3PUWF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 155
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puwF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puwF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puwF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puwF02
3PUZG 3PUXF 4JBWF 4XIGM 3PUYF 4JBWG 3PUWF 3PUXG 3DHWA 4XTCM 3PUYG 4YMUC 4TQUM 3PUWG 4KHZF 3TUJA 4XIGN 2R6GF 3TUIA 2ONKC 4KHZG 4YMTB 2R6GG 4XTCN 3PUVF 4TQUN 3PV0F 3PUVG 3TUZA 4YMWC 3PV0G 4YMSC 4KI0F 3RLFF 3D31C 4YMVC 3PUZF 4KI0G 3RLFG
chains in the Genus database with same CATH superfamily
5L3GB 3I0QA 4LF4T 3ETUA 4TQUM 1SUMB 4KUMB 4ZI7E 5JTGA 2CLYC 2K9AA 3IEEA 4OYKA 5AQOB 1XDPA 4TWDA 5LGNB 2WZIA 4P09A 3FZMB 4NPPA 5AQKB 4YTNA 2WWVA 1J1JA 1SHZC 5JDQA 2UXCT 5IYZE 2ODVA 2BG9C 5F8PA 1D0YA 1WR6A 2BKOA 4QX8B 1MMDA 2NTYA 2QVAA 3I0OA 5J2UE 2B1EA 3FZHB 2H88A 3LBXA 1G73A 2MTQA 3RHWA 3KV6A 3I9WA 3UU5A 3OYZA 2UXXB 1CHUA 4EZ4A 4HTEA 3IHRA 2DL1A 4UVBB 5J1GA 5EZYE 2FJDA 1MMAA 3PDYA 2BVLA 5AQSB 2V5CA 1OXZA 2D9DA 3ZMTB 5AQUB 1E1HB 3L09A 1YD8G 2Y6XA 3QB5A 4DV6T 3AEGA 5FKYA 2W00A 4XTCM 1WFDA 3AAIA 4XIGN 4JEUB 3MZKB 2D2SA 4IE5A 5HCJA 3NBXX 4U2YA 3X1DA 4QHOA 2ZM6T 3PUSA 3EAMA 4HWCA 4PK5A 4O4HE 2KINB 4BA9A 2J47A 4JV5T 4UVAB 2ES0A 4EGWA 4C91A 2WU2A 4O4IE 4GYSA 3FXEB 5LMUT 1WYBA 2JPFA 4DR2T 1UX4A 3RC8A 5L3FB 5FY0A 1HNWT 2VASA 3F57A 5CA0E 5LBMA 3U3IA 4DR1T 3T1HT 4ZXLA 2E8IA 1H7CA 2XQ9A 5HEJA 2LSJA 2GK9A 3TUJA 1HX1B 3CQGB 3SOLA 4ZEYA 4JI3T 3RPUA 4DV7T 3MACA 3O1IA 2RA1A 3TLUA 3UUNA 2NWBA 3JCFA 3ONXA 4JI7T 4WYVA 4UELA 2XHEB 5AQGB 2XZEA 2CE7A 1KNZA 1ZOYA 1SE7A 3OBVE 1J5WA 3LDQB 4HKAA 5FXVA 2XQ5A 2ACZA 3E08A 2YDRA 3RYCE 3OYXA 4ISSA 2DWKA 4U74A 3ESLA 1HFAA 1IZNB 4DBRA 2WU5A 5HCMA 3PUGA 5L47A 1XWMA 4QH5A 4QH1A 3TLSA 1MNDA 5JR9C 2M6BA 3ZC1A 5AQNB 2JQKA 3LJCA 1YW0A 4NXMT 1HR0T 1D0ZA 4L9IA 3C4ZA 5JH7E 2W61A 5HEHA 3IF8B 3KBUA 2NOXA 1QLBA 1D0XA 2WWUA 3RQWA 3T8OA 4A98A 2VQFT 5HXCA 4EV6A 2JJ9A 5F3JA 2UXBT 1IBMT 3DTOA 4MLKA 3AEDA 5ADXL 4IL9A 4OX9T 2DCFA 2DWGA 4H9OC 5L3DB 2WP9A 2A3DA 3RRWA 1N32T 4YSZA 4U72A 4CI2B 3AA0B 2M67A 2SPCA 4V1Av 1MMGA 2KMFA 3MXZA 2K48A 3P7IA 4ZS2A 2UUCT 5KXJA 3AECA 3C4XA 3AE6A 3HKBE 2H7OA 3QOFA 3K1SA 3PURA 3VHLA 3HKCE 4PJLA 3PUWF 2A9UA 2YK0A 3P4RA 2K3WA 2R6GF 4L0RA 5JDGA 2VK9A 4WW0A 2V7IA 5CGMA 4AQFA 3CKDA 3ZLIA 5F5WA 3UU6A 1W0BA 1MIYA 2NP9A 4COFA 4HFIA 1XMOT 2JIWA 2YN6A 3UFEA 3CQXC 3JC6C 4B3ST 5FVKA 3PJAA 4HFVA 3VRBA 3PUVF 5CA1E 4QXCB 4TV8E 2CXLA 4AQYT 4EAHA 3N2GE 4JI6T 1ZEEA 4ZI3C 2E2AA 3RKOA 4X5TA 3WAJA 3LK3B 4YY3T 3AAEB 4YJ2E 5CB4E 3CMLA 2KLQA 4HWFA 3V5SA 2YEVC 4CN1A 1T8BA 4TNWA 3RGLA 1Y64B 5LMNT 4YTMA 2OV9A 2NW7A 1ZKEA 2M6IA 4TV9E 3PUZF 5JDHA 4A56A 4MBQA 2ZM8A 2V5DA 4TWFA 1MNEA 5CJ5A 2LSIA 4TZ4C 4CXXA 3ZEFB 3KV9A 3HA4A 1CUNA 5LGTB 5AQIB 1HNXT 1UURA 2XAHB 3JADA 4B3RT 2EHOB 4U2ZA 4JBWG 4ERRA 3PUYG 2Q9QD 