3PUKA

Re-refinement of the crystal structure of munc18-3 and syntaxin4 n-peptide complex
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
579
structure length
552
Chain Sequence
ERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFNKIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLEEIPKLMKEISSTKSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTEENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYRTNYLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Syntaxin-binding protein 3
publication title Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 152
structure length 552
sequence length 579
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pukA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 3pukA03
3PUJA 1FVFA 5BV0A 2XHEA 4KMOA 4JEHA 4BX9A 5BUZA 4CCAA 1FVHA 1EPUA 4JEUA 1MQSA 1Y9JA 3C98A 5BV1A 4JC8A 4BX8A 3PUKA
chains in the Genus database with same CATH superfamily
3L7LA 3ZOZA 2XOKA 5E95A 1KH3A 5A71A 1RHJA 3C45A 2ZB7A 2XYVA 5JYDA 3P8ZA 1ZINA 3W9GA 4HY3A 4XDYA 4UCQA 5EE1A 2Y0PA 1S2NA 3VZPA 4ZJZA 4Q24A 4LE0A 4FYPA 5LYJF 3L4BA 3P26A 3V4ZA 1H9AA 2E4YA 4G1MB 1P1HA 2X76A 5ARFA 2JHFA 5AJYA 3N2NA 1GRNA 5HOQA 5LYJA 1HZ4A 4IWNA 4NENB 1EGQA 1OMOA 3QTLA 4EG6A 3OUUA 1U3WA 4CV2A 1NJGA 3KKQA 4FIZA 1J2UA 4B0OA 3NWOA 4BFWA 3JY6A 2XVAA 3IQHX 2QN6A 3T3PB 3L8CA 2QYHA 2W2LA 3FWVA 3V7UA 2HD4A 4ZEXA 3INNA 1RM0A 3KB1A 3VR1A 2YW9A 3S1AA 3U9TA 3V8EA 5K3SA 4OFWA 3TSAA 4BKMA 3N53A 2MDTA 3WJ2A 5GMOA 1L5OA 3VVMA 3RDPA 5J59A 1I94B 1K5PA 4GZLA 3FLBA 2JAWA 3D4PA 4Y9SA 4C29A 5U9CA 4F11A 3OFSA 1I32A 1I3CA 5F78A 3KQOA 4ASUA 2EZ8A 3ZQUA 3JD3A 3A3OA 4EI2A 4JODA 1KI7A 4A82A 2B94A 3UI2A 3SQNA 4OSPA 2F1IA 4A63B 2Z09A 1E0JA 4MUMA 4GYOA 5I4IA 2IEIA 1PFYA 4L9PA 2X0JA 5E3HA 1OLXB 2EJVA 3VDXA 3QF7A 2OQVA 2BLLA 2C2YA 2V3VA 5D7NA 1D8EA 1QS0A 4W5RA 4FGKA 4AVXA 1R66A 3T54A 3PIDA 1KKMA 3ZTYA 4O4LF 1NZNA 3PHCA 1COZA 3WLRA 4M49A 1BE1A 2OLKA 4XWOA 2O0LA 3ETJA 4F4DA 4O4LA 1WRBA 1U4SA 4ND8B 4OHKA 3AJDA 3BL5A 4WY8A 3S2ZA 3T3IA 2B8NA 3SQLA 4D9BA 4P3YA 4D8UA 4Z7NB 3T1HB 3JVDA 3HDXA 1NJ5A 1WWKA 2FUKA 1L3BA 1JP7A 3UUXA 1WSAA 3UXYA 3ZDBA 4RELA 3H05A 2H57A 3A2LA 3M0EA 4F9TA 1PWHA 5J5CA 2E89A 3MCZA 3L6BA 5CM2Z 3EZ9A 1UBJS 3H9QA 4MUXA 3OT4A 3JARA 4KUGA 5IT4A 2R6ZA 3N7UA 2GSWA 4AZSA 3PCXA 3EUWA 2RC5A 4ERXA 4JROA 4ECEA 1X74A 3OFNA 1FTNA 1TVEA 3CVWA 3R7WA 3F2IA 2JH9A 1OZGA 2G9ZA 4FKMA 4MQEB 1D2NA 3MBIA 3PDCA 1P62B 4JEMA 3JVVA 5FD8A 3DZIA 1WHSA 5LZ4A 1Z25A 3FYSA 1XVAA 4LQCA 1Y4DE 5JDCC 4HBDA 2Q2VA 3VKUA 4MPJA 3KK0A 2JD0A 3UJNA 5J2TF 4Y6WA 1KAEA 1NVTA 3T3EA 1ZSYA 1GQOA 2IX3A 5F5NA 1NN5A 5JY1A 1E2QA 3MJFA 1KYWA 2G1UA 4Z4FA 4A5OA 2ZB3A 3WYNA 3PPXA 1FXUA 1IWOA 4FM9A 4MVJF 1FP2A 3WGQA 1GM5A 1DFHA 1JWLA 4RJIA 5HTOA 5L7YA 2QVCA 3FVRA 5AHOA 1E1RA 4H6PA 3ESZA 2PPVA 4MVJA 1KVTA 1KZPA 2VI5A 2BI8A 4JKIA 4AFNA 2V98A 3M9WA 4C7BA 4NEGA 3HLKA 5LLTA 5TJHA 2VZ0A 1ZA1A 1Q0ZA 1ZKMA 1ZM2A 3EIWA 3X1ZA 2ZYGA 1SHUX 1DSSG 5KNCA 4DLQA 2Z8ZA 3TZLA 4EL0A 4ZAVA 2BF7A 1GZHB 4ATGA 3NJRA 3FUNA 3IHLA 1JAZA 4C04A 4QGBA 4EEKA 2FMFA 1UL1X 4QZVA 1FUYB 4BFYA 2AC7A 4XLLA 3ADBA 2GHQA 2PAFA 5TPWA 3GLFE 4HOUA 1SZ9A 3V1KA 5JMTA 3A10A 4B3CA 1VA5A 1YI8A 5B1SA 1M2OA 3EVFA 1QOZA 4BB9A 1F8UA 4O2BA 2A0YA 4LYEA 4HPWA 1RBZA 2R8RA 3QE2A 2DPYA 3FNHA 3P5BA 4BO3A 1C50A 2VTBB 1XKQA 4JQOA 2A1TS 3RC2A 1C3JA 4OLFA 1I33A 3AKZA 3LHDA 5JBIA 3HCWA 5THKA 1HX7A 3H3JA 1WSWA 4TYMA 5DW0A 4DADA 4UZFA 4QOFA 5E4FA 4L1KA 1JR3D 4LE1A 2CB0A 1EXWA 1IL0A 5FORA 3PDHA 3O8OB 5LC1A 4BKRA 2P41A 1QUFA 4UEOA 2GBLC 1UKEA 2OCIA 1JKJB 2DEUA 2C59A 4C0JA 1DG1G 4Q9IA 5DLQC 5TMPA 4ZJPA 3UT0A 4H08A 2ST1A 5THQA 3KYCB 1DRWA 4BFTA 5BQ5A 3N8GA 1NMQA 1VBFA 4C0SA 2BEKA 2JGNA 3CZ4A 3EJNA 4JA9A 1DKRA 1X7WB 4CEMA 5AJTA 3O47A 4BP9A 2FRXA 1W87A 1VKOA 3HI6A 4FFNA 4HLCA 2W22A 4KO2S 1Y8RB 2QM3A 4UUQA 3QE9Y 2UZ0A 4YDSA 2CUKA 4K5AB 3O03A 1ZK1A 2Q6TA 1RJEA 1ZNZA 2D0IA 4F9GA 3WWCA 2AMVA 3USZA 2VF7A 3ZDZB 2PO5A 3VYRB 4OP3A 2P11A 3OJEA 1CSEE 1MD9A 2DHQA 5DN9A 1N0QA 4OI0A 1FRZA 3RLFA 4ACKA 1X87A 4QELA 4L78A 3PFIA 1GN9A 3QEBZ 5CXUA 1Z2EA 1P9WA 3ZDQA 2I4IA 1OA0A 1X19A 3A1WA 1V8DA 2UDPA 2D0DA 2BFCA 5TC4A 4EO9A 1L5FA 4NCNA 3UBTA 2ZVQX 5JCOA 4KWTA 1XL0A 3P32A 1OI2A 5GIPE 1SUSA 3WWZA 3IKOB 5CMLA 4N0PA 1E7SA 4ARVA 4TL9A 4ZVKA 3VI3B 1WOMA 3ZPXA 4AY3A 3ER8A 3L41A 1UBTS 5E7JA 1DG9A 3N2EA 3AAAC 1WCWA 4GOOD 4RQUA 3R6LA 4BY9E 1RPAA 1E6KA 1IIBA 4Q1DA 5E76A 4LOLA 5DTQA 3VH1A 3ZDDA 3HEAA 1BE0A 5EOVA 4YYZA 3K92A 4INOA 2CL5A 4LYAA 1IQRA 1JHVA 4EZBA 3LUBA 1SJ9A 2XV1A 2F8MA 1U0JA 3DSRA 4HVTA 4NBNA 5HE8A 2QG9A 1JG1A 1EXMA 3O3CA 2YL2A 3OFVA 2D5CA 5DM4A 3JQAB 2BOVA 3DM5A 1T0UA 3H1GA 3PEUB 1GQRA 2XGMA 1X7ZB 4AWBA 1RYHA 1L1QA 1LPBB 3HEBA 1C0LA 2QRNA 1BJTA 5ERGB 4MRAA 3CLHA 2I4TA 2RHJA 2Z43A 3F6QA 3WFZA 4K40A 2Y1DA 1TL7C 4RBNA 3BIOA 1KGSA 3MD9A 2QUJA 1Q1GA 3SLKA 5FL7A 1LPPA 4ID9A 4RXTA 4L8FA 2OHFA 6Q21A 3QX3A 4CM7A 2ID4A 5CHEA 2H4ZA 2VEDA 5E9JA 3WXXA 3FFAA 1DJOA 4H77A 5CVEA 2JH8A 2GGSA 5IYZB 1DCQA 4G63A 4NS4A 3PNLA 1H19A 2VS1A 4UQPA 4J0EA 5ALRA 2DQYA 1B8NA 7MHTA 3VVCA 3ZHBA 3QV1A 2V4HC 2FZ4A 1L1EA 2HBYA 5FPQA 1SXPA 4AAYA 