1Y6IA 4LKOA 3SS8A 1F48A 4MLZA 3ZE1B 3GDHA 5CCBA 3MF4A 3EARA 5EHQA 2Z4SA 5EIXA 4Q16A 1KJIA 1KS2A 2YINA 1FTYA 3BREA 4G07A 1CPYA 1PZEA 4M37A 1OB5A 2F3QA 4DIUA 3DXZA 5G0SA 2OUKA 4LG1A 3ZXUB 4YR7A 3GARA 3WGLA 3GJSA 4B75A 1O97C 1OHHA 4CI0B 2XPCA 1ZW6A 5GADl 5K51A 3N05A 2BUAA 3JQGA 3LKBA 1AGRA 5IK2D 4ATZD 3IPLA 1BCRA 1NBMD 4DILA 2CV0A 5CGQB 1K98A 1A9QA 4PS7A 2CLLB 2H7CA 1KI6A 5GONA 2P2CA 3TAXA 2PX6A 3ZJUA 3TJMA 1YYHA 5KNCH 1SXQA 4OU4A 1BU5A 1T2CA 4KG7A 4L8GA 3GLIB 4L27A 4AO8A 4N5MA 3UJPA 3C5EA 4R71A 3EFOA 2O07A 1LDBA 1KY2A 1XAJA 7REQB 2LUOA 5DFAA 1G16A 3F6CA 3VR4A 3QVGB 1LK5A 4U8VD 1CCWA 3CLUD 1UINA 2JCGA 2AKEA 2FOLA 4L95C 3FOAA 2IE0A 5L3QB 1JIUA 1H6AA 1J2EA 1VIAA 2XOKD 2O1SA 4S05A 1KWKA 3T54A 2QP4A 5H3LA 3KV3O 1UBNA 4HZUA 1N2XA 2XLCA 4BO9A 2NLOA 2YOGA 2QRGA 2V45A 2X6HA 1VG9B 1XDDA 5HCIA 5HW0A 3N8DA 2V03A 1OZHA 4NOLA 3FLAA 4KQGA 1BE8A 1U3CA 1CZKA 1EAMA 2GBPA 2VF5X 2ZPTX 3VDNB 1Z4QA 5BR8B 1WWKA 5FULA 2QR2A 1ZN9A 2BL4A 5BSTA 2B35A 1DAKA 4M2LA 1X8KA 1KK0A 1P1FA 1YVDA 1ZK4A 2R00A 1AWCB 4G84A 2ZDGA 1QOZA 2GPBA 3N2IA 1SEPA 2ILVA 1PX2A 3HJTA 3N8KA 4XJVA 1NBAA 4XSHA 3SQXA 4LOKA 2LXMA 3B36A 3JZMA 1GPDG 3EAFA 3FGPA 1HXIA 2HIMA 4UI9J 1E7SA 2ZSEA 4PX9A 1X13A 1SUBA 1MA3A 1HG2A 2Z6QA 1ZN8A 3ZZTA 4I14A 1T9BA 5SY4A 2QL5A 4Z49A 5I3CA 4RNCA 2JARA 3LQKA 4S1NA 3G9UA 3L77A 2CLIB 1SURA 3ISJA 1T4CB 3LFUA 2O48X 3G1UA 4GVXA 4OY3A 1Z5OA 5C34B 3PR1A 5H70A 5BSKA 3N87A 3CVOA 1EWKA 2UY1A 3DE6X 2JLXA 5E3IA 4MUFA 1SO8A 1TQ6A 4RPCA 3WLHA 3IIEA 1NE2A 4RXUA 1PR2A 1R3UA 1BI8B 5PGMA 4JBXA 3RH0A 1MR3F 2FSUA 2GO7A 3JQGB 3I3OA 4UATA 3N3AC 4KSBA 3ZV5A 3DB1A 2CV2A 5C5DA 5CH3A 1POXA 2PMWB 5G05J 1T36A 1SZAA 3C3PA 5C35A 4DX1A 1C9KA 3RBXA 4N5CA 2NUPA 4RPIA 2IQCA 2C5FA 2CHFA 1M7GA 2ZVJA 1KKUA 2NZJA 