2UUBT 2UXDT 2Q9QC 4X65T 3TUIA 1Y01A 4JI4T 1IBLT 5KX5E 3B13A 5J2TE 2W67A 2FJEA 5DJQC 3C51A 4X1YE 4PFPA 4HN9A 4H63V 1OEDC 3N2OA 1UUSA 2CXDA 2XM1A 2E5VA 2IUBA 1YKEB 2W2UA 4LMKA 4U7IA 2LRLA 3KV4A 2IC9A 3ZMVB 3NRXA 1S35A 2CWYA 3M3ZB 2WAUA 3ZJ1A 2ACXA 2W4XA 2H3RA 3AA7B 4PAGA 2CEAA 1FJGT 4DV2T 5FL1A 4NXNT 4LFBT 2HH7A 2Z6EA 5JVDE 1NEKA 4LF6T 4KHZG 3HL6A 3EVYA 1YKHB 3P4QA 3ZSTA 4TN7B 3UUBA 3N9QA 3AB3B 5DQVA 3O4XE 5BR8T 3A5XA 2DNXA 2YDSA 4HFCA 4YLHA 4K0KT 4IDOA 4UIGA 4IDQA 3FBZA 2C0SA 2VKDA 3LSVA 4AKIA 4WZXA 3G06A 2WDQA 4HFDA 2CWOA 2HPJA 2IAKA 3EDVA 2MPKA 2X9XA 3F31A 3MA9A 2NTXA 2QRXA 2MYSA 4XAXB 4IT4A 3RC3A 1HNZT 2D0UA 4N78D 5FYMA 5HXEA 2K24A 3TUZA 2EHOA 2LT3A 4DUYT 2BS2A 4CI1B 2G0UA 1UCUA 4LFAT 4OHFA 3RLFG 3ZT5A 3J7Yq 2OA5A 1I94T 4YFSA 3P4PA 2HHHT 3C50A 1UGOA 3EI0A 3FXDB 3N2KE 3NWIA 2VVNA 3PV0G 2NW9A 5FNVE 3EDUA 4XBFB 2WDRA 3FZFB 1SA0E 4HFEA 2PTFA 2LRKA 1FIOA 2CM0A 3RIUA 1Z0PA 1MIWA 1XZYA 2V7MA 3N9NA 1QSDA 2XSBA 4HGAA 5C3JA 3EHZA 2X0HA 1WCRA 2IMLA 2CXFA 2Y8DA 3PE0A 3UFGA 5AQJB 3OKQA 3A8YC 3UQ7A 2J1DG 1ZHCA 2X0YA 3AA6B 4BJNA 5EK3A 5L4HA 2VKHA 4Z90A 4M1PA 1R8IA 4L5GA 5LNKA 5LG3A 3CK6A 5DABA 5ABHA 2LM2A 3JAFA 3AEAA 4EEDA 2N9DA 2LHNA 2N1GA 1YXRA 2JRKA 2LOSA 5FP3A 3CQCB 3ZN1B 5EK4A 1ZP0A 5AFUL 2KXPB 3Q9DA 5DQWA 1D1AA 4JI1T 4LMJA 4WNKA 2HN2A 3K3NA 3KINB 3BQLA 2JQQA 2LLYA 1D1CA 1LVFA 1E2AA 1HS7A 4CQIA 4PJNA 4PW8A 1D1BA 4NIQA 4I43B 4U7YA 3WI3A 4ZI2D 4YMTB 5L2LA 3HKEE 4ZI2C 4U31A 3Q5DA 3ZMZB 4PNIA 2VURA 4EYYR 4X62T 5M4YA 3ANWB 1XMQT 2FJAA 3DJBA 5C2TA 2KT9A 4IE6A 1WLXA 3CIRA 4ISTA 2I6HA 2VWAA 2E9XD 4YSYA 2E9XC 4OFZA 5LHIB 2CHNA 4F8HA 2J62A 4GKJT 3VR8A 4ILCA 3KDSE 3RQUA 3LG7A 2DLRA 2CLYB 3RX6A 5JDMA 3CX7B 3SS1A 4H9RC 3ZMSB 2LSYA 2V7KA 3AE4A 5ABGA 2LSKA 3TLVA 5KDMC 3Q5EA 3B57A 4YMWC 2CA5A 1XDOA 2KNDA 4A5XA 5E0OA 2MAWA 3FBLA 1LRZA 5FVLA 4ILUA 2BG9B 4O8SA 3AXJB 2YINA 4BJMA 1FMWA 5HAXA 4HFBA 4AKLA 3RH3A 2NW8A 3ZKRA 5JDLA 4CXWA 4LF7T 2C5JA 1IBKT 4DV4T 4AISA 5H6RB 4A97A 3RIFA 3NKZA 2LEHA 2X66A 5LHHB 4JYAT 3NRYA 4QXBB 5IWAT 3ZCJA 1KFYA 3OJAA 3ZT7A 1W0AA 4Q25A 1YQ3A 3PUAA 4IL4A 4P0BA 2LJLA 3F2EA 4TQUN 4ILBA 3AE8A 4AKRB 3ANWA 3UQ4A 4OYJA 2WM9A 4E7ZA 2YU2A 3SFEA 2B76A 4KHPT 2X68A 2VB6A 4UF0B 4GIWA 4ZOLE 1N34T 3VR9A 2XQ6A 1HF8A 5LB7B 3RYIE 4DV1T 4O4JE 2L3LA 3L3PA 1HX8A 4F6RC 1AJ3A 2IC6A 2P9BA 3KVAA 2IDOB 4H9QC 4YXDA 2WDVA 2HN1A 1HTJF 1VRBA 4AKGA 3TLWA 3N9MA 5IUXA 4QH4A 2BG9A 3AXJA 4E7SA 4JBWF 4IIJE 3PUYF 1OEDE 3BK9A 3AE7A 1BR4A 4LF8T 1NENA 2XQ7A 3ABVA 2BZBA 1JNRA 5BMVE 1YQ4A 3I1AA 5AQTB 5IHYA 2BKPA 3FZKB 4LMLA 3D0TA 3P8CD 2QGSA 4LF9T 4XIGM 1V9DA 1NAFA 2YDQA 2W66A 1U5PA 3N9PA 4XTCN 3MK7C 5TAOA 4PK6A 3MKDA 1U4QA 2X0LB 4YHJA 4DUZT 5AQHB 1N33T 2FBWA 5L3EB 4CXYA 4YSXA 5LYJE 4KHZF 2V7LA 5JR9B 1WRDA 3ZYKA 5LCYA 4AIUA 3L39A 2DHRA 4DR4T 3AE9A 3KV5A 5HWXA 2VKJA 5KMGP 3K3QC 2BKNA 4UF0A 1M7KA 4DR6T 1X79A 4MALA 4P1NA 4AI6A 