3PUWF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
494
structure length
490
Chain Sequence
b'WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
molecule tags Hydrolase/transport protein
source organism Escherichia coli
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
total genus 155
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puwF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puwF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puwF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puwF02
3PUYF 4YMVC 4KI0G 3PUZG 3PV0F 4KHZG 4XIGN 3PUVF 3PUXG 3RLFG 4YMUC 3PV0G 3PUZF 4TQUM 3PUWF 2R6GG 3TUIA 3RLFF 2ONKC 3D31C 4XIGM 3TUZA 3PUWG 2R6GF 3TUJA 4JBWG 3DHWA 4YMSC 3PUYG 4KI0F 4XTCN 4TQUN 4YMTB 4KHZF 4YMWC 4XTCM 3PUVG 4JBWF 3PUXF
chains in the Genus database with same CATH superfamily
2VL8A 4KI0G 3NRYA 2FJDA 1ZKEA 4H9PC 5JDLA 1HCIA 5EK3A 4KHZG 1YKHB 3ZSSA 4HE8A 5AQTB 3Q2MA 2W66A 3B13A 5AQQB 3OKQA 3RF1A 2WSSV 3UULA 5CGMA 1JNZA 1WYBA 2YU2A 2J47A 2WU5A 2LSYA 3ZMZB 4DV0T 2XQ8A 4GYSA 1HTJF 4CXXA 3LBXA 5IYZE 2WM9A 4AISA 5JDGA 3RC8A 3CQXC 2KMFA 3U3IA 1ZEEA 3RQUA 4A5XA 4YXDA 5AQJB 3UUNA 2H88A 4FI5A 2W61A 3TLSA 2M67A 3FZMB 2VQET 2XQ7A 3PURA 4OYKA 2IHR1 4ZS3A 3EDUA 2XJ7A 1HR0T 2D5UA 2DLRA 3AEBA 1NEKA 2D9DA 3EVYA 4H63V 3UT5E 3RHWA 2MOZA 2XQ4A 4BJNA 4DR5T 2WS3A 4OX9T 3ZMVB 3P7IA 4ISTA 2VQFT 4UV8B 4I50E 5AQUB 3ZMSB 3O9XA 1Z0PA 3QK6A 3PUVF 3DTOA 4O4HE 4TX5A 2X66A 1US7B 2V6YA 3CVRA 3MA9A 1Y64B 4LMLA 2BVLA 3H3AA 4HWDA 3QB5K 3PUQA 3AAEB 5FY7A 3X1DA 4MBQA 1ZV4X 2IIUA 2RP4A 5DQWA 3DP7A 3Q5DA 1W9RA 2FJBA 3Q5EA 3QC9A 2QRXA 2W4XA 5AQGB 3ABVA 1N33T 1OEDB 1WYCA 2LOSA 5AQLB 4XIGM 1G73A 2V7KA 4O4IE 5KMGP 1B7TA 2XZEA 2LHNA 2HH7A 1UX4A 2V26A 2WY2A 4KUMB 4NIQA 3ZCIA 3ZN1B 5HWXA 1YKEB 4UF0B 5LBQB 4ZS2A 4LF4T 2LKGA 2V6XA 3CX6B 4ASKA 3P4RA 5HEUA 5HEHA 4ZI3D 2BS3A 4YMVC 4LFCT 2J62A 2DWKA 2QA7A 1IJ5A 3SWHA 5E0OA 4DV7T 2H3RA 3M3ZB 2V1DB 2VKHA 4HEAA 2WWUA 4ZZCA 3RLFG 1KF6A 4HWCA 5CA0E 5BMVE 4ZHQE 3N9MA 4BAYB 4OHFA 2V7LA 4I0UA 4IE0A 2G0UA 4ZI7E 2V7IA 4A56A 4NUUA 5JRCB 5EK2A 5LNKA 4U31A 3JCFA 2ACZA 3IBPA 4LF8T 1IZNB 2PTFA 3L8RA 2YKSA 2HPLA 2XM2A 3Q9DA 3O1IA 3PUSA 4AQYT 5JR9A 3AA6B 4YHJA 3DHWA 4QH1A 4YY3T 2X9WA 4YHHT 2LSKA 1BR1A 2OA5A 2W0GA 5H6RB 4PK4A 4IDQA 4EEDA 2V5CA 4MALA 3GN5A 4COFA 2XPKA 5M4YA 2K24A 5F5WA 1ZHCA 5LHGB 5FL1A 3MKDA 2KLQA 2CM0A 2XQ9A 4X66T 3ZC1A 4CXWA 4GKJT 3SRZA 3WAJA 1N32T 2LSGA 4PK5A 5HCMA 3AAIA 1YD8G 2HN2A 3PUXG 3LJCA 2H7VC 2YDSA 3OVUA 1BR2A 4LFAT 2IUBA 4IE4A 4JI4T 1D0YA 3GMIA 3PUZF 3CX7B 3KFWX 4QH4A 1OEDC 1XDOA 1MNDA 2L8KA 3N9LA 3FHNA 3FZLB 3GA8A 2VB6A 4OYJA 4XZCA 3UU6A 2XAFB 3LBXB 4OFZA 2NW9A 4DMVA 4YSYA 1DU2A 2XQ5A 2ZMAA 3AXJA 3CK6A 5LB7B 3RIUC 1NAFA 4ZZBA 1VCSA 3TUZA 1SUMB 3UFEA 3OPCA 4CI2B 4YJ2E 3TUJA 4JBWG 2I6HA 3L3PA 4HFVA 1D1BA 3I9YA 2JJ9A 4C91A 2K3WA 3LK42 4JYAT 2K9AA 4DR2T 4UVCB 1NWMX 1O3XA 