3Q1KA 4FYHA 1VL0A 4LE1A 2RKOA 3F6YA 4ZVKA 2WPNA 1MX5A 2YHCA 4YO8A 4DHEA 3FOEC 4JW1A 2JJ1D 2PMKA 2YW9A 3P2OA 3QKRA 4YCNA 1YZKA 3FDHA 3GEBA 3FPFA 5IM5A 2NT3A 1ADGA 1MRZA 5TR9A 4V1CI 4CMJA 9ABPA 1WCXA 1NV9A 3AUAA 3RJTA 3DO6A 3QXCA 1IBLB 1G21A 3RYFB 1XUOA 1CB0A 2I3ZA 3Q8XB 1DC5A 4Y2SA 3FUNA 1KAHA 1S9HA 1Z4KA 2Y8EA 4HSGA 2DBQA 4J4BA 4DSAA 2AV6A 4HXEB 5C5IA 1W0KD 1V35A 2B5VA 4MRUA 2PGDA 2YIJA 3EDQA 1YQXA 2XECA 3KL2A 3NU1A 3Q10A 4WECA 4JLSA 1YI1A 2F3SA 3PUWA 4N9QA 5J63A 1KZ1A 1YS6A 2CZCA 3DEJA 5LB2A 3WIBA 1C0KA 3SIWA 1U3DA 2QGFA 2XSZD 3IVCA 1O89A 4A8TA 2Z6AA 4Q48A 4R2WA 1MMFB 4H7DA 4MKFA 3KTDA 2FAXA 3G0CA 3ZGZA 4V0QA 1SUCA 1GQOA 1Z6XA 2PRJA 3LP8A 2QD1A 3FTVA 5CNIA 1XTSA 5AK6A 1YE8A 3Q3JB 3GLQA 4X3OA 3RK1A 1EX7A 2JKVA 4HYEA 5FJJA 1NSFA 3ORHA 4MCAA 2JFFA 3H4MA 5K3SA 4Y2TA 5AN8A 1RBZA 1KRHA 3L6CA 3PGA1 4BFWA 1UADA 1F0KA 1MX2A 2B8EA 2WTNA 2ZRAA 2BKXA 4K8RB 5D6NA 3ZLUA 5K3FB 2J0VA 1ZM3A 1XF1A 4PCVA 4Q69A 4EQ6B 4HQDA 3VC3A 2JVKA 3GAMA 3LM8A 3RVLA 2BIFA 2PLFA 2Q28A 2V96A 1X1QA 5KHLB 2ROQA 4GOJA 4UI9K 1CEXA 2ZT5A 5EX3A 2V4HC 5CPBA 1SR8A 4HAVA 3NHUA 4XUEA 4QHSA 1DV1A 1K8RA 1HYHA 2WZQA 3EGVA 3PFBA 2Y1EA 2IK8A 2EDCA 2HRRA 4X3PA 4BVJA 1DS6A 5ALQA 1MJHA 2IT1A 4I4TB 1D4OA 1SU8A 2WZBA 5JCXA 1JILA 4ZRNA 3L4JA 3UQ3A 1IN4A 4O2LA 1OLSB 4L9RA 3OZWA 4BNHA 2C2XA 3CPJB 3WP0A 2B2XA 2VSXA 3HHPA 3IQGX 1NMQA 1M2HA 3S8YA 3GJ4A 3LG2A 2C4HA 3DTVD 3FRJA 1RI1A 5G1NA 3SDBA 3SFYA 5BUQA 4HS2A 1SCJA 2EP8A 2AI3A 2WFLB 2XTNA 4C5BA 4DQDA 4V2UA 3J81k 5TEWA 1ZVQA 2VDUE 2J5BA 4JR0A 1WMSA 4BVHA 5A03A 1U9JA 1DELA 5MFPA 2ZROA 3RSOA 1PRYA 1GFWA 4PFJA 4DY6A 4YP9A 3MTQA 2QTAA 1EZ1A 1JBQA 3K70B 3WOHA 4LWQA 2B83A 5AM5A 5KJ1A 2F3UA 4YMUA 3RSCA 3P2MA 4DUYB 3EUFA 5JQGF 4ME2A 2RHBA 2P35A 4IIFA 4TYPA 4UHEA 2WPDD 