3PUKA

Re-refinement of the crystal structure of munc18-3 and syntaxin4 n-peptide complex
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
579
structure length
552
Chain Sequence
ERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFNKIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLEEIPKLMKEISSTKSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTEENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYRTNYLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 3
total genus 152
structure length 552
sequence length 579
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pukA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 3pukA03
3C98A 4CCAA 1MQSA 1FVFA 4KMOA 1FVHA 3PUKA 4JEUA 4JEHA 5BV0A 3PUJA 4BX8A 5BUZA 4BX9A 5BV1A 4JC8A 2XHEA 1Y9JA 1EPUA
chains in the Genus database with same CATH superfamily
3FRJA 2FMKA 5ULLA 3OIVA 4D9GA 4UZFA 1PK7A 1WZIA 4FFSA 2OFFA 1N2IA 4EB6A 4MP3A 1EHYA 2C5SA 1WMAA 2W6NA 2OPHA 2ZWVA 2GAJA 3ZLBA 1JXQA 3Q2OA 3M9WA 3SE7A 4RVDA 4RACA 4ZAYA 2WTAA 3K9WA 5EQDA 4Q0MA 5AH0A 4KR6A 1Y6QA 1ZN8A 3OZXA 2I3ZA 3U7IA 4C22A 1I7QB 4GOOD 2PZKA 2IF4A 4EATA 2WWFA 2DMRA 1QMPA 1W46A 4WXRA 2A9OA 2IZ1A 5E7IA 3VYSB 4FEAA 4HGPA 1N7IA 5B4TA 1C2YA 3ORHA 2CNWD 4H08A 4IFBA 1P4GA 2A5EA 2IYAA 3LDHA 3IKOB 4UUQA 5IZCA 5D0QD 1B14A 3Q0EA 4UXJA 3ZS9A 4B3BA 4AQYB 1SCAA 3AF0A 4GHWA 1TGVA 3MTGA 1QPBA 4XQGA 3CZ5A 4YRDA 1YC2A 4RQBA 1BDIA 2FW8A 1WDKA 2E3JA 3IVMA 2WNIA 2WXNA 4J4TA 4D3YA 4KXFB 3A4YA 3QA3E 4YJ3A 5AENA 1X8KA 3M2TA 1VMKA 3KKZA 5AW9A 4FBGA 3ZWOA 3GWGA 2AUTA 2WF7A 1LX7A 3MIZA 3NWPA 1D9SA 4LXQA 3WGQA 5IJ9B 1CJSA 3GUZA 4RSMA 4DMCA 3EEYA 3H5WA 2O2YA 3IQWA 1V5GA 4OPMA 3W9GA 3JWHA 1TKCA 2V7GA 3FHLA 4IP0A 2EDCA 4WV3A 1I30A 5KJLA 1WB6A 3AJIA 4F38A 621PA 3MA0A 1RWMA 4BJ1A 2XODA 5HFAA 1RFGE 2Z09A 3PC8C 1M6NA 1GNSA 2Q7DA 4D0GA 4M8LA 1R9JA 4R1PA 2VJMA 2IYLD 2WB4A 1I33A 2YICA 1BW9B 5KTRA 4RMJA 2P78A 3OICA 1QTIA 3HLTA 4UARA 1BKDR 4ID3A 5EQFA 4BNLA 1IULA 3IL2A 4OHRA 4CKBA 3IKVA 4QQRA 1Q7EA 4OKSA 3A25A 3VVLA 4YUZA 4JI0B 5KTPA 4BV9A 1UC5B 4TRNA 1OY3D 2HHAA 1VLZA 4AS1A 1EVJA 3HB5X 2EZTA 5IAEA 2JLWA 4AJ1A 5HI7A 3G49A 4D4JA 1Z7EA 4RFLA 1O6GA 1N92A 4IH9A 4XX1A 1T3HA 1U28C 2K2QB 3WQSB 3G5AA 2SCUB 1T8TA 3UT7A 3CRMA 2PUHA 4F2GA 3BMQB 1CD5A 1R9GA 2COEA 1B8VA 2AA3A 2ZJ7A 1GUYA 4N3BA 4K46A 2EJTA 3PEWA 4A1OA 3Q6NA 4L5YA 5REQB 3SXUB 2F00A 4MQ4A 1MJGA 2G67A 2OZLB 4U2EA 1ZS9A 1H0KA 2AOTB 2ZDGA 2J07A 1MC4A 4HATA 1KPIA 2PM6A 4ME6A 4MGYR 1FVHA 4NE2A 2MSLA 3VZPA 3ZVMA 3DBOB 5IMSA 2JK1A 3C41J 5LLDA 2A86A 3W9YA 4A1FA 2W4MA 4D9BA 1OH8A 1FLDA 3EVFA 3W3AH 4PO1A 3BMNA 2XSZD 5A05A 2CVHA 3QI7A 4MGKR 3DSVA 5DLYA 3GO4A 2QF7A 5TMEA 4D8WA 2NUAA 3TWVA 3TWUA 4BKQA 4D42A 2C0CA 1NP6A 3OTIA 4LMPA 3PC4A 4Y1GA 5ALKA 2R1ZA 3R0IA 2O7SA 4DIKA 5CNJA 4P9NA 2HLHA 1MVLA 2LTAA 1TKAA 5BN4B 1FSFA 3M6UA 1B6GA 1NP3A 5H02A 1NJ5A 1R4AA 1TZBA 2F2TA 2IELA 4FYPA 2R6R1 4DIMA 3M49A 4ZVMA 4ER3A 2OBBA 4JUDX 2HEIA 2HMTA 3RNOA 4DDHA 3GAZA 4FT2A 4I1VA 3TR5A 1OTHA 1A69A 1UJKA 4LHEA 3KUXA 4A6PA 3JARA 4DV4B 3LBHA 4C03A 3OQIB 4MQFA 2UXBB 4UU7A 1NVXQ 1YH3A 721PA 1YRLA 4LS3A 3PFFA 3ROFA 5KTKA 1E3SA 4JS0A 3RVOA 5SYMA 4QYSA 4BUJA 4MQMA 1DINA 2C9MA 2H5EA 3NBUA 3REQB 4HVLA 4A7PA 4ESHA 3QU4A 1Y63A 1GZSA 4UHFA 3WJ1A 1P44A 5HUHA 1C1XB 1IMOA 2GCIA 4K03A 3JQGA 4EYOA 3VV3A 2E4VA 4R2JA 4WCFA 1YR7A 1OCCE 2BCJQ 1Y4AE 4DIOA 1IY9A 3T8KA 1KRHA 3MEQA 2WQ7A 1KORA 3HO8A 3FULA 4IDAA 3WL8A 4U7WA 1V0JA 3KIPA 2R5FA 3QOUA 4MLZA 1IQ0A 2Q2VA 3VX3A 3DVLA 1AMNA 1D9ZA 4BSXA 1S2IA 1MIOA 1T0UA 4KSCA 1ESDA 3O9MA 4L5BA 4Q66C 2IU1A 2I7TA 1Z8NA 1M8KA 3BE8A 4N2QA 4KSBA 4C0KA 2MYPA 1NAHA 3ADOA 1QPGA 4PFJA 5HFJA 3HGMA 4AKEA 2MHCA 1MA0A 1TJ4A 1MUUA 4GMRA 4AYTA 4EJSA 4GT1A 3STTA 1E8WA 1Z6ZA 4GX2A 4RELA 3KR2A 2Q1YA 3FUKA 5AQAA 4KR2A 3S2UA 4HO1X 2FE1A 4URFA 3USCS 2VRWA 3GT7A 2NU7A 5ER6A 2VLIA 3M70A 5E0OA 2VRCA 5BMVF 2O57A 3OTQA 1Y1RA 2QUZA 2ZWIA 3CLSC 3OSUA 2YIDA 3R20A 3VR4H 4CU5A 5A2GA 2CLEB 2O8VA 5ENTD 4OY3A 4DYHA 2P9KG 3I3NA 4B80A 2CFZA 5HRAA 3SO8A 3TNFA 1SBIA 2Q4BA 5I9SA 5JSZB 3QKSA 4MCIA 3UWDA 3TUZC 3ASUA 1S63A 4J0GA 3E1GA 5C8DA 1UR5A 2ZP1A 1KQOA 4R1MA 4G8JA 4ZYLA 2GPBA 1UN8A 1CDDA 3PFCA 4BU0A 5BYAA 1HLPA 5A1JA 5FZRA 3L4SO 4MV0A 4RV9A 1BHO1 1WDWB 3KWFA 3CRZA 1CDOA 2XBUA 4DCPA 3OHSX 1V8ZA 5AJZA 4PSVA 3HA5A 4ZARA 3FWPA 3P2EA 2I9CA 3A6HA 2IIPA 3LBAA 4I4TB 4CKWA 4R2LA 4AKIA 3RKUA 2CY0A 4UHCA 3DXYA 5C4IA 2I29A 4X3PA 4PQYA 1TW2A 5DNCA 3ZXSA 1TJ3A 2QDKA 2A6PA 4QDTA 4Q9KA 2AG0A 1SRRA 2YXNA 4CEIA 3Q4GA 3N58A 3SFXA 3GFQA 1A9ZA 3NJ8A 2FJ0A 3Q10A 4EZEA 4GCNA 1YVUA 2PA0A 5B3SE 1P6UA 2ZUBA 3BORA 3TRFA 4OHYA 5J4YA 2I66A 4EA9A 5E75A 3EG9A 3QI2A 2Z4SA 3L82B 1N4RA 1JKJB 3P9PA 1CVIA 5C81A 2B99A 5EX3A 2QORA 5AW7A 1SB8A 3DNFA 4RM2A 4ND5A 1ZINA 2JFWA 3EF1A 1OLSB 3QTLA 2BI7A 2JBHA 3I1IA 4PWYA 2AKYA 2HWYA 3DLTA 1G20B 1RAHA 1YJ8A 1WD5A 2C42A 3GUUA 4JUCA 4AVXA 3T5VA 1Z26A 4QATA 3DEAA 3LZ6A 3FPKA 3LNTA 1QH8B 4GI2A 3FLAA 3MWDA 1VIAA 1KAHA 1G5PA 2BJHA 4JA9A 1Q16A 3GIDA 4ROTA 3S2SA 3SIPA 4WXHA 1W3BA 3W8EA 3EZLA 4YC7A 4ZZ3A 5HKOA 1BXGB 1GAXA 4OP2A 3DF9A 2QTMA 2I1JA 4XCVA 3AV0B 