3PUYA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
371
structure length
371
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 96
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puyA01
1DG3A 2YJTD 4DAMA 5AUOB 4H1UA 4AIMA 1S72A 1NJIC 5AUQA 3I4NG 2W83A 3FHWA 4PMWA 2DFLA 1HNZQ 1G291 3A8JE 4B48A 5K8LA 3TAHA 4PZYA 3K09A 2VTKA 1OB5A 1NLFA 4OHVA 1MO3A 1B7YB 4QFMA 5M3FG 2F4VL 3KKNA 1X8JA 1AE3A 4JI4L 1PH1A 5FBWB 3ZS9A 3CR8A 1KI8A 4CRWB 4DDVA 4Z1MD 1LTQA 2ECKA 4MH0R 3A0JA 3W3AA 4JVMA 1N9WA 4RD4A 2D5DA 5DN6A 3GLGA 3K7UC 4OWXB 1F60A 3IO5A 3CNNA 3KZ1E 4O0AA 3FKIH 2ZJ5A 1CJVC 4PANA 1UKZA 3ZLJA 1UE7A 1IN6A 2PX3A 3I32A 4XWKA 1MH1A 2ZRBA 3BJUA 1NKSA 2NZHA 4QL5A 1DAFA 1RW4A 3KTAB 2RGXA 1IW7C 1HNWQ 2GVAA 3ZQJA 1XTQA 2UVQA 3M3YH 5JI2E 3OEHD 3CW2A 2ZI6A 4R71A 4HB3A 5BN4A 3PV0A 1UKYA 2Q2HA 4OL0A 3CCMA 5FTNA 2RB4A 1P60A 1E2MA 4NCNA 2JIZA 3FE2A 5B58C 3AVTA 3MUFA 4ZDWA 2KWIA 5FJ8G 2EVWX 3R9IA 1JR3A 1FZQA 2CCGA 1E69A 1FMLA 4MGYR 2DN8A 1EYGA 2PCFB 2QP4A 3AVYA 2AKYA 1Z83A 4DNIA 4PHFA 2XZPA 3IO3A 4LJ8A 2H7VA 4CYMA 4JYAQ 2DY1A 4PSAA 1EQRA 5KOYA 3HOUH 4QBIA 5EE0A 3UMRA 2ZTDA 4BECA 2HF8A 4NXNQ 3KUCA 2BDOA 3RYTC 3VR1A 3F1ZA 2NPIA 1L2TA 3J80c 3U7GA 2IC5A 1OXVA 3IEVA 4POGA 3KKMA 1LS6A 4XVRA 2ZUCA 4HDCA 2HYDA 5L3QB 4J15A 4OQMA 2KHIA 1JJCB 3S1RH 2WWGA 5DI3B 2XOKD 2IEZA 3B6YA 3AQQA 2R92H 1GZSA 3VHLB 1VQPA 5CIQA 3DM5A 1KK0A 1JJVA 3I7FA 1VQ5A 2CFMA 3EZ2A 4OJKA 2ZR7A 2E1RA 4IKEA 1HNXL 4YXWA 3U7HB 3CNLA 4B3GA 1DOAA 2J7PA 3U4ZA 1ESNA 1CR1A 3OHMA 3TK1A 1GNQA 3A1TA 5JWOA 4PZLA 3ADKA 3CPFA 3GTJH 1E2VA 2K14A 1T8TA 2CL7X 4NDZA 4Q66C 3OIUA 3KFUA 1S0UA 2V54A 1HYQA 4QBFA 4BLOA 3VR3A 4LV8B 5LMNL 1XTJA 4GBMA 3WRYC 4OO1G 2NVXH 4AG5A 2CK3A 2FOLA 4QHTA 4A0FA 1II9A 3SBDA 3I56A 1N32Q 3A7AB 5FTKA 5DH9A 1G16A 4MITA 1C1YA 1XEWY 4UNSA 4DLXA 1FGUA 3HOZH 1JAIA 1BH2A 1SFOH 1XCGB 5CM8B 1VQHA 2ZJ2A 3T5DA 4HLUC 4IEEA 2XX3A 1II8B 3GTOH 1FUKA 4CVNA 3P1JA 5ELXA 5IYDG 3UG7A 2F43A 4HJ5A 3O8CA 3M9BA 1JALA 4BBSG 2C5LA 1EFUA 4I99A 4O0MA 4US2R 1Y3AA 3BDOA 1BKDR 2QPTA 4D4KA 1A82A 3BK7A 4GMXA 4HJ8A 2JK8A 2E74C 2VQFQ 1Q90A 3EWAA 4P73A 2BBSA 5FTLA 4DK0A 1N6RA 1X6OA 3ZVLA 3CRLC 1E9SA 3U4QB 3FFAA 2B63H 3BC1A 4Q4HB 3LLUA 1ONBA 2WAQG 1OIXA 1SGWA 2J46A 3W5OA 3NH9A 1H9MA 1ZM3A 4ILEA 5JECA 4HIMA 3DZ8A 3CWZA 2ASEA 4TLCA 2I5MX 4KLZA 2RHQB 5GQOA 2ANBA 1PYSB 1XEFA 1Z22A 2Q21A 2WKQA 1RRPA 3NHAA 3QENA 2JLZA 4Y7NH 1N0WA 1WF3A 4GLAC 1XXHE 4AY2A 1U98A 3LY5A 3TW4A 1JR3D 4LFCL 4HIDA 1R9TH 1Q20A 3CC4A 1ZW6A 4LX0A 3EA0A 1FX0B 1HURA 4A3BG 1EWRA 1W2GA 2JGNA 4NP6A 2WWYA 1FTNA 5C3EH 2DGYA 4A4IA 1X8KA 1V5WA 1G19A 1NF3A 1E2ZA 4OQFA 3ZD6A 4PX9A 3KJEA 1YZTA 6Q21A 3OE7A 2IS6A 2H5EA 1Q1BA 1VQFA 1VHTA 3VTKA 1R6BX 2IXEA 2QN6A 4Q4LA 4NCHA 3KKOA 4L5BA 1IN5A 4BFTA 3CC7A 3HP1A 2ZSDA 2YINC 4AKIA 1N36L 4NZYA 5FTJA 2R6CA 3TSWA 3TQYA 3THOA 4DB2A 4RJLA 3QEJA 4OWWB 3OAAA 1CR4A 4MKHA 4CEHA 1KL9A 4A3KH 1EX7A 2XNDA 3AP3A 1UEBA 4BBRH 4YXWD 4JLPA 2PH1A 2IX1A 1BKBA 2J7PD 2OCBA 3AF2A 2IT1A 5LB2A 5C4GB 4A3EH 1TNDA 4WXRA 1XFAA 4LRWA 3ETLA 5FLXc 3QXXA 4BEBA 4JLBA 4HZIA 2EFEB 1I94Q 3GJ5A 3LBIA 1GAJA 2WAXA 1AE2A 2AWOA 3B1YA 5FUXA 4F4CA 2CK3D 4A3GG 2D0OA 5EXPA 4JI6Q 1U9IC 4Q02A 4Q4JB 3ZS8A 4TTQA 2H17A 3CPWA 4ZDIA 1XEXA 2C03A 2WM9B 5CDFE 3QY0A 821PA 4DCNA 4ARZA 2XSZA 1N6PA 1UE1A 4DR1L 4M53A 4RG1A 2NO9A 1D8TA 1SVLA 2O8FB 2R44A 1IJEA 2R6FA 4K46A 2QP9X 1I2MA 4LHVA 3I5XA 1VQBA 2IK8A 4D6PA 3TQCA 2J0UA 4EQ6A 4TYNA 4BLQA 4JG2A 2H57A 4JBYA 4BA2I 4QKQA 2OQKA 1CIPA 1J99A 1T0JB 3MJRA 3WY9A 3KQNA 2Q2TA 4U5XA 2A9KA 2YV5A 1YNXA 4RCNA 1E79A 1Z0JA 3W6OA 4B74A 4PHTA 5AR1A 3U50C 2BA0A 2JA5H 3F5FA 3CCRA 4RCYA 2W2TA 4G5RA 3CX6A 1W5TA 4IFDG 4D4JA 3NHBA 5B57C 3PO3G 4LYJA 2EYQA 3U3MA 1S3GA 3MG9A 4QXAA 4LF4Q 4U00A 5DE3A 4DV2L 2EVBA 4Q1EA 1B8AA 3KYHC 3HU2A 4BZPA 1OH6A 4ZCLA 2WWFA 3JAMi 2RGBA 4Q7KA 1TADA 1Z8FA 2GHIA 2JLRA 2CKZB 4ESHA 4FINA 4QNMA 4X8MA 1SR3A 1HCZA 2IX0A 1CI3M 3TSOA 4DPGA 2GF0A 3T1HL 2GVBA 3B5JA 4OK3A 3RC8A 4AYBE 4V0MA 2NZ8A 3CQZH 4UNQA 3I4LA 1X1RA 1XTKA 2FFBA 