3KVYA 4BSXA 3HCFA 4GKVA 4YGXB 3NXKA 2B1IA 3KSLA 3RK6A 2JASA 1ST3A 4XQ9A 5H59A 2AMVA 4YTEA 1R18A 2LGJA 2CEAA 2QD5A 2WWHA 4U2DA 4CI9A 1KSGA 3GLIE 5AK3A 3AM1A 4O1MA 1M9NA 4KC0A 3GG2A 3AUUA 1D0IA 2KX7A 2HA5A 4ERXA 1I2CA 1G4HA 3ZDFA 2IP2A 2XIQA 1ISHA 2O2SA 1FS6A 1EFUA 3HCEA 3DCJA 4NATA 1U0FA 4UD6A 3VSCA 2VYQA 4OCZA 4L4UA 3MA5A 2VP6A 2DR0A 4RIEA 4BZPA 1XWWA 4HEA1 1Q0RA 4HMQA 4LHZA 4RM2A 3KQNA 3WK6A 2FZWA 1G5RA 4TZTA 5KJMA 3IV9A 1Y1KE 3K4QA 2G40A 3U0VA 2HYIC 4PLGA 3CHRA 1PS9A 4FR2A 4MYUA 3RBVA 5K09A 3NC1C 3HZZA 1F14A 4ND4A 5G0VA 2QM0A 2P5YA 3ZE0B 4EQZA 1O96B 3KJQA 1MO6A 3EXEA 2PT5A 2J9ZB 4JGGA 3SGHA 3I6IA 3H42B 3ZHEB 3GYZA 1E2PA 4MUMA 1B74A 3G13A 3BF7A 4LTNA 2KZTA 3R0ZA 5I7AA 3SHQA 1JR6A 1EHIA 1USIA 2CG3A 4HX5A 5IZ4A 2PN1A 3VQTA 3H5NA 3IPRA 2HA7A 1U80A 5FUVA 4ZTBA 2WXKA 4K8OA 1XJWA 5EYPB 4G24A 2OUIA 4JI7B 1GZSA 2J0UB 2FJUA 5ENTD 2FRVA 3R44A 4Y9DA 2C2LA 4WK0B 4RAOA 5B6PA 2GYWA 1UJKA 2PNFA 3ZJ5A 4RVBA 2RGYA 4OSPA 1K08A 5AOVA 2E55A 1H8ED 2IY8A 2C03A 3GLRA 1BHJA 3G5TA 5HQ8A 1ISMA 2VN8A 1E1NA 1V26A 1JEQA 2GMWA 1ESEA 3PDIA 5EEGA 4DNOA 1ZD8A 3THWB 1Z5PA 2HSGA 1P1JA 4M4SA 4CV1A 2AG8A 2BSXA 2QT9A 2RAVA 1DOZA 1RYZA 4WFJA 1Z56C 3C5RA 2ECKA 4FCWA 2FA9A 2O3UA 2VSQA 1JNXX 3KAPA 3L17A 5E1DA 2JD1A 3WNBA 2WJJA 3VPBA 1KBOA 1YJQA 4LPSA 4Q9NA 4MRMA 1PVOA 5TVKA 4CT0A 1RAGA 1UJ2A 1P2UA 3I8OA 4DV7B 2G88A 1V41E 2J87A 1JMVA 1NN0A 3CLSD 2BW0A 4PVCA 3TAHA 2O0HA 3U7RA 4EMUA 3BQ9A 1ZNWA 4S1WA 5G02A 5I47A 2G4CA 1E5DA 3DVRX 4IIHA 5TARA 2MYPA 3AKCA 3IC5A 2GUGA 4W63A 5FUYA 1THZA 1YZQA 4LYFA 5CCEA 4RSMA 1XZDA 4GAAA 3ELWA 1Q19A 1YCDA 1Q74A 4PHFA 5ITZF 4G2VA 1KJ8A 2BD0A 3C74A 3PFHA 4IKEA 3RC2A 5D2MC 2IIQA 4ZP1A 1E92A 2PH7A 5JAOA 2XWBF 4KR3A 4AU1A 1JFTA 1JKFA 5ER9A 3V79K 6NULA 3E5NA 3P94A 