5LJNA 2LKGA 3GWHA 1M62A 2LSGA 2I0MA 4YHHT 4GKKT 4H9SE 3PJAJ 5ABFB 4PJMA 2XY8B 1L0VA 1E7PA 3N9LA 3B5MA 4KP3C 4TWHA 2UXNB 4O2AE 4YJ3E 2DI4A 2UUAT 4HE8A 4IDNA 4B3MT 3QNUA 4WBNE 2H89A 3AAAB 3RLFF 3ZN0B 5AQLB 4O4LE 2BDEA 2RP4A 2WMOA 3OPCA 1ZV4X 3IBPA 2YKSA 3LFMA 3RI5A 4CN4A 3ZT6A 4ZZCA 4IE0A 1B7TA 3UUXB 3UULA 3K8PC 2UU9T 3PV0F 5LP6E 5AQMB 2CBJA 4AXPA 1FMVA 4ZZBA 2XAJB 3AVSA 1WYCA 5AQPB 3L8RA 4ASKA 3UTKA 4YMUC 3S4UA 3EUHA 3O9XA 3NVOA 1IJ5A 4NUVA 3AE3A 2WY2A 4AKHA 4YMSC 3JAEA 4YTPA 4U3CA 1KK7A 4DO0A 5AQQB 4CI3B 5JR9A 5FL0A 5HEOA 3DP7A 2KSRA 2QYWA 3PUQA 4FJOA 4EB6E 2XUEA 3AEBA 5AQRB 2WZHA 4QKNA 5A1LA 2CCQA 1T72A 4PFOA 2L8KA 4DNDA 3OTOT 5ABFA 4PJJA 2YOEA 1HG2A 5ETWA 3K3OA 4AQFC 3RIAA 5L3CB 5LGUB 3EABA 2BS4A 2XQ4A 2V6XA 4PK4A 4KX6A 4B3TT 5H6QB 1N36T 3R6NA 4I50E 4X1IE 4IGUA 1X9BA 4IE4A 3HI2A 4K0UA 2A2FX 4KI0G 4WBOA 2WB5A 3UT5E 4ANJA 4TNVA 2XQ8A 2F4VT 3RYHE 3OVUA 4LFCT 2X51A 1WR0A 2WBLA 5LBQB 2NR4A 3H3AA 2CBIA 1O3XA 3D31C 2Q9QB 2KWHA 4YT0A 1EZ3A 3ZPOA 4QWNB 3VRAA 5LHGB 3RRCA 2PFVA 3ZCIA 1S94A 4EOZB 2J4GA 1OEDB 3P4WA 1XNRT 4H9NC 2XQAA 3E0ZA 3HR0A 5FMNA 2N2NA 1VOMA 3T1YT 4U33A 5L4EA 3UU3A 3VKGA 2LHRA 4OK0A 3FHNA 5HXSA 5AQFB 3QUJA 3ETVA 1KEYA 3PUXF 3ZYLA 2WMNA 3CPZA 3ONLC 1UK5A 4MFRA 4ADZA 4EIWA 5FXZA 4HEAA 4IDZA 2D5UA 2IW5B 3Q5XA 3A7MA 4X66T 3AEEA 3RKGA 4X64T 1HCIA 3GN5B 5FY7A 2WQYA 1W09A 2PBIA 4JI0T 3BQKA 3PU8A 4UR9A 4KMCA 2A72A 4DV0T 3QB5K 2PG8A 3SFDA 4G63A 5LJMA 2CRBA 4JI8T 2ZMAA 4ILAA 5CFBA 2KWIB 5HEGA 3PTRB 2AE9A 2JMHA 1IAPA 2C5KT 2BS3A 2XJ7A 2Y48B 4HFHA 4G2AA 2Q9QA 2X9WA 4NUUA 3C64A 4DV3T 2CMRA 4ZS3A 2XQ3A 1J5ET 3C4WA 3HKDE 2JMKA 4I55E 3E22E 3PUXG 3ZC0A 4P0AA 1OEDA 4JI2T 2OLTA 2XSAA 3ZYMA 4X1KE 4GK0E 3O1HA 1XNQT 2RPAA 4HWIB 1IJ6A 3H37A 2ZLYA 4X20E 2LM9A 3NZQA 3V5UA 4DBQA 3U78A 4UVCB 4DMVA 2EHOD 2EHOC 3ZMUB 2H7VC 3TLTA 2D0TA 4DR3T 2CPTA 5LXTE 2V6YB 2XM2A 3FZLB 5C8YE 4TUYE 1MMNA 4QX7B 5FY1A 3TKLB 3P4SA 4AQGA 2ONKC 5LOVE 2X67A 2JQHA 5JREA 1KNPA 3GN5A 4BAYB 4HWDA 4JI5T 3UUMA 2W62A 5LA6E 1G8XA 4IREA 4GK5E 3CX8B 3RIUC 2I59A 3DHWA 4TX5A 1JNZA 3CVRA 1QUUA 2PJQA 2CHOA 4EXTA 2V1DB 3KBTA 2MBGA 4Z91A 4JUYA 3AEFA 3MJXA 1KNRA 3KVBA 2ODUA 2X9HA 4UXNB 2LKHA 3QC9A 3VU7H 3I9YA 2XAFB 2W63A 2YU1A 4ZHQE 2XPKA 4UV9B 2MOZA 4QXHB 1BR0A 3ZSSA 4DR5T 5HWYA 3JC6D 1FEWA 3R84B 4H63H 5AQVB 1NWMX 1DU2A 3SRZA 2QA7A 1BR2A 1OWAA 4H9PC 4LF5T 2WCAA 1KF6A 3QK6A 4JLEA 2FJBA 2JQ9A 3M65A 2XASB 4ZI3D 1W9RA 3ONJA 3PU3A 2BBJA 4IHJE 3VKHA 4UEMA 2IIUA 1BR1A 3H3MA 3IA3A 2E9XB 2V6YA 1GQEA 3UU4A 4IDPA 4EYUA 5L3BB 5JRCB 1Z8UA 4J2CA 4DV5T 4XZCA 4JEHB 1LKXA 3AA1B 4EZHA 2WSSV 2VKOA 1HG5A 3PUWG 3C98B 4B6XA 1UX5A 4GOUA 2XQYA 2R6GG 3UU8A 4DMWA 4GYRA 3Q5WA 3NZPA 3BQIA 3LK42 4IE7A 5HXRA 2K5BB 1MIVA 2ZM2A 3WAKA 2XTLA 5J0ZA 4I0UA 2HPLA 3PUVG 2V7JA 1VCTA 2C5IT 1LVKA 5FXXA 3P50A 5HYAA 2KZ7B 2VL0A 4I4TE 4KBMB 3ZJ2A 3O1JA 3RF1A 4FI5A 5ABEA 2ZM0A 4CN6A 