4EY8A 3H0KA 1UM8A 4G1BA 1GUAA 5JAIA 2Y05A 4YAJA 1PL6A 3ENQA 4GP7A 5BWCA 4UXHA 3ZWAA 5LMCA 1J9EA 1TMYA 2VCYA 2BUAA 3VU9A 3NATA 4IVRA 5G1PA 4CF6A 3OG9A 5L8VA 2PN1A 3ISVA 2XT9A 4OJTA 3NTQA 4I50B 2FP4B 1I7LA 3MRXA 5DP2A 2EKDA 4N54A 5KKAA 3OTWA 2BKGA 4XDGA 4NYMQ 5IF3A 2I71A 5J58A 2CLKB 1Z3IX 4LHEA 3C3XA 2X2OA 2BCGY 3UEOA 2ZWMA 2RKKA 3WGKA 5KUTA 1FZQA 3OWHA 2CHZA 1XZKA 5EKDA 5C8YB 3SX4A 1WW8A 3SE7A 1TYEB 5FUQA 3FYTA 1XWFA 3ZNNA 2GXAA 3F8SA 3NGXA 4U04A 5IG2A 3AR4A 4R05A 5ERYA 4TM8A 1XZNA 2IYAA 2ZRGA 3QKSB 3PNTB 1LF5A 3RC8A 5L4SA 4GGPA 3Q8MA 1ZM9A 3BJEA 3NV9A 3SVLA 3CX6A 5EIBE 4W9NC 3LY8A 4M7OA 5AW3A 3C72A 5JO0A 4YUVA 4IH9A 4YMGA 1BW9B 1TUGA 3TFWA 1ORIA 3RWBA 1GO2A 1WLSA 2BSAA 4TXQA 4FEGA 1S2GA 3RFFA 1YA0A 3RYIB 2XQJA 2I4OA 2KE5A 3NDIA 5G04C 4ZHQF 2O7QA 1RBMA 1I1OA 2QTAA 3TWUA 621PA 4Q16A 4ZCSA 1DJPA 4XIJA 3E4CA 4EATA 5IARA 1HTWA 3RRMB 3GFQA 1SN7A 4GP9A 2F2TA 4YPFA 1UXJA 5J63A 2DFPA 3RVPA 3QNMA 3P9NA 2KQUA 1CS4C 1X8KA 2YY7A 3Q6IA 4US0R 4PWZA 2EARA 1W2WB 4P3OA 3I42A 3PZ4A 5E38A 1HEIA 3CK8A 3D5EA 4BQNA 1P29A 4B33A 1KQGA 4BERA 3R5JA 3T5DA 1J5XA 1O94A 2W00A 2CMFA 3TW6A 2IOHA 1KWGA 1U3GA 1RWVA 3EEQA 4GEGA 1RAHA 3QX8A 3H84A 4U2BA 5BT8A 4K03A 3D3MA 3AR9A 3ECCA 3KKZA 2BRUA 2P2CP 4TLDA 2IV2X 2QPAA 2A8YA 3AFMA 5DISB 4ZO8A 2AVPA 4HGRA 2C3OA 1P0QA 1U0GA 3EHQA 1FDIA 1WKCA 1Z7YA 1XGKA 4HEJA 2RIPA 4L23A 3G2LA 3N86A 2PL1A 5C2YA 1YQTA 1EZ1A 5BXOA 1MENA 1QGAA 2Z6UA 4P36A 4G0NA 4TUUA 4YC7A 2GNAA 3M9LA 1S3IA 2WSSD 1EFDN 4MUGA 2W7TA 2E5LB 2NT4A 3R7SA 3LZCA 3N7AA 4YTEA 5JAPA 3FMIA 3A6JA 4XDZA 3T7EA 4U8YD 3V2IA 1N57A 3FPLA 3THSA 2WJIA 2Q0HA 1E2BA 4MA4A 2NZUG 3SYKA 2QLLA 3M34A 4UXJA 5GIOE 1RAGA 3STYA 3ZY4A 3TCNA 4WZAB 10MHA 3CK9A 5HJ5A 4ND3A 3BSYA 3I9V6 4WCFB 5DNDA 3PNKA 1J09A 4D97A 1VSTA 2OGTA 3RJMA 3DT9A 3V48A 2QN2A 5IS2A 3ESRA 1R6BX 2WAXA 2GXUA 2Q07A 2WHYA 4P29A 4D92A 3V8MA 1YVPA 2WQHA 4YXWA 3TYXA 1BOOA 1KYIA 1G5RA 5KHAA 3ABRB 1OU4A 1UPTA 2QQGA 1SR8A 1XEFA 3N6XA 3KJQA 4UHKA 5E8JA 4JASB 2YVQA 1C3OB 2OOKA 3JATB 3IRUA 1PBTA 5DASA 4QO8A 4Q39A 1GPNA 2EVWX 4OSOA 4HXEB 5J08A 2CNWA 4R1TA 1RS0A 1DMSA 1P7YA 2YWEA 4IHQA 3SFXA 1SO8A 2CEKA 3CF0A 4WAUA 1KZGB 3KQQA 3V7FA 3CHMA 4F72A 4EVIA 2R4TA 1PJCA 2G72A 3TLYA 2VDNB 5JJLA 4LC9A 2Y27A 5EMLA 1DZIA 3E9EA 3DO5A 3KHTA 3GFFA 1KQPA 2LO6A 3PX7A 4GMGA 1KJ9A 5CFPA 3HDTA 1Z6PA 3L4JA 1PR0A 4PSDA 3AHIA 4RD4A 3EDMA 3VHRA 1LLUA 1SB8A 3BQOA 3CRZA 1SA0B 3QPCA 1Z29A 5MHTA 3VR2A 2DFKB 4JC5A 1NW5A 5F7XA 3V6MA 3G0DA 3GLRA 4LXXA 3CGHA 4R3UC 4ANXA 4MINA 4DJEC 2YC2C 1LBIA 4KBQA 4WVFA 4GLJA 1U7XA 2KX7A 1BA3A 4R1SA 2JKZA 3ZQ4A 1XDSA 2W2KB 2Y2VA 4OBWA 2IY8A 3VJKA 1ETUA 4AMGA 2CVOA 3VTAA 1YGPA 5FO0A 4HNTA 1MIHA 4O1IA 3U31A 4D9EA 2KLBA 1CLEA 4RY0A 4Y0NA 2B7BA 1OUVA 5DK4A 1SUWA 3GJ5A 3UA4A 1Z0ZA 1K7XB 4QAQA 5E7QA 6AT1A 3W8DA 2EU8A 2L6JA 2NZWA 2R8YA 2WJ6A 2EF1A 1PJRA 1Z26A 1IAQA 3K0HA 5GY7A 3PJDA 2NO7A 1E6WA 1EJ0A 5DCUA 1V9LA 3KXDA 1ZM3A 1IYZA 2LNDA 2NACA 1HQKA 4HOSA 2WTMA 4O2AB 3BOSA 1MBZA 4HRYA 2HRCA 1QOQB 2BISA 3ILSA 1KYYA 5JD6A 2F3QA 4EABA 2D5BA 2B78A 1NZJA 4LRUA 1BX0A 1D0IA 1U9CA 2EBFX 4LDQA 3FETA 2IPNA 4JS0A 3QUTA 4JSYA 4JI6B 2DETA 3HKDA 2ID7A 3GBSA 2XZTG 3SIXA 4ZAZA 3GJYA 4DIDA 4RA6B 2JFQA 3DSWA 1L7EA 1MQ8B 1VMKA 4JLJA 2FB9A 1QZUA 4GPD1 1G8AA 3QKRB 2ZRMA 3P9ZA 4HPXB 4AW9A 1KF0A 1UBGA 3EH1A 2ID8A 1BRMA 1PGOA 2NN3C 2EQBA 3U4GA 1LPAB 1P1JA 4ZJUA 4FDVA 4CMHA 3NBZC 1TAUA 3WFJA 3BS4A 3FFLA 4UI9J 1Z6TA 2C84A 2O3TA 1VL5A 4FA6A 4FGUA 1H1TA 4EPYA 2I1JA 3NZSA 1XTKA 3CEQA 1JF8A 3B8HA 1BS9A 4YDRA 2XYGA 1YQUA 4BLWA 4XGQA 1U8XX 4A91A 4YJ3B 3PEWA 3IP6A 1DU4A 3LPMA 4HFGA 3L8YA 2XVMA 2AUTA 4U3JA 5I8WA 2EFCB 3HXQA 1IHXA 3Q11A 3VV3A 4DRXB 4CODB 4XUDA 4D3XA 3GDWA 2FRVA 4G2VA 1T8SA 3CHQA 3RFCA 1YI1A 2EIME 2O8VA 3VU0A 3TJMA 1NLFA 4JIGA 4NMHA 3ASHA 3NCHA 3BG1B 1QIDA 2AA3A 5LL6P 4GA0A 4H3KB 5ILQA 4N5HX 1KI8A 1U5BB 4IO1A 2RAFA 2I34A 4KQ9A 5JCPA 2OYRA 1NFIE 3ILYA 3LUAA 2O3JA 3M83A 1RW4A 1BMTA 3O2SB 1CEEA 1MIOB 1BJRE 2BL4A 3IP8A 3GYBA 1RJWA 1IMOA 3OAAD 4D4MA 4QJ3A 4RPJA 4PN7A 1E9BA 1EVKA 8OHMA 5IJ9A 4G97A 4U6NA 4ETNA 3AVXA 3TNFA 2CUZA 3TJZA 2HHLA 3NTOA 3C1OA 1QDUA 1G16A 2C2GA 4NEQA 5JCXA 3EOAI 1O9GA 4FGSA 4N6OA 1JH8A 5LX8A 4OD0A 1L5VA 1RJ9B 5B58C 4X85A 1WOYA 3RYFB 2GWRA 3ZQ6A 3P0IA 4J16A 3PH0C 3SAJA 5BVHA 3WRYA 1O96A 1B2LA 2NXCA 3OE4A 3TUIC 1JR3E 3HR4A 1NA3A 2GVDC 1R37A 1QAQA 3DE0X 1KO4A 1KEWA 4L74A 1Q16A 1F51E 4EOGA 4Y30A 3ZCSA 4O4HF 4RNDB 5KCMA 2W43A 4HD8A 5LZ5A 3OU7A 3UCXA 4Z4IA 2NV6A 4BNTA 3EDQA 2B6CA 4NY1A 5IAGA 2EC5A 4GDMA 4O4HA 3QEOA 2HAEA 3CJQA 5KTNA 4TRJA 1LQTA 2BKLA 3SXJA 4G5OA 4FB5A 3KTAA 3I9MA 4IFIA 1UBHS 3G7UA 3PGKA 4QTUB 3T99A 1MFPA 1FSGA 2V8SE 1DAGA 1QHIA 3OXLA 4N9QA 3NOOA 1YU6A 1Z6YA 4OREX 5JXWA 5EI5A 3ORRA 1E7QA 1XPOA 3VO2A 4Z4EA 3U4DA 4O4JF 3F2VA 1O9HA 3N71A 1FP4B 2X6JA 4O4JA 3KEAA 5ENRD 1DJNA 1WCV1 1SPBS 3GK3A 4BO0A 2AN4A 3GBPA 2AXUA 1RKUA 1CQIA 1TW3A 5DN6A 2EKBA 1KYZA 3V9PA 3MWKA 4CIBA 2RHCA 3FDXA 2IPXA 5KNBH 2BGNA 1QONA 4LS3A 3ULQA 3F9RA 3NHZA 1SVWA 1NBME 4NBUA 2AFHA 1NLMA 1XX6A 3AVQA 3RHTA 2ZW9A 2WM8A 2W42A 4M6WA 5L53A 3KQHA 4F1JA 2V0PA 1KP3A 1C3XA 2X3UA 4MWTA 3HKBA 2O0KA 