4POAA 4RLYA 2IWHA 3WB2A 2AJCA 2G63A 1PP4A 3PC6A 2R02A 2Q0XA 4YR7A 1MO2A 2AFIB 3D8SA 5FUWA 2VT2A 5AIAA 3T5PA 1JT9A 3L6AA 2C7OA 3PHCA 3VR6A 2BEDA 3IXMA 3KJEA 4CIYA 3OFSA 4CCWA 1LSSA 1G2OA 2YWFA 2C4KA 5C1PA 1HK7A 3P9XA 2IVZA 3R5FA 2GHTA 4MRNA 4I5GA 1SULA 1ADYA 4YGYA 3TWOA 4MHSA 1C0IA 1EWRA 1SMKA 4I6EA 5LDHA 5AJHA 4U6SA 3QY9A 1P3Y1 5F2EA 1G7RA 2FRVA 4IIVA 4J91A 1TMGE 1MAUA 2X8WA 4B87A 3U4MA 5HFNA 3GGOA 1JWAB 1L7OA 2R8EA 4G25A 2WFZA 1JEOA 2XWBF 3P0RA 4IWXA 5ALVA 1ULHA 3RRYA 1SGWA 2D59A 1J22A 3PCXA 4I14A 2A5JA 3NHJA 4MRMB 1EVQA 4TXLA 5T5QA 3SQOA 3THRA 3U4AA 5KZMB 5IVIA 5LYJB 5JVDF 2XV1A 3Q3HA 4XEUA 1XZFA 2DTDA 1QGYA 5JWHA 3SWWA 4YR9A 2J3MA 1ZR2A 3V1UA 4HH4A 4K5CA 2YHBA 3UICA 5CGQB 4CEHA 2PFSA 3AVWA 5EPUA 1K97A 1EK1A 1Z82A 1A8QA 5AVYA 5CIWA 2VYFA 4P7KA 2RC6A 3WNVA 3KB8A 3RO7A 1VHLA 2RKOA 1N5DA 3KC2A 5K01A 3HVRA 3IB3A 2JJ8A 1VE3A 4MWOA 3O8CA 2ONYA 2QTWB 2IDMA 2C3MA 3N2LA 1KDZA 3ZJYA 2R1TB 5EIFA 4Q21A 2XPCA 1FBTA 3L82A 1B8OA 2X2EA 5K3FA 3PIRA 1PQ4A 4HMOA 1ZKDA 3GVIA 4NK4A 3VAAA 2CNNA 4EBAA 3W5JA 4XA8A 4C06A 5IU6A 3TN7A 2D2EA 3DOUA 4YRFA 5FQ7A 4CKEB 4RD2A 3FTQA 2G72A 3A2LA 3TDMA 4ASUA 4LQ4A 5CECB 2AEEA 2IE8A 1AUXA 5K6AA 2JH9A 2LNDA 4TT3D 3SJCA 1F6WA 3B6MA 1LZKA 4G1VA 2FXIA 2W98A 3JVIA 2MSKA 3N2GA 1F2VA 2IX3A 1BN6A 2V7PA 4X24A 1YVRA 3E8MA 4OHXA 1SW6A 3U49A 5JADA 1H5NA 2OCIA 2ZM5A 2Y4NA 5EPEA 3FFBA 3S1AB 5A9RA 4LWQA 4PDXA 5D7BA 1W85A 5GZ3A 4ITVA 1E58A 4MJ7A 1DQYA 1Z0KA 3TNDA 2Q9CA 4FOPA 3CR3A 3AB7A 3C3AA 3C3XA 1Y80A 4UE6A 5CH3A 4ZAFA 2II6A 3WGGA 2O5EA 3WRXC 1ORWA 5CB8A 2O8EB 1UJ5A 1OHHA 4OGGA 2XA2A 4BPRA 1Q57A 2GGFA 3HADA 4TYMA 2RG7A 4ZA2A 1G16A 2C58A 3QYJA 2G7ZA 4MRRA 2BYTA 2E4UA 2QW0X 1CIJA 1PGNA 2NPOA 2WYUA 4ON9A 1V43A 5D86A 3ML9A 5BWBA 3UK7A 2QLTA 4IV8A 3FTXA 1Y4SA 4HG2A 4CGYA 1FRFS 4HSGA 2POCA 4PE5B 5CPFA 5EJGA 3CUUA 3FLBA 1NLUA 4MV8A 4CF7A 3F3KA 1UMDA 4ZJPA 2NMVA 3NHKA 1P9OA 3ZZ1A 2QNRA 3FYUB 2C4HA 4XDZA 4ZJUA 4HX5A 4LIPD 2AJBA 5JCJD 3ZD7A 3DXZA 2XMRA 1SC9A 4WK6A 2ZAMA 3AEYA 4IN3B 2W2NA 1JCRA 3AW8A 3L7MA 4G5SA 4Q82A 4BSZB 3M5CA 3FTYA 5IM4F 1AKYA 1MF7A 4O2RA 4PTYA 1DC8A 3ISJA 3I6MA 2MR5A 5CDSA 3U64A 1CHDA 1ODSA 1PS0A 1O95A 2X7XA 2XQJA 2UYQA 2VJ8A 4WZAB 4D9NA 1DPGA 4QRHA 1E7RA 1N0QA 4GO1A 4XVQA 4CM8A 3U40A 4NYJQ 4R1TA 3T3PB 1E32A 3VC7A 1SU4A 2XT0A 1P80A 3EZXA 1M5TA 3EW7A 1SA5A 4KFRA 2CBZA 1I80A 1U94A 1DKNA 1XTKA 2OZPA 2PX3A 1XTRA 2CVFA 3L1KA 4HKTA 4X7BA 5IEBA 3HYRA 4F5YA 1LTXA 9LDTA 3TG5A 4TRJA 3S28A 3GOQA 3KNZA 4ECEA 2CHFA 1DIHA 4B4WA 1FFSA 2P9PG 4Y2GA 4JBXA 1CY6A 1L2TA 4DJFC 4N3GA 4DYVA 3EGDA 2EKDA 2P9NG 2NSJA 4J1QA 1WHTB 4I3HA 2LIPA 3S8MA 3JYSA 1ZL2A 3S44A 1LNSA 2XMSA 1MPTA 2GFIA 5FWNA 4I6GA 3MJTA 4RH3A 3NB2A 3N28A 3TH5A 1KETA 1QCZA 1LGYA 1QH8A 2H2FA 4UTPA 4ML3A 1QJ4A 3TIXB 3PD0A 1E3IA 5AJWA 3FOEC 5C4GB 4O4HB 4EX6A 2H54A 3CX7A 3B9RA 4UMFA 2YOFA 3GDHA 1IJFA 4I8IA 2BFPA 2AWOA 4QDXA 4F3NA 2IYOA 1LPBB 1PE0A 1UBCA 4B0ZA 2QM0A 1Q0SA 4G1FA 1OZHA 2QSUA 3B3JA 1EKXA 1PZXA 3K1TA 3AY7A 4ZOEA 5EY5B 5IKEA 3S1LA 5GJVC 1EA5A 5AK0A 2XGSA 4WWNA 3UMCA 4K8OA 3ZE7A 2RGGA 2Q6OA 4FOSA 3ZQ4A 4L72A 4NZMA 3O4VA 1U5AA 4MA5A 4QREA 1ADCA 4Y9DA 1QIFA 2CXTA 3NP7A 1N0IA 3A3YA 1YCSB 4KQEA 5G1PA 1JEEA 1RHQA 3F2IA 4QSHA 2QZPA 3BWYA 3U3JA 4WGFA 3BFXA 4C5BA 5H7XA 2IO3C 1N77A 2OMKA 5JSYA 4AM9A 2X4GA 3OKFA 4P33A 2BONA 1GZUA 2KBEA 4JIMA 4CZ2A 3I2YX 4DIUA 1P4JA 1PX2A 3FSEA 1CX9B 4GKVA 2LW7A 3UYKA 3M6AA 4U7HA 3GG2A 4FZJA 4TLDA 3FRHA 2OSVA 1EVEA 3O1JC 5E4TA 5LXTF 1LBIA 2G40A 3S5JA 5EMKA 3UXGA 3M6IA 4WPGA 4R7LA 1DZ3A 5LUBA 1PEAA 4PAOA 3R77A 5IARA 1L1FA 2KJQA 2GEVA 3CE6A 2AB0A 4OHVA 1UWVA 4YJHB 4QPNA 3TZKA 5TEWA 4C7OB 3C6ZA 4D4LA 1A7JA 2PH7A 4XYGA 3VVMA 1ZMRA 5B53A 4G5XA 1GPAA 1TD1A 4UWKA 3DYBA 5FOUA 5JLAA 3H8VA 2G36A 5IHPA 3I04M 4QYIA 3UO8B 5JNTA 2JFYA 1EUZA 2I1WA 4L4SA 2VZEA 1F6BA 2QE6A 3HCAA 3HGTA 4IH1A 4KE7A 5EJ9A 1B1AA 1XF9A 1RP1A 2XNDA 5BQ3A 4NVRA 3LUKA 5CDFE 2CXOA 2Y6VA 1MHTA 3QPDA 1EK6A 2GK3A 2J6IA 4LVCA 2PRYA 1FFEA 5AKYA 3I8SA 4DR3B 3PNSA 4ANUA 3O26A 1L7QA 1ZH2A 3NBNB 3F97A 4EFKA 1L5QA 3I9FA 3NGMA 2FFBA 3H1EA 5CVCA 4BT9A 1G8SA 1J8VA 1U0HC 1W6UA 1XK6A 3GRRA 4GEGA 4N7BA 5IKPA 4QGFA 1QWSA 5DPMA 4KUEA 3PDJA 2NU6B 5IMBA 3IUYA 4BDTA 1TCBA 2RJNA 2V0CA 3KKKA 4MV1A 2QUIA 4YDRA 4IG4A 4U0ZA 3QSGA 4OHOA 2OKGA 3UM9A 2UYCA 2C7VA 5ENNA 2FSSA 2H1LA 3W2FA 4WZBE 5DNEA 1T9CA 3QYFA 2C2YA 1S0PA 3NHZA 5DI3B 2OBMA 2D2FA 3LM8A 3R9IA 2PGLA 3EXAA 3EZYA 1YUMA 1J0DA 1PFQA 1K2VN 4OSOA 3VYTB 4S05A 2WJVA 2FGJA 1UH5A 3LJNA 5MGNA 1FVFA 1NBIA 1MIHA 1E5XA 1RACA 1VGVA 4HOYA 1KVUA 3MX3A 4Q12A 4XDHA 4BBAA 2CF6A 3ZU7B 4LAFA 4ER7A 3JQBA 4RCYA 5BNWA 3L7LA 3AKDA 4ZOAA 4PC1A 4XOIA 1E7VA 3K2EA 4L2IB 2WB2A 2I6FA 1JAXA 1V3TA 3O21A 1SIOA 5CT9A 3BYZA 5CG2A 2QYOA 3WDMA 1L4EA 2DECA 2Q1XA 2OHOA 4DR1B 5JDIC 3J7AC 1U5BA 2FJPA 1RI5A 4UAUA 1IIRA 1I2ZA 1U8TA 3IDQA 4CGZA 1XXHB 2ODWA 4AJKA 4K6OA 3ZDAA 1U4SA 3A1DA 4R05A 1N7JA 3FCUB 3STXA 1VHJA 2FX5A 2ZS8A 2BFCA 3MMXA 1Q7GA 3C70A 1ESMA 3OX3A 4FR0A 4PO8A 1NIJA 3PZ2A 1K8ZB 1O1YA 5I4KA 2WWYA 1PF7E 2D8AA 3DTVD 3LT1A 2QT0A 4K40A 5GIPE 3UMYA 1JR2A 3AVUA 1D5CA 1QP7A 5EFOA 2VF4X 4D3XA 1PL7A 1F3OA 4L1BA 