3QQ5A 3C5HA 3GTQH 1N6NA 4P74A 2A68C 3T1YQ 2FZLA 2RH5A 2ZSBA 2QMOA 2E2HH 2BOVA 2VL6A 3AB3A 3GLHE 3QPVA 2GVDC 4QJ4A 5JEAH 4DCSA 1E6CA 1G7RA 1FW6A 1D5CA 3UIEA 2PI2A 1U2RA 2N1BA 2CLSA 1DAGA 2Z43A 3K0AB 3B1ZA 3IQXA 4AYBG 1DD2A 4YHHQ 1PH8A 4P33A 1NN5A 3J80i 5TARA 1M90C 1W3SA 1EIFA 2EIFA 4LJ9A 5G3YA 4ZKDA 5FPSA 4C2TA 2VHJA 1US8A 2PNRC 3AKDA 2ALYB 5EE1A 5G40A 4B3XA 3BH7A 2XGTA 1NP6A 1YI2A 5F9HA 3Q9LA 3GTMH 2GF9A 1K73C 4Q5IA 4MRRA 5AUPB 5DNYB 1OXTA 4LJ7A 1TQ6A 1BIFA 4ASUA 5EXXA 2JAQA 3ULJA 2GEUA 4JJKA 5CK5A 3NEMA 2GCOA 3D31A 2ZU0C 3KJIA 2AXPA 2WV9A 4JI8L 2ZE5A 4DJTA 2D74A 1JECA 4L9WA 4WW0A 4YWKA 3S17H 1KIMA 3FMIA 2ODNA 2VYFA 1W5SA 3RSOA 2KHJA 1KO1A 4LFBQ 2KB0A 2XSZD 1L1OC 3MCAA 2ZYUX 1KK3A 4HATA 3UDFA 1HNXQ 1G5TA 1N5IA 1UBGA 2GESA 2MO0A 1U0HC 1TF7A 4PQYA 5FI1B 4OHYA 3K70D 3MLEA 1YZQA 1ZRHA 1PH4A 1GM5A 2N78A 3DKPA 4A82A 4I81A 4EPVA 1Z28A 3FPAA 1Q57A 4JI3L 4BY1H 1YQTA 3IGFA 5KDLA 5SZKB 4ZCMA 3L0PA 3THWB 3OZXA 4UXHA 3SI7A 1XCMA 1E79D 2QG6A 2R6AA 4BLTA 3GTPH 2QAJA 5GJCA 4D0NA 1X8LA 4PPFA 2ZJPA 1XU4A 4DR5Q 3QKSB 3TGPA 2HXYA 1L7VC 3HR8A 1GFIA 1RVDA 4UP9A 4UPAA 5E7JA 4CGZA 2D4HA 1ZD8A 4LPSA 2J5XA 1C0AA 3PUWA 3FKIG 1YVCA 2O0JA 4X8LA 5KSZA 2N42A 1W2HA 3VNUA 3C4JA 4PHHA 1PJRA 2MNAA 3BGWA 1GKIA 1P5ZB 1CSQA 1CBUA 3F8TA 2ZRLA 4Z51A 5C2JB 1M7GA 4G5OA 2J0VA 3FMCA 1E1QA 4XJXA 5D3QA 4DV1L 1F2UB 3PEWA 5GAEC 2PEZA 4NCJA 4TLBA 1KKLA 2F3TA 2QEQA 2BWJA 4Q03A 3VKHA 2VHQA 2UUAL 3LBNA 2HUPA 4AYXA 4OHXA 4QJ5A 3VMFA 2VP2A 3HWSA 3JVVA 2ZR9A 4IRUB 3X1DA 5KO2A 3PSIA 2ZREA 4KBFA 1H9SB 4PZZA 5LMUL 2F3RA 4YQFA 3AF3A 4DV0Q 1S9HA 2ZI3A 3SQWA 2E8GA 5M3FH 4DV7Q 4O2RA 3AVWA 1GILA 4DR7L 2BMJA 2B6HA 4CT4B 4DDWA 1AGPA 1J5EL 2K5NA 3H3VH 3HPRA 4AKGA 3A1VA 3HOUG 2JEBI 2W0SA 1HTWA 4DB4A 3NTUA 1N0UA 2I3BA 4PZ6A 1E2GA 4ESVA 1D2EA 1YHAA 2QAGC 3LGJA 3ICEA 1OH8A 5EP1A 3VR6A 4BZXA 1ZC3A 2ERYA 4UNRA 1QHNA 3P32A 3NC1C 4DWJA 3OYYA 3S24A 1H8HA 4NPHA 4QGFA 3P27A 2R92G 4QM6A 3KLWA 4TL9A 1UBFA 3QBVA 3KF6B 1Z6AA 1TTTA 4Q9IA 1BO6A 1IBLQ 2GEDA 4RZXA 4A2WA 1L1OB 1CTMA 5EP4A 1G3MA 1IAQA 3W5JA 1E3MA 1PUJA 2QE7A 1W0KA 1ZINA 4QG7A 4W7SA 1QVAA 3GEHA 4PQFA 2KBNA 4A76A 1ZIOA 3B1XA 3U3RA 1L4UA 1CRQA 2A5FA 4DSUA 2ERXA 3U9SA 2FF7A 1E9FA 2QQ0A 2GILA 1E2NA 1CRPA 3BBPA 4RFSA 8OHMA 3K09C 2R7DA 2BM0A 1T8UA 1BOFA 3LX8A 4HAVA 4IDOA 4FD2A 1ZIPA 2O8EA 3GLIA 2A78A 3WRXC 4GL2A 1KMHB 1GKUB 4R7ZA 1TU3A 3CPEA 3VDYA 4YDHB 3HOZG 1M8PA 2BDTA 2IYWA 2L0XA 3K0CA 2QPAA 5A0FA 3TNFA 2VP5A 4I1UA 3SR0A 2Z6KA 4KHPQ 2O8DB 2WJIA 2HYIC 1NJGA 3TE6A 1AS3A 1NMZA 3B1WA 1OH7A 1DCZA 1L0WA 4KI0A 4UXIA 4X62L 4C0QC 1IXRA 3B85A 1DADA 3CP0A 2G1KA 3CUEF 4I4LA 4DDTA 3CRRA 3CW2C 2NO1A 1NSFA 2RGDA 3RRYA 3MWLA 4X64Q 1AQYA 3AF1A 4JI7Q 1KHTA 4GZYC 5M5YH 2B63G 2QM7A 1RJ9A 4NYIR 2UUBQ 1HE8B 1Z0FA 4URVR 1K0RA 1HNZL 1BMFA 1VCNA 3K53A 3OIVA 4JYCA 2Q3HA 4RD6A 4TTPA 5H70A 1YZNA 1EXMA 1UJ2A 1Y8PB 2FH5B 3VU9B 1HTPA 2BBWA 1COWD 3A8IE 3S16H 2CJWB 2VH5R 3NKVA 1AKYA 2O52A 2L15A 4KFRA 3BXZA 2R65A 4BXXH 1X1SA 4BRUA 3WP0A 5D3MB 4DV2Q 2N49A 3TIFA 2ONKA 4B32A 1VQ8A 3RS5A 4BWYA 4EQ5A 4KAXA 3A7LA 1KJWA 2RGNA 1GITA 1KO5A 2QAGB 1KI7A 1AQUA 3C5CA 4QBGB 3B78A 1P2UA 1HZBA 2EQBA 5C3EG 2WWHA 2Y0SE 1WCV1 4S35A 3V4RA 5IK2A 1TXYA 3MXNB 1JEEA 3H0GH 1HNWL 1G6OA 1GL7A 1O87A 2AFIE 2CHVA 2JJ1A 4JBXA 1SULA 1VQGA 4M4SA 1K3RA 3SJCA 4C30A 1K8MA 4URWR 4LFAL 2FGKA 1U94A 5DLQE 3MGCA 5LB4A 4AYTA 4R4QA 1CKNA 5H1YA 2AUKA 1SVMA 4RSGA 5AJXA 4KLKA 1BVSA 1H8HD 2QNRA 2ZRGA 4R2HA 1K9MC 1XB2A 2PJZA 3RNUA 4B3RQ 2JA9A 1NTGA 5EE3A 2NVYH 1AN0A 1E9CA 3QNUA 3QUSA 4H9GA 3UKDA 2XB4A 1VPLA 4M1SA 4M1MA 4V0ME 4BBRG 2QE7D 1VQEA 1W0KD 1TF5A 1GVNB 2IXFA 3LH5A 4JYAL 4A3EG 2Q9BA 2WVJA 1IOZA 2F9MA 2QZ4A 4M1TA 4NXNL 3TS0A 2WB1G 4A3BH 2VP6A 4KV9A 1L2FA 4ACAA 4C3ZA 4A6XA 1E2DA 2B7BA 4V0LA 4JT2A 5G41A 2ZYVX 3IHWA 1TQ4A 1XDBA 3LNCA 3AF4A 5DYIA 4B3FX 3G71A 2PT5A 4HAYA 1J7KA 2IUUA 5AUNB 2P0EA 3FVQA 3FTQA 2B3GA 1RYFA 3KJPA 1A2KC 2YC4C 3FHTA 3SFZA 4GS3A 3I55A 2WWXA 4C0JA 1E1OA 1Q8KA 5C0XJ 4JI2Q 2CLCX 2PT7A 4GP7A 5EP2A 4K8OA 4TYWA 