4P22A 4ZANA 3HUEA 2VAXA 1CUXA 4WBXC 4P98A 4ZI5A 3O93A 4D02A 1T9ZA 4B2PA 3LC2O 1T36A 1L5GB 4RK4A 4RANA 3A6PC 4WLNA 1XQ1A 3H8JA 1Y3BE 1QNLA 1ZZGA 4O63O 4RCVA 5HK8A 3U3KA 1BRTA 4A3VA 1WUIS 3HRHA 4ZAGA 1D09A 3ZCVA 3DNFA 4RNCA 2CHQA 4WLOA 3MLEA 3JUEA 4DUZB 1KKUA 1N0UA 3CQCB 2NQ8A 1TK2A 5HJEA 4C0KA 1PGJA 3D59A 4M9SA 3K0CC 3REOA 1V7PC 3MWYW 3UKJA 1M73E 1JHQA 2PHZA 3P0RA 3WZLA 4N2QA 4K46A 3DQZA 2RGBA 5CGQB 2VPYA 2M1XA 3HHMA 1MB4A 4G5GA 3O9MA 4FHKA 4EP1A 1SVSA 3EC2A 5FI1B 3WVNA 1RQPA 4FDTA 4CN9A 3GRUA 4P35A 1UKZA 1K6MA 5AK3A 2BUCA 2VP6A 2XT6A 3AS8A 3KWFA 3IQIX 3GELA 4XD7D 2ILTA 2EFYA 3KO8A 4R9RA 3VU8A 5CHYA 5DHRA 1F0KA 4Q9JA 4IQ4A 4HDRA 4ON9A 3C41J 4KRGA 3IL2A 2OT3B 1CJTC 1THGA 4QDZA 5JAMA 2I4RA 1KMHA 3ZDCA 3G2UA 3Q9UC 1PJAA 3GMTA 3PZRA 4FYKA 5EN4A 2FE4A 4B8ZA 4DKJA 5ES4B 4FMDB 5BNIA 1SCAA 3EXHB 1USKA 4GD3Q 4GZ5A 2QIPA 3RF7A 2XCBA 3MM4A 4K6KA 3P2BA 1Q84A 4M83A 1Z45A 1NP3A 4BVFA 1V7ZA 1BROA 2GAFA 4BVEA 4MLPA 2EIHA 3DXMG 1TVCA 2JAHA 1I10A 3T7SA 3HCRA 2BBWA 2BN4A 2PUWA 3O38A 2XB2A 4L2IB 4AP6A 3QKYA 4NDZA 3ZVVA 1XRJA 4MVJM 2JGLA 2H2GA 1W35A 2YHCA 3KL2A 1KZOA 3AUTA 3KKKA 4PX9A 1II9A 4E2ZA 3ZHTA 4F93B 3ZIDA 1SKMA 2Y6UA 1HZJA 2BEWA 2A0WA 5HK9A 1SPXA 2QE6A 3N74A 2P3OA 1E2GA 3HBMA 4FKZA 3H9GA 2QRGA 2J9FB 4ZV7A 1EVEA 2JFWA 1F48A 3T5GA 1QRUA 2O2XA 1ZD3A 1E5VA 3FTDA 3RAEC 3B60A 4F3NA 3UY4A 3W78A 4WNFA 1VLHA 3PC8A 2WWIA 3RS3A 3CFYA 2Z08A 4EFNA 5A4AA 3GPCA 4C5AA 3BIXA 4NATA 5CRVA 3MWGA 1G7SA 4IV5A 4UEWA 5EQDA 4Y2YA 3R8XA 1Z5SC 3EBOA 3O4ZA 3UG7A 2WT8A 4DM3A 3BMOB 2NTNA 4N48A 5CAEB 1U7ZA 2WXPA 3H2ZA 1KC3A 1GU1A 5E2BA 4CUJA 3P2YA 1FSSA 5CIYA 3U80A 2IS6A 4G8CA 4F38A 4A73A 1I14A 2A1TR 5FOQA 2CXNA 1L4UA 4BEPA 2V58A 1N2OA 2QV7A 1ZD8A 1AKMA 3LKUA 3LWNA 1GLNA 2WKRA 1M0WA 3E9MA 4MB0A 4BHTA 1Q77A 1MAHA 2C96A 1ODLA 3UWMA 1EBUA 4L4RA 1XQYA 4WCVA 1OXUA 3WYCA 1RI3A 2VKQA 4EKNB 2DT5A 4YONB 2X3MA 5FOUA 5BNTA 4CEJB 4EJ2A 2R68A 4TXNA 2ATVA 5TMDA 1E1CB 1HFWA 2IT1A 4MA5A 3E05A 1FFAA 3NGMA 2YJGA 4JEUA 3CUTA 2NZYA 4M0LA 4Q94A 1FW8A 4JJZA 2ZISA 4KDEA 3KD2A 3ZUPA 3KTFA 2I4NA 4XJTA 1XI2A 1GSIA 3DE5X 3S5JA 1J49A 2P4SA 4OU5A 3EVEA 1DEKA 4LHZA 4GEKA 3HB9A 2B5VA 1PF7E 5FKJA 3ABSB 1DTWA 3RNOA 3UM1A 3M6AA 5T41A 5B3LA 3I2HA 4ILEA 2C1ZA 2HF9A 2B92A 4LHWA 1KJWA 2OCAA 5BOSA 4I6JA 1HNNA 1LTKA 4PHTA 4JYAB 3LU1A 4R9NA 2JATA 4Y6PA 1TT5A 2HWYA 1QQAA 4OMUA 1Y9EA 3DA8A 4CQMB 2DZDA 4OLBA 1KVUA 1RRKA 4OHPA 5EC8A 3E9ZA 3GLSA 2QBYA 4L5JA 2GMWA 3ZU7B 3NT4A 3TF5A 1NUHA 3SQMA 2P6UA 2VNKA 4CTKA 4DRZA 4MZDA 2PGDA 2G5TA 4UUMA 4BP8A 4UTOA 3GZTB 3OX1A 3B13B 1QKKA 2YS7A 2EWVA 1G2OA 4BB0A 4OAVB 3B3GA 2OWEA 2CKDA 1YCGA 2H9IA 4O5OA 1KAOA 3HSKA 2MYOA 2GD2A 4B76A 1EP2B 1C7EA 3A1TA 4BCCA 1EWTA 3K6KA 4L0MA 2NZVG 1V5FA 3LPZA 5HX7A 2IUYA 3CCCA 2PWBA 3HVHA 5KWJA 1NFQA 2O5VA 1BDHA 3OJ0A 1XXHB 2ZSJA 1DKLA 5DNAA 4L4UA 4U2CA 3GH1A 3FHOA 3RW9A 1KYVA 1WXWA 2IQCA 1LZKA 5KSOA 3AINA 3CXUA 1ELWA 1KDPA 2C2BA 2FEMA 1B26A 3OQ6A 3IEGA 3KQWA 3TSZA 1ZSVA 2Y93A 3WLKX 4DGQA 1LDNA 2UZ4A 4CU2A 1FVOA 3D2CA 1OBFO 2WF7A 3TZKA 2RH5A 4YDYA 4BX0A 1RLMA 5DULA 3WHKA 5DLPA 3HVJA 1DJLA 5JZSA 3F6RA 1JCRA 1XEWX 3DDCA 3D9NA 3LS8A 4YEDA 1I4EB 4WXEA 1XC7A 3HY3A 4J7AA 1XEAA 1N34B 3AR8A 4P82A 1FX0A 1THZA 1T5BA 4ZKEA 3ANYB 4QYXA 1NG1A 2I8LA 4MV5A 2FWAA 1EH5A 3RK6A 1LI5A 1ZWLA 3AUYA 2VP0A 1Q7EA 1J2RA 4BTBA 5JJIA 5C1DA 4FN5A 2OK7A 3Q3GE 5EZYB 5HMMA 5CERB 1V2HE 5AVKA 4HKTA 1Z4LA 4YAEA 4MUJA 3Q7FA 5LMZA 4N7BA 4HVBA 1P9OA 4DLOA 1NVGA 1Y42X 3IKMB 4N01A 4YQZA 3PC3A 1QAMA 3FHCB 4B4DA 2BGLA 1TZCA 3UFXB 4KACA 5J1SB 4LY9A 3QAQA 2P40A 1SVNA 3BZBA 2PMBA 2QFCA 1ZH8A 3T1QA 4YLYA 3SC3A 2VDQB 2V7WA 1HLDA 4DX5D 4RHYA 4YQFA 3EDRA 4Y6LA 3EUEA 2HYIC 2BF0X 4C07A 1J7KA 1OASA 4HFRA 2HKIA 5TJ9A 2HMYB 3QPAA 2LV8A 3ZZTA 2K7ZA 2ANCA 4X1KB 4XB2A 4HDNA 5AAOA 1CF4A 2PYDA 1RXWA 1Z13A 4IF6A 4FGWA 5AXCA 3PJFA 1BXGB 3DHVA 3LPLA 2YMQA 2PGOA 1D1TA 4WOBA 2GDJA 1U0TA 1KR5A 2JRCA 2XT0A 1SURA 2QY9A 2IOFA 2FOIA 1QE0A 5ESDA 1U4OA 2ZAIA 3DHNA 1AHNA 4JX9A 5GZ1A 4X45A 3FNIA 1RRPA 4ZQHA 1YTLA 5ESXA 4XLZA 1R4MA 5LYJB 4MP8A 3V2UA 4BUZA 5T8IA 3KYDB 1ZW1A 2H1WA 3VR4A 1HDYA 3NBYC 1SCDA 4HNUA 4YP7A 2PX5A 1CJBA 2WYHA 2IYTA 4P1ZA 1E9VA 1PGNA 3T3HA 1YWGO 1ZVMA 3I0MA 3KZCA 1KC1A 3IQGX 2XPYA 1AZLA 3FWPA 2F4VB 2AX3A 1XV5A 2POCA 4G1EB 2SCUB 4MVYA 3IA2A 4OXRA 4QQ8A 4EGAA 5L3SA 3CLTD 1EK0A 5LZ9A 2WUWE 5FUVA 2HI0A 1W0JA 2WU8A 3QFCA 4FMCF 5EJAA 3HY6A 4KQIA 4U6SA 4RWEA 3FWKA 1DCMA 3BQ9A 1XHLA 3ANNA 3GJ0A 4KO8A 5HILA 5SICE 2R8BA 4OA5A 4Q66C 1XAJA 1JZSA 3MIZA 3LSYA 5JAQA 3D9MA 2CLLB 1DS6A 4F92B 3LTNC 2LUHA 1T3HA 1O0SA 2J4CA 2HHAA 4XYLA 2X1LA 3M8KA 5IMSA 4FBMA 4XKBA 5HI7A 2EIKE 5EG5A 4J1TC 2GF0A 3JQ0A 5BWBA 1Y1RA 3DEAA 4M87A 4FVTA 1DBVO 3P2OA 1EPUA 2R5SA 5B1EA 4E5KA 5EP2A 3AC0A 1W5FA 5ALWA 4YAGA 3GMSA 4NG4A 2XEXA 2C7BA 1J33A 3MSCA 2OORC 4O4LB 3C16C 1MQSA 4XVHA 4FDMA 1PUIA 1GU0A 4OCZA 4DARA 4ALIA 2ZZMA 1RAIA 2IUSA 4R2KA 1D6MA 3OZIA 2HMAA 4B6QA 1YVUA 4UZEA 2N0SA 3AILA 4OP2A 3KKPA 1E8YA 1R16A 4MR9B 5C53B 2JZNA 3QTBA 3ZCRA 2AKAB 2JEZA 2P8SA 1QO0A 3KAPA 4IF4A 3FUIA 1T4GA 5KSPA 3A6DA 1N2BA 4NIMA 2P27A 1GV0A 2MOKA 3RHFA 2QTWB 3JARB 4CLOA 3FGZA 1D8DA 