1E79A 2I7XA 1QRAA 4FADA 1ZD5A 5CK5A 4FJ0A 4Q1EA 4U8HA 5JMND 1S4MA 4CIXA 3MCZA 2J7PD 5AD1A 4DR7B 2XMBA 5H3HA 4TMKA 2CUNA 4BVGA 2W6MA 3FI9A 3RV4A 1EYZA 2Y4UA 3VPXA 8ATCA 4ALMA 3BOSA 4F4DA 1JWGA 2X0JA 4A6EA 1JX6A 2QJWA 2M1XA 5GV8A 2GVZC 2HC9A 4IIBA 5J59A 1PSDA 2XCUA 5G41A 3L07A 3OCYA 2Z8ZA 4CT4B 5C37A 5CLFA 3URZA 3GMSA 2VG8A 1RW4A 3GEIA 5IAOA 1BN7A 1L5FA 1SHJA 3P0HA 2GEBA 1W25A 1ZGZA 2CCGA 5K4GA 1Z6PA 4TLAA 5LBIA 3OO1A 4JR2A 3X43A 1H6KA 5DGCA 4DHEA 4HCJA 4GMJA 3B89A 2BHNA 5F2NA 2QV0A 3QWIA 5KNDD 3Q7SA 2E9SA 5CX1A 1UXHA 2I67A 4MMZB 5U1PA 3ZCUA 2PL5A 2YH2A 2XQGA 5F52A 4WVFA 5KO2A 4KVGA 1SC4A 3AUFA 1XKQA 1H5UA 3TZBA 3PENA 2YIMA 3KOXA 4P3PA 1WCIB 1MOQA 2FW1A 2PQRA 4DOMA 3E8SA 5I7UA 2PHZA 3PSHA 1P1KA 5ILQA 4B0OA 1XLTA 4BS9A 4U8YD 2EW2A 1H9AA 4H7DA 3NNSA 2IYYA 3G59A 2EKPA 2WXFA 1QNLA 2AVNA 2E0IA 4DRYA 4Y6RA 5FOSA 1NY5A 2FAXA 3O0DA 1E2JA 3WRYA 4B40A 2O1WA 4CM3A 1IUPA 3T9KA 4LRZA 1GNQA 1LWNA 4TS3A 4MMXB 1GZHB 1LRJA 2X6HA 3FCYA 2GZ2A 2OE2A 2XI4A 5LB4A 3DD5A 1S8OA 1YAJA 4RD1A 3VZDA 4PO9A 1JFSA 2CDRA 1YB7A 2OTCA 3Q1KA 3TFQA 1JEQA 3AM3A 4RTSA 2HDHA 4QUIA 3W4IA 3ITKA 4G5GA 3VU8A 5LD2C 4CKBB 4MRAA 3T1QA 1E9BA 4P82A 4YBZA 5INTA 3I6BA 4RZXA 5CIYA 2X2PA 2AI2A 2X9GA 4CFYA 2VHXA 4CM9A 2YMLA 4EKEA 2J4CA 2W11A 2JJ2A 1IK4A 3ANLA 3IBYA 5MHTA 4P5DA 1UFRA 1TJPB 2R6HA 2YJTD 2DYSE 3GT4A 2BMJA 4KWHA 1W1WA 3UB2A 2CZGA 2NYRA 4PW0A 4MYSA 2BR5A 2FH5B 5BT9A 4UQZA 1GZ6A 4YUXA 3CK7A 2O07A 2EZ8A 1NG1A 1AZTA 2GJ9A 3WGUA 1MX5A 1QIJA 3PRJA 2PA3A 1KDRA 4I2VA 2BGTA 2H7CA 2O1SA 5DFAA 3MB5A 1XIVA 2DTXA 1YGYA 3IQHX 3KJZA 3QU5A 1NVWQ 4X41A 3V5NA 4C7JA 1UKEA 5GV7A 1PNTA 3BIFA 1CVLA 2EGHA 5CVJA 4M3NA 1JNYA 4LDRA 3ZGXA 3BB4A 1U11A 3MUEA 2YV1A 4LBYA 1OBCA 3MBIA 5A4IS 3DV0B 4ZQIA 1ZGHA 5IJZA 3LGXA 4OM8A 2P2LA 5JUWA 4U0SA 3B13B 3B3FA 5DX0A 1YR6A 4H1HA 2P2CP 1E2QA 2ODEA 3K6JA 3H13A 3RWOA 2MINB 4ENQA 1VL2A 1RZUA 4N41A 1QR2A 4RGQA 4GEKA 4A55A 4QASA 2AX3A 1M2WA 1I3NA 3TVDA 1T0JB 1TF7A 4UFNA 2Q0QA 1KEWA 1JQ5A 1KI1A 3E2MA 5DXFA 5SZJA 4MYHA 5LC1A 3UB3A 2GN9A 3HFJA 4GI7A 4AL4A 3UUGA 1NBOA 4FS3A 3TXAA 2DZOA 2BD0A 4KCGA 4O2BB 1VG8A 4BNHA 2IK8A 3RQIA 3WXMA 1PLKA 2BMEA 3LQ4A 5CNMA 2JGEA 3AIMA 4HAVA 1EAMA 3DAFA 4TV9F 4UATA 1NV9A 4XH9B 5EKUA 1EJBA 4UBJA 1UAAA 1WVIA 3GF4A 4O02B 3FDZA 1KZ9A 5A6SA 2BL4A 3QV1A 2NV2B 4WNAA 4FIZA 3UEOA 1V16A 1K9SA 3G2HA 2PWZA 4O2BA 3A6PC 1QYWA 4ZIRA 3NOOA 2BR3A 2IFUA 4IVRA 3TVTA 1E5VA 1FPPA 3QBJA 4I66A 3FTVA 1FCJA 2XDAA 3DOEA 2GM5A 3OF5A 3A1CA 2VOJA 3K72B 1S02A 2Y2VA 3C45A 2WU3A 1P3DA 3PXDA 3O93A 1MC5A 4JWKA 3U7HB 2HDOA 4TKVA 1ZD1A 3WE7A 5IYZB 1ZM9A 3NBFA 1JYFA 1X39A 5L4NA 2IEDA 2C98A 3E5RA 3VPFA 1K3FA 1M8GA 4YJFA 1POWA 3UHJA 1QJCA 1RQLA 4WERA 2JG3A 2WQHA 3ISMC 4IQ4A 1UFOA 2OFOA 3HVEA 3U5TA 3JQ8A 1U9ZA 3RVPA 5JV5A 5ALIA 3DHYA 2PUTA 3DOCA 3H2IA 2KC7A 4O1IA 5K6RA 5EXDA 5KQGA 1BIFA 3ZE9A 1NBME 4LN1A 3PYMA 1ONOA 1Y8CA 4MEJA 4TQAA 5M04A 2R6DA 3LT0A 3T3NA 2FSHA 2X8JB 3NBKA 3BL8A 4PYOA 5CXQA 3V7UA 2BFNA 1X14A 3TDKA 5DTQA 2A5GA 1L9KA 3AG6A 5C1BA 2LE0A 1YACA 5D6OA 2E6KA 2AC2A 4LRTB 2K4MA 3EVBA 1VKOA 4UI9K 3PTAA 1IG3A 5BXUA 1ONSA 2RHWA 1DCEA 4D5EA 2O54A 1XZGA 4HLQB 1N9GB 5ARDA 5G4KB 4XWKA 3I58A 1Y7PA 3RAGA 5AYWD 4DX5D 2CCJA 2FSIA 1GITA 2R6AA 3T99A 4CBVA 2FFAA 2JFGA 1IH8A 1X9IA 1I24A 1X7ZB 2EFDB 2EJBA 3GEBA 3IDZA 4IMRA 5KDOA 3VFDA 5T64A 1P17A 5KVCA 3L9TA 3I2JA 4TQUS 1GCIA 1KZ7B 2YW2A 3QE0A 3DYVA 2CMKA 5EG5A 3FVVA 3TLGA 3V1YA 3P20A 1EEXB 4CMBA 1EHCA 4DF3A 4B6OA 2J3EA 4HUTA 1LB1B 2VXBA 5JTUA 4NURA 1RLOA 5FA5A 3PX2A 4QUDA 1PTJA 1KS9A 2HZBA 2E4AA 2DERA 3N3BC 4IJUA 4WZ6A 1G3IA 2CHEA 3M5WA 3T0GA 2FHSA 2IYRA 3E22B 1OBVA 5EXPA 5ERXA 4K1LA 3RTAA 1QLHA 3CB2A 3HABA 5AW6A 4G0ZA 2XEHA 1HXHA 3IURA 5I8WA 3KJHA 3A0UA 3Q7FA 4FLHA 2JEYA 1M0WA 1I6MA 2RGXA 5CUQA 4BTBA 1XD9A 4M7CA 3H18A 4ZT7A 3IJ5A 1ZD9A 5G40A 3RHZA 2QN6A 1GADO 2ZIXA 1P4AA 1W85B 1OLSA 3HWWA 4AY4A 1SQ6A 4F46A 3LXXA 4LRWA 1N7HA 4V2UA 3K0FA 3RKSA 3L46A 3T5XA 5DEIA 2VATA 4LRQA 3U3OA 4E1AA 3KG2A 3GLIA 5IAAA 1IVSA 3EHDA 1N8KA 3UC5A 2PS1A 3ZE1B 1UINA 1CT9A 5FPYA 2P9GA 3QUBA 3TQHA 4EVSA 4DSNA 5JCOA 1F1BA 2WPDD 3X1XA 2IOYA 4KAFA 3KVNA 4V0KA 3CPJB 1BXGA 3BGSA 3DF7A 3T7TA 5FNVA 1XZAA 4GOLD 2GRNB 1Y7TA 1GILA 3QPUA 3PGA1 2EKZA 2J59A 2CFIA 2O59A 4BXOA 3WZMA 1TYQG 4N18A 2WD9A 2XNHA 1AA9A 4Y2JA 2NZXA 3JAKA 5CT4A 3UMGA 1ZN9A 4W9NA 1NHWA 3U09A 3W7BA 4PS7A 4NICA 4CT5A 5FTKA 3DMDA 4GCOA 2HNKA 4AN0A 6YASA 5K6AC 1RBZA 1SH7A 2VT3A 5EZ5A 3HCBA 4KH0A 3IUSA 5JNSA 2F90A 2JIPA 1BRMA 4M4SA 4B3FX 1SFRA 3R41A 2DWOA 3OZFA 4ZQBA 4OOEA 3Q6MA 4BQQA 1WSWA 3COJA 1FUUA 3HO1A 1NASA 1YE3A 1WTCA 1ZIYA 4IWNA 3LLSA 4UOQA 4RV5A 4BGIA 7ABPA 3P2MA 4CUKA 4IRUA 3OOWA 1CDEA 2F7SA 4NK5A 2W2OA 5GVSA 2X6JA 3CVPA 1YQQA 3LPNA 4V0QA 1G98A 2C0QA 4JB8P 3VM6A 4DQXA 3K1ZA 4MYRA 2PRJA 2X0EA 2D7DA 1K98A 4MX8A 4P4UA 3W2TA 2BR4A 2XYPA 2CJPA 3DW3X 2DUUA 4ZVNA 3RARA 4LJRA 3R9AB 2HF9A 2WKWA 2BRUC 2JGNA 4FDAA 1YVEI 3V79K 2VPWA 5T3RA 2FKNA 4GDMA 4Q6BA 5CBNA 3NGXA 5EWLB 1M34B 4CMGA 4NC9A 2MYOA 2I33A 1SQ5A 2JCGA 4US1R 4XR4A 2KW5A 5JQGA 3QWAA 4P93A 4LZNA 4HGRA 3F3SA 4X00A 4IYPA 1SBQA 5IYZA 1YKSA 2HUPA 3AR4A 1WLYA 