1T72A 4I4TE 3FZKB 1UUSA 4KBMB 2X9YA 1L0VA 1N36T 2BG9C 1MNEA 1HG2A 2JIWA 4H9RC 4DNDA 1XMOT 1HNWT 4LF5T 1E1HB 2K5BB 3AEDA 2JQHA 2WMOA 3DJBA 4U2ZA 3UQ4A 1KNRA 2PG8A 2XQYA 5JDMA 5KXJA 1LVKA 2DI4A 5LGNB 2FJAA 1M62A 2PFVA 2BS2A 2ZM6T 2N1GA 4IL4A 4DV4T 2NTYA 2VKJA 4H63H 4HTEA 1I94T 1UX5A 2NR4A 2Q9QB 3I9WA 5FXWA 4OK0A 2DCFA 3KDSE 4CI1B 1X9BA 3C4ZA 3TLUA 3TLVA 2XTLA 3D0TA 1Y01A 2CMRA 3F2EA 3H37A 1SE7A 4AKRB 5JREA 3CQGB 4F6RC 5LHIB 3T8OA 5GONE 4WBNE 4XTCN 3JAFA 3A7MA 4LF9T 1VRBA 4NUVA 1E7PA 3ZPOA 4ILCA 4QXCB 1YXRA 4UIGA 4EAHA 4NXNT 3RYFE 5LGUB 2BZBA 3PUYF 4EXTA 2KWHA 5DJQC 3SOLA 4GK0E 2A72A 3O1JA 2VL0A 3AA0B 4U2YA 1XWMA 4LF6T 4H9OC 3ZKRA 3A5XA 4HFHA 3BQKA 4IE6A 2W63A 4X5TA 3EABA 2UU9T 1KK7A 5HXHA 2WQYA 3FXDB 3N2GE 2D0UA 4ANJA 5F3JA 3OYZA 4IDZA 2MPKA 4DR3T 4CI3B 2AXDS 3B5MA 2VASA 5LA6E 5DQVA 4I55E 5FYMA 4DV3T 3N5LA 3AE2A 4DBQA 3E22E 4HWFA 3LK2B 2IAKA 3GN5B 4X1IE 4Z91A 4TQUN 5L3FB 2GK9A 3HKDE 4X1KE 4A97A 4DV1T 4O4LE 4TWDA 1CUNA 1MMNA 1QLBA 2P9BA 2V7MA 2W62A 3BQIA 3AE3A 3HKEE 4YTMA 5AQOB 1KNPA 4YTPA 2KZ7B 2NWBA 4IIJE 4EGWA 3ZMUB 4DUYT 5HXRA 4JI6T 5ABEA 3I0OA 2UXDT 1SA0E 1FIOA 2I0MA 2IC6A 1W0AA 4TWHA 5AQNB 2XUEA 1J1JA 3K8PC 2YINA 3SFDA 2PJQA 4XBFB 5L47A 3KV5A 2UUAT 2K48A 2LRKA 4EIWA 2WU2A 2C5IT 2VVSA 3EAMA 4PJMA 1FMWA 3ZCJA 2X68A 1WR0A 3O4XE 2X0YA 4EZHA 2DWGA 4X1YE 5AQVB 5JDFA 5L3GB 5IUXA 3UQ7A 2ONKC 5JQGE 2LSIA 4DR7T 4PJNA 2WWVA 2B1EA 3IA3A 1UK5A 1HNZT 2CHOA 3V5UA 4L5GA 1VCTA 4IDPA 2XASB 2W67A 4YMSC 1T98A 2J4GA 3MZKB 4ISSA 4KI0F 2ACXA 4P0BA 2XQ6A 5LBMA 4L0RA 3Q5WA 5J0ZA 4NXMT 3T1HT 3RKOA 1LRZA 2WDQA 4PJJA 3Q5XA 5EK4A 4U74A 1CHUA 2XHEB 4WNKA 3UUBA 3EDVA 4TUYE 5CFBA 5LG4A 4LMKA 1BR4A 3UUMA 1J5ET 1XNRT 1OEDA 1J5WA 3NKZA 3WAKA 3SS1A 5LP6E 3KVAA 3P4QA 2OV9A 2BKPA 2WB5A 4IGUA 3VHLA 4P1NA 3IEEA 3CWZB 2FJEA 4JI2T 4F8HA 3AE7A 4U72A 4JUYA 5ADXL 3PV0G 4GYRA 2LJLA 2IDOB 2NOXA 1GQEA 2ZM2A 3LG7A 2XAHB 3AEEA 3ANWA 3RLFF 1WRDA 2BG9A 2Z6EA 4GK5E 4O4JE 4HWHA 3PJAJ 4QKNA 4ZOLE 5AQFB 3MACA 3P8CD 2H7OA 2BBJA 5L3BB 3J7Yq 2W2UA 4L9IA 3R6NA 2A3DA 2UXNB 4HKAA 5L3CB 3CQCB 4AI6A 4JLEA 5LJNA 3J9X1 2FBWA 3P50A 4KMCA 2KINB 3ZJ1A 3PUVG 4XTCM 4JI3T 2LLYA 4BA9A 4GIWA 3RIAA 4IT4A 3V5SA 1HFAA 2Q9QC 2W00A 4ZI2C 3N9OA 1MMDA 4P0AA 1V9DA 4DVDA 4WBOA 4EEBA 5LXTE 3ZT7A 4KHPT 4MHCA 4DR6T 1T8BA 2V8SV 2A9UA 4PAGA 3ZSTA 4FJOA 4YTNA 3O1HA 4YMUC 2JPFA 3AA7B 4U7IA 5L3DB 2BKOA 3PUWF 2JQ9A 2D2SA 2YOEA 4O2BE 4B3RT 1W09A 3ESLA 3BK9A 5FY1A 3UU5A 3N9PA 5HEGA 1EZ3A 3KV4A 4MLKA 4U7YA 5LG3A 4C90A 3JC6D 4X65T 5EZYE 2BBHA 4UV9B 3CKDA 2LOPA 2CCQA 2X9XA 4HFCA 5LGTB 1M7KA 2HN1A 4IE5A 5DABA 1IAPA 2CWYA 2VKOA 1U4QA 3CIRA 3QB5A 4EZ4A 2LRLA 1SHZC 3ZMTB 2V6YB 2ODUA 3MJXA 5LOVE 4HGAA 4ZI3C 3PE0A 3ETUA 2LM2A 5HCJA 5FXXA 2MYSA 3AEGA 5AQPB 2ZM8A 4ZXLA 3ZYMA 1UCUA 1IBMT 3P4SA 1KNZA 2CLYB 3AE9A 1XNQT 4GKKT 3UFGA 4HFDA 2KSRA 2UXXB 3PUAA 4IHJE 2AE9A 3TKLB 5AFUL 1FJGT 2KT9A 4TV8E 4JI8T 2BDEA 