3G89A 2FWNA 1U28A 4F6RA 1TTQB 1U1FA 4KJZA 2AVDA 5REQB 2C5EA 3OD5A 1L7VC 5TGDA 2CDRA 4B83A 3ETLA 1Z6XA 3L7DA 1IRIA 1A2BA 2DR2A 3K2QA 2E37A 3L82A 2CL0X 2P9NG 3KLOA 4FU3A 2XB4A 3T1YB 1T10A 5ER9A 3N0WA 2G07A 3FGOA 4MJLA 2JBWA 3R7WB 4RD6A 1AA6A 1AMNA 1L5HA 3WXMA 3ZDRA 1T8WA 3TXMA 1V6AA 4FCTA 2WTNA 2WPDA 2H1VA 2NVUB 3AG2E 2OM6A 3RUPA 3HXMA 4G0WA 5JZOA 1NVFA 4GQIA 2QPOA 3WGIA 2F8SA 1G20A 1S3SA 3MYVA 1AKTA 3HYNA 1OT5A 2VXOA 5FFNA 1RI4A 5J2TB 3JRNA 2F8XK 4NBTA 5EYLA 1VRWA 3GFVA 4JLWA 1F9EA 1JLLA 1FTGA 5KVQA 2IU1A 1W34A 4M46A 3NBKA 3M6XA 4FLMA 3SCZA 2P0EA 1BFKA 4TKUA 1IVSA 3TTUA 2Y1EA 4WASA 4F97A 1VCNA 2C8JA 4CMCA 2VRNA 2IHZA 5B7PA 1RQNA 2FPOA 2JCVA 4D56A 2PUEA 3ZV3A 1Z35A 4MKHA 4GBGA 4QQKA 3BG5A 2WAAA 2VGXB 4B73A 4I5DA 2LTAA 2I4LA 4MW5A 4D4JA 3JD1A 4QECA 5DCWA 1USWA 5CPBA 1A5ZA 4Y2HA 3WL4A 1UOHA 4BO8A 5B1IA 4WUYA 4GBJA 2Q9BA 4KQFA 1U8ZA 4O60A 4Q34A 3KCQA 5TPWB 5BWNA 4U4AA 3SMQA 3HYLA 3SSOA 1OT8A 4GGMX 2OV1A 1DADA 1YZ3A 4LGCA 5C8XA 4TYYA 2RCYA 1U3FA 1M2OB 3F1LA 1HNXB 1HE8A 2JARA 1XMIA 4YRQA 2AD5A 3TQCA 1CUFA 1FVXA 3IQWA 5AJZA 4HXIA 3C3WA 1PSZA 3V1UA 1EGHA 2QAIA 2FUG1 5KVSA 1NI1A 4C5BA 3MPUA 3ZDAA 4JLVA 1TA4A 1UMCA 1VKNA 3TWXA 3VHXA 5ALYA 1R8XA 3EAQA 4L73A 1LDGA 4O2BF 3J7AC 1E1QA 3SHVA 4P33A 4K9KA 4AZTA 8LDHA 1DWUA 1YB7A 3MV3B 2BFFA 2JDIA 3K05A 5E2AA 1T43A 2QA5A 4AJOA 3ORHA 1YDFA 2ZKIA 3NIBA 3BA6A 1PVDA 1F1BA 4DV2B 4FYWA 3ELWA 4CFZA 1IJKA 2Z9CA 4FDLA 4RF4A 2CV0A 4AN0A 4Q9LA 2WJZB 2W2TA 2R6FA 2ZSEA 1QYWA 3VO9A 2SHKA 5DI9A 4NURA 4H2DA 5KWVA 1ZPDA 3GUVA 3WLOA 3AIMA 1QJ4A 2XSZD 1KK1A 5GADl 1JQAA 1G21A 3KQYA 3RQIA 4BAUA 1DFGA 2QGZA 4RTPA 3PDNA 3NAGA 4A0HA 2FWBA 4BO7A 5E3JA 2ZYAA 1E60A 3VC2A 5FTNA 4H7PA 4IDHA 5A03A 1TA0A 2X42A 3ZOKA 2VZLA 2BI7A 2OV2A 4MQFB 2ROQA 4M7WA 3P9RA 4NV0A 1ZXXA 4RVFA 1W5SA 2AXEA 7REQA 4FHZA 4R6WA 3OIVA 4WD3A 3V80A 4FNMA 2WSIA 5HFAA 3QNUA 3MTGA 4QUJA 3FUCA 5D0OD 3LECA 3TXXA 1L5QA 3LLUA 4KPEC 2QMUA 2YJTD 3QWWA 1ZGGA 5EKQD 3G5AA 5KTSA 5M04A 5LWQA 5ARGA 1KJQA 1OV4A 1EFVA 1YDGA 1DC7A 1J8FA 4CM8A 3HK2A 1WLYA 1H6CA 2BFCB 1PLKA 2IPOA 1XPJA 2ZRKA 1FJGB 4CYMD 4RVCA 4AM8A 1VDMA 3NIGB 2H1HA 1GYRA 1BTOA 1TAGA 4MQMA 2JI6A 4YV2A 1ULSA 7ABPA 1K0FA 5EXDA 1RRGA 1T9CA 4Q3KA 3VRHA 5HDBB 2AZMA 4X6YA 2P3LA 1DUIA 3BX1A 2F0YA 3COYA 5LBTA 3UM3A 1MC4A 4R7ZA 3C48A 4ENPA 4AKGA 4ICIA 1FBNA 1XNGA 1L1RA 3WSTA 1VDZA 5EWMA 5BW6B 4LAFA 1DQNA 1U31A 3MJDA 4PSCA 5G1OA 2BHSA 4ALNA 1GA4A 3WWDA 1PEAA 3WAKA 2YWFA 1OFTA 5JCJA 3SSNA 3GFOA 3VYSB 1GPH1 3S7JA 3A6HA 2AIRA 5JMPA 2L0TB 4YI5A 3P97A 1HFKA 4AULA 4EBFA 2HA4A 5CDHA 3C3RA 2D5AA 3R3XA 1P19A 3KYJB 1AXGA 4Q00A 3UUWA 2EP7A 3Q75A 2GZMA 3FNRA 4UKDA 1NVUQ 2Q1YA 2JFFA 5I7UA 1TTPB 3FF1A 4XRRA 4ZT2A 4ZT6A 1V5WA 3VTXA 5AM5A 3PUKA 3GJRA 2UKDA 3Q4AB 4LC1A 4HUTA 2IEDA 1AV6A 2XODA 5G05C 4MLDA 1TVKA 3ZHSA 1RWPA 1DXQA 2VBFA 2HWUA 3M6IA 3NWPA 1TLFA 2MU1A 5D66A 3S27A 2ODPA 3VU1A 2WF5A 4RCYA 4FD3A 3EPJA 2VCEA 4NS1A 2O1SA 2ZDGA 3FTFA 4GI1A 4ER0A 3PNLB 4I1VA 2BIFA 4KC0A 3G2SA 4DJDC 1W25A 2NG1A 4RVOA 2XUAA 4D46A 1L7OA 2WY2D 1Z4MA 1IUOA 3B7SA 3CW9A 3QPDA 1WUTA 1P31A 4EMUA 1QE5A 1UQRA 2ID9A 3QXJA 3TL5A 1UOPA 3IBEA 5MFPA 3CR3A 1GCAA 1K5GA 2CFZA 4KDRA 2P9PG 4E3ZA 3O8RA 3RJTA 1J4AA 1RHRA 4IHKA 4Z5XA 1U2TA 2KBFA 1OZHA 4KN5A 3KLMX 4ARAA 2LIPA 5FADA 2YIJA 3TLBA 3CO5A 4I9GA 4HDKA 3H17A 1N9AA 3KYIB 2FW0A 3K96A 4XX5A 4REQA 1U6KA 1THMA 1TO6A 3FTXA 4KX3A 2NXPA 5TEVA 1PP4A 3TBHA 1LW6E 4M3NA 3X1DA 3A7EA 4EA6A 2KB0A 2X23A 2ONYA 2C0LA 2DY0A 2H9AA 1ZAYA 1QGYA 4Q6BA 2BJWA 4CG2A 3VPXA 1DT3A 4JDUA 1Z0UA 2JFPA 3BILA 1E18A 4H1TA 5HRCA 5T4YA 2HSDA 1Q14A 1YBHA 3OQOA 3TD2A 4WKOA 821PA 4DL9A 3TNLA 2RSLA 4DNFA 2HWKA 3MGKA 3HHPA 3HCDA 3IUYA 1K8KG 2C9DA 1NMSA 3LX4A 4YUWA 3HHEA 1XMPA 5AQ9A 3EGOA 3IOCA 4MO9A 4JCCA 1KMMA 5L51A 3I58A 1H94A 3LW8A 3QFHA 5FLKA 3RS7A 1EHYA 2RD2A 4NSNA 1NA0A 3W3AA 5TIIA 2TYSB 4AF8A 2ZCUA 1UC4B 5GJCA 4H60A 5JS6A 1VG8A 3FPGA 4HQDA 4KQMA 2PG3A 3G2WA 4WRRA 4GYYA 4ZHQB 1QG6A 1VHWA 4Y6OA 1ULUA 5FP0A 3NYIA 2F8YA 4JA2A 4DT1B 5F1PA 3ABKE 4C03A 1YA8A 2HJRA 3QX7A 4MCAA 5EE9A 1Z22A 4ETMA 4K9LA 1VJCA 2Y1CA 4AEZC 1X7DA 2X4GA 1H0SA 3VR6A 2GEJA 3CJRA 1DARA 3QHPA 4IIJF 3KSBC 2WMNA 2Y67A 4BVLA 4GSKA 4ALMA 3TMAA 5C8ZA 2DLCX 4V0RA 2GK6A 1PFWA 3ZE2B 4MUKA 4IIJA 2C95A 1QQEA 4FC7A 1NKTA 1TW2A 4RSYA 4TUMA 2ADOA 3DEZA 2ZR9A 3KLPX 3FZNA 4FE7A 3PA8A 4U2EA 2UYYA 3AF2A 1OB5A 1XO1A 4LF9B 4DPRA 5FWQA 1HOTA 1NVKA 4KUEA 1DC8A 1IY0A 3DZJA 4G86A 3VTFA 1XRNA 2OOEA 4YRIA 3GYZA 3GNSA 2X4LA 1KTIA 4MW2A 1TDJA 2D1TA 1XD2A 4WWNA 4M38A 4HNAD 1ULHA 2HJWA 4KXQA 4MKIA 2EKPA 2X9QA 3L6AA 5F21A 2YICA 1MJFA 4E7PA 5G3YA 1XMXA 4JLNA 3RBXA 1HI9A 5D1NA 2R8XA 3LYAA 4LOKA 3UA3A 3GN2A 3DDSA 2YN2A 1L7QA 3W5AA 3PL5A 2QX6A 3DTVD 1PO7A 1Q1AA 4NCAA 2YRXA 4FOLA 1CNMA 4H0NA 2O5CA 4C48B 5CCXA 2I6SA 3K0SA 3IQFA 5FBRB 4KLAA 4II7A 2VJMA 3A9CA 1ORRA 4XEUA 3HFSA 2FKNA 2PLAA 2GGFA 1KVRA 2YIVX 1EIZA 1FDWA 4JT9A 3F3SA 4G41A 3NO4A 4D9CA 5CNMA 1CUUA 3VNUA 4DKXA 1YFJA 2ZR0A 1QIGA 1ILWA 3T0GA 4UTVA 2L0XA 1PQUA 4M9ZA 3U49A 1MZPA 4IJQA 1L7NA 4F2PA 1ZHFA 3DE1X 5G4KA 3DAGA 3TXNA 1FQWA 4O1OA 1ZR2A 2IIVA 3VXKA 4AKEA 1ZGBA 2XEHA 1OXBB 3JWGA 