4MAFA 5AUQA 2JKZA 2JFVA 5E9JA 3ZEIA 4RZHA 4B44A 4DUZB 3I72A 3RYTC 1CTQA 4ZCQA 1AK2A 3TNYA 1H4SA 3F46A 1D8AA 3T8MA 1T9AA 1VCOA 2UUPA 4YV0A 2CWDA 1H2FA 3OJCA 1FXUA 1RHRA 3HBFA 2VYVD 2DBQA 1Q6ZA 2QLBA 5EKXA 4ED9A 1QUFA 2ZBDA 1P0QA 1U3GA 3HZRA 2QDXA 4K8RB 4ARBA 3PX7A 1X0XA 2W6QA 1XL0A 4XKJA 1SD2A 4PG8A 2BC9A 5L7WA 3WBFA 2IZ0A 4XM2A 3OEEA 1U9YA 1MFZA 4J8SA 4HB3A 4IJKA 2FQXA 5EDSA 2ISCA 2DT8A 1X6VA 3C43A 3WNDA 4BO0A 3FNHA 1EGHA 1CUYA 3N53A 5ARBA 5KU1A 4CCSA 1U5CA 3ONEA 4M7WA 3L4EA 1FLNA 1T0PA 5K2MA 2W70A 2C54A 3HJBA 4HEA1 1U0SY 3A31A 3AHGA 3D7MA 1YFJA 3MMPA 3O8LA 1F12A 3C1OA 2JFBA 3FMIA 1CE8A 1V11A 3OQ1A 4L50A 1SEVA 2WZCA 4HQLA 1RPJA 5E8JA 4YJGB 3DSTA 3V2IA 3IJRA 3QLVA 2VP9A 1VDMA 1HYQA 3KUKA 1KFBB 2PVPA 3L7CA 2I2DA 4HXYA 2C1EA 1JLLA 3SHWA 3H0EA 5IS2A 1HNWB 4JK3A 4RTJA 4NYIR 3D1VA 1KF0A 1O89A 2PXHA 4Q24A 3DE6X 4MULA 3WGHA 1QRTA 4BO9A 3FZQA 4EY3A 3B52X 5DXAA 5DWQA 4GA1A 1Q0ZA 1UIMA 2QLFA 4OH7A 5PNTA 5JJ6A 421PA 4AJHA 1AMOA 1QUEA 2QD4A 5WRFA 1G4HA 1QFSA 2CLFB 5FTNA 4KGZA 2YUTA 2WUFA 2ISSD 2VQ6A 2YZGA 3TD2A 1OV4A 4EB0A 2P79A 2Q1TA 4X7RA 4JL0A 4R8KA 1Z06A 1Y3FE 2QUKA 2PRKA 4I1YA 4KZ0A 3FR7A 3ZHBA 1QOZA 4UTOA 3HHEA 3QK7A 2GRJA 2JA1A 4FR2A 3RIHA 2QZAA 3NNNA 3IAM1 3P4YA 1JKMA 4Q19A 3KTAA 4GOMD 3IEMA 1JHUA 4QODA 1ZK4A 1VFNA 3E3NA 1HF3A 1YA0A 1DPFA 4R7TA 3QU9A 3EUAA 1KTVA 3H4VA 5C9ZA 3ILSA 3BK2A 4I55A 2R79A 3I6ZA 2XAAA 3IELA 4KFSA 1GUDA 1I3KA 1XDDA 3B82A 1ETUA 2C2KA 1P19A 1U2PA 3GLFB 1HRKA 2ZBQA 1FQWA 3IE2A 1RXWA 4DT1A 3H5IA 2Z57A 121PA 1EIWA 3W8FA 1U02A 1Y3CE 2PT7A 3GXOA 1B00A 3G7UA 3WHPA 3EOAI 3Q11A 4CDMA 1Q77A 4JLVA 4G5HA 5B1EA 3OZGA 4CTOA 4CMKA 4EPVA 1ZU5A 1ZJWA 3AVYA 4E4RA 3KB2A 2OXTA 3VC2A 2DSTA 3GLFE 3GFRA 5DV9A 1RJ9B 3LYHA 1YZTA 2CEAA 1DAFA 2DF8A 2WSSA 3EXHA 3FAKA 4IDFA 5BWLA 2FDRA 2D0DA 3FEYA 3H9CA 2EGUA 1AKRA 1PFYA 2HHCA 1AP7A 2OCBA 4PZZA 5FULA 4B09A 1NC1A 3OPYB 5FQ6A 4ZHQA 5IWCA 2IEAA 3OXGA 1TC1A 2O50A 3TVYA 3UM1A 1QIIA 1G291 4WADA 2NO9A 1Q92A 3UJNA 2C0MA 1YFLA 4KPUA 2DHDA 1F0NA 1Z22A 2FWAA 3DOIA 4FNGA 3D54D 2PH3A 2VTVA 5FDFA 5JZ9A 2MOWA 1AB5A 2C3YA 3BRWD 1Y0BA 3RGGA 1H2UA 2O8BA 3F6QA 3IO3A 4HMQA 4RORA 2DC1A 4J3FA 2I71A 1G6OA 3COVA 4KXVA 4B82A 4GSLA 3WGVA 4DCCA 2F0YA 1NNUA 3I64A 2A9RA 1C14A 1WBDA 2C1ZA 3M9XA 5JJBA 3BK7A 4YV2A 4LCTA 4FDLA 4MO9A 5KU7A 3L0CA 1DBSA 2HR2A 1OY1A 4EPTA 3P9ZA 1IZ0A 1UKAA 2AN1A 3JD1A 4EO7A 4JQOA 1J39A 2C20A 2J4DA 4KV9A 1OWOA 3EDTB 1P74A 1Z2NX 3LUDA 5D1HA 5FBHA 5FI3A 3WYEA 3FFLA 4GR4A 2J30A 2BKKB 2DH5A 3CO5A 1XZLA 2HJWA 4H6XA 2JGFA 1LCIA 1JLKA 4IGEA 2WEKA 1GZ7A 2N1BA 3EF0A 3VTXA 3WGLA 3PGKA 4KVZA 1JI0A 2P4UA 3RJTA 1S7GA 5SZIA 2C0PA 5E9QA 4RY0A 4RVFA 1S3FA 4ZU6X 4FEEA 4V0ME 3WGYA 4KVFA 4UHJA 1KQ3A 1TN6A 1QOPB 1RRFA 2UZIR 3AR8A 4H4CA 5BSUA 1JZSA 5E1DA 1LK7A 4B6RA 4EH1A 1C4XA 3I5YA 2H2AA 3FTSA 4QXQA 4Y2VA 2EBFX 3HJGA 2R6FA 5A5EA 1KOLA 4RLFA 1LK0A 3TNJA 4YRZA 2VUHB 3HYSA 3DLCA 4PSCA 3MBOA 2BY4A 2JASA 3HY3A 1IZ9A 3ORSA 3QXGA 3SR4A 5BXQC 2Y1KA 2Z3ZA 4R41A 4XPIA 2P9JA 4H16A 3D43A 3QPCA 2I99A 2O2JA 2ZT8A 3G9XA 4UCQA 5BSMA 5K8TA 5DHRA 1F17A 3MT7A 3LTNC 4CGVA 1KQGA 3W6OA 4C1NA 4ESEA 3QEBZ 1GSHA 4LVOA 3ZH2A 4E5PA 5LQUA 1BU8A 2Y0EA 3G5LA 3AI1A 3G88A 1DIGA 1SXQA 3K6SA 4EKIA 2PUFA 2WKPA 4KR0A 5B1SA 3QWFA 4C30A 3S4YA 3VDQA 1AKEA 1KPGA 5T3UA 1XFAA 4K6FA 2BGWA 2ONDA 1DWOA 4FGSA 3EAGA 4PSUA 4BJ3A 3KQHA 1VB5A 2DETA 3H42B 3WK6A 4YCJA 1PHPA 2C7BA 3RBAA 3CNQS 1GNPA 4L9WA 5IJWA 1N1EA 1S2NA 3M6FA 1R3DA 4PG6A 3TR0A 3DV9A 2RGWA 1N25A 3T4EA 1CJTC 3AR5A 4PYKA 1Q7CA 4F9GA 2QAIA 4L76A 1MJ5A 5HCNA 1RRVA 1DI0A 1XTZA 4L2IA 3SDZA 4QHSA 3SFZA 5ALEA 2OYRA 5CPBA 5IBQA 4JVSB 2VXYA 1CRWG 3UMBA 4NS1A 4D02A 3QFTA 2BEUA 4RY8A 4Q7LA 4TVKA 4UCWA 5J63A 1YJQA 3GARA 1BEEA 3DL0A 1II8A 2XKBA 2O8DB 5F1PA 4KDFA 4Y2UA 3ZWNA 1OT8A 1EQUA 1KP3A 1WIWA 2OLKA 4P36A 3PGXA 3NDIA 1JEYA 1NW8A 3TLXA 1PDVA 3OZBA 1E2BA 3FYHA 4X1IB 1KAQA 3ICVA 4L95C 2VJBA 3D9OA 1SBNE 3IQDB 1RQRA 3RVDA 3SYLA 3GYBA 3T0IA 2RAVA 1RXYA 3LY9A 1SO8A 2J5BA 4OQ4A 4WQMA 4QJ5A 4BO8A 3R1IA 3EVEA 4OUDA 1PSWA 1RLMA 1NXSA 2FNAA 2GOYA 1COZA 3VR6H 1TZ2A 1GYQA 1ZNZA 2RHRA 3PBKA 1PGQA 1O57A 2R96A 4H0NA 4E51A 4KFCA 2ISQA 4Z4IA 4GR9A 4NBLA 1CVRA 1SELA 1VE6A 2BFBB 2GHQA 1XCOA 5EZYF 4F9EA 2J49A 2G1KA 4LJ5A 1G0NA 4UUPA 1OH5A 2RMKA 5CVEA 3BFPA 3RM3A 3KD2A 1DOHA 3P9IA 1N0UA 4Q1BA 1KIAA 1SUIA 1XTJA 4QWWA 4BNUA 5I9NA 1VPDA 3ESDA 4MUXA 3REFA 9MHTA 3KLMX 1MBZA 3JZAA 2JJ1A 5E4YA 1YDGA 4XSVA 1CC1S 1M7HA 4MS1A 3KSMA 1Z29A 5F78A 4C0AC 4P7JA 2H63A 1N8TA 3A70A 3MCTA 4BO6A 4Y9SA 1JI3A 1DQSA 1KMMA 2FK7A 3ICWA 5A6SB 3W2HA 4RTNA 3SI5A 1A9OA 1DHRA 2A1IA 3R5SA 5AJLA 1WBJB 3W5AA 2PX0A 2DCMA 1E60A 1GOTA 3JZIA 4FHFA 2V0PA 4R16A 3ESLA 1MJFA 1X9HA 2N9UA 2ORYA 2YNQA 1JDJA 1ZNXA 5KOYA 3RC1A 1E79D 1BAPA 4HLCA 3I9OA 5JE8A 4F1WA 2G0AA 4WZBB 4CRWA 4RTLA 1ZOLA 1VJDA 1AKNA 1GGKA 1H4VB 3B51X 3OU2A 1E8XA 1BU5A 1U2DA 2DBZA 3CSFA 5K0EA 1UJBA 3TW8B 3D0RA 1EDUA 2Z58A 3FTUA 1MRZA 2ZJFA 4KMMA 4LHYA 2PNJA 4TTQA 3D8NA 3VU9B 2P9QA 3FUUA 3G2OA 1Z4QA 1PAUA 4RG6A 1XD8A 5T8IA 3O8OA 2D1SA 4S1WA 1SQGA 3PT9A 2GVDC 2OFPA 3FPFA 1GP2A 1ZAYA 3HTXA 3N8KA 3SYNA 1HS6A 2GZ1A 2WZBA 3CBQA 