5L4HA 5LJMA 3ZYKA 4TV9E 3SFEA 2CWOA 3F57A 5CB4E 4X20E 2WP9A 4AXPA 4E7ZA 4AKIA 3RX6A 2E9XA 3JC6C 2EHOC 2IMLA 3FBZA 2VKDA 2LHRA 1OWAA 5JVDE 4PNIA 4GOUA 4YFSA 5ETWA 4HFBA 1WR6A 2ODVA 2RA1A 5IHYA 2NW8A 3OBVE 3RGLA 4B6XA 2Y8DA 4YMTB 3CPZA 1MMAA 1MMGA 4AQGA 4EYUA 3QUJA 2F4VT 5FXVA 4LFBT 4UEMA 2E9XD 3LFMA 3NWIA 5AQRB 3LSVA 2BG9E 2WBLA 3HKCE 2JQQA 2NW7A 5FMNA 5FP3A 3RYHE 1D1AA 3PUZG 4J2CA 5HEJA 3N2OA 2YDRA 2SPCA 1HNXT 2CRBA 4QX8B 2UXBT 5JR9C 4WW0A 3LK3B 5C2TA 1S94A 5JRCA 3ETVA 3RIFA 4AQFC 1UURA 1HS7A 2LM9A 2VURA 3NRXA 4TNWA 3C51A 2RPAA 5LHHB 4DUZT 5TAOA 4JI0T 2IW5B 4TNVA 3RI5A 4X64T 2R6GF 2NTXA 4U33A 4DV5T 5KDMC 3KV6A 3AVRA 3FXEB 4IL9A 2XSAA 4JI5T 5LCYA 1KEYA 2N9DA 2L3LA 3KBUA 4KHZF 3P4WA 2WCAA 2LKHA 4H9SE 4UF0A 5AQHB 5FNVE 3S4UA 3ZYLA 5J2UE 4K0UA 4Z90A 1KFYA 3UU3A 4ILUA 2KWIB 3ANWB 2DHRA 3G06A 4MFRA 1YQ3A 1D1CA 4XIGN 2CPTA 3OJAA 3RRWA 4B3TT 3R84B 2Y6XA 3FZHB 3K3NA 5C8YE 4JV5T 4TWFA 2WAUA 2XSBA 3C50A 4ERRA 1E2AA 2KXPB 2YU1A 5BR8T 4HFIA 3UUXB 2EHOB 2MAWA 5JDQA 2LT3A 2XY8B 3CMLA 3AA1B 2JQKA 3E08A 2C5JA 4KP3C 2CXLA 4HN9A 4EOZB 3I0QA 3L09A 3UU4A 4UVAB 4YLHA 4AKGA 3VKGA 3AAAB 4EV6A 4QH5A 4PJLA 4QXBB 2IC9A 2YDQA 3BQLA 3I1AA 5AQSB 3HA4A 3TLTA 4PFOA 2M6IA 4Z8XA 5A1LA 3ONLC 3FB2A 2CA5A 2NP9A 3JAEA 2XAGB 3ZN0B 3NZPA 3UU8A 3KBTA 2Y48B 1X79A 5J2TE 2BKNA 1OEDE 3QOFA 3EHZA 4DIDB 1AJ3A 2E8IA 1WCRA 3LDQB 5FVKA 4O2AE 2J1DG 2XQ3A 4M1PA 4YSXA 2HPJA 2LE8A 4PFPA 2CBIA 1FMVA 3AEFA 3VRBA 1MIVA 2L9QA 4KX6A 4TN7B 4V1Av 3HL6A 3B57A 4Q25A 2A2FX 4TQUM 2WZIA 3AB3B 2MBGA 4UELA 3W15B 4ZEYA 5JDNA 3TUIA 5CJ5A 4ADZA 4DMWA 3PU8A 5F8PA 5L2LA 2BG9B 3ZEFB 2UXCT 2ES0A 1MIYA 3EUHA 5HXSA 5HAXA 4AQFA 1IBLT 3K3OA 2X51A 3ZJ2A 2WDVA 1IBKT 2X0LB 1IJ6A 3A8YC 3VU7H 5HYAA 2DNXA 2X67A 3C4XA 3GWHA 1HG5A 2QVAA 5H6QB 3AE6A 3MXZA 4UVBB 4DV2T 4JBWF 2X0HA 2BVMA 4DBRA 2ZLYA 1WLXA 2WZHA 2YN6A 3HR0A 5ABGA 5LMNT 1LVFA 3FBLA 4CZZB 4B3MT 2OLTA 3JADA 4LMJA 1OXZA 1T7SA 2LSJA 2QYWA 4O8SA 3TLWA 4CN4A 4N78D 5HEOA 1I6ZA 5FXZA 3AE1A 3N9QA 3HI2A 3RC3A 1YW0A 2CBJA 4TZ4C 5CA1E 2YK0A 2M6BA 5ABHA 4BJMA 5JH7E 1VOMA 3HKBE 5JTGA 5LMUT 1JNRA 4UXNB 2VWAA 3C4WA 4NPPA 3N9NA 4I43B 4JI7T 5LYJE 4DR4T 2C0SA 3PU3A 2CE7A 4JEHB 5AQKB 2BS4A 5ABFA 5KX5E 2WMNA 3PUWG 1R8IA 2I59A 1HF8A 3UTKA 3K1SA 3PUGA 5IWAT 4B3ST 4HFEA 4H9NC 3AE8A 5AQIB 1HX1B 3AEAA 1FEWA 3VR8A 4HWIB 4ILBA 5AQMB 3KINB 3NZQA 3ZLIA 2CEAA 2JMKA 5HWYA 3ZC0A 1HX8A 4LF7T 3PJAA 1D0ZA 1ZP0A 4PW8A 3PUXF 1MIWA 2CHNA 2QGSA 3PDYA 4IDNA 4QXHB 4CQIA 4K0KT 2N2NA 4EB6E 2V7JA 4A98A 2Q9QD 3PV0F 4WZXA 1QSDA 3RQWA 3L39A 4PK6A 4P09A 3NVOA 2CXFA 3AECA 1H7CA 2VVNA 2DL1A 1BR0A 3VR9A 3H3MA 3ZT5A 1XMQT 1XDPA 3F31A 3KV9A 3C98B 2R6GG 2FUPA 3E0ZA 3ONXA 3AE4A 3EI0A 3PTRB 4G63A 2Q9QA 2CXDA 3U78A 4QX7B 4YSZA 2E2AA 4JEUB 3RYIE 1ZOYA 3OYXA 4IREA 3VKHA 1D0XA 2X9HA 3OTOT 2YEVC 5C3JA 4AIUA 4EYYR 5JR9B 1Z8UA 3C64A 5JDHA 2B76A 3K3QC 2C5KT 1XZYA 2MTQA 4ILAA 4YJ3E 2V5DA 2VK9A 3ONJA 