2W0SA 2OYRA 1ZU4A 2MRIA 6CHYA 5JH7B 2J3DA 2DC1A 3BRCA 4CIVA 4HCJA 2NAPA 1HEYA 3DPUA 3GR6A 5DGDA 4Z7OB 4XI0A 2PH5A 3LK7A 3ECSA 3TZHA 2QX4A 2A9FA 3CSDA 4U96D 2C8KA 2BHRA 2X41A 4KYUA 4DUIA 4CIBA 2C7QA 3WRXC 3HN7A 1NMYA 2MOWA 2X3YA 4QJ3A 3UF0A 3I2YX 4G5XA 4NE7A 2RAFA 4F2HA 4Y18A 4RH3A 3U7JA 1U5BA 4K0KB 1FW6A 2C95A 4LSZE 3ZIAA 2X2FA 5D85A 4ZYYA 2EKBA 1X1DA 1YKFA 3IPXA 2O3JA 4G1BA 3UHFA 2I8LA 4EUEA 4HVLA 4JEHA 4Z54A 3HXBA 2YR0A 1HNWB 1EXWA 3MKQA 1TOAA 3GLGE 1Y8CA 5IWCA 3DZHA 3AJRA 3RV3A 1RQGA 2C5EA 2Z0MA 3C5CA 3CJQA 3F4BA 3HNPA 2C78A 1FRQA 3JWGA 4L2IA 3WE7A 4AMZA 2WOJA 4K0RA 1HDOA 5KOJA 4HGRA 1GZVA 1ULUA 2OEVA 2PR7A 2PSHA 3FHOA 2ZXEA 2J5KA 2ZAMA 2V3VA 3MB8A 4CTMA 1SCQA 1K1EA 4I7EA 4MCHA 4WCFB 3P9ZA 2CEKA 2AWNA 5INTA 3Q2KA 4YRGA 2ZR7A 3QZUA 3RU0A 2J9RA 2ZT8A 3EOAI 1NG9A 2FZEA 2J4CA 3BSSA 4I50B 4G1CA 5K3BA 4ACKA 3L6OO 3G0BA 5K8LA 3FVWA 5LP6C 3I5YA 2W37A 4F4CA 3W5AA 4O3MA 2I71A 4ZQFA 1G8MA 4GE0A 2JBAA 3JQEA 5F3DA 2AS0A 1MJ5A 3NKLA 4EHIA 1F60A 3UGTA 4A2CA 1P0QA 1VBNA 2J45A 1VPLA 4G36A 4CKEB 2IH4A 2GI4A 1GKKA 4F2PA 4LOLA 5JS2A 1KAGA 1Z0UA 5L7WA 2ORED 3TGLA 4KWHA 4YJ2A 3EIHA 5K03A 1ZD9A 1YRLA 1VIDA 1QE3A 1U99A 4BAGA 4ZIRB 5G3ZA 3HKBA 1WBBA 5CYOA 5KYTA 1UFKA 3P20A 5ECGC 2EGHA 4J4TA 4QIHA 4JPSA 3PRYA 1LPBB 2PVCA 3K9BA 1ZIXA 3OTQA 4S35A 4YRNA 5CLJA 1MZPA 1Y0BA 1JEEA 3Q11A 3REQB 4AJ9A 5LQSA 3FYHA 2ZATA 1RJ9B 4P36A 1PV1A 4DDTA 5KWVA 3G1TA 1U0LA 2B78A 4LYYA 3IIMA 5EVJA 5MGBA 4A91A 4NV3A 1T2NA 5CYFA 4LZOA 1U2RA 3O9ZA 1FP4A 4DDKA 5EJ7A 5LYJF 3UICA 5FPTA 3LBHA 3DSRA 4UAJA 5CM2Z 3PQEA 3TKYA 3RJ5A 1M34B 4WJLA 5JCOA 3OM8A 5T67A 3EQ2A 4ZHQF 5BR1A 2FPIB 1MNAA 4DB4A 4M0PA 5CA1A 4UMDA 2VDKB 4C22A 1II9A 1A2KC 1Z0JA 1V1RB 1IK6A 5D0QD 1QC5A 3EAQA 2XVZA 4PO9A 3UANA 1BH2A 4DIBA 