3RREA 1GQOA 2HXSA 3GJ5A 5DT2A 3O74A 5IN5A 3R7AA 1J0XO 4O8ZA 3RSZA 1UJJA 1XPJA 3P7MA 3RG2A 4MKFA 1KEEA 3F5MA 3IULA 1EEHA 4P84A 3OAWA 3LECA 2G0NA 1VI5A 2HRRA 1PT7A 3AG3E 2ADOA 4M7OA 1TT5B 3SBTB 1R6VA 3I04A 3JQBC 3KVVA 4FGWA 1Y48E 2ANCA 4KNVA 4KQ9A 4GM4A 4LXGA 4OIMA 3JY6A 3FYTA 4RKEA 3WMRA 4YRGA 1M1YA 3PQCA 1PZFA 3GR6A 4C4ZA 4MDEA 2Y05A 1AS0A 5DNAA 3H87A 5IUNC 1J09A 2Q62A 2ESRA 4TVSA 1TN7A 1N0RA 1IYZA 3PRHA 2CE7A 4PTLA 1QZUA 4DZTA 1Y6IA 5LU9A 2JDIA 3AWDA 1EJ6A 1Z7WA 3KQUA 2HO5A 2OBNA 1LFAA 4LOJA 1CQIA 1YBVA 2FR8A 2OUIA 3C4VA 3CH7A 4R6WA 4C4TA 4DSZA 3LUAA 3R0QA 4X6UA 3WDKA 4JIGA 2OLJA 4ES6A 4U5QA 3TM4A 5LYJF 1S89A 1U1CA 3FKSD 2LUOA 2GTIA 2DQ4A 2Q9AA 1AX9A 1AGNA 1OXSC 2OBYA 2YV3A 4X8QA 2GAOA 2WR8A 3GCXA 3MJDA 5G0VA 3VBCA 3VDMA 1T4DA 1G8YA 1C0KA 3AB8A 4NFLA 2CG2A 1OPXA 2FF5A 2V97A 4F5WA 5A02A 3GEGA 5JHHB 2Z2KA 2MINA 3OZRA 4K6GA 4B79A 1Z0UA 4MI6A 2XS1A 3OQIA 2YWCA 4MQFB 5BR1A 3NIBA 4HDAA 2GPWA 1E7YA 1ZA1A 2ZB2A 3DAOA 4NYMQ 4Z8XA 2I34A 4WAUA 5BOSB 1C2TA 1ZK0A 4TLBA 3EY9A 4QU9A 3TSZA 4Z4EA 3C5RA 4LI3X 1YQUA 2HA7A 2MTBA 3CZCA 1E5LA 2G4LA 2GGSA 3VPBA 5CB4F 4UI9J 1BE0A 1E1CB 1MABB 2P6PA 4MPPA 5KYUA 3ONLA 1NLYA 2F1HA 4X6XA 4AUKA 1A04A 2GBIA 4REOA 1SHLA 3CNHA 4FLFA 3X0DA 2ZRAA 3DBLB 2IEJA 1MX1A 3PLNA 1KWGA 1W36C 3AG5A 4D46A 3KR1A 4C76A 2XKAA 5B55A 4MTLA 1R5NA 2QD5A 1EHIA 3IR7A 1H1TA 3MSXA 3RADC 5ADVA 2QQ0A 4RWZA 4J9VA 3GJ0A 3OM0A 2DZDA 2GM3A 3K0HA 4RF4A 3AETA 4TT3A 4EOGA 1V8BA 2P6RA 2J32A 1QWOA 2C8LA 2W48A 3O7WA 4WKOA 1OYWA 3EG9B 3TL2A 2J0UB 1LVGA 2HLDA 1B16A 4FIDA 3Q3VA 4C0QC 5BW8A 3DHEA 2XF8A 3QW2A 4PSDA 4B2LA 2BM0A 2IOFA 3PHLA 2ERXA 4AU1A 4E14A 3L5KA 3QQ5A 2MSEB 2IYVA 1OX5A 5BUSA 1TECE 1G19A 3MINB 2IXGA 1CUWA 3EMBA 2W00A 3CHYA 4QGGA 2NNWB 2QD3A 4CEJB 1X1RA 2PZGA 4TKUB 1BS9A 1Z5OA 1ZD8A 3WWYA 1CUCA 3WKAA 4NHEA 5EP1A 3AKYA 2JI6A 3PXXA 5CFOA 3G9ZA 1MH1A 4MR7A 4FFBB 3S2FA 4BLPA 4B89A 2Z56A 4LCEA 4RJJA 5ILGA 1R4MA 4WLUA 2WAOA 4YXWD 3UJDA 4DJTA 4G36A 4OGLA 1MO5A 4E30A 4XWOA 5IZCC 2OV3A 3KALA 2P3QA 2QRLA 3NDBB 1VG9B 1H2XA 4PSKA 4MQLA 3L8FA 3EGIA 1NXWA 4XVUA 1T2NA 4URVR 1HDYA 1Q74A 4IIEA 4Y2SA 4BWGA 3DE3X 2B1GA 2IOLA 3ENWA 1Y33E 3Q0IA 3D64A 4CKEA 4HI9A 1XP5A 1EVKA 4CUZA 5LKAA 2JVIA 4KH1A 4X20A 3RRBA 1JR3A 3VU1A 3AVOA 3R7QA 3TJPA 3SE0A 4BEWA 5CEFA 8LDHA 3VGPA 3WKBA 3P52A 3IV0A 1GLGA 1F9EA 1HMPA 1XNGA 3H1GA 2BZGA 3AOEC 4F96A 1ARZA 2O8FB 2RI0A 2EKLA 3BC1A 1KYTA 1Z5VA 4HF7A 4F0JA 5JJIA 3BXFA 4BRUA 1IL0A 4W5OA 3QEMA 2ZJ0A 5DTJA 1OZGA 1EZ4A 2DFTA 3DZJA 5C4MA 3ETGA 1NI4A 5F76A 2QR3A 2AG1A 5K3BA 5CFZA 2R9VA 1T0HB 3I62A 3BSWA 3FGOA 3CF2A 3MMSA 5KVAA 3ZYLA 4W9MC 3L0ZA 2D4AA 3F5DA 5KNCH 3QVUA 3Q7EA 2C5GA 1DFHA 2FN7A 3K73O 4F71A 1UXJA 4PZDA 2ADMA 3VHXA 3QA9A 3HI6A 4JP2A 4OV6B 1TM7E 4C4SA 1AS3A 1UBHS 2Z2ZA 4JN6B 2VQFB 3H8JA 2BTQB 3H5TA 1Z4IA 1OJ7A 3RU3A 2ZUTA 2G1UA 1ID8A 3F9IA 4YNBA 2BKEA 5A3VA 2BEVA 4DX2A 1PGOA 2ZDHA 3JVUA 1CQXA 4O3FA 4QLAA 2V5UA 3WHLA 5ES4B 2HSJA 3Q7AA 2GAFA 1VHWA 3A6LA 1DB3A 1RPAA 4DBLE 1U5BB 2WG1A 3F6YA 3U60B 3U3XA 4WD3A 4IFTA 1FY2A 4NBSA 3KM0A 4OVKA 5K05A 5BYBA 4JI8B 1HC7A 1M6YA 3NWOA 1FUYB 3PQ3A 4I9NA 5CK4A 4AM8A 4BKRA 4NCXA 4DX6D 3PZRA 1ZG3A 3JVDA 1OKKD 2YNMA 3O2JA 3E34A 2CYAA 4PX9A 3FETA 1GPUA 4GNRA 5GONA 5KDLA 2VWQA 4OL0A 3UFXA 3CLUD 3WLPA 3FLMA 3DDWA 3BCUA 1M7BA 1TX4B 2EF1A 2VDPB 1ZU2A 1K75A 4ZO4A 4HI8A 1Q3KA 1YT5A 3USZA 4YV7A 5A5DA 4M1TA 4TL8A 2PUGA 3K2BA 3SQDA 3GCDA 3IQXA 4OFXA 2ZS7A 4RIFA 2DAPA 2P0EA 4I3GA 3RLFA 4JYZA 3TZLA 1BE6A 2L0TB 2B83A 1FP7A 4C2TA 1UJ4A 5DYNA 3MS7A 1UMKA 3P9YA 4HLDA 4AG6A 3AL0C 3TYXA 3Q40A 2HV8A 5AWFC 1HORA 4RH0A 1HFJA 2X58A 5LMZA 3AERA 1Z16A 4BX2A 3RRUA 4Y2RA 3ZKAA 2QW8A 1DQZA 2QTFA 4MWTA 2A78A 1YZQA 2PKEA 1N33B 1IPFA 3GJ3A 1QYIA 1L3BA 1B41A 3AQIA 4J49A 4GRAA 2I7CA 3U56A 3VR5D 3DCNA 4I4TA 1L6IA 2Z08A 2WXIA 1QRRA 4RDHA 5ENVA 5IJAA 1I36A 1ZJYA 4IHJA 1NWCA 1QVRA 2PQ0A 2ZCUA 4B4OA 3TE7A 1TW3A 4YCNA 1QFMA 1XVLA 4MIEA 4D2IA 5DNDA 4UM7A 1FRVA 4LSGA 3WDSA 1NXPA 1QHSA 1LTKA 3KJQA 3RYIB 2CUZA 3FWNA 4BAZA 2QVZX 3AVXA 3A6KA 3R3WA 1W87A 3T1NA 4DLZA 3JXJA 2VXCA 4YJ3F 4MDYA 4CL2A 3E3AA 1PC2A 4CDRA 2NTYC 3LL7A 4QUBA 1TVKB 1HL7A 2JHAA 4PZLA 4EELA 4MQ6A 4GKJB 1D4FA 4PINA 3SIWA 3KUUA 3NYWA 4M1EA 1NW4A 3LBIA 2JJYA 1HYHA 4QPCA 2QZ9A 4PZCA 3V4OA 3U3DA 5C3MA 3NIWA 3OQMA 2P9BA 3DLHA 2ZT5A 1E1KA 4RZ3A 3WK7A 4ALLA 1G41A 3AUSA 3P9RA 4P4SA 4WNGA 3HJUA 4PQRA 4BP1A 1U3UA 3WP1B 2JLQA 1CWUA 1XRSB 3OEWA 4PZUA 1NFIE 2AFIE 2JD1A 1PL6A 5FNZA 4ZIRB 2NW6A 3I0ZA 1E0AA 1GAJA 4DREA 3A1NA 1YS6A 2K87A 4JI7B 1JQBA 3MOGA 1YE5A 2IP1A 3GBPA 3MD0A 4AJ4A 1SD1A 3TWTA 5A7GA 4ZMSA 2PL1A 4I4CA 4XYMA 4ILHB 2BGNA 4F4IA 2IGTA 3CBGA 5C80A 2ZREA 1Z8DA 4D45A 1GYPA 1RU3A 3PEVB 5F1OA 3BBPA 3KS9A 3L7KA 4BO1A 3JYPA 4I1MA 2FI1A 1PQUA 1Z5SC 1GSOA 2QTBA 4P31A 5HF5A 4EFDA 2CNKA 3S7DA 1C1YA 2Q3FA 2ZRCA 3AONB 3GAMA 1J1ZA 1S8AA 1V11B 3GDWA 3N2KB 3OC0A 1WQ4A 1VFPA 5I7AA 3IEGA 5U4QA 1MGOA 1T2EA 1JEJA 4EBAG 1QYVA 5FBLB 2FHPA 3TD6A 2YYZA 3LY8A 4FA6A 2WSSD 1DWUA 4ZHSA 4A3VA 4II2A 2WD7B 3Q7QA 2PGAA 5CEJA 4AY6A 3BMNB 5B3JC 3IMCA 1DTWB 1E9RA 4JI1B 4LV8B 2BEWB 5CW1A 3U37A 4B5LA 4BYMA 2VIIA 4OJNA 