3RFXA 5A5VA 9ABPA 3O8NA 7GPBA 4FJZA 2CL6X 2XUPA 2QQEA 3V3KA 4GVPA 2F3PA 4Y0AA 2CCKA 3IKJA 4BE4A 1WVIA 4L3WA 5EXSA 4LXYA 1LKZA 5A3RA 1IZ0A 2VJ8A 4OI2A 3G17A 1OH5A 3VYWA 1LI4A 3CUUA 5LFAA 4IZ6A 5FHQA 4QJ5A 1A2KC 4BT9A 4BDTA 5TMBA 1FNCA 3CVUA 5JWHA 3EXIA 1UFVA 4LJ5A 2ZIXB 1X15A 4UE3S 4RMGA 4KHPB 1W1WA 1AIPA 1OI4A 4TV3A 2VYNA 3OTHA 4EYSA 2ZUWA 3PF8A 2GRNB 1PZHA 4DX2A 4FYXA 1A4UA 3JWIA 3ZU2A 2WZBA 4FX5A 5EYPA 2V9CA 3T8YA 2OO7A 3EEIA 2ZQZA 2IWHA 1R4NB 2A5GA 4QC2A 2PSEA 1TNBA 2YX1A 2JIRA 3ZBTA 1ZVJA 3UT4A 5JTUA 1N6HA 4XSHA 4KNYA 4M0DA 2R5NA 2D5LA 3LRXA 4F60A 1FMTA 4M1KA 3PPYA 2Q7FA 2PVPA 3I12A 3IV9A 1A9XB 1Q2UA 2H7CA 2FUG6 2Q4OA 1R0SA 5TQ0A 1Y37A 2G08A 1SCNE 3OMXA 5ALOA 2ERYA 5F64A 1P7WA 4WWOA 1VYHA 2Z3ZA 5HQTA 3P9KA 1QTIA 3KJHA 4C4ZA 4IAOA 3RTGA 3HKDB 1TQHA 4DEVA 2L17A 3STHA 3OHMA 3A26A 4DNPA 2FTKE 5KNDA 3DLCA 3M5CA 1D7AA 5AK0A 2JIMA 2GHIA 3RADC 4MULA 3ONKA 1OI7A 1E63A 4C7MA 2QYSA 2GN6A 4P4TA 2R6HA 1O95C 4J0JA 3ELYA 3QMWA 1JPJA 3VSAA 2RGGA 3P96A 3T5CA 2VVTA 3TI9A 1VCHA 4L85A 1E8DA 2SKCA 1MHQA 4JUBA 4IQ0A 3K4PA 3EISA 3PVSA 2V6GA 3TSCA 3HCAA 2PU5A 4UBKA 1FNBA 3KDPA 4CIVA 4HVLA 2I6HA 5KJEA 4F3TA 4KX5A 1J56A 2Q3MA 2H85A 5C34B 1JPLA 1YULA 1A5BB 5ERXA 1KSHA 5HKLA 4MAFA 4HSEA 1A9QA 1GGMA 5CBKA 2PL3A 4RD2A 1KE2A 1CNFA 4RM3A 1XTTA 4D5GA 3GLFA 2GI4A 4PG7A 1ZGAA 1TZJA 1VDYA 3M6VA 3L01A 2Z6AA 1ZU4A 3C97A 4JU9A 4C3OB 1SU6A 1MG5A 2YRWA 3STXA 5EJ9A 2CDAA 1CG6A 5KWEA 2PLNA 3EDYA 5ELMA 1WSBA 3IEKA 4A0FA 2YXPX 2UWJG 3BCUA 4PE5B 2R6JA 1NL3A 4TTAA 4IIEA 5BRNA 2WE8A 3EGVA 3CBQA 3CV0A 4QEZA 5L3QA 3NBFA 3O4FA 4OQFA 2IJGX 3F3KA 4D74A 3MUNA 4TMFA 3GZSA 2AE2A 1Z8DA 2XRMA 4KXVA 2WWTA 5IJ9B 3FROA 4WH0A 2C7RA 4LXGA 2XYQA 1U8TA 4LTNA 1ZX1A 5EHXA 2IPLA 1Y63A 4FOOA 1KH2A 3IAHA 4BU1A 4BVHA 1G0NA 1WCIB 4OM8A 3A0RB 4CM5A 2FQYA 4YJFB 2WXMA 5LQUA 1HDZA 5BVHB 2PKYX 1CZOA 1T8TA 4FHJA 2UXBB 1XVVA 1H3FA 2RB5A 2HT1A 4K1XA 3L7OA 3HJGA 1DX9A 4M0FA 2HLPA 2I6QA 3GQBA 3SJUA 3O9ZA 2VSFA 2H16A 1YOVA 4CWAA 3GW4A 1ZCJA 2Q3BA 4R1MA 4XA8A 4O4HB 1SCKA 4HRLA 1JJAA 4PVCA 3WL3A 3IBYA 2QHXA 4DR7B 1PZNA 1SRRA 4HBGA 3TFQA 2QV0A 3ZI7A 3LQKA 1YR3A 6PFKA 4DV3B 3KQTA 2P77A 5EE0A 3JAKA 1FFDA 1G7RA 3D1JA 4H3HB 1GL9B 2QZ9A 1G3NB 2GB4A 4O1PA 1IBCA 4KQXA 3FZGA 1WR8A 2GRJA 1P3Y1 3L9WA 4YECA 3EXEA 3DDUA 3W7AA 3V46A 1V26A 4DA8A 2CHVA 6REQA 4B3TB 3SGHA 1K97A 5HIAA 2FSUA 1Y5IA 1TEHA 1VCMA 2CLMB 4UNQA 5BNFA 3HJHA 1CEQA 4O4JB 4DV7B 4LK2A 2PX4A 4TTQA 3KQNA 3VAZA 3LF2A 1OROA 1HETA 4DBZA 3F6PA 2PFSA 3GJ7A 3O1IC 4BRZA 4CIYA 2EILE 4LJ4A 4LHYA 3N2GA 5JD3A 1OPXA 3R5KA 4BBPA 4R8LA 4TVBA 3MCXA 5CECB 4EX6A 4UHCA 1TIBA 2PGIA 3PT5A 5A7HA 2RH8A 3B9PA 3G2QA 4WXYB 4B8AA 2XNJA 1QLJA 1JR6A 2W6CX 2AFHB 1DAHA 1SBHA 4GU5A 1JT9A 3GUHA 3MOIA 4OH7A 5B1AE 5IVDA 3OPYI 1V7QA 3H8SA 4YAKA 3D4IA 1N7JA 5A4MS 1PNRA 3T41A 3I28A 3I4RB 3TGLA 1HTTA 2G36A 2EL7A 4PYOA 1BO6A 1YL6A 3FPJA 3ZH9B 3DNPA 1GZ7A 3GAFA 3FPBA 3MJTA 1B8UA 4I0WB 1DAEA 3ZU3A 1CVIA 3CLVA 1EDZA 1JB9A 3EQ7A 4NBSA 5B7QA 3GLIE 3EU9A 3GWZA 4UBIA 4E21A 3HZHA 2VHYA 2C92A 1J7JA 2DFLA 3WYFA 3G9XA 3ZZUA 2CMGA 4WN3A 4GI3A 4PFQA 4JUFA 4GMKA 5CVJA 1UW4B 3QKUA 4WJZA 3GFBA 2YDYA 1RWMA 1Y0BA 4LF6B 2Y99A 4DC9A 1GLGA 2PEYA 4HYTA 5DM0A 1Q15A 4AXXA 3D1VA 3QYFA 3ZKWA 3JV7A 2YJ5A 1N6LA 1MG0A 5JJ5A 4JC0A 3Q3VA 4YVOA 1GL3A 4FCWA 2RGAA 3HCPA 5LP6B 2NIPA 1QLWA 2EHDA 4TXJA 3ER9A 2ZYTX 3T12A 3PE3A 4AG6A 5KKCA 3LO8A 4UBMA 4YDHB 2OBYA 4C6HA 2HTFA 4QQNA 2IHJA 1ZHHA 2XTNA 1J1ZA 4B7XA 5K4HA 2R4UA 4TT8A 4YPOA 1KDZA 1GPBA 3U4HA 4R83A 1AKVA 3CMMA 3LMKA 2IITA 5IUNC 3CCBA 4YY3B 2FVXA 1OU0A 3Q9NA 2XDQA 3H5VA 3IIJA 4FLFA 1RXCA 3V4OA 3COZA 4U00A 2ZSBA 3NTRA 5B3AA 1WUKS 2BZSA 2IYEA 1YCHA 4H17A 4K9DA 3CNQS 2WR8A 5IVHA 1N6RA 2FWMX 3Q15C 3J81k 3GB9A 2GPBA 3P9CA 2F43B 4X84A 3IT0A 5FBZA 4K9QA 1DRVA 2AOUB 2QP4A 3L1HA 4ARIA 4KVZA 1UZMA 3D5TA 2ZYWX 1J06A 2X6RA 2E55A 2PVCA 3DAOA 4DI3A 3JZFA 4ZXFA 3HVRA 4KH0A 3MGAA 2J0QA 2ZI9A 1VB3A 3IXEA 1Z5NA 4BFUA 1JGTA 1YZKA 5ALJA 3I1FA 1FMJA 1P5ZB 4MPRA 1LGYA 3C7DB 5F4BA 3ZEAA 1XDBA 5LB4A 5IN5A 3HVKA 2JFGA 4YR7A 1KZHA 1J0XO 3LPAA 5K0LA 5JJ6A 3ESCA 1IUPA 2G25A 3AZOA 3OKFA 3QU4A 1JLHA 2DR3A 3AFGA 2BGRA 4JLAA 2W8ZA 3MQFA 1N1GA 3OQJA 4F7AA 4EJSC 3OZTA 2Q1XA 5JQGA 2F8LA 5ALIA 4XKCA 5TVKA 4MXDA 3JSXA 2XLBA 2HWWA 5T6MA 4ZAYA 2CFRA 3IVMA 3VC1A 4G81A 2BMEA 1C9DB 4PS1A 1OYWA 2RKWA 1Q17A 1GJRA 1MGPA 4E4RA 4KQEA 1VGRA 4TMYA 4EI7A 3D9HA 4Q4AB 2DF8A 5KQLA 4NV3A 1T1SA 2XJ4A 2Z04A 2AK3A 2CC2A 3NKLA 3WLSA 2YNMC 4D82A 4NG5A 2GBFA 4ACAA 3FCYA 2LVBA 4FWBA 4GTMA 3EVAA 2OXEA 3S5UA 1YC2A 2ONZA 1WHTB 3VYUB 1PS9A 3HLYA 5B6PA 2PIDA 3WRVA 5JRDS 3OY2A 3BKWA 4MHSA 1F3LA 1YR7A 4XGIA 1Z38A 4B1FA 5HBGA 4BGVA 1DLJA 3COJA 2BJVA 2YQ5A 3KSZO 1DOZA 2XS1A 1QH8A 3UATA 4CVNA 4KTVE 4ATZD 1IJEA 3DAFA 3HMQA 1W8DA 3QB2A 4NV1A 5KMGB 2H8GA 3A9TA 3QC1A 1KMNA 2Q27A 1TNOA 3B82A 2WKPA 3T5TA 3LUPA 4Z7QB 3R5FA 1DHTA 2V0CA 5TQJA 3GRZA 2J5RA 2WWRA 4AX4A 3GHYA 3PBKA 2ZU0C 3CKBA 1GNRA 1QIKA 2FYTA 4K9NA 4X1IB 5ALMA 1MRNA 1H93A 1XMVA 1Y80A 1KJZA 1GDTA 2JI4A 3MCTA 3H4MA 3FDJA 1GPJA 3VDQA 4TVKA 2VDWA 1Y8MA 4QBFA 4LJ6A 4CTOA 5JI3E 2W37A 3ON5A 2NC9A 1D4AA 5CDUA 5KTOA 2YUTA 