3K1JA 4EK9A 1RHQA 3CVYA 4G4JA 1YE3A 2J32A 4R2MA 5G1OA 1PV4A 1RWQA 3A6LA 3AR2A 3AY7A 5BUZA 1MPXA 4M0FA 3K0HA 3HCWA 1REQB 2H7VA 3N9IA 1JALA 3S3TA 3EXIA 1BMFD 3EEBA 4P98A 4QYXA 1U7XA 3VBEA 1PGOA 5E9AA 3EUAA 4QYSA 5JZ9A 2CLKB 1KO1A 2FEOA 2Q3DA 4JNCA 4IF6A 2HQRA 4TLBA 3ZZUA 3WL3A 4OLBA 4AICA 3AFNA 2VP0A 3CC8A 3U3OA 4NYMQ 4RPGA 3IT0A 1GVNB 4KQEA 3JTMA 5J58A 5ALPA 4E1VA 2P9LG 1FQJA 4QFVA 1ZGJA 2UZ3A 2WM9A 2YHEA 4B85A 2QRVB 2XBMA 4AY2A 3U19A 1IK4A 2GZ3A 1J4AA 2I33A 3LQ1A 4QNRA 4DBVO 5AQ1A 4RVOA 3IAEA 2H17A 4B8CB 4AJ2A 4HRYA 3QK0A 3ESQA 2YVQA 4FQ7A 3V2OA 4REMA 3T6KA 3JWHA 4EZBA 3VR5A 2WVIA 2E89A 5ALXA 2Z56A 3RKSA 1CRLA 3C98A 1D2HA 5EE1A 1Z0FA 4IX9A 2XCTB 2JC3A 5CK5A 5DI9A 3T7KA 5JC8A 1NM5C 4W8OA 3ESBA 3IVAA 3MELA 3ROGA 5CDYA 4CLOA 4EGAA 1PL8A 4AZVA 1LC0A 3AS5A 3H75A 3C6QA 5CVEA 2ONJA 1N5KA 2I65A 2B1GA 5GGYA 4TYNA 2WV9A 5CIYA 4GA0A 1NW4A 1E2HA 3SI7A 4G23A 3CKKA 1QB8A 2FBNA 1R0RE 1EFKA 1UM8A 1G1MA 1K7CA 2PZEA 3HU2A 3TOVA 5MGNA 4Z3OA 4RZQA 1RP1A 3EGEA 1LZKA 1NJSA 3AHCA 1NF3A 5TQ0B 3ST7A 2P5UA 1KJWA 3DQPA 3KKPA 3RVQA 1W36C 2X6IA 1WB6A 1NVMB 2XR1A 3T9EA 5JNRA 4LBYA 5KZMB 4K6GA 3BTOA 1XLVA 3CIOA 1ES9A 3FGZA 2IYOA 3ICPA 3R3YA 4LHEA 4QRDA 2PQ0A 3T3EA 4GLLA 4PYNA 5BO5A 2QV0A 4Y1GA 3SR4A 3LC2O 1TNDA 4OMCA 5LX8A 5IT4A 2EFHB 4YCAA 5DM4A 2JGKA 1Z0DA 2HDNB 3QPDA 4TQ9A 4ECEA 1OH8A 5T8KC 3SJCA 1YZYA 3IMEA 3WIUA 4C0WA 3SE0A 5CNKA 1HNZB 3KSRA 1X2BA 2J6CA 2X5OA 4IVPA 4OMUA 3TLAA 1SKYE 3DKVA 4RS3A 6YASA 4AM8A 4RTMA 2LAHA 1CC1S 4U8HA 3B1ZA 3P71T 2GA9A 3C3AA 3HUEA 2W7TA 3V1YA 3CE9A 3NZEA 2VJMA 3FVRA 1X80A 3GF4A 4IH4A 3RIBA 5KQLA 2PUDA 4XARA 2PTHA 2P30A 3PHBE 4N9WA 1OH6A 3RFCA 4FKMA 4PAWA 1K63A 4LDNA 4M3NA 4P35A 4FCVA 3EIWA 2ZWOA 2VPTA 1OGIA 4CKCB 4LCTA 2O1WA 2GHIA 4FEYA 4ZFHA 1B43