4YRBA 5TQ0A 1E59A 2DQZA 4DCUA 3UPTA 4DT1B 3U16A 2Q3JA 5HG0A 2I2AA 2NZ2A 4MTCA 2I3AA 3ND9A 4D44A 1WHSA 1CS0B 3H5VA 3ND5A 3OIGA 4GI1A 1EX6A 2VEDA 3SNKA 3MLEA 4N8EA 3QLUA 4QLOA 3MIIA 3FU5A 1CERA 2HRDA 3FD8A 1ZKMA 4PQGA 3RSGA 3T1OA 1I7SB 1ATZA 1HNZB 5J40A 2AJLI 2O3SA 3PH0C 1QQTA 3AG4E 1ZUNA 2EATA 2WG0A 2H4YA 2QNBA 3EXEB 1Q6YA 4PR0A 3UH1A 1WHSB 1TQ4A 4Y1RA 4KVOA 5BW5A 4P4LA 1LQTA 5G0TA 5LZ7A 2I65A 1TAHA 3PGLA 4LSWA 1CRPA 1JQKA 1JMYA 2YJNA 4ZYUA 5AN8A 1EE9A 2D54A 2RDMA 3PVSA 3JVVA 3KBBA 4NJMB 3QVGA 1P8AA 2KHZA 4JOSA 3O94A 3M3PA 4ZEMA 3AR2A 4UHDA 4N7RA 4N3NA 1GRNA 2JHFA 2QQ5A 4PZAA 3ZJTA 1FP4A 5LCWJ 3O8OB 1OD6A 2VI5A 5K3FB 2APJA 1PV1A 2NO5A 3ET4A 3EVCA 5JAPA 1OB5A 2DGDA 4QG7A 4HDSB 1K6EA 1QE3A 1VKJA 2FX3A 2O7RA 4YCMA 1IB6A 1TNOA 1WPGA 2BKAA 3UCFA 4R2MA 1UM8A 2A5DA 2P2GA 3L43A 3QMMA 3TG8A 1QGOA 3ORYA 4TTRA 5JMPA 5E76A 5CLHA 5TQVA 3UUFA 5DYWA 3WJ7A 1A72A 3OCJA 5CT6A 4C7VA 1GGNA 1D2GA 1X7YB 2WILA 3KOOA 1M5RA 4CLOB 2CKDA 2FPIA 1JAIA 2GVNA 3OMLA 1LJLA 1ZQ1A 3ML8A 1K27A 1U6JA 3N75A 3OZUA 2I62A 2PSEA 1AQLA 1G60A 1P0IA 4QQKA 4HXIA 4DA0A 2QLNA 3N70A 5B1DA 1S5PA 3ZDBA 2J09A 2PFGA 1KGDA 2WP8J 1EINA 5DGHA 4CUJA 1GN8A 1P2DA 2FEZA 1NRWA 3C5HA 5THQA 3IAUA 3V4RA 4HV4A 3LT4A 2VNIA 3I73A 3KAJA 5BSFA 5HJ5A 3BMOB 1GRCA 4DLQA 4JJAA 2AMJA 4LXUA 1CUUA 3DMYA 1YZVA 4O4LF 5DTIA 2CZCA 1UBGA 3A58B 3FFTA 1KMHB 4P2GA 4HB4A 4J0FA 5BQOA 3UV3A 1Z63A 2ZRKA 5T7BA 1KOFA 5KYYB 1KEEB 3NT5A 3JCKC 2XUOA 5JO0A 4DMGA 3TXXA 4Z9XA 4LX0A 1AURA 3FMGA 3PKJA 4OJMX 4RHEA 1E3TA 521PA 1OU0A 2ZB7A 3QEKA 3WLLA 1B89A 4HT3B 3F8SA 1KMNA 1C80A 1YIOA 1P7PA 2P11A 2WJPA 3URKA 5AVRA 1OIVA 4PCAA 4FE3A 5K09A 4ZVKA 4KNWA 1DNPA 1TNBA 3HBJA 1JIIA 4YMWA 5I5EA 1XAGA 1YWGO 5A4DA 1SHKA 2NZVG 2J3DA 2GW1A 1KO5A 4CWAA 3PEYA 1GQ2A 2X5JO 4D4MA 1U2GC 4KUGA 5D51S 3HA2A 3LZCA 4IDBA 4URHA 1XNRB 4B93B 3VTAA 1H8ED 2RBKA 1PJ4A 2AOXA 4RPKA 2HEGA 2VA9A 4K0RA 2HBQA 3MK31 3SJZA 3UIEA 4BFCA 2ZVJA 2VSXE 4KC0A 4P54A 2VP4A 3VR2A 4CMAA 4IXTA 1P9LA 5E6UA 4QVGA 1SUAA 2VUSA 2YFQA 4KZCA 5C8YA 4I1OB 4DIDA 4BLUA 5I45A 3I5XA 2R6CA 2H85A 3NKFA 3MM4A 5IK2A 3QTBA 2GZHA 1S8NA 3MWDB 1E9DA 3ZTYA 4O4JB 5C8ZA 4GXQA 2XE7A 4WGGA 3R09A 1NSFA 1DKPA 3FSGD 4HFNA 3FMFA 4RY9A 2VTEA 4MLDA 1V4VA 1OC4A 2NXWA 4XSHA 5DVZA 3WLTA 2IP4A 4F86A 1W36B 1HQKA 1U0TA 1U80A 5ED0A 1JJIA 2ATXA 2PRZA 4JL6A 2PJRA 1A4IA 2ZITA 3E70C 3ULYA 3R44A 1RAFA 3DGEC 3AUJB 3R3HA 5AHRA 3TLKA 3UKOA 2OFWA 1XX6A 4LE1A 2X8AA 2QV7A 1OI4A 4P7FA 5L3ZA 3RK4A 2D5CA 1DSSG 4XJSA 2I3BA 3ZU5A 1NP7A 4KWIA 2AYXA 1E7UA 4JEIA 4K3UA 1ESZA 2I80A 2EJWA 5J90A 2X1MA 3O91A 2RBEA 4UD2A 4CLEA 3ER8A 3O9ZA 4DWJA 5I9IA 1FJGB 2NAPA 2R4QA 4EQ6A 3KXLA 4FYYA 2ZSUA 3FB1A 4JT2A 3RCBA 3ZE2B 4UHBA 4YB8A 4NQZA 2EIHA 2HPHA 1WDTA 4J6FA 4EJ6A 1CZLA 3AUUA 1ZVMA 4IGAA 3AXSA 3FUVA 1XZNA 5MF6A 1N75A 2XUPA 3RSOA 2HPZA 1BE1A 2OCAA 3EY4A 3IHKA 5HCUA 5IDXA 2QTVA 4NF2A 1E4EB 4IDQA 2IKSA 3JPYA 1JEAA 2R47A 1NQVA 4LW8A 4C0WA 2VJKA 4B3DA 1JG1A 3WRYC 3EJWA 1UEXC 1VG1A 2IPNA 2A92A 4O5AA 3VKGA 4FJ1A 4D3ZA 3IIIA 3HEMA 1QG2A 1TZJA 3RRNA 4EKNB 1XI2A 3FNRA 4MVXA 1YQWA 3T35A 5H1YA 4F8YA 2O2SA 3KXKA 2YWXA 1XWFA 3LX8A 4S35A 4OYYA 1K7EB 3QVJA 4C29A 1WKVA 4MV5A 1C0EA 1SBZA 2CHGA 2PXCA 4K9NA 4ND8A 1R0YA 1R16A 5EJIA 2F8YA 1DV1A 4GP7A 3QVMA 5HUJA 3KWLA 1VE5A 1KDTA 1LD8A 1YZUA 2JH8A 3EIQC 2AJDA 3UENA 1YZKA 3I52A 3MCUA 3L9WA 4Q9JA 3H2HA 1Q5PA 3JARB 5P21A 3T5AA 4LTNA 4YRSA 2Q0SA 3UJHA 3D5TA 3TFWA 4HP8A 3OFKA 4M54A 3TI9A 2FVXA 1F0PA 2VTKA 1BNCA 1UJ6A 2IX9A 2V98A 2OV8A 3BB3A 3ESAA 4I50B 4RGVA 1EVLA 5F7ZA 1D9XA 1HDXA 5HIIA 2ETVA 2XOKA 1IN8A 3G8YA 3A1VA 4WY8A 1C1XA 4KQHA 1I94B 3F96A 2PZFA 4FLMA 1VJ1A 1TE2A 3EXEA 1MZCA 2NZYA 4AI6A 3S81A 4M1MA 2PGJA 2OAQ1 2V6BA 2Q1SA 2D2XA 3QKUA 1QQBA 3UXEA 3GLGB 2XCRB 3HXEA 3P9NA 2NNLD 3QJGA 2QAGC 4L02A 4YQEA 3ZX5A 2XQFA 4RHXA 5AW8A 1J2TA 1BWPA 4NHOA 3LQRA 2HRZA 3IDAA 4BO7A 3QGMA 1AGRA 1DZIA 2ECFA 5AQ1A 4HDOB 4B47A 2YKGA 1NU8A 4ZQEA 3WISA 4EYEA 2WUWE 1E7SA 1BH2A 3LS8A 3KSDO 3U3KA 3WGKA 2P9UG 3UA4A 4Q3OA 5FI5A 1Y3AA 2BP7B 4YP5A 3T06B 3O73A 2C07A 5EC8A 2O8EA 3EGCA 4GXTA 5JFTA 3E03A 5C46F 3LVBA 2FFHA 1E9VA 1BDJA 3DMTC 4L5IA 4UPVA 5KQPA 3C2QA 3Q9NC 4LOKA 2DTEA 5CFLA 1DG3A 2Q2QA 4D0LB 2PGOA 4EJSB 3CX6A 1YB5A 4MARA 2OB1A 3OTGA 5EZSA 4IKEA 2LCQA 4H7JA 1WZUA 1EDDA 4EKGA 3ME5A 4C4PA 5KKNB 3GLHE 4HB0A 1AC5A 2XWPA 4KFUA 3I28A 4DGSA 1Z18A 2BSQA 1JFRA 3WIVA 1HT2E 2YHIB 2Q8QA 4PC7A 1CNEA 1C0LA 2M6KA 1BI8B 2VZLA 3D9JA 2B0CA 3C5WP 6Q21A 5BR7A 2NUTA 2Q6KA 3IAEA 4FDUA 4U3JB 1Y4UA 5KOHB 4R68A 3GZNB 4HAIA 4WTOA 4EPXA 1TMYA 1HZJA 5AVUA 3V1LA 5BSEA 1LBQA 1DQPA 5ICGA 3B1XA 5DHQA 5BWCA 4YXFA 5KTNA 4D8UA 4PZYA 3D8TA 4ZRNA 4JYBA 5AOAA 4CKXA 3LUFA 2HPVA 2GFQA 2XT6A 4J2OA 4R31A 1VI6A 1XWWA 1A8SA 4COKA 5IF9A 2J5QA 4X1OA 2DCUA 3W6ZA 4CNQA 4JHKA 2GEJA 2JCSA 2JLSA 3R6WA 4JX9A 1J9ZA 4M6WB 2C84A 4OU4A 4WWOA 4RC9A 1HX7A 1FX0B 4NAVA 5CT5A 5DXJA 3O92A 4J0HA 4LECA 1VPWA 2QMHA 2QZJA 1DJQA 2CZQA 1O94A 2YVLA 3ELBA 3HWSA 4X97A 2XDWA 5H80A 4TTVA 1PJSA 2Y0PA 4R84A 5FJIA 5EHNA 3WWZA 2VJQA 3ZGQA 4MVJM 2Y4TA 4PIMA 4EO4A 4DKJA 4OAUC 4ZEVA 3RKVA 1KYYA 1N3YA 1P0CA 2WTXA 3EDCA 2W71A 1C3LA 