5BOSB 3L0BA 2JPDA 5DNCA 5CDYA 3RS9A 3R44A 4RPIA 3QE3A 2XXAA 1LTXA 2BWJA 3TL3A 5IDYA 4E32A 3AW8A 1CRLA 2KI5A 1ZSNA 4MEAA 3Q9LA 3SDBA 2JK0A 4PQEA 3ZJUA 2QBYB 2PQNA 3H1PA 5BN3A 3TQOA 4DIMA 3CN9A 4XVUA 1ODCA 4E70A 4DLSA 3TE6A 4YWHA 3Q79A 1PT9A 3QPUA 4UEQA 1YJ5A 3ED1A 5T4EA 2J9XB 1R0XA 5FWXA 4RTRA 5E4YA 1E4VA 3E35A 4EJFA 4OGGA 3S2SA 4LIPD 4RVBA 4WWPA 3EMKA 4E08A 5DLDA 5K3BA 1XQWA 3P0EA 4L8GA 1EB9A 4CPDA 4BZPA 2IU3A 2C0QA 5EHIA 3IOYA 1FTSA 3UXMA 1DO8A 1RLJA 2EDCA 1XR3A 1DBIA 1PAUA 3RC9A 3QUAA 1VL6A 4YA6A 2ZPUA 5BRJA 5FQ6A 2F3TA 1GQFA 2DUWA 3O75A 1RKXA 2ZVPX 4K3VA 1G8MA 3EDCA 3HFRA 3PYXA 1CE8B 5JAHA 5CX1B 4RE5A 2HJGA 4ATNA 1KMCA 1Z2AA 3NPAA 4PO9A 5CDTA 2BTEA 1X7XA 4XASA 1JG3A 1XTIA 3GXOA 3IUPA 1ZK2A 3G49A 3PRZA 5E1MA 1KI3A 3DWLG 4XUEA 2ZI3A 2BH9A 3PD0A 4CI9A 2QYOA 1UC9A 4XWTA 2Q1WA 4ZVVA 2BDEA 4O2RA 2IGTA 3IQXA 1CC1S 3PDIB 3LX5A 1KRHA 5SYNA 2BHRA 1JE0A 1Y1SA 4DX6D 2GLXA 1L4KA 4RKEA 3AY6A 2ZM5A 5F7ZA 5F3DA 4L8YA 2P2SA 3RM3A 3PC7A 1IFXA 1PZEA 1SG0A 3HP7A 1D2CA 2P75A 4JQYA 5IAAA 3CEMA 4MDYA 3GDFA 2WFZA 2JVJA 4N5NA 2OB2A 4ROTA 2AN3A 2IFTA 4F2WA 2HLNA 1MVNA 5GGYA 1FE8A 3E58A 3KEGA 2CK3D 1UBLS 3AB7A 3JPYA 5FNVB 1K7FB 2YWXA 1SXJC 2I2FA 4JYBA 2VT2A 4IKPA 5D5PA 2D1QA 5A7FA 4C20A 3KAEA 1DXHA 3WK7A 3W0LB 3FRIA 1W93A 4CIXA 3GJ4A 4LJRA 3MGGA 5DM70 1HUQA 5TPZA 4TMTA 3R0QA 3GP8A 1KDOA 2PX6A 2EIJE 3G1TA 4MV3A 4BC1A 1RXUA 2FMIA 2IOSA 4HI0E 5LJLA 5BW8C 3DFFA 5CM8B 3OPQA 4NYIR 3BMNA 1ZNQO 1ZESA 4FC6A 2C00A 3LWBA 4O08A 4KITB 1KFJB 2O52A 1Z63A 5EL0A 3FCOA 2P1ZA 2FN4A 2VQ6A 2M6RA 4QTYA 1E1DA 5J47A 3FSJX 5ETJA 2WIAA 4HDOB 1E0KA 2WAOA 4HH3C 1GFSA 3DEHA 1JAXA 4XFJA 2E4WA 2RHLA 1G19A 2Y4TA 4TKZA 1OX6A 4KFUA 2PJZA 2H65A 4GA2A 4K6CA 3R6WA 2YHAA 4R2XA 4JA0A 4EHNA 1I51A 4FBLA 3KTDA 3ELUA 2YHIA 1Y6IA 5G4LA 5LN1A 5IZCA 3UM9A 2IEGA 2FG7C 2FFQA 4D8WA 2OCCE 1U99A 3GIWA 4US2R 3JYPA 4Y6GB 3AJEA 3NQ41 3MTQA 3AJ9A 2IYUA 3U16A 3PQ6A 3BWDD 2B6NA 2O8BA 2I9KA 1ZIDA 1XELA 1UC8A 4BATA 5HCIA 1TVMA 4OLHA 2JK1A 4EY3A 1AB6A 4PSAA 4S24A 3K0BA 2Q3LA 2LCIA 1X9IA 3OCUA 2NOAA 5C81A 4P3PA 2BTQA 1W4RA 4FMCB 2CG3A 4HNRA 2MJLA 3ESLA 2V4ZA 3PLAE 1MQAA 4OL9A 4DQLA 4X63A 4PUCA 4ENRA 1LS6A 4BO5A 3NASA 4H27A 4D0LB 3WNCA 3S1AB 1VHTA 3UX4A 4M22A 4XGRA 2G17A 4S2EA 4P31A 1L8OA 2IX9A 3Q3JB 3RU0A 1GEEA 4RU1A 1TNYA 3WTCA 1RWKA 3R7QA 4CQNA 3FCUB 5TNXA 4LGYA 3RSEG 3EZ7A 1JEYA 3AFHA 1FVHA 3U0VA 4PG4A 3MA0A 3DTTA 3IC5A 1DELA 1KK3A 1GADO 3HC7A 3S68A 4PPGA 3T9CA 1P2BA 5CCEA 2O07A 1RC1A 1KAMA 1O03A 3RS5A 3GGCA 4IZOA 2QM8A 3NH6A 1X8LA 3IDQA 3BWMA 1L5RA 1C7IA 3G9ZA 1QUEA 2Z1NA 3HZRA 2ES4A 3U4CA 3OMLA 4G0UA 2WOOA 1FFWA 3FULA 1JR3A 2WJVA 3JQQA 2Y9PB 2IL1A 1QS0B 2BFEA 1YE3A 2JFBA 1RADA 1G5PA 2G0TA 4YDQA 1V45E 3QG1A 1QVAA 1D1PA 1Z0IA 4EYKA 5JOQA 1G4HA 1GAJA 4ILIA 4ZV9A 2D74A 4O4IA 1JXQA 4CU5A 1JLKA 2PKRA 4O8CA 4UARA 3RKSA 3SJAA 4D9NA 2OGSA 5FF9A 4TKLA 2B98A 4OXQA 5BRAA 3D0OA 3NIFB 2WQ7A 4MQ5A 4EI9A 5FA8A 3PNVA 4KVOA 1DO2A 3S8YA 1HE1C 1S8AA 1L5HB 5F9FA 4NE7A 4DC1A 2H2HA 1CD5A 1HH4A 4Y3UA 2QR3A 4XOIA 5LQJA 2GUWA 3EF0A 3S1LA 3AU8A 4J4TA 1ISIA 1SQFA 4P4GA 1XF1A 3RIXA 4E5DA 2OCKA 2W2MA 1G20B 2AOXA 4EM6A 3A9WA 4D25A 2I1VB 4QQIA 1G6KA 5H4HA 1ACLA 4PGFA 4V0ME 3GUZA 1GYPA 1TLTA 2J41A 1RD4A 1NBMA 2CMHA 5ALDA 1T6NA 1NDUA 1RABA 1WHSB 4JIMA 4FFBA 5AVWA 4IDEA 3HB7A 2OO5A 1THTA 3ZVLA 2IEYA 3QOYA 4B0ZA 3SHFA 4P7KA 3L0OA 2VXBA 3CSTA 1S89A 1V5GA 5CH3A 2YOFA 1JALA 3TBFA 1O77A 4P8RA 5DO9A 5H1YA 1QQ7A 2RD0A 1XLVA 4AMVA 1JYEA 3MAGA 2V97A 3C1UA 3G85A 3UT6A 4R2IA 1CUIA 3ER6A 2JHGA 3FJYA 3Q88A 3OSUA 1I2DA 2NQ2C 4Q02A 4UPDA 4BBAA 1XDUA 3L7YA 3UGTA 4B3XA 3VKWA 1YQQA 4ND1A 3UXGA 4HX9A 3AI3A 1FP1D 4HFNA 3SQVA 3NAZA 5A62A 3PDUA 5KSYA 4CMEA 3BICA 4GOXA 1T1IA 3TRHA 1ZONA 1CFJA 4HS4A 3MILA 4HB2A 1H4VB 4KTTE 2Q0XA 2GPTA 1IXVA 1DAIA 3RYHA 5CFRA 4MWEA 1JHOA 1UKVY 4LXUA 4DDVA 4CUKA 3OQMA 2AXQA 2O3RA 2I3AA 1CUGA 2ZTMA 1UMCB 3TOXA 5H7XA 2J33A 3FSGD 3U7GA 5FZSA 1DPFA 2VPPA 2BONA 1UDAA 2XQVA 4KE8A 2BLNA 2EV9A 4TRMA 4HX5A 3SIWA 1M8PA 2W2PA 3IJRA 4WOKA 5SYMA 3THYA 3LBYA 1FSZA 4O2BB 4AL4A 4U0JA 4UU1A 2HZ7A 4HATA 3OCZA 5FQ4A 3THWA 3EBLA 1G5HA 2W6MA 3D31A 1APBA 4LHVA 3KE9A 4FMPA 3CZPA 4ITVA 5BSKA 3G8DA 2NZXA 4Z0TA 4QDOA 2PMCA 1TO1E 4X54A 5DCYA 5BSRA 1AP7A 1DIAA 3D4OA 1JILA 5JVDA 2XKAA 1SZDA 4X64B 4MP6A 1OLUA 2C57A 3TMYA 1QPZA 2B2CA 1G21B 1U2SA 1RDFA 3GC6A 1QK5A 4AG3A 3GIDA 2CJFA 4PFJA 4WINA 4AUKA 2YWGA 3QVOA 1N5DA 4B81A 4AIIA 1NUPA 1EFPA 2FMUA 1E7VA 1K7EB 3U19A 1SVKA 2GZRA 4YMHA 1T2CA 3PE4A 1NATA 3V4SA 2C2KA 5HQ8A 4OQPA 1G9SA 4E5UA 1JSCA 1KJJA 4FI3F 5JDIC 2PZKA 2I54A 4OQ4A 3ZW9A 2Z9BA 4JB2A 5ALHA 5KBYA 1EK1A 2X1HA 2X8LA 3A3PA 4JB8P 2I33A 1QP7A 3H0CA 1UQTA 4TKVA 3WO0A 4BS9A 3FTNA 1TD9A 1EFVB 3K1TA 3D6VA 2JVIA 4CM8B 3K71B 3UK1A 5LP0A 5BY2A 4IINA 4HAWA 2XX3A 4YHBA 3E3NA 5A0TA 4REMA 3ND7A 3ASVA 1G3MA 3TRFA 4LDZA 4GHWA 1JHYA 1QYDA 2QPLA 3C5CA 1I8TA 4ZDKA 4E2WA 3T7IA 2AMJA 3QYAA 3JVEA 2JD2A 3WYEA 2GJ9A 2BM9A 3TZCA 3RNLA 3D3WA 4P4UA 2VP3A 1GNLA 4NQ0A 1SEPA 1FRFS 4V1CI 1RAAA 4AM9A 1YCFA 1ULZA 2CVQA 3B85A 2JFOA 3KNZA 3CX7A 1G5TA 2G6BA 2YJZA 5FI5A 4MRVA 3RTCA 4DIOA 4Y2GA 4P3KA 4XWAA 2NU7A 2VCHA 5EWMB 