2NVQH 3BH0A 1YR8A 5JFGA 3S14H 1XNJA 2X1VA 4ERNA 4F92B 2ZSAA 4P4TA 5JJIA 1NLYA 3V9PA 3IEUA 4Z54A 3E9IA 1E2WA 2NOAA 4PAMA 2JA5G 1Q1QA 4HZUA 1MT0A 4PC6A 4W9MC 2GXAA 2H92A 2I1QA 5G53C 1N32L 2X2FA 2OFOA 2WJYA 2ORVA 1KI6A 4B3BA 4JL8A 1XMOQ 1BMFD 1FNMA 3B13B 3SU8A 3VX4A 1VG1A 4PG3A 3S1NH 1W7AA 3I4MH 1V1QA 2OSBA 4W5JA 5DHAA 1GIAA 4Q9KA 4TQUS 1G7TA 2GWHA 1CSPA 4JI1Q 1SVKA 2GETA 3HKSA 3AVQA 4LJAA 1SKYB 4BFVA 2DCUA 3KX2A 5HTKA 3NELA 2RHSB 3TRFA 1G8HA 3KUDA 4OHZA 4C2UA 2UU9Q 2VQFL 1Z29A 3ZD7A 1XXHA 1XJ0A 1XCPA 2E87A 1AKEA 2MMCA 1IBMQ 3I8XA 3F2BA 3TR0A 1F3OA 1T91A 2PMZE 4LNQA 1JQLB 3CZPA 4EFLA 5IK2D 1QJOA 3ASZA 5JEAG 2JJ1D 2BJVA 4TZ0A 2ATXA 4XTCS 4NU0A 1R2QA 1E3PA 2CHGA 3B82A 3T53B 1Q21A 1KDOA 5A5GA 5C18A 1QVCA 4DLYA 1ZVQA 2ZJAA 4Q21A 3GLGE 1P61B 2HHHQ 4L5SA 1E4YA 2IHBA 3HJNA 2FFHA 3I8SA 1EFRA 2VF8A 1Q0UA 3OTOL 4Z8XA 4E22A 4KCGA 2GRJA 3DMNA 2XAUA 4A3DH 4N3NA 1NNEA 3ERSX 1NRJB 5LD2C 1O7IA 4POFA 1CLUA 1DEKA 1T0HB 5EXTA 2HCBA 2CCZA 4OI4A 3C14C 5FL3A 1JJGA 2OZEA 2JQOA 4M1YA 2QBYB 2A69D 4O2DA 3B60A 1E94E 2F43B 2OAP1 4MUBA 3EX7C 1XPRA 2K33A 4X6AH 2IYUA 2IYTA 3KXKA 4NKRA 2ATWA 4FDBA 2QGNA 4A0RA 1ESMA 2CMKA 2LWIA 2ZRIA 4EDHA 1XRJA 1P8LA 2I4IA 2OBMA 3S15H 4A3IH 4HEJA 1GUNA 4KYIB 4ZDKA 3K70C 3J81j 5EUMA 5H8WA 1H9KA 1KNQA 1S9DA 2VLIA 3IBYA 3TVTA 3PIOA 4B44A 3MFYA 4TL7A 4A1FA 4UY8C 2DNCA 4LHXA 1M7HA 1A1VA 1E32A 2RGCA 2NN6I 4TSFA 1BDOA 1T5LA 3P26A 4LI0A 2D2FA 3JC66 2C9YA 4Y52H 2BBOA 5CDFA 3U3OA 4CW7A 2EYUA 1GO3E 1SLJA 1Q22A 3HYTA 3T51B 3TUJC 1VF7A 1G3QA 5E7MA 1E2HA 1QUQA 3PUZA 4HIOA 1KRSA 3CCQA 1QF9A 2F1MA 2IHEA 1UKVY 2CL6X 4B3SL 1D2MA 4Q1BA 3V00A 2A19A 1ZYUA 4D25A 3FKSA 1I94L 3BFKA 1PVOA 3RSLA 2IUSA 1KRTA 4DR3Q 3GCGA 4LF7Q 1VQ7A 1KJYA 5BYKA 4TQAA 2LMCB 1QVFA 1VIAA 3BZCA 4ABYA 3EG5A 2OCPA 3OFNA 2NZJA 4PFSA 3EZFA 4C9BA 3N5CA 5GADl 1X3SA 4DKXA 3LQRA 4O3MA 1M6NA 3VR4A 4XVUA 3NXSA 1S1MA 1PH2A 1IQPA 1GNPA 3THYA 3GLIE 4APVA 5GJVC 3CD6A 1HR0W 1U8AA 2H8KA 2QI9C 1OF1A 2L5TA 3UE0A 2Z4RA 3CXCA 5L3RA 3LFUA 4B43A 2EWVA 2R6GA 3OIWA 1K5DA 2ZAOA 3BOSA 2VS1A 3X1XA 3GLFE 2GBLA 3EPLA 2PQAB 4CEHB 1HPCA 2LKDA 1A6XA 3H15A 4DV3Q 1NG1A 4XIGS 4DV5Q 2UXCQ 1NN3A 4G5QA 4Y0AA 4B73A 3GJ6A 5JRZA 4LF4L 4A0HA 2RMKA 4CEIA 2X77A 2QT1A 1KC8C 2IYRA 3GLHA 3CRMA 4KKUA 2R93H 3TRZA 3S2HH 2V6JA 1IBRA 4W5WA 1SVOA 4WA7A 2K5VA 3BS4A 5LD2B 1Y14B 4IOAA 4LJ5A 2BMEA 1NIPA 3K80C 3Q7PA 3GTKH 3I61A 4B6EA 1EFRD 3ZVRA 4ZDJA 5KDDA 1P4SA 1II0A 1XEXB 2NN6H 1JXMA 4QOSA 3AB9A 3HU1A 4NHOA 4ACBA 2AD1A 3NBFA 2GJAA 4ARZB 5J4HA 4KXFB 2O8BA 2JXMB 3T1YL 3TQFA 3K70B 4OQLA 3N70A 4DV4Q 1QHYA 4LFAQ 4V02A 1XP8A 4DCTA 4DLVA 1E2IA 4X66Q 4I7ZC 2J0UB 3UWKA 1B9NA 2QGQA 2O5VA 2D7CA 4M9SA 4EQ6B 4XD7D 2EU8A 3QF7A 1PA6A 4NMMA 4DSOA 2DHRA 1GL6A 4YHHL 3QE0A 4PAOA 4LF5Q 4HDOB 2WKPA 2KI5A 5EZ6B 3M85A 4NXMQ 3HGBA 1XTSA 4M9XA 2IYQA 4TSFD 1JR6A 1KSGA 4PZ7A 4A9AA 4NE2A 1WBDA 1R5NA 3SJAA 4G7HC 5JWRA 2IS1A 1T3LA 1G5RA 4ZCIA 1I4TD 2OTLA 1YRAA 4YC7A 2BM1A 5G3ZA 4L5QA 3WXMA 2FMXA 2CVHA 2AL7A 3FMFA 3FKSD 3VKGA 1SE8A 5IP7H 2IF0A 4RCZA 4A6PA 1DAMA 4MZ9A 4M1KA 5F98A 5SZJA 3ZVMA 4P31A 5B64A 1KD1C 3LW7A 4DV6L 4B2LA 2J0SA 2K32A 3ZIAA 3P4YA 4LFBL 1M1YE 2C9OA 4DK6C 2NG1A 3BB4A 1KDTA 2DFKB 1F6BA 2IYXA 3OFND 1NKTA 4IFEA 1DPFA 4PPQA 5IHPA 4RY2A 2IS2A 2ORWA 3U4VA 2R2AA 4MGIR 5KSPA 5J4VA 3UANA 2WJHA 2W00A 4ZO4A 3WYAA 3RS0A 1TAGA 2CHQA 1W0JA 4LYAA 2VBCA 4IO9A 1P3JA 3O47A 4KFUA 1KAOA 2QF7A 4BEJA 1RIPA 2F3IA 2PNHA 2FGJA 2FXQA 2ZRCA 3FKQA 4LC0A 4PSKA 4RZUA 1QHHA 1RRFA 1LF5A 1GUGA 3TSZA 4F4IA 4MDFA 4UQOA 4UKDA 1A7JA 1SMYC 4LWCA 3OW7A 2IA5A 1US8B 4K81B 4DR5L 2J7KA 5C0XI 4U02A 2A6HD 4BXXG 3SJZA 4BA1I 2OFWA 3TH5A 2DYKA 2JJ2A 4FI3C 2PLFA 1VQCA 3I3SR 1K83H 3OW2A 1UE5A 3VX3A 2YZ2A 5KSOA 5CB8A 1UAAA 2XXAA 2WAQE 3HOWH 4JS0A 1XJCA 1JNYA 1JEDA 1ONLA 3Q5EA 1H9RA 2I1VB 2GZHA 1ZCBA 4NBSA 5DN6D 2IWRA 4DLTA 5TMPA 3AVOA 3H0GG 5FBVB 4R9UC 3KKQA 1R7RA 4MDEA 5TY0A 1I6VC 2FPKA 1AS2A 2ZEJA 1KI3A 1HQYE 2YU9H 3RWMB 1GKYA 3EASA 1A8VA 1XD8A 2OEPA 5M3MH 4DEXA 1N6HA 3W1GA 2ZS8A 4OI0A 3D4RA 