3PUTA

Crystal structure of the cert start domain (mutant v151e) from rhizobium etli at the resolution 1.8a, northeast structural genomics consortium target rer239.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
150
Chain Sequence
TTRSAEHTTFVIERRLTAPVARVFRAWSTPESKRQWFACHVPLEYALDFRPGGTERNYTADTDGLLHAYDARYIDIVPDTRIIYAYEMKLGQTRISASLVTVAFDVEPSGTRMVFTEQVVFLDGYGDNGARLQGTEIGLDNLELFLVRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein
publication title Crystal Structure of the CERT START domain (mutant V151E) from Rhizobium etli at the resolution 1.8A, Northeast Structural Genomics Consortium Target ReR239.
rcsb
source organism Rhizobium etli cfn 42
molecule tags Structure genomics, unknown function
total genus 41
structure length 150
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3putA00
3NMNA 2REZA 2EJXA 3NEFA 3TVRA 4QIPA 4BKCA 1XUVA 2E3QA 2E3PA 3H3QA 1T27A 3Q64A 1LN1A 4XRWA 4Y31A 4A88A 5E4MA 3NI8A 1H2OA 2L65A 2M89A 4A81A 5BRLA 2E3RA 4PSBA 2N4BA 4LGBA 2IL5A 4REHA 3KL1A 2QIMA 2L8OA 2L9PA 5JO2A 5E4BA 4A85A 2LGHA 4A8VA 3NS2A 1ICXA 3OH8A 1TXCA 3ELIA 4LGAA 2I9YA 4A87A 4BK7A 2K7HA 2A1LA 2KTEA 4REJA 3KB0A 1LLTA 2RERA 3NJOA 1XN6A 3C0VA 3W9RA 4LA7A 5E4DA 2PSOA 4N3EA 3W9KA 2VNEA 3PU2A 4JDAA 3H3TA 5JO1A 1IFVA 2LCGA 2GKDA 2K5GA 1UW5A 3UIDA 2LPXA 3F08A 3P51A 3QSZA 4IGWA 4MNSA 3ZVUA 1B6FA 5E46A 3KDIA 1FM4A 4IGYA 3IJTA 3NJ1A 4Q0KA 1FSKA 4IHRA 3RT2A 4A80A 3NMPA 4C9CA 5C9YA 4BTZA 1BTVA 3KAYA 3KDJA 2E3MA 2MOUA 4MA6A 2N4AA 1JSSA 2E3SA 4DSBA 1E09A 2KEWA 3NJ0A 3RT0C 2LE1A 1Z94A 2FLHA 3TL1A 3WG8A 2FFSA 3Q63A 4DSCA 2E3NA 3JRQB 3QN1A 2VQ5A 4IH0A 2M47A 5JNNA 4IH2A 1EM2A 2R55A 3KAZA 3UJLA 4OICA 3K3KA 4GY9A 4M9BA 3RD6A 3H3RA 1KCMA 3R6PA 2LF2A 3NMHA 5I9JA 4R7KA 4A83A 1TW0A 2E3OA 4MAPA 3OJIA 4WVOA 4JHGA 4IGVA 1T17A 2Z9ZA 3IE5A 3Q6AA 4A84A 4A86A 1BV1A 2Q3QA 4BK6A 1LN2A 2LDKA 3NMVA 4A8GA 2BK0A 4RYVA 3CNWA 3NEGA 4Z3LA 3E85A 4XRTA 3TVQA 3NMTA 4DS8A 2LEQA 1VJHA 2NN5A 1XDFA 1ZXFA 3K90A 3OQUA 3JRSA 4B9RA 2D4RA 2RESA 3FO5A 5I8FA 2KF2A 4C9IA 2Z9YA 3KDHA 3NR4A 5AMWA 3OTLA 4A8UA 2WQLA 4BKDA 1XFSA 2NS9A 3TFZA 2LIOA 3PUTA 2LAKA 1QMRA 3UQHA 1XN5A 3P9VA 4REIA 4C94A 2QPVA 2LUZA 4JHHA 3P0LA 4LG5A 1X53A 2PCSA 4JHIA 1LN3A 2KCZA 3KLXA 4M9WA 3H3SA 4JDLA 4FPWA 4N0GC 3GGNA 3KB3A 4IGXA