2L9QA 2VQET 3W15B 5JDNA 2WS3A 3KFWX 5LG4A 5FXWA 3GA8A 3Q2MA 1T98A 2XAGB 2V26A 3N5LA 2E5LT 2LOPA 4DVDA 5EK2A 3FB2A 2BBHA 2BG9E 3AE5A 2XAQB 3LK2B 1US7B 5HEUA 2BVMA 2LE8A 2E9XA 3LBXB 3AVRA 3PUZG 5GONE 2FUPA 1T7SA 4DIDB 5JRCA 3RYFE 4MHCA 2V8SV 4Z8XA 1VCSA 1I6ZA 2IHR1 3N9OA 4DR7T 4KI0F 4YMVC 4UV8B 2VL8A 4CZZB 4HWHA 2W0GA 3CX6B 3AE2A 4C90A 5HXHA 4EEBA 3GMIA 5JDFA 5JQGE 3J9X1 3SWHA 3AE1A 2VVSA 4O2BE 2AXDS 2X9YA 3CWZB
chains in the Genus database with same CATH topology
3PUZG 3PUXF 4JBWF 4XIGM 3PUYF 4JBWG 3PUWF 3PUXG 3DHWA 4XTCM 3PUYG 4YMUC 4TQUM 3PUWG 4KHZF 3TUJA 4XIGN 2R6GF 3TUIA 2ONKC 4KHZG 4YMTB 2R6GG 4XTCN 3PUVF 4TQUN 3PV0F 3PUVG 3TUZA 4YMWC 3PV0G 4YMSC 4KI0F 3RLFF 3D31C 4YMVC 3PUZF 4KI0G 3RLFG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUZ G;  3PUX F;  4JBW F;  4XIG M;  3PUY F;  4JBW G;  3PUW F;  3PUX G;  3DHW A;  4XTC M;  3PUY G;  4YMU C;  4TQU M;  3PUW G;  4KHZ F;  3TUJ A;  4XIG N;  2R6G F;  3TUI A;  2ONK C;  4KHZ G;  4YMT B;  2R6G G;  4XTC N;  3PUV F;  4TQU N;  3PV0 F;  3PUV G;  3TUZ A;  4YMW C;  3PV0 G;  4YMS C;  4KI0 F;  3RLF F;  3D31 C;  4YMV C;  3PUZ F;  4KI0 G;  3RLF G; 
#chains in the Genus database with same CATH topology
 5L3G B;  3I0Q A;  4LF4 T;  3ETU A;  4TQU M;  1SUM B;  4KUM B;  4ZI7 E;  5JTG A;  2CLY C;  2K9A A;  3IEE A;  4OYK A;  5AQO B;  1XDP A;  4TWD A;  5LGN B;  2WZI A;  4P09 A;  3FZM B;  4NPP A;  5AQK B;  4YTN A;  2WWV A;  1J1J A;  1SHZ C;  5JDQ A;  2UXC T;  5IYZ E;  2ODV A;  2BG9 C;  5F8P A;  1D0Y A;  1WR6 A;  2BKO A;  4QX8 B;  1MMD A;  2NTY A;  2QVA A;  3I0O A;  5J2U E;  2B1E A;  3FZH B;  2H88 A;  3LBX A;  1G73 A;  2MTQ A;  3RHW A;  3KV6 A;  3I9W A;  3UU5 A;  3OYZ A;  2UXX B;  1CHU A;  4EZ4 A;  4HTE A;  3IHR A;  2DL1 A;  4UVB B;  5J1G A;  5EZY E;  2FJD A;  1MMA A;  3PDY A;  2BVL A;  5AQS B;  2V5C A;  1OXZ A;  2D9D A;  3ZMT B;  5AQU B;  1E1H B;  3L09 A;  1YD8 G;  2Y6X A;  3QB5 A;  4DV6 T;  3AEG A;  5FKY A;  2W00 A;  4XTC M;  1WFD A;  3AAI A;  4XIG N;  4JEU B;  3MZK B;  2D2S A;  4IE5 A;  5HCJ A;  3NBX X;  4U2Y A;  3X1D A;  4QHO A;  2ZM6 T;  3PUS A;  3EAM A;  4HWC A;  4PK5 A;  4O4H E;  2KIN B;  4BA9 A;  2J47 A;  4JV5 T;  4UVA B;  2ES0 A;  4EGW A;  4C91 A;  2WU2 A;  4O4I E;  4GYS A;  3FXE B;  5LMU T;  1WYB A;  2JPF A;  4DR2 T;  1UX4 A;  3RC8 A;  5L3F B;  5FY0 A;  1HNW T;  2VAS A;  3F57 A;  5CA0 E;  5LBM A;  3U3I A;  4DR1 T;  3T1H T;  4ZXL A;  2E8I A;  1H7C A;  2XQ9 A;  5HEJ A;  2LSJ A;  2GK9 A;  3TUJ A;  1HX1 B;  3CQG B;  3SOL A;  4ZEY A;  4JI3 T;  3RPU A;  4DV7 T;  3MAC A;  3O1I A;  2RA1 A;  3TLU A;  3UUN A;  2NWB A;  3JCF A;  3ONX A;  4JI7 T;  4WYV A;  4UEL A;  2XHE B;  5AQG B;  2XZE A;  2CE7 A;  1KNZ A;  1ZOY A;  1SE7 A;  3OBV E;  1J5W A;  3LDQ B;  4HKA A;  5FXV A;  2XQ5 A;  2ACZ A;  3E08 A;  2YDR A;  3RYC E;  3OYX A;  4ISS A;  2DWK A;  4U74 A;  3ESL