3ASYA 1HZCA 4JV5Q 2IYSA 1XNQQ 1HJPA 1RC8A 4MYCA 5JJLA 1CJTC 4DV0L 2QGZA 4MA4A 5DO9A 2RHDA 4DV7L 2IXGA 3P20A 1DAHA 2WJVA 2DUDA 3KXIA 3MSXA 2B8FA 2JIZD 3HFZB 3GEIA 2G88A 4P4SA 2D06A 5HY6A 2ZSEA 3OTOQ 1FMJA 1FQKA 3TVDA 1C7YA 4A0GA 1DGSA 2Q2IA 121PA 1KOFA 3U7EB 3FB4A 4O25A 4XWAA 4A2PA 4D0GA 2JEAI 2E2JH 3EC1A 4FXPA 4HLCA 3A1WA 4D2IA 4B3MQ 3KQLA 3K0CC 5JRJA 4LBWA 4L15A 4L8GA 1UF9A 2Z6KC 5AJZA 3KQKA 4G01B 3KDFA 4DNRB 4NYMQ 4DR6L 2KCTA 1OKKA 1J90A 1IXRC 1W1WA 5FBLB 2AMCB 2ZJRA 1IBLL 2MMGA 3C8UA 3W9YA 3GFOA 1E96A 3W6NA 3QBTA 3H1TA 3MWKA 1NBME 1DELA 2WMOB 1MABB 2KSQA 1WOCA 2ZANA 1EFHA 3WWVA 3L0SA 3J7A5 2AHOA 3ZIAD 3A8KE 5HCIA 3QSYA 2FSHA 4Q47A 2D62A 5E7NA 1LABA 4LWZA 4RZ3A 4AWXA 1KI9A 1C9OA 4JC0A 4CEJB 3M1IA 3NE5B 4HYYA 2G1JA 1W0JD 1ZAKA 4G5SA 2FE4A 4H44C 4B3SQ 4ON9A 5J40A 4B33A 3GTLH 1T6NA 4AURA 4IVPA 1Z0KA 3ICQB 1E24A 3I4MG 4MYTA 1U0LA 2HIXA 3FMPB 3Q8DA 1WQ1R 1G51A 2J45A 2RGNC 4KHPL 4LV5B 1VQAA 3HOVH 4LUZA 3CRKC 1GOTA 3J81i 1D9ZA 1YR6A 2LCFA 1IONA 3H2YA 2QENA 2QROA 3W5IA 1Z5ZA 4FW9A 4IDHA 2JJ2D 4L9SA 1UEJA 4RD1A 1YRBA 1XD9A 1DO2A 2OESA 5TXGA 2VSOA 2PZEA 3LO5A 1J2JA 1WDTA 1KTVA 4GSYA 4M21A 3EBEA 2V1CC 2Z0SA 1SVIA 2ZTCA 4X64L 1VQMA 3CCEA 2VNUD 2CWAA 1L4YA 4JI7L 3K0EA 4M1WA 2IUTA 4D82A 1GSIA 2XNSA 3JZMA 1E2JA 3WDNA 1YHQA 4FMBB 3CC2A 2UUBL 2FSGA 2WSMA 4KODA 2ZE7A 5HE9A 2UKDA 3NBHB 2GXQA 2WOJA 2G0TA 1E2LA 3HOXH 3S1AA 3SYNA 1RFLA 1RRCA 4UJ3A 4LK1C 1GDDA 3O8RA 3ZJYA 1OIWA 3WHKA 1XMJA 1R5OA 4MTNA 4RFSB 5GVRA 2AKAB 1JE5A 1P72A 2ZM6Q 4JMPA 3CF0A 3CZQA 3A36A 1R4AA 2O8EB 2A69C 1MRSA 3N6RA 4H02A 4A3DG 3AUYA 3NVAA 4Q9JA 3GJXC 4ZV4A 4DT1A 2PL3A 2Q0HA 3GJ3A 5DHFA 3WBKA 2GN5A 4X8OA 4C7OA 2DWQA 5L3SA 3CF5A 3G6EA 1CUKA 1O7LA 2GXUA 4QBHA 3O8DA 1MV5A 2ZRKA 1VIYA 3AGPA 3F3YA 4AG6A 5B30A 1CR0A 3K0FA 3LW8A 3GFPA 2HJVA 4MRNA 4QIWE 1G18A 2BH2A 3FMOB 4QL3A 4JI5L 4M0LA 1QDEA 4DEYA 2GJKA 1KO4A 3A37A 1ODFA 1ZM9A 4A3IG 3A4LA 1PV4A 2YNMA 3TUZC 4ZI3A 1ASYA 3QKTA 1JB7A 1TQDA 2DBYA 4PZ8A 3OE7D 4DSNA 4EPRA 4B3RL 4GKJQ 2X2EA 3CB4A 3PIRA 5JSZA 4R4CA 1RJ9B 4YMWA 3QOFA 1I4DD 2JATA 1GKHA 2VQEQ 1CULC 1SN8A 2Z83A 3U2QA 2A1AA 2A5DA 3QG1A 3G4SA 1BBUA 1KNXA 4OK6A 2ZRAA 1JAHA 3OAAD 3R7WA 1T9HA 2VA8A 2XNDD 1LTLA 3DOEA 1YE8A 1U0JA 2P5TB 1NVWQ 4YMUA 4JOIA 2GJ8A 2R8RA 2RAPA 3TJZA 1ZUHA 4JBKA 1MJCA 2CQOA 4P3YA 3KF8B 2AUJD 2ID0A 3B1VA 4DUGA 4DKAC 2OT3B 3T1QA 2WICA 2ZM5A 1TEXA 1WJJA 4IFDJ 3AYHB 4PPNA 2IEYA 2XEXA 2WHXA 2Z6VA 3K1JA 1J8MF 4NYMR 4A8JA 4DV6Q 5IP9H 4LHZA 4HJ7A 1NSTA 5IRCD 2C95A 2PJRA 2X8AA 5FOSA 4FMCF 1CKNB 5GAHC 1IZ6A 4JI2L 3U61B 2NQ2C 2AK3A 2C2HA 4GOPA 1VQ4A 4NYIQ 4F7WA 5BR8L 2ZRMA 5SZHB 2IS4A 1GUAA 1IY0A 3VHXA 1BYUA 1T5EA 4BFUA 3MXUA 1Z63A 3EPKA 1AZTA 4PV1C 2V3CC 1VG8A 4DUZQ 1ZD1A 2VL7A 1XTRA 1GNRA 3ZZ0A 1LVGA 1IL2A 1AGRA 1QZHA 1P2VA 3ULPA 4B76A 1E9RA 1FYCA 1XMOL 2HT6A 3BRWD 4PO1A 5ANRB 3VNVA 3QF4A 1N6LA 4MRPA 3EARA 1OSNA 1HQMC 4LCBA 4M1OA 4LYFA 2B7CA 2QTHA 4PC7A 2FPMA 2R93G 3SYLA 4JI1L 3LBHA 3U5ZB 5BWMA 1Q86C 4MUAA 4H13C 1P62B 2B8WA 4LY6A 4L5RC 1QZXA 4EPWA 1KSHA 1MKHA 3UDXA 4Q4HA 1R10A 2ZJBA 3EW9A 1WP9A 4D0LB 3AVVA 4GNXA 1XD2A 1SKQA 2WMNB 2VZAA 2UU9L 2NN6G 4MNOA 5FPTA 2JLUA 4AQYQ 1CU1A 1XX6A 2QUZA 4KU4A 4WZBE 4QHSA 1IBML 3QXJA 1E9BA 4C0AC 1KQSA 3U44A 1N33Q 1GRRA 4FWIB 2JLXA 1WB9A 3RS7A 5GJBA 4YY3Q 3S1QH 3M0EA 1UDWA 4TMVA 5BQ5A 1TWFH 1KK2A 3L82B 3L43A 1OB2A 2ZIAA 4L5TA 1G6PA 5JBQA 1D7QA 4FWTA 4AKEA 1TU4A 3SS8A 1OE0A 4IHQA 2CDNA 2NTYC 1KSFX 1W49A 4IOJA 2PEYA 5FOWA 3TMKA 2HHHL 5JJKA 5CLLA 2CE7A 2CEAA 2OO7A 3PJRA 4HZUB 3PO2H 3EXAA 3K9GA 3W3ZB 4D26A 3C7KA 2VO1A 4A93H 1G8PA 1KI6B 4WAUA 1YVDA 2B8GA 2QRZA 1D2NA 3FWYA 2VW9A 1LY1A 3FP9A 4UNPA 4C0BA 1HE1C 3Q5DA 4EPYA 2ODEA 3ZDQA 1Y1WH 2EQSA 2IY5B 2HDNB 1SMXA 1NMFA 3ZYCA 3NDBB 1F2TA 1IYJB 1TF2A 3IHLA 1ETUA 4IPDA 5IP7G 2KCCA 1FP6A 3NWJA 1W4BA 4P72A 3QIAA 4LBYA 1NL3A 4DR6Q 3SOPA 1XXHB 1WI5A 2NPFA 3UG6A 4ASUD 4DUGD 4I1VA 2PZFA 2CNWA 3G5UA 2A5JA 1HT1E 2PMKA 5FR2A 3T1VA 5FH9A 3X1ZA 5HE8A 2Q6TA 1IY1A 2XB2A 1UKEA 4II7A 4JLDA 4WXPA 1ZNYA 1N5JA 5J5CA 