1YQ4A 3RYCE 3AXJB 3QNUA 4E7SA 1UGOA 4QHOA 5FKYA 4YT0A 5L4EA 3FZFB 3RKGA 4AKHA 3RH3A 3MK7C 2XM1A 4X62T 1LKXA 4UR9A 2E9XB 3RRCA 1U5PA 4CN6A 5ABFB 2UUBT 5L3EB 2UUCT 3M65A 4JI1T 2KNDA 3N2KE 3VRAA 5J1GA 3ZT6A 1NENA 4QWNB 4AKLA 3RPUA 3AVSA 4IDOA 4DO0A 4WYVA 3WI3A 5FVLA 2EHOD 4H9QC 2E5LT 4DR1T 1N34T 5HXEA 5FY0A 5HXCA 2XAQB 2XAJB 2JRKA 2LEHA 3D31C 4CN1A 3CX8B 1W0BA 5FL0A 2PBIA 2H89A 2ZM0A 4XAXB 2WDRA 3IHRA 3PUYG 1S35A 2E9XC 3AE5A 2D0TA 4G2AA 4CXYA 2CLYC 2EHOA 4IE7A 3RIUA 3T1YT 1G8XA 4YMWC 1WFDA 3IF8B 2XQAA 3KVBA 3NBXX 3P4PA 4DV6T 2HHHT 4U3CA 2JMHA 1QUUA 2E5VA 4ZI2D
chains in the Genus database with same CATH topology
3PUYF 4YMVC 4KI0G 3PUZG 3PV0F 4KHZG 4XIGN 3PUVF 3PUXG 3RLFG 4YMUC 3PV0G 3PUZF 4TQUM 3PUWF 2R6GG 3TUIA 3RLFF 2ONKC 3D31C 4XIGM 3TUZA 3PUWG 2R6GF 3TUJA 4JBWG 3DHWA 4YMSC 3PUYG 4KI0F 4XTCN 4TQUN 4YMTB 4KHZF 4YMWC 4XTCM 3PUVG 4JBWF 3PUXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY F;  4YMV C;  4KI0 G;  3PUZ G;  3PV0 F;  4KHZ G;  4XIG N;  3PUV F;  3PUX G;  3RLF G;  4YMU C;  3PV0 G;  3PUZ F;  4TQU M;  3PUW F;  2R6G G;  3TUI A;  3RLF F;  2ONK C;  3D31 C;  4XIG M;  3TUZ A;  3PUW G;  2R6G F;  3TUJ A;  4JBW G;  3DHW A;  4YMS C;  3PUY G;  4KI0 F;  4XTC N;  4TQU N;  4YMT B;  4KHZ F;  4YMW C;  4XTC M;  3PUV G;  4JBW F;  3PUX F; 
#chains in the Genus database with same CATH topology
 2VL8 A;  4KI0 G;  3NRY A;  2FJD A;  1ZKE A;  4H9P C;  5JDL A;  1HCI A;  5EK3 A;  4KHZ G;  1YKH B;  3ZSS A;  4HE8 A;  5AQT B;  3Q2M A;  2W66 A;  3B13 A;  5AQQ B;  3OKQ A;  3RF1 A;  2WSS V;  3UUL A;  5CGM A;  1JNZ A;  1WYB A;  2YU2 A;  2J47 A;  2WU5 A;  2LSY A;  3ZMZ B;  4DV0 T;  2XQ8 A;  4GYS A;  1HTJ F;  4CXX A;  3LBX A;  5IYZ E;  2WM9 A;  4AIS A;  5JDG A;  3RC8 A;  3CQX C;  2KMF A;  3U3I A;  1ZEE A;  3RQU A;  4A5X A;  4YXD A;  5AQJ B;  3UUN A;  2H88 A;  4FI5 A;  2W61 A;  3TLS A;  2M67 A;  3FZM B;  2VQE T;  2XQ7 A;  3PUR A;  4OYK A;  2IHR 1;  4ZS3 A;  3EDU A;  2XJ7 A;  1HR0 T;  2D5U A;  2DLR A;  3AEB A;  1NEK A;  2D9D A;  3EVY A;  4H63 V;  3UT5 E;  3RHW A;  2MOZ A;  2XQ4 A;  4BJN A;  4DR5 T;  2WS3 A;  4OX9 T;  3ZMV B;  3P7I A;  4IST A;  2VQF T;  4UV8 B;  4I50 E;  5AQU B;  3ZMS B;  3O9X A;  1Z0P A;  3QK6 A;  3PUV F;  3DTO A;  4O4H E;  4TX5 A;  2X66 A;  1US7 B;  2V6Y A;  3CVR A;  3MA9 A;  1Y64 B;  4LML A;  2BVL A;  3H3A A;  4HWD A;  3QB5 K;  3PUQ A;  3AAE B;  5FY7 A;  3X1D A;  4MBQ A;  1ZV4 X;  2IIU A;  2RP4 A;  5DQW A;  3DP7 A;  3Q5D A;  1W9R A;  2FJB A;  3Q5E A;  3QC9 A;  2QRX A;  2W4X A;  5AQG B;  3ABV A;  1N33 T;  1OED B;  1WYC A;  2LOS A;  5AQL B;  4XIG M;  1G73 A;  2V7K A;  4O4I E;  5KMG P;  1B7T A;  2XZE A;  2LHN A;  2HH7 A;  1UX4 A;  2V26 A;  2WY2 A;  4KUM B;  4NIQ A;  3ZCI A;  3ZN1 B;  5HWX A;  1YKE B;  4UF0 B;  5LBQ B;  4ZS2 A;  4LF4 T;  2LKG A;  2V6X A;  3CX6 B;  4ASK A;  3P4R A;  5HEU A;  5HEH A;  4ZI3 D;  2BS3 A;  