chains in the Genus database with same CATH superfamily
3HM9A 3NMNA 2REZA 2EJXA 4NCBA 3NEFA 3TVRA 4QIPA 4BKCA 3DLBA 1XUVA 2E3QA 2E3PA 3HJFA 3H3QA 1T27A 3Q64A 1LN1A 4XRWA 4Y31A 4A88A 5E4MA 3NI8A 1H2OA 2L65A 2M89A 4A81A 5BRLA 3F73A 2E3RA 4PSBA 2N4BA 3HK2A 4LGBA 3GL2A 2IL5A 4REHA 3KL1A 2QIMA 2L8OA 2L9PA 5JO2A 5E4BA 4A85A 3DLHA 2LGHA 4A8VA 3NS2A 3HO1A 2ZYLA 1ICXA 3OH8A 1TXCA 4JHYA 3ELIA 4LGAA 2I9YA 4A87A 4BK7A 2K7HA 2A1LA 2KTEA 4REJA 3HXMA 3KB0A 1LLTA 2RERA 3NJOA 1XN6A 3C0VA 3NQNA 3W9RA 4LA7A 5E4DA 2PSOA 4N3EA 3W9KA 4E6FA 2VNEA 3PU2A 4JDAA 3HVRA 3H3TA 5JO1A 1IFVA 2LCGA 2GKDA 2K5GA 1UW5A 3UIDA 4QCKA 4N47A 2LPXA 3F08A 3P51A 3QSZA 4IGWA 3GB4A 4MNSA 3ZVUA 1B6FA 5E46A 3KDIA 1FM4A 4IGYA 3IJTA 3NJ1A 4N41A 4Q0KA 1FSKA 4IHRA 3RT2A 4A80A 3NMPA 3GKEA 4C9CA 5C9YA 4BTZA 1BTVA 3KAYA 3KDJA 2E3MA 2MOUA 4MA6A 2N4AA 1JSSA 2E3SA 4DSBA 1E09A 2KEWA 3NJ0A 3RT0C 2LAFA 2LE1A 1Z94A 2FLHA 3GTEA 3TL1A 2FFSA 3Q63A 3WG8A 2E3NA 3JRQB 4DSCA 3QN1A 2VQ5A 4IH0A 2M47A 5JNNA 4IH2A 1EM2A 2R55A 3KAZA 3UJLA 4OICA 3K3KA 4GY9A 4M9BA 4NCAA 3RD6A 3H3RA 1KCMA 3R6PA 2LF2A 3NMHA 5I9JA 4R7KA 4A83A 3GTSA 1TW0A 2E3OA 4MAPA 3OJIA 4WVOA 4JHGA 4IGVA 1T17A 2Z9ZA 3IE5A 3Q6AA 3TVQA 4A84A 4A86A 1BV1A 2Q3QA 4BK6A 1LN2A 2LDKA 3NMVA 4A8GA 2BK0A 5EKQC 4RYVA 3CNWA 4N76A 3NEGA 4Z3LA 3E85A 4XRTA 4QDFB 3NMTA 3TGOC 2LEQA 1VJHA 2NN5A 1XDFA 1ZXFA 3K90A 3OQUA 3JRSA 4DS8A 4B9RA 2D4RA 2RESA 3FO5A 5I8FA 4KPYA 2KF2A 4C9IA 2Z9YA 3KDHA 3NR4A 5AMWA 3OTLA 4A8UA 2WQLA 4BKDA 2YH6A 1XFSA 2NS9A 3GL0A 3TFZA 3GOBA 2LIOA 3PUTA 2LAKA 4QDCA 1QMRA 3UQHA 1XN5A 3P9VA 4REIA 4C94A 2QPVA 2LUZA 4JHHA 3P0LA 4LG5A 1X53A 2PCSA 4JHIA 1LN3A 2KCZA 3KLXA 4M9WA 3H3SA 4QDFA 4QDDA 4JDLA 4FPWA 4N0GC 3GGNA 3KB3A 4IGXA
chains in the Genus database with same CATH topology