5P21A 2RCNA 4LOAA 3PUYA 1YR9A 4CZ2A 3PEYA 3KJHA 2BH8A 3FFBA 3K9NA 5LMNW 2VF7A 2GBLC 2A6HC 2WZQA 4UXJA 4LF6Q 3LAWA 3AV0B 1SXJE 5FOVA 3U60B 2BE5D 1KK1A 2FEMA 1QG4A 1NJFA 4LUOA 1KY2A 1N5LA 4IPCA 4L8JA 3TREA 2AR7A 3E2IA 1RL2A 4H1VA 4DR3L 4TYPA 3W8RA 4LF7L 1Y69U 4PAQA 4YMSA 1G4AE 4LJZC 5FUYA 4ZI2A 1E9DA 2C35B 2ZRJA 1U90A 5FBQB 1XMQQ 4B2PA 1VQKA 3GLFA 3HOWG 1CKMA 1Z0IA 5TB5A 4URXR 2D2EA 4RD0A 3BZKA 1A63A 1KO8A 4Q4AA 1KAGA 3LX5A 2REBA 2ZU6A 5CB6A 4PQRA 1PMRA 1NN1A 1RYHA 3K0XA 4L16A 5M5XH 3CWQA 2A3RA 4HUQA 3ZZTA 2ZJYA 2JA6H 1VTKA 4ME3A 2W2XA 3LA6A 5CYPA 3R8FA 1E2FA 3QKRA 2DB3A 2HIVA 1E1QD 5M3MG 1Q44A 2C99A 2E75C 5J3BA 4DCUA 1YZLA 3ADCA 2OTJA 2ZI4A 2GEVA 2VUMH 2K5UA 4DV3L 1TUIA 4GOXA 4DV5L 2UXCL 2D2CC 4EFMA 2ZVPX 3LVQE 4G5GA 4B71A 1N6IA 2FU5C 1Z47A 1QUQB 1Q1ZA 4IOCA 1MO5A 1GUTA 1X54A 1BYIA 3I4OA 1O78A 4JI0Q 1QHGA 2VP0A 2WJJA 2ZI5A 1VYTA 4GZLA 2OM2A 3EIHA 3NEJA 3MAAC 1GHJA 1M2OB 2DPXA 1N34Q 3CR7A 4OI2A 3RS3A 2J59A 4BFZA 5KTYA 1TWGH 2UXDQ 2QMEA 1KY3A 2HJGA 1J70A 5K36H 2W6JA 4NONA 3X2SA 1IN7A 5IF9A 2A5YB 4AK9A 1Z06A 3OF5A 4IOKA 1KSJA 1NMXA 1OT3A 3CLVA 3LDAA 4JSYA 4Q7MB 4US1R 1G4UR 2ZQ5A 3AVXA 1PH5A 1R0YA 5JS7A 3SQXA 3EZ6A 1VECA 2ZITA 3EIEA 1WE2A 4DV4L 4JI5Q 2ATVA 1OV4A 3CH5A 4TLAA 3KB1A 4BGDA 2FFAA 1VQLA 4X66L 4TT3A 4J0QA 3THYB 1OXUA 1I6HH 1UFQA 1K5GA 2ONJA 3CRQA 1E98A 5A35A 1GUSA 3HU3A 3CONA 4DXAA 1XZPA 1Q81C 1EUJA 2WB1E 3D0FA 2YHSA 2YWEA 1Z6GA 3RLOA 4LF5L 1XPUA 2E5LQ 1JQJC 2O0KA 4EUNA 1UE6A 2CNWD 2ZJZA 2ORIA 3IPYA 2ZRDA 4NXML 3STBD 4B3TQ 1FFHA 1G8GA 3EIVA 1LB1B 2I5HA 1OPXA 1S1CA 3SHWA 1GWNA 1H8EA 1HUQA 1UADA 4B2IA 4TLDA 5HPYB 4KHZA 4JBMA 4CEIB 2V4ZA 5HR5A 3GLHB 5LDDC 1FTSA 1GRQA 1YJ5A 3CNOA 5K8IA 3E0EA 2CL0X 2KA7A 5CITA 2QORA 3DXJC 1P2TA 5FBRB 2EW1A 2CW0C 3EC2A 3VR5A 4KSBA 3HOVG 3WNCA 4V0NA 3AFQA 4HR7B 1CKEA 2BIFA 3CBQA 4DLRA 1RPZA 3AEZA 4Q19A 2OXRA 2O8BB 3SE0A 2GXSA 5KNBA 4UP7A 3THWA 2ZYTX 3ZGXA 2OQ0A 3REFA 2ZYWX 4M9ZA 3TUIC 2QL6A 1C4OA 3B9QA 2ZXUA 3A1UA 4K0KQ 2Q9CA 3PEUA 4HB0A 2H5XA 4MYHA 2IX3A 2O8CA 5BR8Q 4DCVA 3E9HA 4QGAA 1H9JA 1Z0DA 1FQJA 2VRWA 4PTLA 1WCMG 3HOXG 1XF9A 3GMTA 3Q3JB 4IFDI 1Q12A 2JA7H 2WPDA 2YWFA 3SGIA 4GOKA 1PFSA 2P5SA 4URUR 5TV2A 3CM0A 2YOHA 5BXQC 3BWDD 1LACA 3A5ZB 621PA 4LSGA 1E9AA 1NVUQ 4YLGA 2G0NA 2VEDA 4GPTA 1HT2E 5AJYA 2FA9A 4IXNA 2OCAA 3KFVA 5CM9C 4KN4C 2OCEA 1UWVA 1E2KA 3DDCA 3WNBA 4PC3A 2H18A 2SHKA 221PA 2W58A 4RZ2A 2PZGA 2OHFA 3FYHA 4B47A 5C1BA 3HYRA 3KL4A 1TEVA 1Y1VH 1ZNXA 2ZE8A 2PPBC 2W6JD 3CPHA 5JEEA 1NVVQ 1HZ9A 1Y8NB 4KFTA 1VQDA 2XJ4A 1XNRL 3A4MA 2QP3A 2FEOA 1YKSA 2VIIA 3PF5A 1N2CE 4CT5A 1GD7A 4HB4A 4DDUA 1G9XA 2Y8EA 4JV5L 1A4RA 4DR2Q 2OBLA 1XNQL 2NO6A 3NH6A 4ZIRA 5AJ3Q 4DRZA 5DGXA 5GAGC 1W47A 3KFXA 5FOUA 5BW8A 1KHIA 1XZQA 3HR7A 1QHHB 2AFHE 4HSEA 2GAOA 4DK3C 1NE3A 3EQLC 4QY7A 4DVGA 4TTRA 2BCGY 3KDSE 2QA4A 1MKYA 4EPXA 1GG2A 4NTZA 3B9PA 1H8ED 1NBMA 4XH9B 2IHYA 4B3ML 1XPOA 1E4VA 1QVGA 1VCOA 2C78A 1T4GA 3IIMA 3TR5A 2XXAB 1ZP6A 1HR0Q 4YWLA 1ANKA 2PCLA 3IPXA 4IXMA 4PSVA 3DO6A 4DC9A 2IYYA 5EP3A 4Q7LA 3G48A 3AM1A 1QHIA 1TU2B 1J6QA 2HF9A 3BD9A 2O0HA 3DL0A 2FG5A 2ZTSA 4QNRA 4TN1A 3NDPA 4FMDF 5JCZA 4IPHA 5C44H 4L4UA 1E1TA 3E70C 2OILA 3ZVNA 5IP9G 2BKEA 1D8LA 5EAYA 4Q9LA 2QA5A 2GNOA 4BRWA 2GK7A 5FPYA 1JJ7A 1BBWA 2NVTH 1XMSA 3QPUA 1PZNA 2KENA 3CCJA 4OWTB 4H0LC 4JBWA 4AIIA 4DIEA 1YNJC 5JS8A 3MRSA 1FJGQ 4LV6A 1Z6TA 4JLNA 3SC3A 5EXSA 2F52A 4DIDA 1RIFA 2CWPA 3ZJYC 2OCYC 3VKWA 2W6IA 4DLWA 1LM0A 3ZZUA 1PH7A 3UMFA 1G5PA 1OH5A 4NL4H 4P4SB 1U81A 3CX7A 3R20A 1VYVA 5DLQC 1WRBA 5FLMH 5GJWC 4BLPA 3L2PA 2GAAA 1U8ZA 4WIAA 3CAMA 2IYVA 1E2EA 4HJAA 3MD0A 4LBZA 2KJQA 4IJMA 1JJ2A 4P75A 5HZHA 1G7SA 4D81A 4DNTB 2EJFC 1A0IA 3DKVA 4G7OC 1ZU5A 1E0AA 3KDFB 1VQ6A 4D4MA 4YONB 3FPPA 2BVNA 4B3DA 2RHMA 2D7DA 1TKWB 5FI0B 1S96A 4KJZA 4CDGA 4QC2A 2XJ9A 3BIFA 2NO0A 1KZGB 3VAAA 4C3JH 2YKGA 2WWIA 5B2ZA 4JLMA 1KI2A 1MO4A 2AKWB 2G77B 2AHOB 3H4MA 1NY4A 3T56B 1LUZA 3LXXA 3T5GA 2VHCA 4S2EA 3GFTA 2CBZA 2FNAA 2ZM6L 2OUKA 3JVUA 2LXJA 1P16A 1NMYA 1DS6A 1ZM4A 3PO2G 