3L84A 3O4RA 3OI7A 5DVZA 4CV1A 1FS6A 2BM1A 4JP1A 2V03A 4RJJA 1S0UA 2X6KA 2D59A 4F2HA 3EIXA 5KDLA 5H8WA 2FQXA 3PKZA 2X5NA 4BZXA 2IYZA 1QWOA 3MLBA 4R69A 1U2PA 4EGJA 4HMPA 4EVSA 3SMVA 2ECPA 2CXUA 1EG7A 3DBSA 4R2JA 1EWKA 2F1KA 2FZCA 2JLUA 2Q2OA 5IF9A 4B84A 5HF6A 3TTWA 1LV8A 4FKBA 3TGWA 4G9GA 4MUAA 3DC7A 4JUIA 3IUMA 3R0IA 4N47A 4JB3A 4PIPA 4F4FA 1DKOA 3HFGA 3HWSA 4CMGA 3H97A 1IPHA 4XIGS 4BKUA 5IASA 2J4DA 1TVKB 1NJ6A 3CHRA 4CHGA 4GXRA 3N8IA 4Z9XA 1J20A 1IHYA 5LQMA 4B6GA 1HEUA 1YS7A 4HNVA 4NBRA 1RFGE 4FS3A 1I7NA 2ODEA 1NR7A 2ZAYA 3W5IA 4WIAA 5WRFA 1XYGA 3DHWC 4IWYA 4GR4A 4TTSA 3L16A 5T4HA 3Q40A 5HE9A 3RQSA 2J3QA 4IDPA 5IEJA 1N4PA 3DWGA 1M7BA 1F12A 3WISA 1GQSA 4R1NA 2NZ8A 3CNOA 5DIFA 4YQEA 1LTHR 3LQ1A 2GFIA 1ZK0A 3GMIA 3EOBI 3BVPA 4YRKA 5B37A 3DSXA 2OEVA 3CVYA 1C8KA 3ABIA 1XLTA 2ORWA 2P5YA 3GJ8A 4M9QA 4U0SA 2V0GA 3TLEA 3QLVC 4JL0A 1C1HA 2PX8A 1O5IA 4W7SA 3TB4A 1GG5A 1IXZA 3ITDA 4OHRA 1U5AA 3GUUA 4HGOA 2WU1A 4DN6A 1U0BB 1E79D 1H2EA 2XQ0A 4W1QA 4IO0A 4YUYA 2ZRDA 3L08A 4HDKB 2R1VA 3AV0B 3DFKA 2GAAA 5AKJA 2BBTA 4D8VA 4JXTA 4U2KA 2EJUA 1KY4A 5SZKB 2PBRA 4QTTB 4B74A 1P80A 3EGXA 3O31A 3L17A 2YHUA 3IO5A 4OIFA 4IX9A 5D2MC 1ZUIA 1ODJA 3VU9B 4KIWA 3JQBC 4G2NA 1IBLB 2WHRA 5IC6A 1CX9B 4UZSA 5DDIP 2QSYA 4A8JA 2WYWA 5EKXA 4R2WA 5HRUA 2PM6A 1WKVA 4AROA 4LMBA 3KJGA 1LK5A 4RABA 2ZRLA 3WK5A 3ZXXA 2ZJ3A 1C2YA 2XMGA 2G1JA 4X95A 4DMMA 2OO3A 3DKVA 1VIVA 3ADDA 4BRSA 1A8PA 4E0BA 1SOMA 1EE2A 2I6XA 1UCFA 2ZJZA 4HK4A 3OEED 4XAQA 5K8UA 5AM1A 4DF3A 4LISA 5B4TA 1Q7GA 3C3BA 2XMSA 2GN0A 5FJYA 5ECWA 1OAOC 3GOQA 1YQXA 2JI8A 4FQ7A 1TLLA 4N5QA 3QP9A 3TNDA 1Z2PX 2Y1GA 5IAJA 2AZTA 5JV5A 3EQ2A 3HV0A 4RJ2A 2CT8A 3W6ZA 4KYVA 1F2VA 2BEVA 3OO0A 1WEKA 2XUOA 4YJGA 3OQHA 2HV8A 1MEOA 3TCXB 4NF2A 3L07A 5D84A 1DTEA 4EZEA 4OXYA 3L6DA 4JL6A 1T4CA 4JXKA 1Q1ZA 3LM8A 1SVMA 1BU5A 1BWSA 4GPKA 3VZQA 3R7LA 4B40A 3C15C 2P6NA 1Y9JA 4HNGA 4IIJB 1T25A 2C8VA 4HDMA 1XKTA 3KZMA 3GP3A 4PZPA 5B2ZA 1FQKA 4LC0A 2BM8A 3FJ1A 1DKUA 2PRYA 3ZBPA 1GNQA 3VHQA 1F38A 4G5YA 1D6JA 5IU6A 4JNCA 3KSLA 4KE7A 1GCGA 2JIOA 5AHXA 2CF6A 1CVLA 1T2AA 1U4NA 2B30A 2NYVA 1NI3A 2UUBB 1R18A 1BE8A 1NLYA 4D8TA 4FX2A 3EOZA 5JUWA 3AG6A 2JB9A 3F71A 1VPDA 4CCSA 2FZWA 1W6UA 5JHBA 3KEQA 4FD2A 3PJGA 3F0TA 1JSZA 4O2LA 4H6XA 1VBMA 3IO3A 2CUTA 3CKMA 2CNNA 4CL0A 1NONA 2BHNA 4S35A 3I5UA 3LNCA 4DJ5X 4JBIA 4E12A 3WWPA 2I7VA 1RWXA 2H08A 3QF4A 1NM5C 2ZBDA 1Y6GA 3WP0A 1Z2OX 2ETVA 3PHBE 1LSUA 1SIBE 2X7JA 3AR7A 4I2VA 2BSXA 3D0KA 4BEBA 4KKXB 1M1YE 2A57A 5CLQA 2CLSA 1FFEA 3OWXA 4BX8A 4CQLA 3VDRA 2XBLA 2WFMA 1S7CA 4V03A 5T7BA 3LDZA 3B38A 4ID3A 3ASZA 1GCIA 1N7HA 1QHSA 3RRZA 3SSMA 2OZLA 1SOUA 3UXHA 1OI3A 2Q45A 3T5XA 1IUKA 2A0FA 5JJ7A 4NTZA 5TF0A 1EGMB 4F84A 2VHVA 1XCMA 2CHFA 5KIAA 1F6DA 4XIFA 3G7NA 3U66A 2P2NA 3SQDA 4RTKA 4M8LA 2XB8A 3INGA 4M0UA 4DJAA 2I3DA 3VI4B 1I30A 1P7PA 5AW0A 3CRMA 2QR2A 2P1DA 1EX7A 3NTXA 2WIJA 3OJLA 4LI3X 1E2HA 4S0XA 4B7AA 2QTVA 4PZUA 2NU9A 2OUIA 4B3DA 2X1VA 4FS8A 2E87A 3OAAA 4I9HA 1OXKB 2ZT8A 4XQ9A 4B31A 1KSFX 3SYNA 1DC3A 3QKTA 5A3QA 2CVZA 3WGOA 1XA3A 1BD3A 2OPBA 4R2MA 3BE5A 5JXHA 2QLJA 3A1EA 4QYWA 1X86B 3V8PA 4K0KB 3E8MA 5D8DA 5HS4A 4B48A 2R96A 4N2SA 3HACA 4YRBA 4FYJA 2P67A 3GLGE 4MYDA 3PFFA 1R5OA 1OD6A 5JPIA 2ETAA 1W46A 3GRRA 1ZVVA 3QXXA 2DERA 2IK8A 4LFAB 5FHRA 2HXYA 3WSWA 3M1YA 1AK9A 4ZOBA 3UJDA 3HXFA 4P81A 4U39A 4X3PA 4N3AA 3BGOS 1A98A 2JA2A 5ENOD 2P8JA 3OQPA 4JNKA 3BTSA 1IEXA 2PV7A 2V8BA 4IZIA 5EYPF 2XEEA 5TQ0B 2WVAA 4D4HA 2C7QA 2AVNA 3IURA 2O20A 2XCLA 2I66A 1E90A 1R1DA 4IRUA 2WV9A 1Q2ZA 3QU7A 2ZIVB 2H4HA 4MRMA 3MEQA 1O89A 1AB5A 2MIIA 1Y4AE 3L8GA 1Y7PA 3FR7A 5GZ3A 1N77A 1HZZC 1VB5A 1U80A 2F7SA 4DIEA 3SX2A 3QVMA 3PGLA 3CIFA 4PH4B 2FEZA 3DUWA 5EZQA 3FMOB 1ZAKA 4AXBA 1M5UA 1KR2A 3OCCA 1PTJA 2PBLA 4MUBA 2PKXA 2M1ZA 3OIUA 1WB9A 2CE7A 3LUFA 4GZCA 1OIWA 1M6NA 1WDKA 3CHOA 1QOPB 3TG8A 1NY6A 3QNWA 2NVBA 2G88A 1FT2A 1TQ8A 3DF9A 3N2ZB 4IJWA 4UQOA 4NCIA 4BV9A 3OQ1A 3IPCA 3ONEA 1DBQA 2I2XB 2G9VA 4ZD6A 2HR1A 5B1BE 3BFXA 4WOJA 3GLUA 3TD6A 2ZCVA 3NHKA 1MHTA 4R3WA 5ILOA 4TWRA 2IONA 3MV2B 1G6OA 3AY0A 5AQ7A 5AW1A 1I7PA 3GRCA 1UZLA 4BIMA 4W8HA 2OEPA 2H18A 2JIDA 1ZXBA 1CZKA 5A7DB 3AM3A 3IHWA 1PFKA 3K1AA 3WDKA 1QHHA 3ED5A 5CRUA 4A6XA 4V0QA 4DEXA 4IJUA 3ME5A 3BMXA 4UXIA 4KQKA 1A9ZA 4U3JB 3H2KA 4U7PB 3M3DA 3VX4A 3LLMA 3IFSA 1FVFA 4EZIA 4J3FA 4MAAA 5DH9A 1NUUA 2LD4A 2A7QA 3H5AA 2YV5A 3ZKAA 2C9OA 3GRYA 3NW9A 1YNOA 5LQNA 1ELKA 4QPZA 3RREA 2QEQA 2P9YA 2WIBA 1SUEA 5EXEA 2FLVA 3EMBA 3WGGA 1PV2A 3ZD8A 2CXXA 4P5EA 3FCEA 5EIXA 3RC3A 3WKCA 1JSRA 1YQWA 3O8QA 4LX0A 5HZMA 1TYCA 1YQGA 2Z6VA 3T5BA 2BR4A 1UM9A 4DMHA 5KYWA 1E96A 2QAGC 1OKKD 3GQBB 3AP3A 5DYWA 3UUFA 2Q99A 2ECOA 1YCDA 4EFDA 5EUCA 1E94E 4FWIB 4QRDA 4RVUA 3C3DA 1USGA 2EKLA 3IV0A 1L9XA 5JO9A 1V43A 2YC4C 3IUQA 3CSUA 3WLMA 2VT6A 1JDBB 2Q0SA 1O96B 1Z39A 4JAVC 1WUHS 3JAKB 1QRAA 3TQSA 2C4NA 3OZXA 2B4TO 1WULS 4JY7A 2HCBA 4BN0A 4BO1A 4Q47A 3T9BA 2ISQA 2OQRA 4DSAA 3LHFA 3EXEB 2QN9A 2Q41A 4YGYA 2HA6A 4TQGA 3AGPA 4GR5A 1TFRA 5AW7A 1T4DA 2CXRA 4CR7A 3ONVA 2YINC 3DTYA 2GAJA 5BW4A 4A27A 5T67A 1E9CA 4Q1BA 3NTLA 3OOEA 4IDBA 3N2GB 3KTAB 2DBRA 4RHTA 