3HM9A 3NMNA 2REZA 2EJXA 4NCBA 3NEFA 3TVRA 4QIPA 4BKCA 3DLBA 1XUVA 2E3QA 2E3PA 3HJFA 3H3QA 1T27A 3Q64A 1LN1A 4XRWA 4Y31A 4A88A 5E4MA 3NI8A 1H2OA 2L65A 2M89A 4A81A 5BRLA 3F73A 2E3RA 4PSBA 2N4BA 3HK2A 4LGBA 3GL2A 2IL5A 4REHA 3KL1A 2QIMA 2L8OA 2L9PA 5JO2A 5E4BA 4A85A 3DLHA 2LGHA 4A8VA 3NS2A 3HO1A 2ZYLA 1ICXA 3OH8A 1TXCA 4JHYA 3ELIA 4LGAA 2I9YA 4A87A 4BK7A 2K7HA 2A1LA 2KTEA 4REJA 3HXMA 3KB0A 1LLTA 2RERA 3NJOA 1XN6A 3C0VA 3NQNA 3W9RA 4LA7A 5E4DA 2PSOA 4N3EA 3W9KA 4E6FA 2VNEA 3PU2A 4JDAA 3HVRA 3H3TA 5JO1A 1IFVA 2LCGA 2GKDA 2K5GA 1UW5A 3UIDA 4QCKA 4N47A 2LPXA 3F08A 3P51A 3QSZA 4IGWA 3GB4A 4MNSA 3ZVUA 1B6FA 5E46A 3KDIA 1FM4A 4IGYA 3IJTA 3NJ1A 4N41A 4Q0KA 1FSKA 4IHRA 3RT2A 4A80A 3NMPA 3GKEA 4C9CA 5C9YA 4BTZA 1BTVA 3KAYA 3KDJA 2E3MA 2MOUA 4MA6A 2N4AA 1JSSA 2E3SA 4DSBA 1E09A 2KEWA 3NJ0A 3RT0C 2LAFA 2LE1A 1Z94A 2FLHA 3GTEA 3TL1A 2FFSA 3Q63A 3WG8A 2E3NA 3JRQB 4DSCA 3QN1A 2VQ5A 4IH0A 2M47A 5JNNA 4IH2A 1EM2A 2R55A 3KAZA 3UJLA 4OICA 3K3KA 4GY9A 4M9BA 4NCAA 3RD6A 3H3RA 1KCMA 3R6PA 2LF2A 3NMHA 5I9JA 4R7KA 4A83A 3GTSA 1TW0A 2E3OA 4MAPA 3OJIA 4WVOA 4JHGA 4IGVA 1T17A 2Z9ZA 3IE5A 3Q6AA 3TVQA 4A84A 4A86A 1BV1A 2Q3QA 4BK6A 1LN2A 2LDKA 3NMVA 4A8GA 2BK0A 5EKQC 4RYVA 3CNWA 4N76A 3NEGA 4Z3LA 3E85A 4XRTA 4QDFB 3NMTA 3TGOC 2LEQA 1VJHA 2NN5A 1XDFA 1ZXFA 3K90A 3OQUA 3JRSA 4DS8A 4B9RA 2D4RA 2RESA 3FO5A 5I8FA 4KPYA 2KF2A 4C9IA 2Z9YA 3KDHA 3NR4A 5AMWA 3OTLA 4A8UA 2WQLA 4BKDA 2YH6A 1XFSA 2NS9A 3GL0A 3TFZA 3GOBA 2LIOA 3PUTA 2LAKA 4QDCA 1QMRA 3UQHA 1XN5A 3P9VA 4REIA 4C94A 2QPVA 2LUZA 4JHHA 3P0LA 4LG5A 1X53A 2PCSA 4JHIA 1LN3A 2KCZA 3KLXA 4M9WA 3H3SA 4QDFA 4QDDA 4JDLA 4FPWA 4N0GC 3GGNA 3KB3A 4IGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMN A;  2REZ A;  2EJX A;  3NEF A;  3TVR A;  4QIP A;  4BKC A;  1XUV A;  2E3Q A;  2E3P A;  3H3Q A;  1T27 A;  3Q64 A;  1LN1 A;  4XRW A;  4Y31 A;  4A88 A;  5E4M A;  3NI8 A;  1H2O A;  2L65 A;  2M89 A;  4A81 A;  5BRL A;  2E3R A;  4PSB A;  2N4B A;  4LGB A;  2IL5 A;  4REH A;  3KL1 A;  2QIM A;  2L8O A;  2L9P A;  5JO2 A;  5E4B A;  4A85 A;  2LGH A;  4A8V A;  3NS2 A;  1ICX A;  3OH8 A;  1TXC A;  3ELI A;  4LGA A;  2I9Y A;  4A87 A;  4BK7 A;  2K7H A;  2A1L A;  2KTE A;  4REJ A;  3KB0 A;  1LLT A;  2RER A;  3NJO A;  1XN6 A;  3C0V A;  3W9R A;  4LA7 A;  5E4D A;  2PSO A;  4N3E A;  3W9K A;  2VNE A;  3PU2 A;  4JDA A;  3H3T A;  5JO1 A;  1IFV A;  2LCG A;  2GKD A;  2K5G A;  1UW5 A;  3UID A;  2LPX A;  3F08 A;  3P51 A;  3QSZ A;  4IGW A;  4MNS A;  3ZVU