1GRVA 2H7VA 3PR2B 1EK5A 3HH8A 1PJQA 4KMSA 2AS0A 4XYBA 5AO9A 3WO0A 2B1IA 2XT9A 2RHCA 3LCRA 2WM9B 1JDSA 3AW9A 2ZYGA 1M76A 1IHGA 1EFTA 1RM4A 2ODBA 3JXEA 1EZ1A 1E1LA 1G7SA 1LPOA 1RKQA 4G56A 2RFAA 2YJ5A 5JROA 4Z4QA 2CDNA 1NURA 3IVXA 3OFVA 2YUIA 4UBNA 5K5EA 3LEWA 5FA6A 3EISA 2I55A 1ZBDA 2ASEA 2OESA 3VNSA 5H16A 4AJJA 3PIIA 3M6WA 1CUVA 1CR6A 3II6X 1TM5E 4GX1A 4IDCA 3AI3A 3VKFA 1SQMA 2J1LA 3LXRA 4O4IB 4ZTZB 3CLTD 5EMNA 1N2ZA 1C4WA 4L8VA 5KJMA 1JA0A 1Y98A 4J2HA 5ITZB 4ARUA 2DY0A 1CP3A 2YHAA 4EJ0A 3CQ9A 4GKKB 4RPJA 4ONEA 4WESB 4RZIA 2EWMA 4ZP1A 3FPAA 3UAYA 4C2AA 4R0MA 1LBTA 1WUIS 2D3TA 4EUNA 1HETA 3H75A 2BISA 3X1MA 2NSZA 3INNA 1VOTA 4CL3A 4ZYXA 2JLYA 3O2QB 5CCBA 1B6RA 1YE8A 4FSDA 3RRNB 1Z5GA 5KYGA 2FP4B 4CR7A 4GE0A 2H65A 4HYQA 4UKDA 4OAPA 1NU6A 4E03A 3G8DA 3A6ZA 1U1GA 2JC3A 3V8NA 1WXWA 1QO0D 4B8CB 2I91A 1YB1A 4FQ8A 4UM9D 4E31A 3UF0A 3ZIMA 1WR8A 4FGUA 5EZYA 3PEFA 4MS6A 4S04A 5GADl 2RGRA 3HB9A 3OJEA 4E15A 1Z45A 3TUIC 3GCGA 2H18A 3GRAA 2ID8A 3DDHA 4WVLA 4KK4A 4QXRA 4F7DA 5B4UA 4ATNA 1G5RA 2JFNA 4IOLA 3FSGA 4JJ8A 4Z9FA 3BU8A 2HI0A 5G1NA 3OXFA 3IHLA 4WT7A 3GQBA 4MROA 5AM1A 1WW3A 3RIBA 4BASA 3L7DA 4P58A 2PUCA 3BZBA 3T7DA 4ACAA 3DOJA 5ALQA 1GQYA 1E9EA 3OZTA 4GB9A 1UBLS 4L9RA 2AZDA 3OMXA 5FLKA 4EHKA 3BN3A 1KI2A 1M2NA 2REOA 3KTFA 4JQSA 4PGMA 5EINA 2C2ZA 5BN1A 1FU8A 3J81k 3NVKI 3K9GA 5AXDA 2E48A 4FKZA 4HVCA 3REGA 5FBZA 3U4QA 1FNBA 2VYNA 4F7WA 5KJFA 1CR4A 1ECPA 4Q3DA 3R9XB 2GO1A 1QGUB 2AXEA 4ZYYA 5JYCA 1UOPA 1L4HA 1XCBA 1ORRA 1PJBA 1ZP6A 2IP2A 4JVSA 2ZQYA 1FSPA 5JNUA 5DU2A 1DP4A 3V4SA 4IGKA 4DEVA 3OEHA 1QLWA 4HK4A 4HSEA 2OV2A 4JWTA 1D1PA 4V03A 4X44A 5B2EA 3CX8A 1EUYA 3FUTA 1ZC4A 2Q6LA 3HDYA 1X2EA 2Z6VA 4Z9YA 4ZVRA 2WAXA 3RAUA 4JX8A 2NVOA 4EABA 2YXBA 3KWMA 4K81B 5SV2A 5DN6D 3H04A 1OWLA 3BF7A 1KK1A 3EGOA 3G6KA 2YN0A 3DMPA 1R12A 5TDHA 1JVBA 2WU1A 3G8CA 4KQCA 1T29A 3NDJA 4IV5A 4A23A 5B7GA 5L6MB 4M2LA 2P5UA 5L53A 4B46A 2BMDA 1THGA 1U2ZA 2WXPA 2PAAA 2YWEA 2AKAB 2WDPA 3B1WA 3DRAA 4FJZA 5DHTA 5EP4A 3SNHA 4A0QA 2X23A 1JIKA 4G84A 1BMQA 1TL7C 3NASA 5I8PA 1BFKA 4PV7A 3V2UA 2WWTA 1E3DA 3KKEA 4JUFA 4Y2YA 5F98A 3FPSA 2UYHA 1G9SA 2EP8A 2EX0A 3RIXA 5IKOA 1EK0A 1N2SA 2GZRA 2PQ2A 1E5TA 3O1LA 2V5QC 4WEQA 2UY1A 5JCJA 2EWWA 1K7XB 3F8WA 2FULA 3IVAA 1N6HA 2ODAA 2DWQA 2I7VA 3RJ5A 4YMTA 1QZ2A 1C9KA 4F6RB 5KJCA 3MYYA 1ORVA 4QDZA 1W0KA 4G1CA 3IODA 4RY2A 3SBEA 3LO5A 5KNBH 4MUBA 2DQKA 3OPQA 2PDAA 3WMEA 4BNYA 1XZBA 1J33A 3ZDDA 4AWXA 1LS1A 1D4OA 5FT9A 1C9JA 3KFXA 3L7YA 2AN5A 3ESZA 1TAUA 1P2VA 1VSQA 3Q12A 2QHXA 5CU7A 3PNYA 3QXXA 3ZHEA 4R51A 3TW4A 2SKDA 4UCFA 2NUBA 4YCBA 2HLPA 5JD3A 1GAQA 2AOUB 4HDRB 5K0NA 4C9BB 3TK1A 1JVNA 4PLGA 2ILTA 2Z83A 1PO7A 1E5DA 4L4UA 3TJZA 5IPFA 1UOHA 1XYYA 3WLAA 3ZCPA 5C5CA 4C4XA 2Q46A 5BOSA 2OZVA 1ZU4A 3D0QA 1VMEA 2RK3A 2XCLA 2DJIA 5KWSA 3HXQA 1OH7A 2XZLA 4E2YA 3FU0A 3MTIA 5F9FA 3FUMA 1L7NA 3GY0A 1AIPA 3EVAA 2JFZA 4KXYA 1TJ5A 1OTXA 2P62A 1NWHA 5JD4A 2ZE5A 4GP9A 2G80A 3V2GA 1DG1G 2ZPUA 1QNFA 2Z4RA 1NYRA 3EHMA 2IC5A 2PZJA 3HG7A 3IAAA 2B37A 1OCRE 3NHAA 4CR6A 2DIWA 5LJLA 2FZ4A 1O94D 5LZ4A 4WBSA 3HWX1 3IBCA 1AM4D 5ADHA 3INYA 5E4FA 1JSRA 2JHGA 1YDHA 2YHSA 4B84A 1YRAA 4DCMA 4E5MA 3HL4A 3RQSA 5I9LA 3IBSA 1FW6A 4ZK2A 4QU5A 2TMDA 4O1HA 1ADBA 4CCAA 5E6SB 1W47A 4ZHQF 1LF5A 1UDBA 2G9RA 4DTCA 5ABPA 1VPLA 4OLHA 4AY5A 1OCOE 1USKA 3A6GA 4HUQB 5E0KB 2W9XA 3F9CA 3EU9A 2CLMB 1LBHA 4NSNA 1XP8A 3ZGYA 4BNJA 1SVMA 4L6AA 3B2NA 4PBSA 2WXQA 3E4DA 1DTSA 3FLEA 3MJFA 4D6PA 1TLTA 2GK4A 1ML3A 3A4NA 3BGVA 3NC4A 4JLAA 1MXHA 4RE6A 3TCXB 3UV7A 3EGXB 2VHYA 4HWKA 3H9JA 1D6NA 1I6LA 3FVWA 5F2KA 3H6HA 4YT2A 2C77A 1Y5NA 2QS9A 3ASOE 3AEXA 4RHCA 2HPAA 5K03A 4DV5B 5K8CA 1HT1E 2OCKA 5F4ZA 3SXUA 1U8XX 4YY3B 3I37X 10MHA 2VCYA 3EQZA 2A3RA 4TSRA 5JVDB 1X81A 1XBTA 3LX5A 4ZWNA 3B8HA 4NARA 3VO9A 1QU3A 4GZDA 3R7NA 1QGZA 4APFA 3JUIA 1SXIA 4R2KA 1WXFA 5ALTA 3QNKA 3BWBA 2PBZA 2AN9A 1H2RS 2Y3IA 1L5KA 5A7FA 3C98A 1YZ3A 4E08A 3D6UA 4IHJB 4BTEA 2ONKA 5J4VA 1KC1A 3SMQA 2EARA 1E66A 1JIXA 2CEKA 1NDHA 2GBLA 3OQVA 3X2FA 2N42A 4KQJA 3S2IA 4Z54A 2R85A 5E7QA 1Y3IA 4MW1A 1OGYA 3CLKA 2HA2A 4NH4A 4WNAB 1XA4A 3JZDA 5AK3A 2W2QA 2ZI5A 2R5WA 5AI6A 2LUHA 5FR2A 3RH0A 1IBLB 1W8DA 1YJCA 1A71A 1R6DA 2JI8A 4GTSA 4YJ2F 1VYHA 2WLSA 3FGPA 4Y0AA 5LA6F 2FQWA 2E18A 3UMSA 4BFTA 1RS0A 2GBPA 3G9UA 4N39A 3PFNA 3UZUA 4JHLA 1C9EA 3R8FA 1FS4A 1EFPA 3AM4A 3QX9A 3C3PA 5BN4A 2I2CA 1Q0HA 3FJ1A 3BERA 4N4AA 1CJMA 2VDWA 3R4VA 5DB4A 3VUFA 4Q3EA 3U0BA 5LQCA 3NAMA 3DFKA 2BW0A 3BD6A 2GCOB 1AHNA 1YKGA 4TXNA 4F4HA 3CKLA 1W5EA 4HH1A 4IW3B 4KK3A 3EQ6A 3WWPA 4D81A 4ALJA 4OK5A 4OXIA 3EEIA 4R0VA 5L95A 3K6SB 3T3DA 4OGWA 2F3SA 4UDXX 3I6YA 4IYJA 2R00A 3AIIA 4AMGA 4B32A 4OQNA 1N2CA 1SRQA 3EEQA 1KO1A 3FHEA 2OXEA 1KH3A 2C57A 1L9XA 3JALB 4E13A 4O2AA 4NFSA 4ZVQA 4KRGA 4FE4A 3KQWA 1A2OA 3H6KA 4FFBA 4GMFA 3D7KA 4O6VA 1X74A 2PZMA 5AHWA 5DK6A 5EWMA 4UTXA 1OFIA 1Q19A 2R2AA 4LHZA 2VBFA 1Z47A 1O97C 2BGUA 2IV2X 3SZMA 4BX3A 2XB2A 2ID4A 3RUAA 3E37A 2V9PA 2X6TA 2GYVA 1LRLA 3CR3C 3KXIA 3M0EA 1CPYA 1VLLA 5EMJA 4BNZA 5J4HA 5JZMA 4JA2A 3TW0A 1P2SA 2J3IA 2QUBA 1II8B 3PQ7A 4KN9S 5EWMB 3GN2A 4IX9A 4BQNA 