A;  1HFA A;  1IZN B;  4DBR A;  2WU5 A;  5HCM A;  3PUG A;  5L47 A;  1XWM A;  4QH5 A;  4QH1 A;  3TLS A;  1MND A;  5JR9 C;  2M6B A;  3ZC1 A;  5AQN B;  2JQK A;  3LJC A;  1YW0 A;  4NXM T;  1HR0 T;  1D0Z A;  4L9I A;  3C4Z A;  5JH7 E;  2W61 A;  5HEH A;  3IF8 B;  3KBU A;  2NOX A;  1QLB A;  1D0X A;  2WWU A;  3RQW A;  3T8O A;  4A98 A;  2VQF T;  5HXC A;  4EV6 A;  2JJ9 A;  5F3J A;  2UXB T;  1IBM T;  3DTO A;  4MLK A;  3AED A;  5ADX L;  4IL9 A;  4OX9 T;  2DCF A;  2DWG A;  4H9O C;  5L3D B;  2WP9 A;  2A3D A;  3RRW A;  1N32 T;  4YSZ A;  4U72 A;  4CI2 B;  3AA0 B;  2M67 A;  2SPC A;  4V1A v;  1MMG A;  2KMF A;  3MXZ A;  2K48 A;  3P7I A;  4ZS2 A;  2UUC T;  5KXJ A;  3AEC A;  3C4X A;  3AE6 A;  3HKB E;  2H7O A;  3QOF A;  3K1S A;  3PUR A;  3VHL A;  3HKC E;  4PJL A;  3PUW F;  2A9U A;  2YK0 A;  3P4R A;  2K3W A;  2R6G F;  4L0R A;  5JDG A;  2VK9 A;  4WW0 A;  2V7I A;  5CGM A;  4AQF A;  3CKD A;  3ZLI A;  5F5W A;  3UU6 A;  1W0B A;  1MIY A;  2NP9 A;  4COF A;  4HFI A;  1XMO T;  2JIW A;  2YN6 A;  3UFE A;  3CQX C;  3JC6 C;  4B3S T;  5FVK A;  3PJA A;  4HFV A;  3VRB A;  3PUV F;  5CA1 E;  4QXC B;  4TV8 E;  2CXL A;  4AQY T;  4EAH A;  3N2G E;  4JI6 T;  1ZEE A;  4ZI3 C;  2E2A A;  3RKO A;  4X5T A;  3WAJ A;  3LK3 B;  4YY3 T;  3AAE B;  4YJ2 E;  5CB4 E;  3CML A;  2KLQ A;  4HWF A;  3V5S A;  2YEV C;  4CN1 A;  1T8B A;  4TNW A;  3RGL A;  1Y64 B;  5LMN T;  4YTM A;  2OV9 A;  2NW7 A;  1ZKE A;  2M6I A;  4TV9 E;  3PUZ F;  5JDH A;  4A56 A;  4MBQ A;  2ZM8 A;  2V5D A;  4TWF A;  1MNE A;  5CJ5 A;  2LSI A;  4TZ4 C;  4CXX A;  3ZEF B;  3KV9 A;  3HA4 A;  1CUN A;  5LGT B;  5AQI B;  1HNX T;  1UUR A;  2XAH B;  3JAD A;  4B3R T;  2EHO B;  4U2Z A;  4JBW G;  4ERR A;  3PUY G;  2Q9Q D;  2UUB T;  2UXD T;  2Q9Q C;  4X65 T;  3TUI A;  1Y01 A;  4JI4 T;  1IBL T;  5KX5 E;  3B13 A;  5J2T E;  2W67 A;  2FJE A;  5DJQ C;  3C51 A;  4X1Y E;  4PFP A;  4HN9 A;  4H63 V;  1OED C;  3N2O A;  1UUS A;  2CXD A;  2XM1 A;  2E5V A;  2IUB A;  1YKE B;  2W2U A;  4LMK A;  4U7I A;  2LRL A;  3KV4 A;  2IC9 A;  3ZMV B;  3NRX A;  1S35 A;  2CWY A;  3M3Z B;  2WAU A;  3ZJ1 A;  2ACX A;  2W4X A;  2H3R A;  3AA7 B;  4PAG A;  2CEA A;  1FJG T;  4DV2 T;  5FL1 A;  4NXN T;  4LFB T;  2HH7 A;  2Z6E A;  5JVD E;  1NEK A;  4LF6 T;  4KHZ G;  3HL6 A;  3EVY A;  1YKH B;  3P4Q A;  3ZST A;  4TN7 B;  3UUB A;  3N9Q A;  3AB3 B;  5DQV A;  3O4X E;  5BR8 T;  3A5X A;  2DNX A;  2YDS A;  4HFC A;  4YLH A;  4K0K T;  4IDO A;  4UIG A;  4IDQ A;  3FBZ A;  2C0S A;  2VKD A;  3LSV A;  4AKI A;  4WZX A;  3G06 A;  2WDQ A;  4HFD A;  2CWO A;  2HPJ A;  2IAK A;  3EDV A;  2MPK A;  2X9X A;  3F31 A;  3MA9 A;  2NTX A;  2QRX A;  2MYS A;  4XAX B;  4IT4 A;  3RC3 A;  1HNZ T;  2D0U A;  4N78 D;  5FYM A;  5HXE A;  2K24 A;  3TUZ A;  2EHO A;  2LT3 A;  4DUY T;  2BS2 A;  4CI1 B;  2G0U A;  1UCU A;  4LFA T;  4OHF A;  3RLF G;  3ZT5 A;  3J7Y q;  2OA5 