3PUWF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 155
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puwF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puwF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puwF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puwF02
3PUYF 4YMSC 3DHWA 3D31C 3PUWF 4JBWF 3PUZG 3PUVG 2R6GF 3PV0F 4YMTB 3TUZA 3PUXF 4YMWC 2ONKC 4KHZG 3RLFF 3PUYG 4TQUM 4KI0F 3TUIA 3PUWG 4YMUC 4JBWG 2R6GG 3PV0G 4XIGM 4XTCM 4TQUN 3PUZF 3PUVF 3PUXG 3RLFG 4XIGN 4XTCN 3TUJA 4KI0G 4KHZF 4YMVC
chains in the Genus database with same CATH superfamily
4TV8E 4QH1A 4FI5A 3I9YA 2XQ8A 1U5PA 5KXJA 2BG9A 2AXDS 3RLFF 2KZ7B 2PFVA 3QK6A 5JR9B 3VU7H 3P4WA 2V5CA 5EK3A 5IUXA 2N9DA 3ZMUB 4MFRA 1HG5A 4ZS3A 3PUWF 3O4XE 2K48A 1NAFA 4NXNT 3DTOA 1NWMX 3OPCA 5L4EA 3LBXA 3UFGA 2CHNA 5AQTB 4KP3C 5AQOB 2VQET 2V7MA 2XTLA 3E22E 2WWVA 1HNZT 4HKAA 3H3AA 4YY3T 1CUNA 4YSYA 3VKHA 2MOZA 3RIFA 3JADA 2K3WA 4H63H 3JC6C 1XDPA 2KXPB 4O2AE 5AQPB 1I94T 3X1DA 1D0YA 2XQ6A 3C98B 2I0MA 3RKOA 4JV5T 4CN6A 2X9YA 4DUYT 3RYFE 2KINB 4PW8A 4C90A 4AQYT 2LHRA 2CWOA 3L09A 2M6BA 1T98A 2VVSA 4NPPA 2EHOA 3L3PA 4LFCT 4GIWA 2XUEA 2BKOA 5JTGA 4B3RT 4IE4A 1ZP0A 4AKIA 1M7KA 3OYZA 4ILCA 3AE4A 4QWNB 3NRXA 2WMNA 4OYKA 5AQMB 4CN4A 5LB7B 3S4UA 5LA6E 5HEOA 1MMDA 3SRZA 4LF4T 1E2AA 1T8BA 4L5GA 4YFSA 5JDGA 4OX9T 2X68A 2VB6A 1BR1A 3EDVA 2NOXA 1S35A 2ZM2A 1KFYA 4I43B 4O8SA 2V6XA 4H9SE 4J2CA 3MA9A 1ZHCA 4TV9E 3CIRA 2XAQB 3QB5A 4WBOA 4ILAA 2XSBA 2QRXA 4U74A 2LE8A 3TKLB 4AKLA 4X66T 4PAGA 2PJQA 4X1KE 4N78D 4X64T 5L2LA 2KT9A 4P0BA 4Z90A 5FP3A 3HKEE 2FUPA 2Z6EA 4AKGA 2WB5A 4TQUM 1MIVA 2BG9E 3OJAA 3K3QC 2K24A 4YMVC 4TUYE 2BS3A 4DV5T 4DVDA 3PUVG 5DQWA 3PUGA 3LK42 4CZZB 3SFEA 2KWHA 1E7PA 2Y8DA 4AKRB 4IDOA 2VL8A 4DV4T 2LKGA 2JPFA 4ZI3D 3EVYA 2JJ9A 2WU2A 5JQGE 2V7IA 4JBWF 3UU3A 4I0UA 5LMNT 2A2FX 3ZT7A 2NR4A 2KSRA 3RIUC 5TAOA 4HE8A 4K0UA 3AE9A 2HN2A 4Z8XA 2BVLA 2DI4A 1Y64B 3F57A 3JAEA 4YTMA 1UX4A 4ZEYA 2IDOB 2X0LB 4UF0B 1NEKA 2XM2A 4P0AA 3ETUA 2W67A 2A72A 4H9RC 3KVBA 1XNQT 5L3FB 5HEUA 3UU8A 3AA6B 4H9OC 4DV3T 5IYZE 4KX6A 5ABFB 3TLTA 4IE0A 1R8IA 4HWIB 3JC6D 3FHNA 5J2UE 3WI3A 5LGTB 3TUZA 5LJNA 4PFOA 5E0OA 2ZMAA 4GKJT 4U2YA 2CCQA 1J5ET 4QXHB 3NVOA 3AXJB 3LFMA 2K5BB 2QA7A 2CE7A 4UVCB 2H7OA 2HPJA 1J1JA 5LHIB 3RIAA 4IL9A 2Q9QC 2CWYA 4QH5A 2I59A 4HGAA 4QXCB 3EABA 4EZHA 2ODVA 1HG2A 2CMRA 3LJCA 2E2AA 2BBHA 1YD8G 1YKHB 2CBJA 5CA1E 2W0GA 3AE8A 4HWDA 1HNXT 4YJ2E 3KBTA 3TLWA 4G2AA 1BR2A 4DR5T 3UUBA 2WSSV 3UQ4A 1SA0E 3A8YC 3AECA 1N32T 4CXXA 4MBQA 1ZKEA 5CJ5A 4ILBA 4BAYB 2VKOA 3AEGA 5CFBA 3O1IA 1WR0A 3VRBA 3N9OA 1VCSA 5AQIB 2X67A 2LSJA 1HNWT 3N9QA 2VASA 2XAHB 5JR9C 4IE6A 2H89A 1IBLT 4B6XA 4UF0A 3RKGA 3R84B 2E9XC 5AQNB 3PUXF 2JMHA 4EGWA 3UU6A 2Q9QB 2FJDA 1HX8A 2BZBA 5ABFA 4EV6A 2KMFA 3QOFA 2NWBA 3KV6A 1I6ZA 4IHJE 4F8HA 3CKDA 4YSZA 3CQGB 2LM9A 1CHUA 