1N2EA 3Q5DA 5JPIA 3L8ZA 4PYJA 4OB8A 1OYOA 1A27A 4BFSA 5J2UF 1AK9A 2XENA 1MORA 4YA6A 5EOVA 3W5VA 2NM0A 2MSWA 3AVVA 2IT1A 2MYNA 2UZ1A 2ZT7A 3TQIA 1P1IA 2LXMA 1CF2O 1TTQB 2GJ4A 3QFFA 3ZHSA 2ZRMA 4Q7JB 3WTCA 2HCTA 2Z1NA 1X19A 4JJIA 1XZEA 4RX1A 2D1YA 4MVWA 2YS7A 3BXPA 1X92A 2W37A 4KQIA 4MUEA 4A2CA 4EDFA 1E9AA 1OPRA 4NFHA 1SKAA 4BZPA 5F7XA 1WZ2A 5K3SA 3AEQB 5IBRA 1NVEA 3ZKJA 1TNYA 1CZRA 1T4CA 2Q4DA 4MYTA 4EFLA 4GFDA 5FD8A 2ALJA 2ZUSA 2VLBA 4OHFA 3PFWO 4QUKA 4X6LA 1NVAA 4B74A 1WNFA 2H8KA 1XHFA 3PF8A 5BVGB 2YYAA 3SJ7A 4JSTA 3ZY6A 2ZIRA 1OXXK 2P90A 2PWPA 3BWCA 3HHPA 4Y2HA 2CNBA 1A9PA 3BAFA 4X91A 3VSDA 4GIBA 3FPBA 3ANSA 4KU4A 4GYYA 3SSAA 2JCYA 4W5QA 4I2WA 2QX6A 3MT8A 1QFYA 3TTUA 1QG0A 1GKYA 1AS2A 2AE2A 3RU0A 3PSAA 4TV8F 3R7WA 1ZIDA 1X3LA 4HLUA 5CLQA 4OQYA 3GU3A 3UYLA 4JJEA 4ERXA 2OCCE 3L4BA 4IUCS 3SEQA 3U61B 1NT2A 1ZM3A 3I23A 4CT4A 4TV3A 1KY3A 3LPLA 3BUAA 5ER9A 3IP8A 2Q5FA 1BGWA 2FOLA 3CXRA 4HS9A 3SC2B 4I2ZA 5DYIA 2QE7A 3LD9A 4XKBA 1ZPDA 1OVMA 3B38A 4M36A 4G9EA 5FOQA 5IHXA 2FSGA 4NOMA 3ICQB 3BXEA 1F60A 4L85A 3HMQA 5IDWA 3ABOB 4G11A 2I8LA 2IL1A 4GGMX 2GBLC 2CMFA 3V4VB 3FH8A 2HQRA 2PGIA 4MICA 1XDSA 2B69A 2FEWB 4RNCA 3ZU3A 4OP3A 5GAJA 3ZW3A 2QT9A 2RKWA 3VYRB 3GLHA 1TMOA 1LPPA 1I2AA 3H2BA 4NG4A 2HADA 2G5GX 5KS2A 1V9SA 2J6HA 1QBGA 1KH2A 2DBAA 3KT6A 1BQ3A 1MA3A 3DLPX 3T4UA 4D8YA 4X65B 4R9RA 2XSZA 3ESQA 3T5MA 3PEUA 4EHIA 1XMSA 3LLCA 4R40A 5DTRA 1S2OA 2AI3A 5JAQA 1ECBA 2O3JA 2QGZA 3A10A 4KTVE 5J2TF 5CD1A 3PC2A 1YZGA 3QIAA 3H05A 4MPJA 4HHEA 1ATIA 2AN4A 3B6EA 3DE0X 3K9CA 5MDHA 1ZESA 4DR2B 1UP6A 5CVTA 2ZJ3A 2IXAA 2J4BA 4BETA 1MX9A 3KJNA 4Q3LA 4V0RA 3THYA 3ZJVA 5CBPA 2RBGA 1V54E 2NO4A 4AK9A 4M88A 4QGAA 4TS9A 3R7BA 4PBRA 3V4ZA 2AIRA 3GAAA 4BN0A 5AVXA 4U2CA 1BJKA 1IM8A 3H1TA 3D6TB 4QUEA 5GJBA 4AURA 1QYCA 3ILXA 4F1SA 1RSZA 3JTEA 3BWVA 5KSZA 1CSEE 1EXDA 4ND8B 3JD0A 4A1GA 1EFLA 4NU0A 3ZWWA 2NGRA 3VO1A 1PG2A 2AFHA 1OBHA 4O29A 1AGYA 3KYDA 3OJXA 4FYKA 2GD2A 2YINC 2B1QA 2OGSA 1PBTA 2G4CA 3Q9UA 4FYIA 3LOQA 2VDOB 1QGAA 3PK0A 5E6UB 2BLLA 1T4MA 2NVUA 1DUVG 1X1AA 4Q9IA 4LWZA 4TX1A 3IQGX 3ZDYB 3CF0A 3QVXA 5FA8A 2V6FA 2MWMA 5ARGA 2VPQA 5KNCA 1I4TD 5T4EA 2HRCA 3D9QX 4RKFA 3L13A 1GU1A 1JHVA 3JYHA 4D56A 4TWIA 2VJMB 3O4GA 4N48A 1J8YF 1IDN1 2ENUA 2I2OA 3QLJA 5EHGA 1EFVB 5IANA 2PMKA 2RH5A 3ONFA 3E8XA 1ISFA 1GARA 2I2WA 2RGYA 2RH9B 3CX3A 1ZEMA 2FR0A 2AEFA 4LDAA 4YIKA 2R3SA 1JECA 3RS0A 3K6KA 1NA3A 4TXRA 1U2SA 1UEIA 2CLSA 1QORA 3OFJA 4PTZA 3CB4A 4H7IA 4UI9C 4D8XA 4FYVA 4I5IA 2XYQA 2JABA 1YUBA 3H5NA 4YUVA 1NF8A 4WOJA 1KK0A 2QI9F 5B6PA 1WF6A 3QKWA 2X3UA 2XD4A 5EMHA 3FKSA 1B93A 1X80B 3WAJA 2GD0A 2FOIA 2QGFA 3Q5MA 4CF6A 3PUKA 1QIMA 2JCVA 2QUAA 5C1DA 3COYA 4N7MA 2O20A 3W5HA 2QD1A 3SHFA 4HX9A 4DMKA 1W35A 3C7DB 2IVFA 3T8YA 4PG7A 4BGVA 3CGHA 2BN4A 1H05A 2JDID 3RHFA 4UM5A 4UOEA 1XRRA 4K9RA 3DSSA 5EAIA 4K5BA 2BMWA 2L69A 3PDNA 2ODTX 4JJKA 3SZ3A 1HFEL 4YJGA 2Z5VA 4D3SA 2B36A 1WDMA 4LNBA 2XB8A 3C1AA 3D81A 4G2NA 4TMYA 3NZSA 1CUGA 4OHZA 2PKCA 3AUKA 2E49A 4WAFA 1ZO8A 4TXMA 1H4QA 3VR4A 3N2ZB 4OUKX 1Y42X 5GOTA 4HQOA 3KSZO 4XQEA 4PLVA 3ICOA 1RLIA 4BOYA 4KXKB 3DFZA 5AKIA 3H8SA 2KLHA 4JLNA 4I9FA 3SPXA 1HO3A 1LTQA 1RMYA 2FWNA 3UK0A 5KKCA 2DOKA 2PV7A 1A5AB 1BQ4A 1LQ2A 4K9PA 5AKKA 3T3IA 1Y1SA 2VPZA 4DR5B 1XQ6A 3BTUA 4X8HA 4JOBA 4PLCA 3VPHA 4CKCA 1JSZA 1RRMA 1YDFA 2PKRA 5AUPB 3B3AA 3KQTA 5HIKA 4F4JA 1XRPA 1S2DA 3H3JA 5EYPB 4MEAA 1H9CA 3TLGB 4LRUA 4TRRA 1WV1A 3OO0A 3HACA 2YN4A 2WJWA 3BAZA 1HEYA 1IATA 1E7WA 2ZCVA 2YHEA 5JJ5A 2ZB4A 4PLYA 1K4KA 2W6JD 3DBIA 5G05C 4WJZA 4QEZA 2EU8A 4WNYA 3ASZA 1FS6A 1E77A 2YVUA 4MSUA 2FCAA 1EWVA 2BTOA 3T4PA 4E33A 1HYBA 2Q2NA 2JCXA 3ITDA 5FWYA 2P5TB 1J2YA 1PAQA 2AWNA 2IWRA 1IQUA 2ZBUA 5AUOB 1U8EA 2P9YA 1RM5A 2Q4EA 1MQAA 3MNFA 1Y82A 3ZKWA 1CDZA 3D4OA 3LHFA 4YP0A 1DC5A 2ZXUA 4W8GA 4FD2A 4OYHA 3RBZA 4JYMA 3GLIB 4EPWA 1IOLA 5CA1B 5KINB 4LDJA 4EZLA 2P9EA 1QQ5A 2L2QA 1VGQA 4RSYA 4JUIA 2CXHA 2GH1A 1E5QA 4KB5A 5FHQA 1WSBA 2WF5A 1IBCA 2X9LA 7MHTA 3K31A 1H2BA 1KJWA 1TUBB 3N8GA 4B3HA 5ICSA 3AM1A 1P5ZB 4JKYA 2D7JA 3PJDA 4LOHA 1YXMA 1RHKA 2P58C 2O1XA 2Q1UA 3AFHA 3O5AA 3SHVA 4BAUA 5IZ4A 1Q11A 1RYNA 3BZUA 2CHWA 2FP4A 3I2GA 3OPXA 4M1YA 3AJDA 4GYOA 4R2XA 5DLDA 3OX4A 2IYFA 3ULKA 5F1KA 4HTFB 4TMTA 4N5NA 3CZ4A 3A8TA 3FUCA 1S64A 1LSUA 2JD2A 3LY5A 1VL1A 2DPGA 5K0ZA 1EWYA 3PE3A 5KNHD 2XNSA 1CB7A 3BREA 3KZ1E 4FYJA 1QF6A 4CCYB 3FUEA 4K6KA 5IXSA 3OZCA 4Q9LA 4R4JA 1XZPA 5KOJA 1L5HB 3O83A 4LOIA 1NZDA 3GD5A 1YUNA 3PDWA 2B4TO 3UWSA 4F1PA 3M2PA 4RA6B 3JQFC 1Y4ZA 1R0KA 3BUSA 4I5EA 1X70A 4OCZA 3KQQA 4PHGA 5FFFA 4EQ6B 3UAZA 5JBQA 2DYRE 3R7DA 4EHHA 5IEJA 1MXFA 5CBPB 3CIFA 1ORDA 1FVXA 1QH9A 1ZI8A 4PYLA 2OZLA 5AK6A 5LB2A 4QBHA 3T3HA 3ANMA 2A84A 4QUAA 3HLKA 1H69A 4RLSA 3ZU6A 2OQVA 1IM5A 1CEYA 1WMBA 1E6CA 1YQEA 1MNQA 1XN1A 2DUWA 3KPVA 4HH3C 3MWKA 1WY7A 4G97A 3OBIA 4I0WB 5EZ6B 4M86A 2X41A 1ZOOA 2V6IA 2Y0DA 5ELMA 2OCPA 3LPCA 3P0FA 1ZCAA 1LV8A 2UUBB 4FZRA 4NBVA 4CTNA 4TLEA 3TSWA 1AKWA 2ZEJA 4F1JA 4RADA 3JS5A 5JCPA 1O9GA 2QLJA 1E0SA 2JFPA 5LDDC 3PG5A 4BESA 4D0RA 5JSFA 1KFJB 5CB4A 3DLIA 2NP6A 4TGLA 4Q9AA 1OU4A 1ZD4A 3NLLA 5LN1A 2WWX