2D3WA 3PCRB 1G8FA 4HAWA 5L3VA 4WVFA 3B8HA 4GT1A 4A93G 2YWHA 2UXBQ 3EWSA 1PUIA 1E2QA 2EFCB 5TDHA 5JZVA 1B70B 4URZR 5IWAQ 3THXA 2OBNA 3GTGH 3IIKA 4LUVA 4F91B 4JOIC 2BMFA 3DEFA 2VHUA 5DIFA 1EOVA 2BV3A 1Y1WG 3RRZA 1EWQA 3VFDA 3RRMA 4PO9A 4DZZA 3SBEA 5C4MA 3WMFA 2G83A 1RE0A 5JLJA 1NBMD 3BERA 4B75A 3FHCB 2F1JA 1P2SA 4M22A 3TW8B 4A8JC 1V8QA 3A74A 4LUCA 4YWMA 1NVVR 4GKKQ 1J8YF 1KI1A 4EPTA 1TL7C 1ASZA 3AVUA 4GKJL 4GOPC 3F0TA 4WZ6A 2BE5C 1IN8A 4KBGA 1XTDA 2ZE6A 1FL9A 3S1AB 5IDVA 2QT0A 2VQEL 1OW3B 4IPGA 3RZOH 1UDXA 3GJ4A 1WYDA 3ONWA 4KKTA 4BPBA 4DR4Q 3CMEA 1E0JA 1FOEB 5IYBH 1DG1G 1S4QA 2FFQA 3IRBA 1G8YA 1AM4D 2FV8A 2ZRNA 4YCUA 4HLQB 3UWOA 4X65Q 5FFMA 4WBSA 4PXAA 3ZQ6A 3JAMc 3QXSA 3T1TA 4EJSA 1YITA 1VQNA 3RABA 4RMFA 2XITA 4NB3A 2W6ID 4DT1B 2MQHA 4C7OB 5L3SB 4QHYA 3MJHA 5IYCH 4KKSA 1N0VC 2FSFA 4E5UA 1FUUA 3SYKA 4GNXC 2B21A 3UPUA 3K0FB 5J47A 1S3OA 3L0OA 3PG5A 4M9QA 2WIBA 2BKUA 3LWNA 3I72A 3TZUA 3BG3A 2ZSFA 1EESA 2BMDA 1VKJA 4DBLC 2EWWA 2HXSA 3ECCA 5KYKA 3IUYA 1AZSC 3UXMA 2MSEB 5FUVA 2FZ4A 4R4TA 4P32A 4BLRA 2JA6G 1YBYA 1M1KC 2W2VA 1QHXA 2CVFA 5IY0A 4JT4A 3WBJA 1YEZA 5JSZB 2BA1A 2UZIR 4DUZL 1GTVA 1ZM7A 5KHOC 2EFGA 3I1FA 2VUMG 4F38A 3V4FA 3NBXX 2VPPA 1WBBA 3ER0A 1SZPA 4TLEA 1OXSC 4C0SA 4AKHA 3WNDA 2O5IC 5BN3A 2G6BA 3EA5A 2H16A 1YHBA 4TWZA 3G0HA 3R7WB 4DLSA 2J9RA 2EDGA 3KXLA 4LF9Q 1W4RA 4BFXA 1N25A 3DMDA 1T5IA 4F93B 4EFNA 4AYWA 1KAWA 2W0MA 1KGDA 1I4LD 4A3MH 2GZAA 2OLJA 5K36G 5JMTA 5F9FA 4ZKEA 4A3JH 4D80A 3W1BA 2R7ZH 1VMAA 4AQYL 1KJZA 1XJVA 1HH2P 3Q7QA 1V43A 3IKJA 1W4CA 2GCOB 2Z0MA 4FIDA 4HLDA 1N33L 1WXQA 3GJ0A 3NENA 2K7VA 1TPZA 5FTMA 3KQHA 4R1JA 1EQQA 2GVZC 3QG5A 3H94A 3FHOA 4A8JB 4YY3L 3ADBA 1LF0A 2ZS9A 5FOTA 2JASA 1CKOA 1MO6A 3T1OA 4JL6A 1XNRQ 1EWHA 3STBC 1XJQA 1ZNZA 4JKYA 4GOPB 3BE4A 2QU8A 2FPLA 1X86B 4JIMA 2A7QA 2WSSA 2HQLA 1K8OA 3TS2A 3K9LA 5KPJA 4TMKA 4EX5A 2QBYA 3K0SA 2JLQA 1MR3F 4Q1DA 2ODWA 1SRUA 1EWIA 5C4JH 3PF4A 2MSDB 4A3CH 1W44A 1E22A 1ZM2A 3BORA 1G7CA 1TMKA 5FPKA 2V1UA 3CO5A 3QF4B 3PGZA 2IL1A 4RKEA 5GADC 4LF8Q 1LW7A 3A4NA 4I1OA 1YR7A 4OONA 1SQ5A 1DVRA 4XOIA 3WHLA 2JLSA 5E95A 4BUJA 1NY6A 3PUVA 2OLKA 2A2ZA 2UZ3A 4GNXB 4DLZA 4B6FA 4HUTA 1MIUA 2KCMA 1XD2B 4IJHA 3KB2A 1Q46A 1M74A 2CE2X 1Q82C 1ZBDA 5JEDA 1R0WA 3SJBA 1IBKQ 1SXJA 1ZYRC 3GLGB 4IVQA 4P71A 2AWNA 4IDPA 4MRVA 2GTPA 1OIVA 5M5WH 4JL5A 4KITB 3U44B 1LYLA 1B9MA 1PH6A 521PA 2B8TA 1XMIA 3AUXA 1CJMA 2WAYA 2DWOA 3IILA 5C0XH 4R4IA 2HV8A 4G1UC 1S3SA 4LDJA 4YDSA 3K81C 1D9XA 3W34A 3D3QA 2QRNA 2Q9AA 2YTYA 2VSFA 4WJ3M 1Z7TA 4LF6L 1NY5A 4AC9A 1IY2A 2UUCL 3H0KA 5E3HA 2JA7G 4LC1A 3M4YA 4IOMA 5L8VA 4XVQA 4MYUA 3R9WA 4OX9L 4X8HA 1X56A 1NG9A 3K8AA 3OOCA 1PH9A 1EIYB 1HY3A 1OHHA 4BFYA 1ZC4A 3EZ7A 1K8GA 3UE1A 1DAEA 3HOYH 1KZ7B 1XEWX 4B3CA 1YIJA 1YJ9A 1XMQL 4OXPA 3EN2A 1QZGA 1EGAA 3JZAA 1F2TB 2XZOA 4V0OA 2FN4A 4BE7B 5C4XH 4DUYL 1G17A 5DSZA 5K8UA 2PQAA 1Z6HA 1EK0A 1FP7A 2J1LA 3K7AH 1UPTA 4FMDB 4JLJA 4ZPXA 3RAPR 1Y1VG 5JCPA 4JJZA 3EZ9A 4N0DA 3IFTA 4KN7C 2LXKA 4NPSA 3LNNA 3KJOA 1G41A 1ZJ6A 4KYUA 2GZDA 1FNNA 4OK5A 1W48A 1OYWA 4OQXA 5DYGA 3ND8A 1E1RA 1IHUA 4CF7A 3X1YA 3U3JA 2HEIA 1TWAH 1NVXQ 1IYUA 1GL9B 4HAZA 4JVSB 1Z08A 1GUOA 4AH6A 2OFXA 4FN5A 1WCMH 5FOXA 1TQ2A 2HT1A 2J41A 2IYLD 2C04A 1X65A 1GVPA 1P7CA 2ZUBA 4OQNA 3WP1B 5K8TA 3I2ZA 3CMAA 2YC2C 2ZRPA 3KTAA 2KBEA 2ODBA 4JLOA 5F2EA 5J4LA 1P9NA 4JI0L 3SNHA 4A75A 1DAKA 1B0UA 1UEIA 2WSSD 4JVNA 4LW1A 1VCIA 1VQIA 1WA5A 1N34L 4XSHA 3I5YA 4Q9HA 3GLIB 3BJIC 4MKIA 4GFDA 5A4JA 2UXDL 2NGRA 2QY9A 5EQTA 4XTRA 2A6ED 3IIJA 1IJFA 3OIYA 3U3KA 1W46A 5FPHA 4LHWA 2C96A 5FR1A 4OKSA 1NI3A 3GLFB 1W36D 1KDPA 4JYBA 1HZAA 2C98A 1I50H 3GD7A 3AF0A 3Q72A 3QKUA 4HI0E 3LWUA 1Z9FA 2A8VA 2ZROA 4Q4AB 2B29A 4G0NA 2NZOA 2P65A 4FCVA 4HUQB 5C44G 1VF5C 4C0HA 2WBLC 3CKLA 3IBGA 2F4VQ 1I3QH 3IDQA 4JI4Q 4P4UA 2EJGC 4IQZA 2J87A 1RRGA 1E7ZA 2D0PA 1SXJD 2E5LL 3IQWA 1OKKD 3QKRB 4A3LH 3DPUA 4M2LA 2IWHA 5KPDA 3FDIA 1LV7A 4B3TL 4GOJA 3H86A 3J81k 1S2MA 5L3QA 4TMTA 4WZAE 5DI3A 1U99A 4LYHA 3D7MA 3SDZA 1MRNA 2Z4SA 