4JI6T 4U7YA 1E1HB 3C4ZA 5ABGA 4YMWC 2AE9A 5HEGA 2LSKA 2BS4A 3RF1A 2LEHA 4AI6A 2K9AA 1FMWA 4EAHA 2UXCT 3O9XA 4EZ4A 4L0RA 3P4RA 2UU9T 3N9PA 4UV9B 3AVRA 4IGUA 2XQ5A 3I0QA 1X9BA 4TNVA 5BR8T 3GWHA 5FL0A 2XY8B 4JI8T 3AA7B 5LGUB 2RP4A 1KK7A 2M67A 3LK3B 2XZEA 3RIUA 2SPCA 4LFAT 2FJBA 2X51A 4AISA 1WYCA 5DQVA 2NW9A 4XBFB 5HXEA 2WDRA 2XQ4A 4XAXB 1WR6A 1YXRA 5IWAT 1KNZA 4JUYA 4MHCA 3AEBA 5ETWA 1UX5A 3K1SA 1HCIA 3IBPA 3R6NA 2IIUA 4ZI2C 2V6YB 3NBXX 2E9XB 1KNPA 3AEEA 4KMCA 1ZEEA 3Q9DA 1KF6A 3J7Yq 3IF8B 5LMUT 3KVAA 2N2NA 4NIQA 3SFDA 2XSAA 2D0UA 4ZI7E 2YDRA 1J5WA 4U33A 3PURA 4AQFC 3AAAB 3N2OA 1Z8UA 2F4VT 5AQHB 1HTJF 2UXXB 3ZCJA 3HKDE 2IMLA 2LOPA 4JI2T 3QUJA 4PK5A 1QUUA 2D2SA 3LDQB 3ZKRA 2GK9A 4O2BE 4B3ST 5LYJE 1ZV4X 3CQCB 3AEFA 2IC9A 2R6GG 4O4LE 4IE5A 1UCUA 1WRDA 2LLYA 2W66A 4O4HE 2Y6XA 4LFBT 3MKDA 4ERRA 3RX6A 5A1LA 3VR8A 3V5SA 3V5UA 4CQIA 4PNIA 5AQKB 2W4XA 2CXDA 3LSVA 2L9QA 3AA0B 4X65T 2EHOD 1HX1B 3MACA 2W00A 4DR1T 3ZYKA 1T72A 2B1EA 3P4SA 4DV0T 5FXZA 2A3DA 3T8OA 3UULA 4U3CA 2JQHA 3O1HA 4HFDA 4I55E 4IDQA 4P09A 2X9HA 3VHLA 4CXWA 2WZHA 3ZN1B 2L8KA 4H9PC 5AQGB 1L0VA 2WZIA 2XAJB 2ZM0A 3D31C 4ZXLA 3SS1A 4HTEA 1S94A 4JI3T 1MIWA 2MPKA 3RHWA 2IW5B 3ZN0B 3ZJ2A 3UTKA 3FBLA 3LG7A 2JQ9A 2VQFT 5JR9A 3PV0G 2V1DB 4NXMT 2DHRA 4OHFA 5L3CB 5KX5E 3ZMTB 2V6YA 3ZCIA 5J2TE 4QXBB 2XQAA 3D0TA 3HA4A 2UUCT 2YDQA 2V7JA 3L39A 1W0BA 1XZYA 2DWKA 3RI5A 3NKZA 2OA5A 4X5TA 4KI0G 4AKHA 2WQYA 4U31A 5J0ZA 3FZMB 3B13A 3UFEA 4X20E 3CQXC 5JH7E 4BJMA 3ANWB 2WMOA 1QLBA 5AQQB 4GKKT 2JIWA 2ACZA 3RQUA 3K3NA 3RC3A 4IDPA 3BQKA 2NTXA 2B76A 2H3RA 4YSXA 3TLUA 1HR0T 2YK0A 1W0AA 4NUUA 3RRCA 1HS7A 3CVRA 4UVBB 2CM0A 5HCJA 4PK6A 4G63A 3LK2B 2BS2A 4ZHQE 1IBKT 5DJQC 5JDFA 5JVDE 4CN1A 4HEAA 1W09A 4QX8B 4C91A 4X1YE 3JAFA 2YINA 3PJAA 2L3LA 1FEWA 3GN5B 5L3EB 2BBJA 4U2ZA 3WAJA 3VR9A 3HKBE 5JDQA 2BVMA 2WBLA 3AEDA 4DO0A 4QX7B 5FXXA 3Q5XA 4FJOA 4ZI2D 1XMQT 3PUVF 3MK7C 2DL1A 4UEMA 5HWXA 4IREA 2LRKA 4XTCN 5LJMA 2LOSA 4TZ4C 1MIYA 1BR0A 3PUQA 1MMNA 2BG9C 4U7IA 4AQFA 4PJMA 3VKGA 1D1CA 2WWUA 3EDUA 4OYJA 5AQSB 1G8XA 1BR4A 4LMJA 1LKXA 3NRYA 4A98A 3AA1B 3ZJ1A 5JDNA 4DR6T 4DR7T 2H88A 2LSIA 3A7MA 3P4QA 2H7VC 2IHR1 4JEHB 5HWYA 2VWAA 3N9MA 4IIJE 4ANJA 4LMLA 3AAIA 3AEAA 2VURA 4H9NC 3ZYLA 2BKNA 2LT3A 4GYRA 4KBMB 2PG8A 4TWHA 3C50A 2HPLA 3RGLA 4KHZG 2RA1A 3MZKB 3ANWA 4DR2T 4DV7T 4WBNE 1M62A 5F5WA 1XDOA 3DJBA 4HFIA 4V1Av 5LBMA 3KV9A 3B57A 2LSYA 4MLKA 3AE3A 5FNVE 2YU1A 4ISSA 4ZOLE 3E0ZA 5FYMA 3C4XA 4UR9A 1YW0A 4QKNA 3O1JA 4I50E 4O4JE 5LCYA 4PJJA 4Q25A 3UUNA 2CXLA 2VL0A 2W61A 1SUMB 2XAFB 1US7B 2BG9B 3N2GE 2MTQA 1YQ3A 2YN6A 2MYSA 3SOLA 5CB4E 4YMUC 1OEDC 2QYWA 4QH4A 4ZZBA 3AE5A 4EYUA 4PFPA 4YHHT 3UUMA 3OYXA 4X62T 3GN5A 3CX6B 2NW8A 1JNRA 3PJAJ 4A97A 1V9DA 1KNRA 3LBXB 2UXNB 5JRCB 2FJEA 3PUYG 4DV2T 3CX8B 4JEUB 2E5VA 3P8CD 5HCMA 3WAKA 5LG3A 1MMGA 3DP7A 5CA0E 3T1HT 2VKHA 1Z0PA 4CI2B 2W62A 