A;  1B6F A;  5E46 A;  3KDI A;  1FM4 A;  4IGY A;  3IJT A;  3NJ1 A;  4Q0K A;  1FSK A;  4IHR A;  3RT2 A;  4A80 A;  3NMP A;  4C9C A;  5C9Y A;  4BTZ A;  1BTV A;  3KAY A;  3KDJ A;  2E3M A;  2MOU A;  4MA6 A;  2N4A A;  1JSS A;  2E3S A;  4DSB A;  1E09 A;  2KEW A;  3NJ0 A;  3RT0 C;  2LE1 A;  1Z94 A;  2FLH A;  3TL1 A;  3WG8 A;  2FFS A;  3Q63 A;  4DSC A;  2E3N A;  3JRQ B;  3QN1 A;  2VQ5 A;  4IH0 A;  2M47 A;  5JNN A;  4IH2 A;  1EM2 A;  2R55 A;  3KAZ A;  3UJL A;  4OIC A;  3K3K A;  4GY9 A;  4M9B A;  3RD6 A;  3H3R A;  1KCM A;  3R6P A;  2LF2 A;  3NMH A;  5I9J A;  4R7K A;  4A83 A;  1TW0 A;  2E3O A;  4MAP A;  3OJI A;  4WVO A;  4JHG A;  4IGV A;  1T17 A;  2Z9Z A;  3IE5 A;  3Q6A A;  4A84 A;  4A86 A;  1BV1 A;  2Q3Q A;  4BK6 A;  1LN2 A;  2LDK A;  3NMV A;  4A8G A;  2BK0 A;  4RYV A;  3CNW A;  3NEG A;  4Z3L A;  3E85 A;  4XRT A;  3TVQ A;  3NMT A;  4DS8 A;  2LEQ A;  1VJH A;  2NN5 A;  1XDF A;  1ZXF A;  3K90 A;  3OQU A;  3JRS A;  4B9R A;  2D4R A;  2RES A;  3FO5 A;  5I8F A;  2KF2 A;  4C9I A;  2Z9Y A;  3KDH A;  3NR4 A;  5AMW A;  3OTL A;  4A8U A;  2WQL A;  4BKD A;  1XFS A;  2NS9 A;  3TFZ A;  2LIO A;  3PUT A;  2LAK A;  1QMR A;  3UQH A;  1XN5 A;  3P9V A;  4REI A;  4C94 A;  2QPV A;  2LUZ A;  4JHH A;  3P0L A;  4LG5 A;  1X53 A;  2PCS A;  4JHI A;  1LN3 A;  2KCZ A;  3KLX A;  4M9W A;  3H3S A;  4JDL A;  4FPW A;  4N0G C;  3GGN A;  3KB3 A;  4IGX A; 
#chains in the Genus database with same CATH topology
 3HM9 A;  3NMN A;  2REZ A;  2EJX A;  4NCB A;  3NEF A;  3TVR A;  4QIP A;  4BKC A;  3DLB A;  1XUV A;  2E3Q A;  2E3P A;  3HJF A;  3H3Q A;  1T27 A;  3Q64 A;  1LN1 A;  4XRW A;  4Y31 A;  4A88 A;  5E4M A;  3NI8 A;  1H2O A;  2L65 A;  2M89 A;  4A81 A;  5BRL A;  3F73 A;  2E3R A;  4PSB A;  2N4B A;  3HK2 A;  4LGB A;  3GL2 A;  2IL5 A;  4REH A;  3KL1 A;  2QIM A;  2L8O A;  2L9P A;  5JO2 A;  5E4B A;  4A85 A;  3DLH A;  2LGH A;  4A8V A;  3NS2 A;  3HO1 A;  2ZYL A;  1ICX A;  3OH8 A;  1TXC A;  4JHY A;  3ELI A;  4LGA A;  2I9Y A;  4A87 A;  4BK7 A;  2K7H A;  2A1L A;  2KTE A;  4REJ A;  3HXM A;  3KB0 A;  1LLT A;  2RER A;  3NJO A;  1XN6 A;  3C0V A;  3NQN A;  3W9R A;  4LA7 A;  5E4D A;  2PSO A;  4N3E A;  3W9K A;  4E6F A;  2VNE A;  3PU2 A;  4JDA A;  3HVR A;  3H3T A;  5JO1 A;  1IFV A;  2LCG A;  2GKD A;  2K5G A;  1UW5 A;  3UID A;  4QCK A;  4N47 A;  2LPX A;  3F08 A;  3P51 A;  3QSZ A;  4IGW A;  3GB4 A;  4MNS A;  3ZVU A;  1B6F A;  5E46 A;  3KDI A;  1FM4 A;  4IGY A;  3IJT A;  3NJ1 A;  4N41 A;  4Q0K A;  1FSK A;  4IHR A;  3RT2 A;  4A80 A;  3NMP A;  3GKE A;  4C9C A;  5C9Y A;  4BTZ A;  1BTV A;  3KAY A;  3KDJ A;  2E3M A;  2MOU A;  4MA6 A;  2N4A A;  1JSS A;  2E3S A;  4DSB A;  1E09 A;  2KEW A;  3NJ0 A;  3RT0 C;  2LAF A;  2LE1 A;  1Z94 A;  2FLH A;  3GTE A;  3TL1 A;  2FFS A;  3Q63 A;  3WG8 A;  2E3N A;  3JRQ B;  4DSC A;  3QN1 A;  2VQ5 A;  4IH0 A;  2M47 A;  5JNN A;  4IH2 A;  1EM2 A;  2R55 A;  3KAZ A;  3UJL A;  4OIC A;  3K3K A;  4GY9 A;  4M9B A;  4NCA A;  3RD6 A;  3H3R A;  1KCM A;  3R6P A;  2LF2 A;  3NMH A;  5I9J A;  4R7K A;  4A83 A;  3GTS A;  1TW0 A;  2E3O A;  4MAP A;  3OJI A;  4WVO A;  4JHG A;  4IGV A;  1T17 A;  2Z9Z A;  3IE5 A;  3Q6A A;  3TVQ A;  4A84 A;  4A86 A;  1BV1 A;  2Q3Q A;  4BK6 A;  1LN2 A;  2LDK A;  3NMV A;  4A8G A;  2BK0 A;  5EKQ C;  4RYV A;  3CNW A;  4N76 A;  3NEG A;  4Z3L A;  3E85 A;  4XRT A;  4QDF B;  3NMT A;  3TGO C;  2LEQ A;  1VJH A;  2NN5 A;  1XDF A;  1ZXF A;  3K90 A;  3OQU A;  3JRS A;  4DS8 A;  4B9R A;  2D4R A;  2RES A;  3FO5 A;  5I8F A;  4KPY A;  2KF2 A;  4C9I A;  2Z9Y A;  3KDH A;  3NR4 A;  5AMW A;  3OTL A;  4A8U A;  2WQL A;  4BKD A;  2YH6 A;  1XFS A;  2NS9 A;  3GL0 A;  3TFZ A;  3GOB A;  2LIO A;  3PUT A;  2LAK A;  4QDC A;  1QMR A;  3UQH A;  1XN5 A;  3P9V A;  4REI A;  4C94 A;  2QPV A;  2LUZ A;  4JHH A;  3P0L A;  4LG5 A;  1X53 A;  2PCS A;  4JHI A;  1LN3 A;  2KCZ A;  3KLX A;  4M9W A;  3H3S A;  4QDF A;  4QDD A;  4JDL A;  4FPW A;  4N0G C;  3GGN A;  3KB3 A;  4IGX A; 
#chains in the Genus database with same CATH homology
 3HM9 A;  3NMN A;  2REZ A;  2EJX A;  4NCB A;  3NEF A;  3TVR A;  4QIP A;  4BKC A;  3DLB A;  1XUV A;  2E3Q A;  2E3P A;  3HJF A;  3H3Q A;  1T27 A;  3Q64 A;  1LN1 A;  4XRW A;  4Y31 A;  4A88 A;  5E4M A;  3NI8 A;  1H2O A;  2L65 A;  2M89 A;  4A81 A;  5BRL A;  3F73 A;  2E3R A;  4PSB A;  2N4B A;  3HK2 A;  4LGB A;  3GL2 A;  2IL5 A;  4REH A;  3KL1 A;  2QIM