1VDZA 1AIPA 1NIJA 1CFMA 4BY7H 2GKSA 3WYFA 5J4YA 4Q1AA 1ZKOA 1C9KA 2AN9A 1EFTA 4URYR 4C0KA 2YYZA 2G9NA 3PXGA 5FLMG 4R98A 4PO8A 4TMXA 3RS2A 4Q01A 1EX6A 2EFDB 1S8FA 3E1SA 4GI7A 3R8CA 1QHSA 1CR2A 3AQ4A 1XMVA 1TUEA 1OHHD 2O5JC 3UMSA 3CF6R 1KIXA 1TWCH 2QM8A 3AKEA 3CX8A 2QPOA 3M4QA 4Z8YA 4G3XA 3ULLA 3DVLA 4NH0A 2QMHA 4A3FH 3RANA 1PLLA 3QJYA 1XTIA 1JXOA 1G21E 1PLKA 2BEKA 2DFNA 4LBVA 1CXZA 3PENA 4PHGA 4BFWA 4K0KL 1YZGA 3GQBA 2FJUA 3HPQA 5DISB 3LQQA 2J3EA 5AWFC 3RDPA 3CF2A 5HZKA 4AD8A 1HA3A 3AKYA 2FSIA 3T35A 2Z5FA 3AKCA 1ZMXA 4JZKA 1II8A 3MWJA 2F1HA 1E1RD 2QSZA 1X55A 4GLVB 1JR3E 2WWWA 1KXLA 1TWHH 3EPHA 1HEIA 2V55B 2P67A 1S40A 2ZJ8A 2XTMA 4IDQA 3H3VI 2P6UA 3OESA 3AGQA 5IT5A 3TEHB 3A58B 5E4FA 4OGQC 1SROA 4GN4B 1NLZA 3U4QA 4OHWA 3RC3A 4DLUA 4DHEA 1W4AA 4PC2A 1ZUNB 1SKYE 3KJGA 2F1RA 3RVBA 5GVSA 2CCJA 1YJNA 4UNNA 4GMDA 4OBEA 2MFIA 2OV2A 5CLQA 3E5HA 2RGEA 4C4PA 3KLRA 2JA8H 1AH9A 3DM3A 1H95A 4JKIA 3TLXA 2PLRA 5CJPA 5LMNQ 1FPMA 2BBTA 4V03A 4Q1CA 3PQCA 2MO1A 1CJKC 1VG0B 4GN3B 3CIOA 4GZMA 2Q3FA 1F48A 4IVRA 2EJMA 4P0TA 1G3UA 4DR2L 1FX0A 2OXCA 4POAA 5DI9A 2JDIA 2O8CB 5AJ3L 1X9NA 1JPJA 1CTQA 3LD9A 4I1SA 3TKLA 1GJXA 4C3HH 5H1SE 2P6NA 2ZVQX 2GJ9A 4M8NE 3W90A 2V9PA 4GRAA 1O3YA 4C2MH 2GCNA 2WJGA 1XWIA 3G82C 3LV8A 1I2DA 1G3IA 1WMSA 4LZZA 3OPOA 1OLOA 4TKOB 1K8RA 2R6DA 5IYBG 2ZAMA 3SFVA 2LKCA 3D8BA 3MMPA 4W5HA 4Q7JB 3WMEA 2P3SA 3GPLA 2WOOA 4EAQA 2DNEA 1W2BA 2VQSA 4LJ6A 3U58A 2PMDA 1R0XA 2BC9A 1DBSA 1E0SA 1VHLA 4A4DA 2QTVB 4E09A 1QVRA 4QQBX 3B7GA 1HR0L 1MABA 2VSXA 2IBMA 1COWA 1MJEA 2QMUA 4QJFA 2XTNA 5IYCG 3I4NH 4KLNA 1JI0A 3SN6A 5LPNA 2YTVA 3WMGA 3RHFA 1SHKA 2CLDX 2REXB 2XGJA 2YOFA 3U6BA 3QXCA 4JCVE 2ZPTX 3T61A 3O8BA 4CEJA 3HDTA 1I5FA 4RFVA 4Q18A 1UM8A 2WIAA 2OG2A 3Q85A 4BASA 5KNDA 1LFDB 1Q3HA 4KFSA 5KU1A 4UJ5A 3CH4B 3L0IB 3A8TA 3P4XA 1FL0A 4IJLA 3PIPA 2WKRA 4LFCQ 5HKKA 2V7QA 4TYYA 4HLUA 1FJGL 4JBJA 2N8NA 2BJWA 4Q4JA 4ZIRB 2X19A 4EKDA 4OO1I 1A62A 1IXSB 3M4OH 1YJWA 2UUCQ 1SVSA 4C0LA 5BYJA 3EIQA 3KKPA 5EE9A 3SHFA 1JMCA 2ZJOA 4LHYA 2O8FA 1QRAA 4QM7A 1HQCA 4OX9Q 3RNLA 3ADDA 1K6MA 3R9XA 2YOGA 3QVUA 2ZETA 4BQSA 1VQJA 1Z6YA 3NG1A 3M7NA 3RN2A 1ZCAA 4JVLA 1OFTA 5EUQB 1IW7D 3BAFA 4YCWA 4DAYB 3PITA 1P9WA 2NMVA 2EXDA 4TL6A 3LXRA 4A3MG 1N36Q 1WFQA 5FJ8H 3VQTA 1MOZA 4A3JG 2JJ8A 2JEOA 3C15C 5EE5B 4DUYQ 4Y0VA 4GN5A 2R7ZG 3RS4A 2ZRFA 3KOJA 3SZRA 4HB2A 2XZLA 3BB1A 5KSYA 2F55A 4U7DA 1ZUIA 1VQOA 1GHKA 3PCOB 3A6PC 3TBKA 2RF4A 2WTUA 2ANCA 3AVPA 1N3BA 3HKZE 2DFTA 4V0KA 3AP1A 2YVUA 1N6KA 3QEOA 4GNKA 5ELNA 1X3EA 2QEXA 3REGA 5CIWA 2VHTA 1Q3TA 2ES2A 1DO0A 2AK2A 1PLJA 3DM9B 4JLVA 4MRSA 2JDID 2R7FA 2YTXA 4A3CG 2H1LA 2UXBL 4DR1Q 1E99A 4R2IA 4CIDA 5AJWA 3I92A 1Z3IX 1CP2A 5IWAL 4HIKA 2NIPA 1E2PA 3HKZG 1U5KA 4C3IH 1YZUA 2V6IA 1RZ3A 4QRHA 5IT9c 5SZIA 4EJSC 3B6EA 3I62A 1KDRA 2K75A 3RR5A 2G3YA 3PUXA 4O2LA 3CPJB 1OYYA 1HH4A 3VR2A 3K0AA 4RD2A 4US0R 3K9HA 3PVSA 2CCKA 5EZ5A 4WJ4A 4NCIA 3RN5A 4R4OA 3W6PA 4OO1H 1PYBA 5JWHA 1T3SA 4GKKL 2DWPA 3I73A 3QPWA 3N2IA 4TMZA 1Z0AA 4QJ3A 4TL8A 4ALPA 3NEYA 1GP2A 2ZR0A 3MEFA 5BN5A 1P73A 1ZU4A 2XTZA 3DOFA 2N3SA 4KVGA 5LBIA 5C0XG 1N8RC 4TQ9A 1NMGA 4QGUA 2V1XA 5CK4A 1U9IA 3QI2A 5EJEA 5IYDH 5HCNA 1YZKA 2R62A 3QXHA 1DAIA 4BBSH 1ZNWA 3GJ8A 4HAUA 2LSSA 4DR4L 1KMQA 1LNZA 3LLMA 5HKKD 5C46F 3T1HQ 1JBKA 2V7QD 4RKFA 421PA 2A5GA 4X65L 4N0EA 2P2LA 4TYQA 2XTIA 1CEEA 2HLDA 1Z07A 1XBTA 3T12A 3Q8XB 2BCJQ 4NYJQ 2K50A 5JI3E 2PX0A 1OXXK 1DARA 3THXB 3GEEA 5J4KA 1T3HA 3HOYG 2F1IA 4HJ9A 5KNCA 1QG2A 3GJ7A 4RD3A 1QBKC 2Y0SG 3OEEA 3L8YA 4BZQA 5JHHB 3DLLA 1P75A 3FOZA 1CS4C 2KE5A 5C4XG 3MWYW 4YCVA 4D4LA 5CYOA 4JLKA 4IEIA 4A3KG 4GP6A 1G1MA 1D6JA 1OFUX 2GA8A 4WOPA 5FUWA 4AI6A 1G3RA 2V4DA 4PR0A 1JT8A 3TAUA 3QKSA 1OJLA 1M7BA 3DHWC 5UKDA 2WFWA 2E9SA 1Z2CA 3WYGA 5HGQA 2PI2E 3BFVA 3SEAA 1R8SA 2PBRA 3AP2A 4FCTA 4XSGA 4TMWA 3X1WA 2K52A 3T34A 2WP8J 4A92A 1G6HA 4MGKR 4IW3B 3CCVA 3D6TB 4A2QA 1F5NA 3NIBA 2RKOA 3FGNA 1AS0A 2A6EC 2ASBA 5GROA 3PFIA 5AJVB 4LF9L 1SHZA 2Q3MA 3UK6A 1F2UA 3W8NA 4G7ZC 3BH6A 3RRNA 3S2DH 