4TNWA 4X1IE 5FY0A 4A56A 2WDQA 4DNDA 3FB2A 2JQKA 4IDZA 4XTCM 4F6RC 5LGNB 3TLVA 2CHOA 3OBVE 3EHZA 4DMVA 5JDLA 2FBWA 2E5LT 2ES0A 1IJ5A 4PJLA 3UUXB 1AJ3A 3PUZG 3H37A 3RC8A 2ONKC 2DNXA 2LKHA 2NTYA 5C8YE 4YLHA 2CBIA 2ZM8A 2YDSA 3F2EA 1OWAA 4O4IE 3P4PA 2IAKA 3AXJA 5ADXL 3BQLA 3RLFG 4GYSA 2N1GA 4COFA 3AE1A 4HWFA 4JYAT 3PUYF 2YOEA 2YEVC 1UGOA 4WW0A 1LRZA 3UQ7A 4JI0T 2X0HA 3PUWG 1OEDB 3GMIA 3U3IA 1D0ZA 2V7LA 3PU3A 1WYBA 3QNUA 3KFWX 4QHOA 3UU5A 3K8PC 3RYHE 4LMKA 1OXZA 3M3ZB 1N33T 4YXDA 3JCFA 5FKYA 2Y48B 3ONLC 2LM2A 3AAEB 3NZQA 4OK0A 3AE6A 4UXNB 3IHRA 4JI5T 5LP6E 5F8PA 2CRBA 2WDVA 4A5XA 2MBGA 5HEJA 3C64A 3I9WA 3NZPA 3A5XA 4JI1T 4HWHA 2LHNA 2PBIA 3ZPOA 4TX5A 2HH7A 2D9DA 2VVNA 3KBUA 2X0YA 5JRCA 2LSGA 2C5KT 3E08A 1Y01A 3FZFB 3PU8A 1UURA 4TQUN 3J9X1 4H63V 3Q5DA 4HFCA 2CPTA 3KV5A 5HXRA 3ONXA 1YQ4A 1NENA 1W9RA 3M65A 5L4HA 5HYAA 5LOVE 1ZOYA 5LHGB 4LF9T 4EEDA 2Q9QA 4K0KT 5M4YA 4HFHA 4B3MT 5DABA 2Q9QD 3K3OA 4DV6T 4EYYR 3N9NA 2VKJA 2XQYA 3W15B 5GONE 4E7ZA 5ABEA 2XM1A 4BA9A 3CMLA 2DWGA 3VRAA 3B5MA 2J1DG 2X9WA 2ZM6T 3GA8A 2HN1A 5LHHB 5LNKA 3EUHA 5J1GA 1FJGT 1OEDA 2C5IT 4ZZCA 1SE7A 4HN9A 5HXCA 3TUJA 4EEBA 2WP9A 5HAXA 1GQEA 1HF8A 3NWIA 3Q5WA 4IL4A 1WLXA 3AB3B 4PK4A 2R6GF 5LBQB 4UV8B 3N5LA 4AIUA 2YU2A 4WNKA 4MALA 5JREA 3H3MA 3Q5EA 4TWDA 2ACXA 5EK4A 4CXYA 4GK0E 3KINB 4M1PA 4LF7T 2WM9A 2QGSA 4LF6T 3ETVA 1KEYA 2E9XA 4ILUA 5FMNA 3ZYMA 1VRBA 3AE2A 4HWCA 3CWZB 2A9UA 2E9XD 3ESLA 5F3JA 1B7TA 5HEHA 5C2TA 4HFEA 3CK6A 3RH3A 2CLYC 2JRKA 4ISTA 3ABVA 5LXTE 3N9LA 4DV1T 4JBWG 2XQ9A 4XZCA 5AQLB 4GK5E 2VKDA 2WAUA 5C3JA 3PV0F 3G06A 2W63A 1VOMA 1FMVA 4LF5T 3HI2A 3P7IA 3N2KE 2M6IA 2V7KA 4BJNA 3I0OA 5LG4A 3DHWA 1U4QA 2V8SV 4AXPA 3TLSA 4OFZA 4DR3T 4KI0F 1UK5A 3C4WA 3QC9A 4JLEA 5FL1A 2ZLYA 1JNZA 1X79A 3ZC1A 2UXBT 4DR4T 1VCTA 2UUAT 5AQRB 5ABHA 3PDYA 2UUBT 3HR0A 4TWFA 2WY2A 4IT4A 2DCFA 4ADZA 4XIGN 3IEEA 1G73A 2NP9A 4EOZB 1EZ3A 2CLYB 2VK9A 3F31A 1T7SA 2MAWA 4JI4T 3BK9A 1WFDA 3BQIA 5AQVB 5BMVE 3HL6A 4IE7A 4L9IA 2C0SA 5FVLA 1IAPA 4GOUA 4UIGA 3MJXA 2NW7A 3RPUA 2YKSA 2WU5A 3FZHB 1D1AA 1IJ6A 4LF8T 2BDEA 5AQJB 5IHYA 1OEDE 2LRLA 1HFAA 3RQWA 3ONJA 4DUZT 1N36T 2V26A 2JMKA 3ZMVB 5L3BB 2WS3A 2X66A 2CEAA 5HXHA 5AQUB 2IUBA 4ASKA 3CX7B 3OKQA 4P1NA 1YKEB 1LVKA 5H6QB 3P50A 4HFBA 3RRWA 2XQ3A 1IZNB 3PE0A 1XMOT 2X9XA 5JDHA 3IA3A 2D0TA 2JQQA 5H6RB 5CGMA 3AVSA 4I4TE 4DIDB 5AQFB 3KDSE 5FY1A 3L8RA 1WCRA 3TUIA 3QB5K 3PUSA 4YT0A 3ZC0A 5FXWA 2PTFA 2XASB 3FXEB 4H9QC 1SHZC 2OLTA 2W2UA 5EZYE 3OVUA 2EHOC 1MNEA 4WZXA 4U72A 5L3GB 4IDNA 5L3DB 1XNRT 3RYIE 1N34T 3OTOT 3PUXG 4YJ3E 3Q2MA 5HXSA 5FVKA 3T1YT 5EK2A 4KHZF 1IBMT 3ZSSA 3I1AA 4KHPT 2P9BA 4PJNA 2C5JA 2CA5A 2J4GA 5KMGP 3PTRB 4HFVA 4UVAB 4WYVA 2KNDA 3ZMSB 5KDMC 2UXDT 2WCAA 3SWHA 4AQGA 2HHHT 4YTPA 2J47A 2CXFA 4JI7T 4EXTA 2DLRA 3EI0A 1FIOA 2XPKA 3FZKB 2E8IA 2OV9A 4XIGM 2XJ7A 4UELA 1QSDA 3FBZA 4ZS2A 3AE7A 4TN7B 2IC6A 