4EG8A 2EFEB 2XZLA 1JS1X 3EW9A 4D81A 4FHEA 4DA9A 221PA 3QZUA 5BURA 2R25B 3NHJA 3H83A 3EWNA 1XQ6A 2WSBA 4MMZB 3L93A 4FFDA 1BDIA 2H29A 3OZWA 2AR9A 4GVXA 2YWRA 1MO2A 4DMCA 1BCSA 2YIDA 3LL4A 4LRQA 4RKWA 4RJLA 4RL4A 2VPZA 4DR1B 1TJNA 5ALNA 1CQIB 5HF8A 2P7HA 1AE1A 4PAMA 3AM5A 2CNLA 1U7PA 2G70A 2BGMA 5CFQA 1MNAA 2CV1A 4OHOA 5FBWB 3M3HA 1JFLA 4HYQA 3QV2A 3WIOA 4OHYA 4MEJA 4TMZA 2QU8A 1OXVA 3A4NA 3LGXA 3EN0A 2YJNA 4M6WB 4PONA 1EGAA 3SS8A 1H2AS 4HLLA 4PPYA 3HKBB 3GEPA 2QGNA 4A3TA 5ADWA 5IAOA 4ZZ2A 1I0IA 4KWIA 4OJYA 2JLSA 1IC6A 3BB4A 2OL4A 4KFTA 1T36B 1GG2A 3L7AA 1Y8ZA 4YRNA 1XZHA 4C7XA 4IBOA 1YCSB 4IOKA 4IXMA 1XTVA 1U2ZA 3EAGA 1DC4A 2R02A 3B1WA 2XB6A 4MWCA 2RJ3A 1JXMA 3LDUA 1HSOA 1NW7A 1SUIA 2Q6KA 1TJYA 4FOPA 4MV1A 4G5QA 4HXGA 5IH7A 2DKFA 2C94A 4BWRA 1BN7A 1YO6A 3LD9A 1ONPA 5P8WA 2YV3A 1A27A 4HQKA 5ED4A 4AUMA 1QYRA 4BLTA 3IAAA 1RPJA 3G6WA 2FSVA 3TAUA 1J5PA 3AG4E 3FPCA 1VKHA 5T57A 1GEGA 3EE6A 3KE8A 4C0HA 2JFZA 1TIPA 3OHSX 3WQBA 5AQBA 1TNDA 5AHRA 4F2DA 3H87A 3T7RA 2PD3A 1PBNA 3P2MA 2MT9A 1JFFA 1Z56C 4ZYZA 4YDEA 3RT1A 5B64A 3UKDA 3RS2A 1N1DA 4HDRB 2H4YA 5F73A 2WU3A 1JPNA 1F14A 4U2DA 4OGKA 3W5JA 2A78A 1KMHB 2JCYA 3SIRA 4X8QA 3MG9A 1PG5A 1ESDA 1ZRMA 1TJ3A 1YGYA 2AYZA 4Q3DA 4ZI7F 2ENUA 5FQ7A 3Q98A 3MTEA 1DKMA 3H5LA 3HA7A 3NNNA 4L9RA 1TM4E 4ZI7A 1IJFA 1PYOA 1O95D 2JHCA 2VP5A 3CZ5A 1BI8B 4ZQFA 1R50A 1X1CA 2ZBPA 3AI2A 4UDXX 4ARZA 3NX4A 4OJMX 2VYVD 1IOWA 4R9VA 4H0CA 1UBKS 3M4JA 6NULA 5K6TA 1H3NA 3JSAA 1OBVA 4U7DA 3LT2A 1WD5A 4BVKA 2RDMA 3GL9A 3FU5A 3LYUA 3WA6A 1M2EA 3FKJA 5ICSA 5EGSA 1WPXA 2O2SA 3CURA 1BGVA 3T1NA 3VGPA 2ACKA 3DP9A 3LVQE 2AV6A 2P4EA 3B5IA 4RA9A 2QUKA 2FR8C 2DZOA 3ETCA 4DX1A 2FOLA 4W8GA 4LRTB 1QGZA 2BEWB 4NONA 4HQFA 3PS9A 1AOXA 3C7TA 3NJ4A 3V79K 1U7UA 1UMDA 2IFUA 1L6RA 1YBVA 2VDJA 3QG5A 3TGPA 4Q9NA 5JQGF 2WOJA 3CNNA 1WV0A 1BX1A 4O29A 4LDAA 2Y4NA 3NV7A 5C1BA 4X92A 3VR5D 1PK9A 5CNJA 3IVGA 3H5OA 3A25A 1QCDA 1XRMA 3UKUG 2GTIA 3DXKG 4XOUA 2NTYC 3O2JA 1XYYA 4EG4A 1ZBQA 2GEVA 2BCJQ 2XMZA 3WLJA 2YXDA 2JFYA 5J4HA 1DQPA 4UNPA 1V16A 1QH8B 1G2IA 4PDXA 1NVEA 2Y4UA 1YVDA 2LGJA 2FQ1A 4JBHA 4I66A 1KQ3A 2O23A 2RAUA 1YRHA 4OI4A 1B2RA 3V1LA 1QYVA 1JDUA 3E33A 1M54A 4US1R 2V74B 4XB6B 4RPLA 4FCCA 4XX0A 3ZY2A 3RG8A 4KV9A 4BWFB 1SU8A 1N4RA 3OZDA 1Z18A 2QIOA 4KIJA 2OLJA 2ORYA 5FIOA 1BKDR 1C30A 3UH0A 2K5UA 3MTBA 4EPXA 3AF0A 5I7FA 3LPNA 4MI1A 1CERA 2BZGA 3MA5A 2IY7A 4C4TA 3ACDA 5DTRA 3HDJA 1B15A 5DHSA 2DVMA 4B89A 3AH8A 2XPCA 2IZZA 5I7RA 4YRMA 1NSTA 2I3GA 1ZY2A 5YASA 2QC9A 5JLJA 1OHHD 1F7UA 2RGNC 1RIIA 2PRKA 3MWDA 3D54D 1XJWA 4ACLA 3EYAA 2O8CA 3DVAA 1M1YA 2VJCA 3DV9A 4HYYA 1FPPA 4Q01A 1BHSA 3MCAA 1J5EB 4J0QA 5BN3B 4DV6B 5JSZA 2I6GA 1P44A 3R9MA 2FXIA 1RYFA 1DTWB 2IOQA 4YDOA 4W5OA 2H06A 1GGVA 3G0BA 3T5MA 3VJLA 2WABA 4M36A 4YFYA 1F8FA 2ZUDA 3LPCA 3HJRA 3ZVMA 2QR5A 3OZFA 5HWSA 3PB3A 1TT5B 1NJ8A 3K35A 1U04A 1C0EA 2C2MA 2Y0EA 4Y6SA 1BFDA 3OCVA 2HQOA 5C1OA 1EF1C 4JK3A 5J1TB 5IAKA 2ZRQA 4JZKA 4J29A 1AA9A 5FA6A 5C18A 4INZA 3AOGA 2C61A 5ENQD 3CVQA 1KIFA 3F73A 4G9BA 3B6IA 2R1TA 3V55A 2JLXA 2HPAA 5CIWA 1PY1A 1BU8A 4LCBA 3S70A 1I0LA 1EM8A 3LLCA 4LEUA 4QGSA 1SIWA 4L5AA 3IOBA 1LPSA 1W47A 2HPZA 4LQ4A 4IS2A 3TQFA 4I9FA 1EJ2A 1W1UA 4PQGA 1C4WA 4AJKA 4HYEA 3V1MA 4IJ6A 3WOVA 2PUFA 5CLIA 3DMGA 4NZMA 2N47A 3D81A 1TI7A 3QUCA 3C8ZA 1PC2A 5SYAA 4K9SA 3GV0A 4ECAA 3O94A 1XNRB 5AXDA 3ZGXA 1HE2A 3H2SA 5KYXA 2PX3A 4JLOA 2FN7A 2ZAMA 2PMWB 1JEDA 1ZM4A 1LDEA 4O02B 3WRXA 4W1PA 1FC0A 2PGLA 4WESA 2YQZA 2JRLA 2I7DA 1IY9A 4P4LA 4C3VA 1BYUA 4OQNA 1P2VA 1CUAA 3TPFA 1ECJA 1BGWA 1E3DA 2I91A 1CY8A 1RQ7A 3Q1LA 1XCOA 1G2PA 3DBLA 3V97A 2RBGA 3CGWA 5DMHA 1JDSA 1NPTO 3Q0EA 5AMXA 4KIGA 3K0FA 4IR7A 1CUBA 3GHHA 1SKQA 2R4QA 4CCWA 4E14A 3RVKA 1FX0B 4UATA 4F71A 1JBEA 1WVMA 4FILA 5BO5A 1Z3XA 2VJQA 5D7BA 3NS7A 2OGZA 3CNLA 3RFTA 2HUPA 4DCGA 1SQ6A 4FGZA 3FU6A 3MFQA 4RM2A 2NM0A 1DVPA 3QARA 3EGEA 5FWYA 5A4JA 3R7AA 1IB0A 3SR3A 2J5QA 1ECCA 4ZARA 3E3LA 2Z9DA 4TYWA 4Q1EA 3I5MA 4K6OA 4Y9UA 1PVOA 1BQ3A 3GGSA 2BYTA 3BMNB 4RHEA 3HCFA 3COSA 3UH1A 4DABA 3E2PA 2R2LA 3UK6A 2I29A 2CD9A 2F62A 1JUQA 1P18A 3IBSA 3KX2A 3OVMA 2QI9F 2W2OA 5JALA 2B4YA 3L8EA 5D00A 5M3BA 3JQEA 2F1OA 3ROXA 4UU7A 1E0SA 3P0HA 1DAKA 5EJ8A 1W5EA 2AFVA 3REQA 2IF0A 2VHEA 3BPSA 3KQPA 1D9XA 4OVVA 5C3MA 3SVZA 1IWBB 1IYGA 3AI1A 2J0UA 5GZ6A 2UYGA 4LGMA 4M1WA 1L7RA 1OC2A 3V1TC 1HYEA 3TEMA 4CL8A 4HDNB 1VL1A 2XGOA 4EBAG 1CQWA 3R20A 2HK9A 2KATA 3H2HA 3G2TA 3R0VA 4EZKA 4CBVA 2WXIA 4N7RA 1HQDA 4XYMA 1MVOA 1AKWA 1GVHA 2HRQA 4ANWA 5I9MA 3X3HA 3HXCA 2NO1A 1JU9A 4M8SA 4WBNA 1HWYA 3HGMA 1XTZA 4B4VA 1UAGA 3EVBA 1R4MB 2PX0A 2O8BB 4LF4B 1L6IA 3W5VA 1SUDA 2NXEA 1HG5A 3K32A 1GTMA 1L5MA 4ZCIA 4LOHA 2PZLA 2YNMD 2VP9A 1WG0A 4NABA 2BTQB 1H0AA 1RBYA 3K70B 4Z7JA 1A97A 3DEIA 5DM60 4AKSA 1EDUA 1MF7A 1BAPA 1SZPA 4YFVA 3U4MA 1NOJA 3DLPX 4I8DA 1L3IA 1G42A 4XTCS 1QFXA 3AR5A 3GZJA 3L7CA 5LJIA 5L3SB 5AKHA 3AUUA 1FUUA 3QVJA 3HE3A 4KH1A 2BE7A 4M8NE 2ZSFA 1ZP6A 5EX0A 5JSHA 3HJFA 1KFBB 2VYIA 1PYDA 3BEEA 2AOWA 2YQ4A 3NTVA 4CKZA 4NMWA 4GTOA 3ASOE 2FW7A 1JEQA 2Q3EA 3O5AA 2GA8A 4PC2A 5H3LA 2CXOA 2N1BA 1XOIA 2K4MA 1ZIYA 4IDDA 2BMFA