4YMV C;  4LFC T;  2J62 A;  2DWK A;  2QA7 A;  1IJ5 A;  3SWH A;  5E0O A;  4DV7 T;  2H3R A;  3M3Z B;  2V1D B;  2VKH A;  4HEA A;  2WWU A;  4ZZC A;  3RLF G;  1KF6 A;  4HWC A;  5CA0 E;  5BMV E;  4ZHQ E;  3N9M A;  4BAY B;  4OHF A;  2V7L A;  4I0U A;  4IE0 A;  2G0U A;  4ZI7 E;  2V7I A;  4A56 A;  4NUU A;  5JRC B;  5EK2 A;  5LNK A;  4U31 A;  3JCF A;  2ACZ A;  3IBP A;  4LF8 T;  1IZN B;  2PTF A;  3L8R A;  2YKS A;  2HPL A;  2XM2 A;  3Q9D A;  3O1I A;  3PUS A;  4AQY T;  5JR9 A;  3AA6 B;  4YHJ A;  3DHW A;  4QH1 A;  4YY3 T;  2X9W A;  4YHH T;  2LSK A;  1BR1 A;  2OA5 A;  2W0G A;  5H6R B;  4PK4 A;  4IDQ A;  4EED A;  2V5C A;  4MAL A;  3GN5 A;  4COF A;  2XPK A;  5M4Y A;  2K24 A;  5F5W A;  1ZHC A;  5LHG B;  5FL1 A;  3MKD A;  2KLQ A;  2CM0 A;  2XQ9 A;  4X66 T;  3ZC1 A;  4CXW A;  4GKJ T;  3SRZ A;  3WAJ A;  1N32 T;  2LSG A;  4PK5 A;  5HCM A;  3AAI A;  1YD8 G;  2HN2 A;  3PUX G;  3LJC A;  2H7V C;  2YDS A;  3OVU A;  1BR2 A;  4LFA T;  2IUB A;  4IE4 A;  4JI4 T;  1D0Y A;  3GMI A;  3PUZ F;  3CX7 B;  3KFW X;  4QH4 A;  1OED C;  1XDO A;  1MND A;  2L8K A;  3N9L A;  3FHN A;  3FZL B;  3GA8 A;  2VB6 A;  4OYJ A;  4XZC A;  3UU6 A;  2XAF B;  3LBX B;  4OFZ A;  2NW9 A;  4DMV A;  4YSY A;  1DU2 A;  2XQ5 A;  2ZMA A;  3AXJ A;  3CK6 A;  5LB7 B;  3RIU C;  1NAF A;  4ZZB A;  1VCS A;  3TUZ A;  1SUM B;  3UFE A;  3OPC A;  4CI2 B;  4YJ2 E;  3TUJ A;  4JBW G;  2I6H A;  3L3P A;  4HFV A;  1D1B A;  3I9Y A;  2JJ9 A;  4C91 A;  2K3W A;  3LK4 2;  4JYA T;  2K9A A;  4DR2 T;  4UVC B;  1NWM X;  1O3X A;  1T72 A;  4I4T E;  3FZK B;  1UUS A;  4KBM B;  2X9Y A;  1L0V A;  1N36 T;  2BG9 C;  1MNE A;  1HG2 A;  2JIW A;  4H9R C;  4DND A;  1XMO T;  1HNW T;  4LF5 T;  1E1H B;  2K5B B;  3AED A;  2JQH A;  2WMO A;  3DJB A;  4U2Z A;  3UQ4 A;  1KNR A;  2PG8 A;  2XQY A;  5JDM A;  5KXJ A;  1LVK A;  2DI4 A;  5LGN B;  2FJA A;  1M62 A;  2PFV A;  2BS2 A;  2ZM6 T;  2N1G A;  4IL4 A;  4DV4 T;  2NTY A;  2VKJ A;  4H63 H;  4HTE A;  1I94 T;  1UX5 A;  2NR4 A;  2Q9Q B;  3I9W A;  5FXW A;  4OK0 A;  2DCF A;  3KDS E;  4CI1 B;  1X9B A;  3C4Z A;  3TLU A;  3TLV A;  2XTL A;  3D0T A;  1Y01 A;  2CMR A;  3F2E A;  3H37 A;  1SE7 A;  4AKR B;  5JRE A;  3CQG B;  4F6R C;  5LHI B;  3T8O A;  5GON E;  4WBN E;  4XTC N;  3JAF A;  3A7M A;  4LF9 T;  1VRB A;  4NUV A;  1E7P A;  3ZPO A;  4ILC A;  4QXC B;  1YXR A;  4UIG A;  4EAH A;  4NXN T;  3RYF E;  5LGU B;  2BZB A;  3PUY F;  4EXT A;  2KWH A;  5DJQ C;  3SOL A;  4GK0 E;  2A72 A;  3O1J A;  2VL0 A;  3AA0 B;  4U2Y A;  1XWM A;  4LF6 T;  4H9O C;  3ZKR A;  3A5X A;  4HFH A;  3BQK A;  4IE6 A;  2W63 A;  4X5T A;  3EAB A;  2UU9 T;  1KK7 A;  5HXH A;  2WQY A;  3FXD B;  3N2G E;  2D0U A;  4ANJ A;  5F3J A;  3OYZ A;  4IDZ A;  2MPK A;  4DR3 T;  4CI3 B;  2AXD S;  3B5M A;  2VAS A;  5LA6 E;  5DQV A;  4I55 E;  5FYM A;  4DV3 T;  3N5L A;  3AE2 A;  4DBQ A;  3E22 E;  4HWF A;  3LK2 B;  2IAK A;  3GN5 B;  4X1I E;  4Z91 