2FJAA 4NUVA 2G0UA 4CI3B 3UU4A 4YMTB 4Z91A 3C51A 3EAMA 4CI1B 3ZT5A 3CPZA 4YHJA 4EIWA 1UUSA 2XQ7A 4B3TT 5L47A 4KUMB 2XHEB 2QVAA 3UT5E 1LVFA 3ZLIA 3U78A 5FY7A 2J62A 3ZEFB 3ZMZB 1D0XA 3PUAA 3ZSTA 3RYCE 1MMAA 3FZLB 4DMWA 1MNDA 4EB6E 2EHOB 2V5DA 1DU2A 5AFUL 3MXZA 2XAGB 3ZT6A 1D1BA 4E7SA 3HKCE 3KV4A 2RPAA 2ODUA 4YMSC 5FXVA 1H7CA 4YTNA 5JDMA 4ZI3C 1XWMA 3FXDB 1O3XA 4DBQA 4DBRA 2I6HA 2KWIB 3PUZF 2LJLA 2D5UA 2BKPA 2KLQA
chains in the Genus database with same CATH topology
3PUYF 4YMSC 3DHWA 3D31C 3PUWF 4JBWF 3PUZG 3PUVG 2R6GF 3PV0F 4YMTB 3TUZA 3PUXF 4YMWC 2ONKC 4KHZG 3RLFF 3PUYG 4TQUM 4KI0F 3TUIA 3PUWG 4YMUC 4JBWG 2R6GG 3PV0G 4XIGM 4XTCM 4TQUN 3PUZF 3PUVF 3PUXG 3RLFG 4XIGN 4XTCN 3TUJA 4KI0G 4KHZF 4YMVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY F;  4YMS C;  3DHW A;  3D31 C;  3PUW F;  4JBW F;  3PUZ G;  3PUV G;  2R6G F;  3PV0 F;  4YMT B;  3TUZ A;  3PUX F;  4YMW C;  2ONK C;  4KHZ G;  3RLF F;  3PUY G;  4TQU M;  4KI0 F;  3TUI A;  3PUW G;  4YMU C;  4JBW G;  2R6G G;  3PV0 G;  4XIG M;  4XTC M;  4TQU N;  3PUZ F;  3PUV F;  3PUX G;  3RLF G;  4XIG N;  4XTC N;  3TUJ A;  4KI0 G;  4KHZ F;  4YMV C; 
#chains in the Genus database with same CATH topology
 4TV8 E;  4QH1 A;  4FI5 A;  3I9Y A;  2XQ8 A;  1U5P A;  5KXJ A;  2BG9 A;  2AXD S;  3RLF F;  2KZ7 B;  2PFV A;  3QK6 A;  5JR9 B;  3VU7 H;  3P4W A;  2V5C A;  5EK3 A;  5IUX A;  2N9D A;  3ZMU B;  4MFR A;  1HG5 A;  4ZS3 A;  3PUW F;  3O4X E;  2K48 A;  1NAF A;  4NXN T;  3DTO A;  1NWM X;  3OPC A;  5L4E A;  3LBX A;  3UFG A;  2CHN A;  5AQT B;  4KP3 C;  5AQO B;  2VQE T;  2V7M A;  2XTL A;  3E22 E;  2WWV A;  1HNZ T;  4HKA A;  3H3A A;  4YY3 T;  1CUN A;  4YSY A;  3VKH A;  2MOZ A;  3RIF A;  3JAD A;  2K3W A;  4H63 H;  3JC6 C;  1XDP A;  2KXP B;  4O2A E;  5AQP B;  1I94 T;  3X1D A;  1D0Y A;  2XQ6 A;  3C98 B;  2I0M A;  3RKO A;  4JV5 T;  4CN6 A;  2X9Y A;  4DUY T;  3RYF E;  2KIN B;  4PW8 A;  4C90 A;  4AQY T;  2LHR A;  2CWO A;  3L09 A;  2M6B A;  1T98 A;  2VVS A;  4NPP A;  2EHO A;  3L3P A;  4LFC T;  4GIW A;  2XUE A;  2BKO A;  5JTG A;  4B3R T;  4IE4 A;  1ZP0 A;  4AKI A;  1M7K A;  3OYZ A;  4ILC A;  3AE4 A;  4QWN B;  3NRX A;  2WMN A;  4OYK A;  5AQM B;  4CN4 A;  5LB7 B;  3S4U A;  5LA6 E;  5HEO A;  1MMD A;  3SRZ A;  4LF4 T;  1E2A A;  1T8B A;  4L5G A;  4YFS A;  5JDG A;  4OX9 T;  2X68 A;  2VB6 A;  1BR1 A;  3EDV A;  2NOX A;  1S35 A;  2ZM2 A;  1KFY A;  4I43 B;  4O8S A;  2V6X A;  4H9S E;  4J2C A;  3MA9 A;  1ZHC A;  4TV9 E;  3CIR A;  2XAQ B;  3QB5 A;  4WBO A;  4ILA A;  2XSB A;  2QRX A;  4U74 A;  2LE8 A;  3TKL B;  4AKL A;  4X66 T;  4PAG A;  2PJQ A;  4X1K E;  4N78 D;  4X64 T;  5L2L A;  2KT9 A;  4P0B A;  4Z90 A;  5FP3 A;  3HKE E;  2FUP A;  2Z6E A;  4AKG A;  2WB5 A;  4TQU M;  1MIV A;  2BG9 E;  3OJA A;  3K3Q C;  2K24 A;  4YMV C;  4TUY E;  2BS3 A;  4DV5 T;  4DVD A;  3PUV G;  5DQW A;  3PUG A;  3LK4 2;  4CZZ B;  3SFE A;  2KWH A;  1E7P A;  2Y8D A;  4AKR B;  4IDO A;  2VL8 A;  4DV4 T;  2LKG A;  2JPF A;  4ZI3 D;  3EVY A;  2JJ9 A;  2WU2 A;  5JQG E;  2V7I A;  4JBW F;  3UU3 A;  4I0U A;  5LMN T;  2A2F X;  3ZT7 A;  2NR4 A;  2KSR A;  3RIU C;  5TAO A;  4HE8 A;  4K0U A;  3AE9 A;  2HN2 A;  4Z8X A;  2BVL A;  2DI4 A;  1Y64 B;  3F57 A;  3JAE A;  4YTM A;  1UX4 A;  4ZEY A;  2IDO B;  2X0L B;  4UF0 B;  1NEK A;  2XM2 A;  4P0A A;  3ETU A;  2W67 A;  2A72 A;  4H9R C;  3KVB A;  1XNQ T;  5L3F B;  5HEU A;  3UU8 A;  3AA6 B;  4H9O C;  4DV3 T;  5IYZ E;  4KX6 A;  5ABF B;  3TLT A;  4IE0 A;  1R8I A;  4HWI B;  3JC6 D;  3FHN A;  5J2U E;  3WI3 A;  5LGT B;  3TUZ A;  5LJN A;  4PFO A;  5E0O A;  2ZMA A;  4GKJ T;  4U2Y A;  2CCQ A;  1J5E T;  4QXH B;  3NVO A;  3AXJ B;  3LFM A;  2K5B B;  2QA7 A;  2CE7 A;  4UVC B;  2H7O A;  2HPJ A;  1J1J A;  5LHI B;  3RIA A;  4IL9 A;  2Q9Q C;  2CWY A;  4QH5 A;  2I59 A;  4HGA A;  4QXC B;  3EAB A;  4EZH A;  2ODV A;  1HG2 A;  2CMR A;  3LJC A;  2E2A A;  2BBH A;  1YD8 G;  1YKH B;  2CBJ A;  5CA1 E;  2W0G A;  3AE8 A;  4HWD A;  1HNX T;  4YJ2 E;  3KBT A;  3TLW A;  4G2A A;  1BR2 A;  4DR5 T;  3UUB A;  2WSS V;  3UQ4 A;  1SA0 E;  3A8Y C;  3AEC A;  1N32 T;  4CXX A;  4MBQ A;  1ZKE A;  5CJ5 A;  4ILB A;  4BAY B;  2VKO A;  3AEG A;  5CFB A;  3O1I A;  1WR0 A;  3VRB A;  3N9O A;  1VCS A;  5AQI B;  2X67 A;  2LSJ A;  1HNW T;  3N9Q A;  2VAS A;  2XAH B;  5JR9 C;  4IE6 A;  2H89 A;  1IBL T;  4B6X A;  4UF0 A;  3RKG A;  3R84 B;  2E9X C;  5AQN B;  3PUX F;  2JMH A;  4EGW A;  3UU6 A;  2Q9Q B;  2FJD A;  1HX8 A;  2BZB A;  5ABF A;  4EV6 A;  2KMF A;  3QOF A;  2NWB A;  3KV6 A;  1I6Z A;  4IHJ E;  4F8H A;  3CKD A;  4YSZ A;  3CQG B;  2LM9 A;  1CHU A;  4JI6 T;  4U7Y A;  1E1H B;  3C4Z A;  5ABG A;  4YMW C;  2AE9 A;  5HEG A;  2LSK A;  2BS4 A;  3RF1 A;  2LEH A;  4AI6 A;  2K9A A;  1FMW A;  4EAH A;  2UXC T;  3O9X A;  4EZ4 A;  4L0R A;  3P4R A;  2UU9 T;  3N9P A;  4UV9 B;  3AVR A;  4IGU A;  2XQ5 A;  3I0Q A;  1X9B A;  4TNV A;  5BR8 T;  3GWH A;  5FL0 A;  2XY8 B;  4JI8 T;  3AA7 B;  5LGU B;  2RP4 A;  1KK7 A;  2M67 A;  3LK3 B;  2XZE A;  3RIU A;  2SPC A;  4LFA T;  2FJB A;  2X51 A;  4AIS A;  1WYC A;  5DQV A;  2NW9 A;  4XBF B;  5HXE A;  2WDR A;  2XQ4 A;  4XAX B;  1WR6 A;  1YXR A;  5IWA T;  1KNZ A;  4JUY A;  4MHC A;  3AEB A;  5ETW A;  1UX5 A;  3K1S A;  1HCI A;  3IBP A;  3R6N A;  2IIU A;  4ZI2 C;  2V6Y B;  3NBX X;  2E9X B;  1KNP A;  3AEE A;  4KMC A;  1ZEE A;  3Q9D A;  1KF6 A;  3J7Y q;  3IF8 B;  5LMU T;  3KVA A;  2N2N A;  4NIQ A;  3SFD A;  2XSA A;  2D0U A;  4ZI7 E;  2YDR A;  1J5W A;  4U33 A;  3PUR A;  4AQF C;  3AAA B;  3N2O A;  1Z8U A;  2F4V T;  5AQH B;  1HTJ F;  2UXX B;  3ZCJ A;  3HKD E;  2IML A;  2LOP A;  4JI2 T;  3QUJ A;  4PK5 A;  1QUU A;  2D2S A;  3LDQ B;  3ZKR A;  2GK9 A;  4O2B E;  4B3S T;  5LYJ E;  1ZV4 X;  3CQC B;  3AEF A;  2IC9 