A;  1I94 T;  4YFS A;  3P4P A;  2HHH T;  3C50 A;  1UGO A;  3EI0 A;  3FXD B;  3N2K E;  3NWI A;  2VVN A;  3PV0 G;  2NW9 A;  5FNV E;  3EDU A;  4XBF B;  2WDR A;  3FZF B;  1SA0 E;  4HFE A;  2PTF A;  2LRK A;  1FIO A;  2CM0 A;  3RIU A;  1Z0P A;  1MIW A;  1XZY A;  2V7M A;  3N9N A;  1QSD A;  2XSB A;  4HGA A;  5C3J A;  3EHZ A;  2X0H A;  1WCR A;  2IML A;  2CXF A;  2Y8D A;  3PE0 A;  3UFG A;  5AQJ B;  3OKQ A;  3A8Y C;  3UQ7 A;  2J1D G;  1ZHC A;  2X0Y A;  3AA6 B;  4BJN A;  5EK3 A;  5L4H A;  2VKH A;  4Z90 A;  4M1P A;  1R8I A;  4L5G A;  5LNK A;  5LG3 A;  3CK6 A;  5DAB A;  5ABH A;  2LM2 A;  3JAF A;  3AEA A;  4EED A;  2N9D A;  2LHN A;  2N1G A;  1YXR A;  2JRK A;  2LOS A;  5FP3 A;  3CQC B;  3ZN1 B;  5EK4 A;  1ZP0 A;  5AFU L;  2KXP B;  3Q9D A;  5DQW A;  1D1A A;  4JI1 T;  4LMJ A;  4WNK A;  2HN2 A;  3K3N A;  3KIN B;  3BQL A;  2JQQ A;  2LLY A;  1D1C A;  1LVF A;  1E2A A;  1HS7 A;  4CQI A;  4PJN A;  4PW8 A;  1D1B A;  4NIQ A;  4I43 B;  4U7Y A;  3WI3 A;  4ZI2 D;  4YMT B;  5L2L A;  3HKE E;  4ZI2 C;  4U31 A;  3Q5D A;  3ZMZ B;  4PNI A;  2VUR A;  4EYY R;  4X62 T;  5M4Y A;  3ANW B;  1XMQ T;  2FJA A;  3DJB A;  5C2T A;  2KT9 A;  4IE6 A;  1WLX A;  3CIR A;  4IST A;  2I6H A;  2VWA A;  2E9X D;  4YSY A;  2E9X C;  4OFZ A;  5LHI B;  2CHN A;  4F8H A;  2J62 A;  4GKJ T;  3VR8 A;  4ILC A;  3KDS E;  3RQU A;  3LG7 A;  2DLR A;  2CLY B;  3RX6 A;  5JDM A;  3CX7 B;  3SS1 A;  4H9R C;  3ZMS B;  2LSY A;  2V7K A;  3AE4 A;  5ABG A;  2LSK A;  3TLV A;  5KDM C;  3Q5E A;  3B57 A;  4YMW C;  2CA5 A;  1XDO A;  2KND A;  4A5X A;  5E0O A;  2MAW A;  3FBL A;  1LRZ A;  5FVL A;  4ILU A;  2BG9 B;  4O8S A;  3AXJ B;  2YIN A;  4BJM A;  1FMW A;  5HAX A;  4HFB A;  4AKL A;  3RH3 A;  2NW8 A;  3ZKR A;  5JDL A;  4CXW A;  4LF7 T;  2C5J A;  1IBK T;  4DV4 T;  4AIS A;  5H6R B;  4A97 A;  3RIF A;  3NKZ A;  2LEH A;  2X66 A;  5LHH B;  4JYA T;  3NRY A;  4QXB B;  5IWA T;  3ZCJ A;  1KFY A;  3OJA A;  3ZT7 A;  1W0A A;  4Q25 A;  1YQ3 A;  3PUA A;  4IL4 A;  4P0B A;  2LJL A;  3F2E A;  4TQU N;  4ILB A;  3AE8 A;  4AKR B;  3ANW A;  3UQ4 A;  4OYJ A;  2WM9 A;  4E7Z A;  2YU2 A;  3SFE A;  2B76 A;  4KHP T;  2X68 A;  2VB6 A;  4UF0 B;  4GIW A;  4ZOL E;  1N34 T;  3VR9 A;  2XQ6 A;  1HF8 A;  5LB7 B;  3RYI E;  4DV1 T;  4O4J E;  2L3L A;  3L3P A;  1HX8 A;  4F6R C;  1AJ3 A;  2IC6 A;  2P9B A;  3KVA A;  2IDO B;  4H9Q C;  4YXD A;  2WDV A;  2HN1 A;  1HTJ F;  1VRB A;  4AKG A;  3TLW A;  3N9M A;  5IUX A;  4QH4 A;  2BG9 A;  3AXJ A;  4E7S A;  4JBW F;  4IIJ E;  3PUY F;  1OED E;  3BK9 A;  3AE7 A;  1BR4 A;  4LF8 T;  1NEN A;  2XQ7 A;  3ABV A;  2BZB A;  1JNR A;  5BMV E;  1YQ4 A;  3I1A A;  5AQT B;  5IHY A;  2BKP A;  3FZK B;  4LML A;  3D0T A;  3P8C D;  2QGS A;  4LF9 T;  4XIG M;  1V9D A;  1NAF A;  2YDQ A;  2W66 A;  1U5P A;  3N9P A;  4XTC N;  3MK7 C;  5TAO A;  4PK6 A;  3MKD A;  1U4Q A;  2X0L B;  4YHJ A;  4DUZ T;  5AQH B;  1N33 T;  2FBW A;  5L3E B;  4CXY A;  4YSX A;  5LYJ E;  4KHZ F;  2V7L A;  5JR9 B;  1WRD A;  3ZYK A;  5LCY A;  4AIU A;  3L39 A;  2DHR A;  4DR4 T;  3AE9 A;  3KV5 A;  5HWX A;  2VKJ A;  5KMG P;  3K3Q C;  2BKN A;  4UF0 A;  1M7K A;  4DR6 T;  1X79 A;  4MAL A;  4P1N A;  4AI6 A;  5LJN A;  2LKG A;  3GWH A;  1M62 A;  2LSG A;  2I0M A;  4YHH T;  4GKK T;  4H9S E;  3PJA J;  5ABF B;  4PJM A;  2XY8 B;  1L0V A;  1E7P A;  3N9L A;  3B5M A;  4KP3 C;  4TWH A;  2UXN B;  4O2A E;  4YJ3 E;  2DI4 A;  2UUA T;  4HE8 A;  4IDN A;  4B3M T;  3QNU A;  4WBN E;  2H89 A;  3AAA B;  3RLF F;  3ZN0 B;  5AQL B;  4O4L E;  2BDE A;  2RP4 A;  2WMO A;  3OPC A;  1ZV4 X;  3IBP A;  2YKS A;  3LFM A;  3RI5 A;  4CN4 A;  3ZT6 A;  4ZZC A;  4IE0 A;  1B7T A;  3UUX B;  3UUL A;  3K8P C;  2UU9 T;  3PV0 F;  5LP6 E;  5AQM B;  2CBJ A;  4AXP A;  1FMV A;  4ZZB A;  2XAJ B;  3AVS A;  1WYC A;  5AQP B;  3L8R A;  4ASK A;  3UTK A;  4YMU C;  3S4U A;  3EUH A;  3O9X A;  3NVO A;  1IJ5 A;  4NUV A;  3AE3 A;  2WY2 A;  4AKH A;  4YMS C;  3JAE A;  4YTP A;  4U3C A;  1KK7 A;  4DO0 A;  5AQQ B;  4CI3 B;  5JR9 A;  5FL0 A;  5HEO A;  3DP7 A;  2KSR A;  2QYW A;  3PUQ A;  4FJO A;  4EB6 E;  2XUE A;  3AEB A;  5AQR B;  2WZH A;  4QKN A;  5A1L A;  2CCQ A;  1T72 A;  4PFO A;  2L8K A;  4DND A;  3OTO T;  5ABF A;  4PJJ A;  2YOE A;  1HG2 A;  5ETW A;  3K3O A;  4AQF C;  3RIA A;  5L3C B;  5LGU B;  3EAB A;  2BS4 A;  2XQ4 A;  2V6X A;  4PK4 A;  4KX6 A;  4B3T T;  5H6Q B;  1N36 T;  3R6N A;  4I50 E;  4X1I E;  4IGU A;  1X9B A;  4IE4 A;  3HI2 A;  4K0U A;  2A2F X;  4KI0 G;  4WBO A;  2WB5 A;  3UT5 E;  4ANJ A;  4TNV A;  2XQ8 A;  2F4V T;  3RYH E;  3OVU A;  4LFC T;  2X51 A;  1WR0 A;  2WBL A;  5LBQ B;  2NR4 A;  3H3A A;  2CBI A;  1O3X A;  3D31 C;  2Q9Q B;  2KWH A;  4YT0 A;  1EZ3 A;  3ZPO A;  4QWN B;  3VRA A;  5LHG B;  3RRC A;  2PFV A;  3ZCI A;  1S94 A;  4EOZ B;  2J4G A;  1OED B;  3P4W A;  1XNR T;  4H9N C;  2XQA A;  3E0Z A;  3HR0 A;  5FMN A;  2N2N A;  1VOM A;  3T1Y T;  4U33 A;  5L4E A;  3UU3 A;  3VKG A;  2LHR A;  4OK0 A;  3FHN A;  5HXS A;  5AQF B;  3QUJ A;  3ETV A;  1KEY A;  3PUX F;  3ZYL A;  2WMN A;  3CPZ A;  3ONL C;  1UK5 A;  4MFR A;  4ADZ A;  4EIW A;  5FXZ A;  4HEA A;  4IDZ A;  2D5U A;  2IW5 B;  3Q5X A;  3A7M A;  4X66 T;  3AEE A;  3RKG A;  4X64 T;  1HCI A;  3GN5 B;  5FY7 A;  2WQY A;  1W09 A;  2PBI A;  4JI0 T;  3BQK A;  3PU8 A;  4UR9 A;  4KMC A;  2A72 A;  4DV0 T;  3QB5 K;  2PG8 A;  3SFD A;  4G63 A;  5LJM A;  2CRB A;  4JI8 T;  2ZMA A;  4ILA A;  5CFB A;  2KWI B;  5HEG A;  3PTR B;  2AE9 A;  2JMH A;  1IAP A;  2C5K T;  2BS3 A;  2XJ7 A;  2Y48 B;  4HFH A;  4G2A A;  2Q9Q A;  2X9W A;  4NUU A;  3C64 A;  4DV3 T;  2CMR A;  4ZS3 A;  2XQ3 A;  1J5E T;  3C4W A;  3HKD E;  2JMK A;  4I55 E;  3E22 E;  3PUX G;  3ZC0 A;  4P0A A;  1OED A;  4JI2 T;  2OLT A;  2XSA A;  3ZYM A;  4X1K E;  4GK0 E;  3O1H A;  1XNQ T;  