A;  4TQU N;  5L3F B;  2GK9 A;  3HKD E;  4X1K E;  4A97 A;  4DV1 T;  4O4L E;  4TWD A;  1CUN A;  1MMN A;  1QLB A;  2P9B A;  2V7M A;  2W62 A;  3BQI A;  3AE3 A;  3HKE E;  4YTM A;  5AQO B;  1KNP A;  4YTP A;  2KZ7 B;  2NWB A;  4IIJ E;  4EGW A;  3ZMU B;  4DUY T;  5HXR A;  4JI6 T;  5ABE A;  3I0O A;  2UXD T;  1SA0 E;  1FIO A;  2I0M A;  2IC6 A;  1W0A A;  4TWH A;  5AQN B;  2XUE A;  1J1J A;  3K8P C;  2YIN A;  3SFD A;  2PJQ A;  4XBF B;  5L47 A;  3KV5 A;  2UUA T;  2K48 A;  2LRK A;  4EIW A;  2WU2 A;  2C5I T;  2VVS A;  3EAM A;  4PJM A;  1FMW A;  3ZCJ A;  2X68 A;  1WR0 A;  3O4X E;  2X0Y A;  4EZH A;  2DWG A;  4X1Y E;  5AQV B;  5JDF A;  5L3G B;  5IUX A;  3UQ7 A;  2ONK C;  5JQG E;  2LSI A;  4DR7 T;  4PJN A;  2WWV A;  2B1E A;  3IA3 A;  1UK5 A;  1HNZ T;  2CHO A;  3V5U A;  4L5G A;  1VCT A;  4IDP A;  2XAS B;  2W67 A;  4YMS C;  1T98 A;  2J4G A;  3MZK B;  4ISS A;  4KI0 F;  2ACX A;  4P0B A;  2XQ6 A;  5LBM A;  4L0R A;  3Q5W A;  5J0Z A;  4NXM T;  3T1H T;  3RKO A;  1LRZ A;  2WDQ A;  4PJJ A;  3Q5X A;  5EK4 A;  4U74 A;  1CHU A;  2XHE B;  4WNK A;  3UUB A;  3EDV A;  4TUY E;  5CFB A;  5LG4 A;  4LMK A;  1BR4 A;  3UUM A;  1J5E T;  1XNR T;  1OED A;  1J5W A;  3NKZ A;  3WAK A;  3SS1 A;  5LP6 E;  3KVA A;  3P4Q A;  2OV9 A;  2BKP A;  2WB5 A;  4IGU A;  3VHL A;  4P1N A;  3IEE A;  3CWZ B;  2FJE A;  4JI2 T;  4F8H A;  3AE7 A;  4U72 A;  4JUY A;  5ADX L;  3PV0 G;  4GYR A;  2LJL A;  2IDO B;  2NOX A;  1GQE A;  2ZM2 A;  3LG7 A;  2XAH B;  3AEE A;  3ANW A;  3RLF F;  1WRD A;  2BG9 A;  2Z6E A;  4GK5 E;  4O4J E;  4HWH A;  3PJA J;  4QKN A;  4ZOL E;  5AQF B;  3MAC A;  3P8C D;  2H7O A;  2BBJ A;  5L3B B;  3J7Y q;  2W2U A;  4L9I A;  3R6N A;  2A3D A;  2UXN B;  4HKA A;  5L3C B;  3CQC B;  4AI6 A;  4JLE A;  5LJN A;  3J9X 1;  2FBW A;  3P50 A;  4KMC A;  2KIN B;  3ZJ1 A;  3PUV G;  4XTC M;  4JI3 T;  2LLY A;  4BA9 A;  4GIW A;  3RIA A;  4IT4 A;  3V5S A;  1HFA A;  2Q9Q C;  2W00 A;  4ZI2 C;  3N9O A;  1MMD A;  4P0A A;  1V9D A;  4DVD A;  4WBO A;  4EEB A;  5LXT E;  3ZT7 A;  4KHP T;  4MHC A;  4DR6 T;  1T8B A;  2V8S V;  2A9U A;  4PAG A;  3ZST A;  4FJO A;  4YTN A;  3O1H A;  4YMU C;  2JPF A;  3AA7 B;  4U7I A;  5L3D B;  2BKO A;  3PUW F;  2JQ9 A;  2D2S A;  2YOE A;  4O2B E;  4B3R T;  1W09 A;  3ESL A;  3BK9 A;  5FY1 A;  3UU5 A;  3N9P A;  5HEG A;  1EZ3 A;  3KV4 A;  4MLK A;  4U7Y A;  5LG3 A;  4C90 A;  3JC6 D;  4X65 T;  5EZY E;  2BBH A;  4UV9 B;  3CKD A;  2LOP A;  2CCQ A;  2X9X A;  4HFC A;  5LGT B;  1M7K A;  2HN1 A;  4IE5 A;  5DAB A;  1IAP A;  2CWY A;  2VKO A;  1U4Q A;  3CIR A;  3QB5 A;  4EZ4 A;  2LRL A;  1SHZ C;  3ZMT B;  2V6Y B;  2ODU A;  3MJX A;  5LOV E;  4HGA A;  4ZI3 C;  3PE0 A;  3ETU A;  2LM2 A;  5HCJ A;  5FXX A;  2MYS A;  3AEG A;  5AQP B;  2ZM8 A;  4ZXL A;  3ZYM A;  1UCU A;  1IBM T;  3P4S A;  1KNZ A;  2CLY B;  3AE9 A;  1XNQ T;  4GKK T;  3UFG A;  4HFD A;  2KSR A;  2UXX B;  3PUA A;  4IHJ E;  