A;  2R6G G;  4O4L E;  4IE5 A;  1UCU A;  1WRD A;  2LLY A;  2W66 A;  4O4H E;  2Y6X A;  4LFB T;  3MKD A;  4ERR A;  3RX6 A;  5A1L A;  3VR8 A;  3V5S A;  3V5U A;  4CQI A;  4PNI A;  5AQK B;  2W4X A;  2CXD A;  3LSV A;  2L9Q A;  3AA0 B;  4X65 T;  2EHO D;  1HX1 B;  3MAC A;  2W00 A;  4DR1 T;  3ZYK A;  1T72 A;  2B1E A;  3P4S A;  4DV0 T;  5FXZ A;  2A3D A;  3T8O A;  3UUL A;  4U3C A;  2JQH A;  3O1H A;  4HFD A;  4I55 E;  4IDQ A;  4P09 A;  2X9H A;  3VHL A;  4CXW A;  2WZH A;  3ZN1 B;  2L8K A;  4H9P C;  5AQG B;  1L0V A;  2WZI A;  2XAJ B;  2ZM0 A;  3D31 C;  4ZXL A;  3SS1 A;  4HTE A;  1S94 A;  4JI3 T;  1MIW A;  2MPK A;  3RHW A;  2IW5 B;  3ZN0 B;  3ZJ2 A;  3UTK A;  3FBL A;  3LG7 A;  2JQ9 A;  2VQF T;  5JR9 A;  3PV0 G;  2V1D B;  4NXM T;  2DHR A;  4OHF A;  5L3C B;  5KX5 E;  3ZMT B;  2V6Y A;  3ZCI A;  5J2T E;  4QXB B;  2XQA A;  3D0T A;  3HA4 A;  2UUC T;  2YDQ A;  2V7J A;  3L39 A;  1W0B A;  1XZY A;  2DWK A;  3RI5 A;  3NKZ A;  2OA5 A;  4X5T A;  4KI0 G;  4AKH A;  2WQY A;  4U31 A;  5J0Z A;  3FZM B;  3B13 A;  3UFE A;  4X20 E;  3CQX C;  5JH7 E;  4BJM A;  3ANW B;  2WMO A;  1QLB A;  5AQQ B;  4GKK T;  2JIW A;  2ACZ A;  3RQU A;  3K3N A;  3RC3 A;  4IDP A;  3BQK A;  2NTX A;  2B76 A;  2H3R A;  4YSX A;  3TLU A;  1HR0 T;  2YK0 A;  1W0A A;  4NUU A;  3RRC A;  1HS7 A;  3CVR A;  4UVB B;  2CM0 A;  5HCJ A;  4PK6 A;  4G63 A;  3LK2 B;  2BS2 A;  4ZHQ E;  1IBK T;  5DJQ C;  5JDF A;  5JVD E;  4CN1 A;  4HEA A;  1W09 A;  4QX8 B;  4C91 A;  4X1Y E;  3JAF A;  2YIN A;  3PJA A;  2L3L A;  1FEW A;  3GN5 B;  5L3E B;  2BBJ A;  4U2Z A;  3WAJ A;  3VR9 A;  3HKB E;  5JDQ A;  2BVM A;  2WBL A;  3AED A;  4DO0 A;  4QX7 B;  5FXX A;  3Q5X A;  4FJO A;  4ZI2 D;  1XMQ T;  3PUV F;  3MK7 C;  2DL1 A;  4UEM A;  5HWX A;  4IRE A;  2LRK A;  4XTC N;  5LJM A;  2LOS A;  4TZ4 C;  1MIY A;  1BR0 A;  3PUQ A;  1MMN A;  2BG9 C;  4U7I A;  4AQF A;  4PJM A;  3VKG A;  1D1C A;  2WWU A;  3EDU A;  4OYJ A;  5AQS B;  1G8X A;  1BR4 A;  4LMJ A;  1LKX A;  3NRY A;  4A98 A;  3AA1 B;  3ZJ1 A;  5JDN A;  4DR6 T;  4DR7 T;  2H88 A;  2LSI A;  3A7M A;  3P4Q A;  2H7V C;  2IHR 1;  4JEH B;  5HWY A;  2VWA A;  3N9M A;  4IIJ E;  4ANJ A;  4LML A;  3AAI A;  3AEA A;  2VUR A;  4H9N C;  3ZYL A;  2BKN A;  2LT3 A;  4GYR A;  4KBM B;  2PG8 A;  4TWH A;  3C50 A;  2HPL A;  3RGL A;  4KHZ G;  2RA1 A;  3MZK B;  3ANW A;  4DR2 T;  4DV7 T;  4WBN E;  1M62 A;  5F5W A;  1XDO A;  3DJB A;  4HFI A;  4V1A v;  5LBM A;  3KV9 A;  3B57 A;  2LSY A;  4MLK A;  3AE3 A;  5FNV E;  2YU1 A;  4ISS A;  4ZOL E;  3E0Z A;  5FYM A;  3C4X A;  4UR9 A;  1YW0 A;  4QKN A;  3O1J A;  4I50 E;  4O4J E;  5LCY A;  4PJJ A;  4Q25 A;  3UUN A;  2CXL A;  2VL0 A;  2W61 A;  1SUM B;  2XAF B;  1US7 B;  2BG9 B;  3N2G E;  2MTQ A;  1YQ3 A;  2YN6 A;  2MYS A;  3SOL A;  5CB4 E;  4YMU C;  1OED C;  2QYW A;  4QH4 A;  4ZZB A;  3AE5 A;  4EYU A;  4PFP A;  4YHH T;  3UUM