A;  2L8O A;  2L9P A;  5JO2 A;  5E4B A;  4A85 A;  3DLH A;  2LGH A;  4A8V A;  3NS2 A;  3HO1 A;  2ZYL A;  1ICX A;  3OH8 A;  1TXC A;  4JHY A;  3ELI A;  4LGA A;  2I9Y A;  4A87 A;  4BK7 A;  2K7H A;  2A1L A;  2KTE A;  4REJ A;  3HXM A;  3KB0 A;  1LLT A;  2RER A;  3NJO A;  1XN6 A;  3C0V A;  3NQN A;  3W9R A;  4LA7 A;  5E4D A;  2PSO A;  4N3E A;  3W9K A;  4E6F A;  2VNE A;  3PU2 A;  4JDA A;  3HVR A;  3H3T A;  5JO1 A;  1IFV A;  2LCG A;  2GKD A;  2K5G A;  1UW5 A;  3UID A;  4QCK A;  4N47 A;  2LPX A;  3F08 A;  3P51 A;  3QSZ A;  4IGW A;  3GB4 A;  4MNS A;  3ZVU A;  1B6F A;  5E46 A;  3KDI A;  1FM4 A;  4IGY A;  3IJT A;  3NJ1 A;  4N41 A;  4Q0K A;  1FSK A;  4IHR A;  3RT2 A;  4A80 A;  3NMP A;  3GKE A;  4C9C A;  5C9Y A;  4BTZ A;  1BTV A;  3KAY A;  3KDJ A;  2E3M A;  2MOU A;  4MA6 A;  2N4A A;  1JSS A;  2E3S A;  4DSB A;  1E09 A;  2KEW A;  3NJ0 A;  3RT0 C;  2LAF A;  2LE1 A;  1Z94 A;  2FLH A;  3GTE A;  3TL1 A;  2FFS A;  3Q63 A;  3WG8 A;  2E3N A;  3JRQ B;  4DSC A;  3QN1 A;  2VQ5 A;  4IH0 A;  2M47 A;  5JNN A;  4IH2 A;  1EM2 A;  2R55 A;  3KAZ A;  3UJL A;  4OIC A;  3K3K A;  4GY9 A;  4M9B A;  4NCA A;  3RD6 A;  3H3R A;  1KCM A;  3R6P A;  2LF2 A;  3NMH A;  5I9J A;  4R7K A;  4A83 A;  3GTS A;  1TW0 A;  2E3O A;  4MAP A;  3OJI A;  4WVO A;  4JHG A;  4IGV A;  1T17 A;  2Z9Z A;  3IE5 A;  3Q6A A;  3TVQ A;  4A84 A;  4A86 A;  1BV1 A;  2Q3Q A;  4BK6 A;  1LN2 A;  2LDK A;  3NMV A;  4A8G A;  2BK0 A;  5EKQ C;  4RYV A;  3CNW A;  4N76 A;  3NEG A;  4Z3L A;  3E85 A;  4XRT A;  4QDF B;  3NMT A;  3TGO C;  2LEQ A;  1VJH A;  2NN5 A;  1XDF A;  1ZXF A;  3K90 A;  3OQU A;  3JRS A;  4DS8 A;  4B9R A;  2D4R A;  2RES A;  3FO5 A;  5I8F A;  4KPY A;  2KF2 A;  4C9I A;  2Z9Y A;  3KDH A;  3NR4 A;  5AMW A;  3OTL A;  4A8U A;  2WQL A;  4BKD A;  2YH6 A;  1XFS A;  2NS9 A;  3GL0 A;  3TFZ A;  3GOB A;  2LIO A;  3PUT A;  2LAK A;  4QDC A;  1QMR A;  3UQH A;  1XN5 A;  3P9V A;  4REI A;  4C94 A;  2QPV A;  2LUZ A;  4JHH A;  3P0L A;  4LG5 A;  1X53 A;  2PCS A;  4JHI A;  1LN3 A;  2KCZ A;  3KLX A;  4M9W A;  3H3S A;  4QDF A;  4QDD A;  4JDL A;  4FPW A;  4N0G C;  3GGN A;  3KB3 A;  4IGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...