2AE9 A;  3TKL B;  5AFU L;  1FJG T;  2KT9 A;  4TV8 E;  4JI8 T;  2BDE A;  5L4H A;  5LJM A;  3ZYK A;  4TV9 E;  3SFE A;  2CWO A;  3F57 A;  5CB4 E;  4X20 E;  2WP9 A;  4AXP A;  4E7Z A;  4AKI A;  3RX6 A;  2E9X A;  3JC6 C;  2EHO C;  2IML A;  3FBZ A;  2VKD A;  2LHR A;  1OWA A;  5JVD E;  4PNI A;  4GOU A;  4YFS A;  5ETW A;  4HFB A;  1WR6 A;  2ODV A;  2RA1 A;  5IHY A;  2NW8 A;  3OBV E;  3RGL A;  4B6X A;  2Y8D A;  4YMT B;  3CPZ A;  1MMA A;  1MMG A;  4AQG A;  4EYU A;  3QUJ A;  2F4V T;  5FXV A;  4LFB T;  4UEM A;  2E9X D;  3LFM A;  3NWI A;  5AQR B;  3LSV A;  2BG9 E;  2WBL A;  3HKC E;  2JQQ A;  2NW7 A;  5FMN A;  5FP3 A;  3RYH E;  1D1A A;  3PUZ G;  4J2C A;  5HEJ A;  3N2O A;  2YDR A;  2SPC A;  1HNX T;  2CRB A;  4QX8 B;  2UXB T;  5JR9 C;  4WW0 A;  3LK3 B;  5C2T A;  1S94 A;  5JRC A;  3ETV A;  3RIF A;  4AQF C;  1UUR A;  1HS7 A;  2LM9 A;  2VUR A;  3NRX A;  4TNW A;  3C51 A;  2RPA A;  5LHH B;  4DUZ T;  5TAO A;  4JI0 T;  2IW5 B;  4TNV A;  3RI5 A;  4X64 T;  2R6G F;  2NTX A;  4U33 A;  4DV5 T;  5KDM C;  3KV6 A;  3AVR A;  3FXE B;  4IL9 A;  2XSA A;  4JI5 T;  5LCY A;  1KEY A;  2N9D A;  2L3L A;  3KBU A;  4KHZ F;  3P4W A;  2WCA A;  2LKH A;  4H9S E;  4UF0 A;  5AQH B;  5FNV E;  3S4U A;  3ZYL A;  5J2U E;  4K0U A;  4Z90 A;  1KFY A;  3UU3 A;  4ILU A;  2KWI B;  3ANW B;  2DHR A;  3G06 A;  4MFR A;  1YQ3 A;  1D1C A;  4XIG N;  2CPT A;  3OJA A;  3RRW A;  4B3T T;  3R84 B;  2Y6X A;  3FZH B;  3K3N A;  5C8Y E;  4JV5 T;  4TWF A;  2WAU A;  2XSB A;  3C50 A;  4ERR A;  1E2A A;  2KXP B;  2YU1 A;  5BR8 T;  4HFI A;  3UUX B;  2EHO B;  2MAW A;  5JDQ A;  2LT3 A;  2XY8 B;  3CML A;  3AA1 B;  2JQK A;  3E08 A;  2C5J A;  4KP3 C;  2CXL A;  4HN9 A;  4EOZ B;  3I0Q A;  3L09 A;  3UU4 A;  4UVA B;  4YLH A;  4AKG A;  3VKG A;  3AAA B;  4EV6 A;  4QH5 A;  4PJL A;  4QXB B;  2IC9 A;  2YDQ A;  3BQL A;  3I1A A;  5AQS B;  3HA4 A;  3TLT A;  4PFO A;  2M6I A;  4Z8X A;  5A1L A;  3ONL C;  3FB2 A;  2CA5 A;  2NP9 A;  3JAE A;  2XAG B;  3ZN0 B;  3NZP A;  3UU8 A;  3KBT A;  2Y48 B;  1X79 A;  5J2T E;  2BKN A;  1OED E;  3QOF A;  3EHZ A;  4DID B;  1AJ3 A;  2E8I A;  1WCR A;  3LDQ B;  5FVK A;  4O2A E;  2J1D G;  2XQ3 A;  4M1P A;  4YSX A;  2HPJ A;  2LE8 A;  4PFP A;  2CBI A;  1FMV A;  3AEF A;  3VRB A;  1MIV A;  2L9Q A;  4KX6 A;  4TN7 B;  4V1A v;  3HL6 A;  3B57 A;  4Q25 A;  2A2F X;  4TQU M;  2WZI A;  3AB3 B;  2MBG A;  4UEL A;  3W15 B;  4ZEY A;  5JDN A;  3TUI A;  5CJ5 A;  4ADZ A;  4DMW A;  3PU8 A;  5F8P A;  5L2L A;  2BG9 B;  3ZEF B;  2UXC T;  2ES0 A;  1MIY A;  3EUH A;  5HXS A;  5HAX A;  4AQF A;  1IBL T;  3K3O A;  2X51 A;  3ZJ2 A;  2WDV A;  1IBK T;  2X0L B;  1IJ6 A;  3A8Y C;  3VU7 H;  5HYA A;  2DNX A;  2X67 A;  3C4X A;  3GWH A;  1HG5 A;  2QVA A;  5H6Q B;  3AE6 A;  3MXZ A;  4UVB B;  4DV2 T;  4JBW F;  2X0H A;  2BVM A;  4DBR A;  2ZLY A;  1WLX A;  2WZH A;  2YN6 A;  3HR0 A;  5ABG A;  5LMN T;  1LVF A;  3FBL A;  4CZZ B;  4B3M T;  2OLT A;  3JAD A;  4LMJ A;  1OXZ A;  1T7S A;  2LSJ A;  2QYW A;  4O8S A;  3TLW A;  4CN4 A;  4N78 D;  5HEO A;  1I6Z A;  5FXZ A;  3AE1 A;  3N9Q A;  3HI2 A;  3RC3 A;  1YW0 A;  2CBJ A;  4TZ4 C;  5CA1 E;  2YK0 A;  2M6B A;  5ABH A;  4BJM A;  5JH7 E;  1VOM A;  3HKB E;  5JTG A;  5LMU T;  1JNR A;  4UXN B;  2VWA A;  3C4W A;  4NPP A;  3N9N A;  4I43 B;  4JI7 T;  5LYJ E;  4DR4 T;  2C0S A;  3PU3 A;  2CE7 A;  4JEH B;  5AQK B;  2BS4 A;  5ABF A;  5KX5 E;  2WMN A;  3PUW G;  1R8I A;  2I59 A;  1HF8 A;  3UTK A;  3K1S A;  3PUG A;  5IWA T;  4B3S T;  4HFE A;  4H9N C;  3AE8 A;  5AQI B;  1HX1 B;  3AEA A;  1FEW A;  3VR8 A;  4HWI B;  4ILB A;  5AQM B;  3KIN B;  3NZQ A;  3ZLI A;  2CEA A;  2JMK A;  5HWY A;  3ZC0 A;  1HX8 A;  4LF7 T;  3PJA A;  1D0Z A;  1ZP0 A;  4PW8 A;  3PUX F;  1MIW A;  2CHN A;  2QGS A;  3PDY A;  4IDN A;  4QXH B;  4CQI A;  4K0K T;  2N2N A;  4EB6 E;  2V7J A;  4A98 A;  2Q9Q D;  3PV0 F;  4WZX A;  1QSD A;  3RQW A;  3L39 A;  4PK6 A;  4P09 A;  3NVO A;  2CXF A;  3AEC A;  1H7C A;  2VVN A;  2DL1 A;  1BR0 A;  3VR9 A;  3H3M A;  3ZT5 A;  1XMQ T;  1XDP A;  3F31 A;  3KV9 A;  3C98 B;  2R6G G;  2FUP A;  3E0Z A;  3ONX A;  3AE4 A;  3EI0 A;  3PTR B;  4G63 A;  2Q9Q A;  2CXD A;  3U78 A;  4QX7 B;  4YSZ A;  2E2A A;  4JEU B;  3RYI E;  1ZOY A;  3OYX A;  4IRE A;  3VKH A;  1D0X A;  2X9H A;  3OTO T;  2YEV C;  5C3J A;  4AIU A;  4EYY R;  5JR9 B;  1Z8U A;  3C64 A;  5JDH A;  2B76 A;  3K3Q C;  2C5K T;  1XZY A;  2MTQ A;  4ILA A;  4YJ3 E;  2V5D A;  2VK9 A;  3ONJ A;  1YQ4 A;  3RYC E;  3AXJ B;  3QNU A;  4E7S A;  1UGO A;  4QHO A;  5FKY A;  4YT0 A;  5L4E A;  3FZF B;  3RKG A;  4AKH A;  3RH3 A;  3MK7 C;  2XM1 A;  4X62 T;  1LKX A;  4UR9 A;  2E9X B;  3RRC A;  1U5P A;  4CN6 A;  5ABF B;  2UUB T;  5L3E B;  2UUC T;  3M65 A;  4JI1 T;  2KND A;  3N2K E;  3VRA A;  5J1G A;  3ZT6 A;  1NEN A;  4QWN B;  4AKL A;  3RPU A;  3AVS A;  4IDO A;  4DO0 A;  4WYV A;  3WI3 A;  5FVL A;  2EHO D;  4H9Q C;  2E5L T;  4DR1 T;  1N34 T;  5HXE A;  5FY0 A;  5HXC A;  2XAQ B;  2XAJ B;  2JRK A;  2LEH A;  3D31 C;  4CN1 A;  3CX8 B;  1W0B A;  5FL0 A;  2PBI A;  2H89 A;  2ZM0 A;  4XAX B;  2WDR A;  3IHR A;  3PUY G;  1S35 A;  2E9X C;  3AE5 A;  2D0T A;  4G2A A;  4CXY A;  2CLY C;  2EHO A;  4IE7 A;  3RIU A;  3T1Y T;  1G8X A;  4YMW C;  1WFD A;  3IF8 B;  2XQA A;  3KVB A;  3NBX X;  3P4P A;  4DV6 T;  2HHH T;  4U3C A;  2JMH A;  1QUU A;  2E5V A;  4ZI2 D; 
#chains in the Genus database with same CATH homology
 3PUY F;  4YMV C;  4KI0 G;  3PUZ G;  3PV0 F;  4KHZ G;  4XIG N;  3PUV F;  3PUX G;  3RLF G;  4YMU C;  3PV0 G;  3PUZ F;  4TQU M;  3PUW F;  2R6G G;  3TUI A;  3RLF F;  2ONK C;  3D31 C;  4XIG M;  3TUZ A;  3PUW G;  2R6G F;  3TUJ A;  4JBW G;  3DHW A;  4YMS C;  3PUY G;  4KI0 F;  4XTC N;  4TQU N;  4YMT B;  4KHZ F;  4YMW C;  4XTC M;  3PUV G;  4JBW F;  3PUX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...