A;  3OYX A;  4X62 T;  3GN5 A;  3CX6 B;  2NW8 A;  1JNR A;  3PJA J;  4A97 A;  1V9D A;  1KNR A;  3LBX B;  2UXN B;  5JRC B;  2FJE A;  3PUY G;  4DV2 T;  3CX8 B;  4JEU B;  2E5V A;  3P8C D;  5HCM A;  3WAK A;  5LG3 A;  1MMG A;  3DP7 A;  5CA0 E;  3T1H T;  2VKH A;  1Z0P A;  4CI2 B;  2W62 A;  4TNW A;  4X1I E;  5FY0 A;  4A56 A;  2WDQ A;  4DND A;  3FB2 A;  2JQK A;  4IDZ A;  4XTC M;  4F6R C;  5LGN B;  3TLV A;  2CHO A;  3OBV E;  3EHZ A;  4DMV A;  5JDL A;  2FBW A;  2E5L T;  2ES0 A;  1IJ5 A;  4PJL A;  3UUX B;  1AJ3 A;  3PUZ G;  3H37 A;  3RC8 A;  2ONK C;  2DNX A;  2LKH A;  2NTY A;  5C8Y E;  4YLH A;  2CBI A;  2ZM8 A;  2YDS A;  3F2E A;  1OWA A;  4O4I E;  3P4P A;  2IAK A;  3AXJ A;  5ADX L;  3BQL A;  3RLF G;  4GYS A;  2N1G A;  4COF A;  3AE1 A;  4HWF A;  4JYA T;  3PUY F;  2YOE A;  2YEV C;  1UGO A;  4WW0 A;  1LRZ A;  3UQ7 A;  4JI0 T;  2X0H A;  3PUW G;  1OED B;  3GMI A;  3U3I A;  1D0Z A;  2V7L A;  3PU3 A;  1WYB A;  3QNU A;  3KFW X;  4QHO A;  3UU5 A;  3K8P C;  3RYH E;  4LMK A;  1OXZ A;  3M3Z B;  1N33 T;  4YXD A;  3JCF A;  5FKY A;  2Y48 B;  3ONL C;  2LM2 A;  3AAE B;  3NZQ A;  4OK0 A;  3AE6 A;  4UXN B;  3IHR A;  4JI5 T;  5LP6 E;  5F8P A;  2CRB A;  2WDV A;  4A5X A;  2MBG A;  5HEJ A;  3C64 A;  3I9W A;  3NZP A;  3A5X A;  4JI1 T;  4HWH A;  2LHN A;  2PBI A;  3ZPO A;  4TX5 A;  2HH7 A;  2D9D A;  2VVN A;  3KBU A;  2X0Y A;  5JRC A;  2LSG A;  2C5K T;  3E08 A;  1Y01 A;  3FZF B;  3PU8 A;  1UUR A;  4TQU N;  3J9X 1;  4H63 V;  3Q5D A;  4HFC A;  2CPT A;  3KV5 A;  5HXR A;  3ONX A;  1YQ4 A;  1NEN A;  1W9R A;  3M65 A;  5L4H A;  5HYA A;  5LOV E;  1ZOY A;  5LHG B;  4LF9 T;  4EED A;  2Q9Q A;  4K0K T;  5M4Y A;  4HFH A;  4B3M T;  5DAB A;  2Q9Q D;  3K3O A;  4DV6 T;  4EYY R;  3N9N A;  2VKJ A;  2XQY A;  3W15 B;  5GON E;  4E7Z A;  5ABE A;  2XM1 A;  4BA9 A;  3CML A;  2DWG A;  3VRA A;  3B5M A;  2J1D G;  2X9W A;  2ZM6 T;  3GA8 A;  2HN1 A;  5LHH B;  5LNK A;  3EUH A;  5J1G A;  1FJG T;  1OED A;  2C5I T;  4ZZC A;  1SE7 A;  4HN9 A;  5HXC A;  3TUJ A;  4EEB A;  2WP9 A;  5HAX A;  1GQE A;  1HF8 A;  3NWI A;  3Q5W A;  4IL4 A;  1WLX A;  3AB3 B;  4PK4 A;  2R6G F;  5LBQ B;  4UV8 B;  3N5L A;  4AIU A;  2YU2 A;  4WNK A;  4MAL A;  5JRE A;  3H3M A;  3Q5E A;  4TWD A;  2ACX A;  5EK4 A;  4CXY A;  4GK0 E;  3KIN B;  4M1P A;  4LF7 T;  2WM9 A;  2QGS A;  4LF6 T;  3ETV A;  1KEY A;  2E9X A;  4ILU A;  5FMN A;  3ZYM A;  1VRB A;  3AE2 A;  4HWC A;  3CWZ B;  2A9U A;  2E9X D;  3ESL A;  5F3J A;  1B7T A;  5HEH A;  5C2T A;  4HFE A;  3CK6 A;  3RH3 A;  2CLY C;  2JRK A;  4IST A;  3ABV A;  5LXT E;  3N9L A;  4DV1 T;  4JBW G;  2XQ9 A;  4XZC A;  5AQL B;  4GK5 E;  2VKD A;  2WAU A;  5C3J A;  3PV0 F;  3G06 A;  2W63 A;  1VOM A;  1FMV A;  4LF5 T;  3HI2 A;  3P7I A;  3N2K E;  2M6I A;  2V7K A;  4BJN A;  3I0O A;  5LG4 A;  3DHW A;  1U4Q A;  2V8S V;  4AXP A;  3TLS A;  4OFZ A;  4DR3 T;  4KI0 