2RPA A;  4HWI B;  1IJ6 A;  3H37 A;  2ZLY A;  4X20 E;  2LM9 A;  3NZQ A;  3V5U A;  4DBQ A;  3U78 A;  4UVC B;  4DMV A;  2EHO D;  2EHO C;  3ZMU B;  2H7V C;  3TLT A;  2D0T A;  4DR3 T;  2CPT A;  5LXT E;  2V6Y B;  2XM2 A;  3FZL B;  5C8Y E;  4TUY E;  1MMN A;  4QX7 B;  5FY1 A;  3TKL B;  3P4S A;  4AQG A;  2ONK C;  5LOV E;  2X67 A;  2JQH A;  5JRE A;  1KNP A;  3GN5 A;  4BAY B;  4HWD A;  4JI5 T;  3UUM A;  2W62 A;  5LA6 E;  1G8X A;  4IRE A;  4GK5 E;  3CX8 B;  3RIU C;  2I59 A;  3DHW A;  4TX5 A;  1JNZ A;  3CVR A;  1QUU A;  2PJQ A;  2CHO A;  4EXT A;  2V1D B;  3KBT A;  2MBG A;  4Z91 A;  4JUY A;  3AEF A;  3MJX A;  1KNR A;  3KVB A;  2ODU A;  2X9H A;  4UXN B;  2LKH A;  3QC9 A;  3VU7 H;  3I9Y A;  2XAF B;  2W63 A;  2YU1 A;  4ZHQ E;  2XPK A;  4UV9 B;  2MOZ A;  4QXH B;  1BR0 A;  3ZSS A;  4DR5 T;  5HWY A;  3JC6 D;  1FEW A;  3R84 B;  4H63 H;  5AQV B;  1NWM X;  1DU2 A;  3SRZ A;  2QA7 A;  1BR2 A;  1OWA A;  4H9P C;  4LF5 T;  2WCA A;  1KF6 A;  3QK6 A;  4JLE A;  2FJB A;  2JQ9 A;  3M65 A;  2XAS B;  4ZI3 D;  1W9R A;  3ONJ A;  3PU3 A;  2BBJ A;  4IHJ E;  3VKH A;  4UEM A;  2IIU A;  1BR1 A;  3H3M A;  3IA3 A;  2E9X B;  2V6Y A;  1GQE A;  3UU4 A;  4IDP A;  4EYU A;  5L3B B;  5JRC B;  1Z8U A;  4J2C A;  4DV5 T;  4XZC A;  4JEH B;  1LKX A;  3AA1 B;  4EZH A;  2WSS V;  2VKO A;  1HG5 A;  3PUW G;  3C98 B;  4B6X A;  1UX5 A;  4GOU A;  2XQY A;  2R6G G;  3UU8 A;  4DMW A;  4GYR A;  3Q5W A;  3NZP A;  3BQI A;  3LK4 2;  4IE7 A;  5HXR A;  2K5B B;  1MIV A;  2ZM2 A;  3WAK A;  2XTL A;  5J0Z A;  4I0U A;  2HPL A;  3PUV G;  2V7J A;  1VCT A;  2C5I T;  1LVK A;  5FXX A;  3P50 A;  5HYA A;  2KZ7 B;  2VL0 A;  4I4T E;  4KBM B;  3ZJ2 A;  3O1J A;  3RF1 A;  4FI5 A;  5ABE A;  2ZM0 A;  4CN6 A;  2L9Q A;  2VQE T;  3W15 B;  5JDN A;  2WS3 A;  3KFW X;  5LG4 A;  5FXW A;  3GA8 A;  3Q2M A;  1T98 A;  2XAG B;  2V26 A;  3N5L A;  2E5L T;  2LOP A;  4DVD A;  5EK2 A;  3FB2 A;  2BBH A;  2BG9 E;  3AE5 A;  2XAQ B;  3LK2 B;  1US7 B;  5HEU A;  2BVM A;  2LE8 A;  2E9X A;  3LBX B;  3AVR A;  3PUZ G;  5GON E;  2FUP A;  1T7S A;  4DID B;  5JRC A;  3RYF E;  4MHC A;  2V8S V;  4Z8X A;  1VCS A;  1I6Z A;  2IHR 1;  3N9O A;  4DR7 T;  4KI0 F;  4YMV C;  4UV8 B;  2VL8 A;  4CZZ B;  4HWH A;  2W0G A;  3CX6 B;  3AE2 A;  4C90 A;  5HXH A;  4EEB A;  3GMI A;  5JDF A;  5JQG E;  3J9X 1;  3SWH A;  3AE1 A;  2VVS A;  4O2B E;  2AXD S;  2X9Y A;  3CWZ B; 
#chains in the Genus database with same CATH homology
 3PUZ G;  3PUX F;  4JBW F;  4XIG M;  3PUY F;  4JBW G;  3PUW F;  3PUX G;  3DHW A;  4XTC M;  3PUY G;  4YMU C;  4TQU M;  3PUW G;  4KHZ F;  3TUJ A;  4XIG N;  2R6G F;  3TUI A;  2ONK C;  4KHZ G;  4YMT B;  2R6G G;  4XTC N;  3PUV F;  4TQU N;  3PV0 F;  3PUV G;  3TUZ A;  4YMW C;  3PV0 G;  4YMS C;  4KI0 F;  3RLF F;  3D31 C;  4YMV C;  3PUZ F;  4KI0 G;  3RLF G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...