F;  1UK5 A;  3C4W A;  3QC9 A;  4JLE A;  5FL1 A;  2ZLY A;  1JNZ A;  1X79 A;  3ZC1 A;  2UXB T;  4DR4 T;  1VCT A;  2UUA T;  5AQR B;  5ABH A;  3PDY A;  2UUB T;  3HR0 A;  4TWF A;  2WY2 A;  4IT4 A;  2DCF A;  4ADZ A;  4XIG N;  3IEE A;  1G73 A;  2NP9 A;  4EOZ B;  1EZ3 A;  2CLY B;  2VK9 A;  3F31 A;  1T7S A;  2MAW A;  4JI4 T;  3BK9 A;  1WFD A;  3BQI A;  5AQV B;  5BMV E;  3HL6 A;  4IE7 A;  4L9I A;  2C0S A;  5FVL A;  1IAP A;  4GOU A;  4UIG A;  3MJX A;  2NW7 A;  3RPU A;  2YKS A;  2WU5 A;  3FZH B;  1D1A A;  1IJ6 A;  4LF8 T;  2BDE A;  5AQJ B;  5IHY A;  1OED E;  2LRL A;  1HFA A;  3RQW A;  3ONJ A;  4DUZ T;  1N36 T;  2V26 A;  2JMK A;  3ZMV B;  5L3B B;  2WS3 A;  2X66 A;  2CEA A;  5HXH A;  5AQU B;  2IUB A;  4ASK A;  3CX7 B;  3OKQ A;  4P1N A;  1YKE B;  1LVK A;  5H6Q B;  3P50 A;  4HFB A;  3RRW A;  2XQ3 A;  1IZN B;  3PE0 A;  1XMO T;  2X9X A;  5JDH A;  3IA3 A;  2D0T A;  2JQQ A;  5H6R B;  5CGM A;  3AVS A;  4I4T E;  4DID B;  5AQF B;  3KDS E;  5FY1 A;  3L8R A;  1WCR A;  3TUI A;  3QB5 K;  3PUS A;  4YT0 A;  3ZC0 A;  5FXW A;  2PTF A;  2XAS B;  3FXE B;  4H9Q C;  1SHZ C;  2OLT A;  2W2U A;  5EZY E;  3OVU A;  2EHO C;  1MNE A;  4WZX A;  4U72 A;  5L3G B;  4IDN A;  5L3D B;  1XNR T;  3RYI E;  1N34 T;  3OTO T;  3PUX G;  4YJ3 E;  3Q2M A;  5HXS A;  5FVK A;  3T1Y T;  5EK2 A;  4KHZ F;  1IBM T;  3ZSS A;  3I1A A;  4KHP T;  2P9B A;  4PJN A;  2C5J A;  2CA5 A;  2J4G A;  5KMG P;  3PTR B;  4HFV A;  4UVA B;  4WYV A;  2KND A;  3ZMS B;  5KDM C;  2UXD T;  2WCA A;  3SWH A;  4AQG A;  2HHH T;  4YTP A;  2J47 A;  2CXF A;  4JI7 T;  4EXT A;  2DLR A;  3EI0 A;  1FIO A;  2XPK A;  3FZK B;  2E8I A;  2OV9 A;  4XIG M;  2XJ7 A;  4UEL A;  1QSD A;  3FBZ A;  4ZS2 A;  3AE7 A;  4TN7 B;  2IC6 A;  2FJA A;  4NUV A;  2G0U A;  4CI3 B;  3UU4 A;  4YMT B;  4Z91 A;  3C51 A;  3EAM A;  4CI1 B;  3ZT5 A;  3CPZ A;  4YHJ A;  4EIW A;  1UUS A;  2XQ7 A;  4B3T T;  5L47 A;  4KUM B;  2XHE B;  2QVA A;  3UT5 E;  1LVF A;  3ZLI A;  3U78 A;  5FY7 A;  2J62 A;  3ZEF B;  3ZMZ B;  1D0X A;  3PUA A;  3ZST A;  3RYC E;  1MMA A;  3FZL B;  4DMW A;  1MND A;  4EB6 E;  2EHO B;  2V5D A;  1DU2 A;  5AFU L;  3MXZ A;  2XAG B;  3ZT6 A;  1D1B A;  4E7S A;  3HKC E;  3KV4 A;  2RPA A;  2ODU A;  4YMS C;  5FXV A;  1H7C A;  4YTN A;  5JDM A;  4ZI3 C;  1XWM A;  3FXD B;  1O3X A;  4DBQ A;  4DBR A;  2I6H A;  2KWI B;  3PUZ F;  2LJL A;  2D5U A;  2BKP A;  2KLQ A; 
#chains in the Genus database with same CATH homology
 3PUY F;  4YMS C;  3DHW A;  3D31 C;  3PUW F;  4JBW F;  3PUZ G;  3PUV G;  2R6G F;  3PV0 F;  4YMT B;  3TUZ A;  3PUX F;  4YMW C;  2ONK C;  4KHZ G;  3RLF F;  3PUY G;  4TQU M;  4KI0 F;  3TUI A;  3PUW G;  4YMU C;  4JBW G;  2R6G G;  3PV0 G;  4XIG M;  4XTC M;  4TQU N;  3PUZ F;  3PUV F;  3PUX G;  3RLF G;  4XIG N;  4XTC N;  3TUJ A;  4KI0 G;  4KHZ F;  4YMV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...