4JI8Q 1PH3A 1U8YA 2DR3A 2YWGA 1W36C 2K4KA 2ZI9A 2OWOA 3N2EA 1G64A 4Q1FA 4EJSB 2K5HA 4DK1A 2JLVA 2F9LA 1YU9A 4NCKA 2ZI7A 1B23P 5M04A 3K8YA 5AK0A 1DTSA 3BU2A 3KQUA 3LVRE 4UP8A 2JLYA 3CCLA 3RZDH 3GP8A 1H9SA 1W36B 2JLWA 5E7IA 4BLSA 2Q2UA 3CRVA 1IYVA 1SXJC 2RGGA 1A5TA 5FL7A 4YMVA 4FMCB 4JI3Q 2C77A 2HCJB 3A1SA 3J7ZC 4KO8A 1VCMA 1HV8A 4Q48A 1RKBA 1VYUA 5JHGB 2I5LX 2ZJQA 3T06B 4BFSA 1YZ6A 1E0KA 2V8OA 2IHFA 2KBFA 3BFXA 3C41J 5H68A 2ZRHA 4A3GH 4A3LG 1Y8OB 1FVIA 4TT3D 2JJQA 4Q00A 4KVAA 4LJYA 4LPKA 3CCSA 2NO7A 4A36A 2GDJA 4EIWA 2MSCB 3NBZC 3M4PA 1A2BA 1G20E 2ZUDA 3CCUA 4LGMA 2FWRA 2QTFA 1AA9A 4LK2A 4BY7G 3DZDA 2RGAA 3KF6A 1CJUC 4LF8L 4DV1Q 1Z2AA 5IE8A 2JCSA 4ITRC 1DXMA 1L1OA 1IXZA 2A30A 2E76C 3UDGA 4PPGA 5KDOA 2CXXA 2UUAQ 1AK2A 4FCWA 3AH8A 2HLDD 3B2EA 5ELOA 2FDCA 1N6OA 3EPJA 4TZ6A 1IBKL 1P9RA 4Z1MA 3UATA 2VY3A 4IDNA 2P6RA 2VP4A 4IFDH 3ND9A 5LMUQ 1P6XA 3PO3H 2BEJA 1ELOA 4A3FG 1NN0A 2VP9A 3T15A 5F3WB 4E07A 3OEED 1IM2A 4N1AA 2R9VA 1Y63A 4DR7Q 1KI4A 4GDFA 3NC0C 1TX4B 2C9CA 1AJEA 1KMHA 1J5EQ 2AX4A 4A15A 4HDQB 2GCPA 1DE0A 1KO7A 3VA7A 2E2IH 4B35A 1BS1A 4XWOA 1K8AC 1E9EA 2O8DA 2JE6I 3OEHA 4QGHA 1X3GA 3RLFA 3L2OB 2F6RA 1ZD9A 1Q1EA 1R5BA 1R8QA 3PEVA 3AEVA 2B92A 2N46A 1X6VA 2ZS7A 4OYHA 4OI1A 2Q8IB 1UBEA 3EAQA 1CF4A 4JLAA 3GDEA 4XD7A 1JPNA 3L8ZA 2QQEA 3CRW1 2WPDD 1EG7A 1Q7YC 5CJ2A 1KYIA 3RWOA 3U7FB 3AFPA 5JEAJ 2I0QA 1SVWA 2IYZA 3S1MH 3C16C 4NYJR 4E03A 5KUTA 1VS0A 1UBCA 1H65A 4MQBA 4RVCA 3U6KA 3F2DA 4LJ4A 2GK6A 4F4JA 2A68D 1L8QA 2TMKA 4OJQA 3RLNA 2GJSA 1OFHA 2IW3A 3LRPA 4IFBA 3H84A 1SXJB 3VU9A 2F7SA 2FX3A 4IOLA 2CJWA 1OTCA 3GO5A 2JA8G 1VG9B 4BY1G 1R0ZA 4YMTA 2PCJA 4KSCA 1LS1A 4QGGA 1V9PA 4MKGA 1EFCA 4MKFA 1OFIA 4MGZR 2IF2A 1YNNC 3UDIA 4HAXA 4PC1A 5D3MA 5TVKA 2AXNA 1FR3A 1GRNA 3ZH9B 5FL7D 1YHNA 2BHRA 2XOKA 4TVAB 2AD5A 2QAGA 3A5UA 4JI6L 3BB3A 4B34A 721PA 3QVVA 1NBWA 2QSYA 2JA1A 3PR1A 1Z6XA 2EFHB 1JB1A 2ZT9C 3L7ZC 3F2CA 1M34E 4DSTA 3M6AA 4GLXA 2J0QA 1VQ9A 1EFWA 1N5KA 4X62Q 2REOA 3NBYC 2OAQ1 2OE2A 4JSTA 1PHJA 4JK1C 1X3FA 1IN4A 2C8VA 2ZTEA 4KMUC 3J81c 1KKMA
chains in the Genus database with same CATH superfamily
1DG3A 1AK9A 1EOTA 2NU6B 3K09A 1NLFA 4KK3A 2LR0A 2ECKA 3DBLA 2UZ4A 2JI7A 1LA2A 2RGXA 3R7BA 4LF4B 5GIPE 1WV1A 3DDUA 2EY2A 1B2RA 4N40A 1A4IA 2UYHA 1B8VA 3HDJA 4DNOA 1XFDA 1TUBB 3X1MA 4ND5A 4R1TA 1E69A 2IV2X 4BX0A 4M8KA 1Y82A 4LJ8A 5IU6A 4GKJB 1SCAA 1YBAA 1X9HA 2NPIA 3U7GA 1QTNA 3A32A 4M0KA 1TPYA 1A9PA 1XZAA 3TK1A 2LZ0A 3A1TA 1C8LA 2AEJA 2K14A 5HIMA 1CJSA 3U56A 2I7CA 3KFUA 4DV6B 3JYOA 1ENPA 3QSGA 1K8ZB 1IDN1 1N4AA 3W6UA 5A4JA 4CVNA 5IYDG 3O8CA 3F9CA 4CG2A 3AZQA 1M2GA 2VQFQ 1Q90A 5FTLA 3ZU4A 1N6RA 4ZD6A 3U4QB 5DK6A 2J5RA 1EVIA 1EWYA 4GSKA 2FFKB 4LQ4A 4Y7NH 1N0WA 3KWJA 1UFKA 3U7JA 2UUPA 3DL7A 2QRPA 3UCFA 1HDCA 4BJ5A 2NTEA 3UMMA 1I3OA 4RTMA 1E2ZA 2G5GX 1T0PA 4JEHA 4WBXC 4NCHA 4AMZA 2QX6A 1PNTA 4D9BA 3AO0B 3HQ4O 1RYEA 1KL9A 1SRQA 2XWBB 5CORA 4YXWD 4YT5A 2XDQB 5K6RA 2JAXA 3LBIA 4RTPA 2MR5A 4QUAA 2KPOA 1XEXA 5GV8A 4CIAA 1XLUA 3SIWA 2WJPA 4FS8A 3MJRA 2H4WA 4KY5A 3BGVA 4G5RA 4ER6A 3PO3G 2EYQA 3UXYA 4JX9A 4UHEA 5DKFA 3U7QB 3RTCA 2A5LA 1DEOA 2PRZA 2IX0A 5T4FA 3PJDA 3CZ5A 1NQWA 2Z1NA 3QQ5A 5CHYA 3C5HA 3GTQH 4LDZA 4RY8A 3G2NA 3BA6A 3PXEA 2OXEA 3IIIA 1JA1A 1ABFA 4F4FA 3EG9A 5TARA 3MRVA 4FVMA 1FLVA 4LJ9A 4TM8A 3ZXIA 2VHJA 2WD7A 5EE1A 5M5XB 1K73C 2O2DA 5K5PA 3RJTA 3E9CA 1VBNA 2WZCA 3ZJUA 3NEMA 2WV9A 2GB4A 4OLFA 2ODNA 1KO1A 2WC1A 4YAUA 1UKAA 4H27A 3ZWDA 3IGFA 5SZKB 4E31A 4ZCMA 1P1IA 2CFOA 1X8LA 4DR5Q 2YY5A 1XZKA 2HXYA 1I13A 4H3VA 3AHJA 1BMTA 4WHMA 3E27A 1PR5A 2O0JA 1SPBS 4P4GA 5LNK6 1HMPA 1IEQA 1V7QA 5ARBA 4K9QA 4JNCA 3LBNA 1X7YB 5DYWA 3X1DA 2ZR9A 1M1NB 4B9WA 4OM7A 4KBFA 4P7FA 1AHIA 4FX5A 3SQWA 5JAUA 5M3FH 4J0JA 4IYJA 1Z5WA 3SYMA 1AGPA 2K5NA 3OJOA 1E1LA 4NZNA 1LZKA 3ICEA 3C0KA 1QHNA 3TI7A 3VNBA 1F3LA 4NPHA 3CTMA 1MO2A 4J4TA 3NBQA 1CTMA 1LV9A 3SEBA 3WNVA 1QYDA 2H1FA 3QFHA 3EVFA 2J09A 1E2NA 1MX9A 3F4KA 5JG7A 1V3QE 3GMSA 4LHEA 2JW5A 3K0CA 2PA3A 4YAKA 2O6LA 1BNCA 4DVJA 2EX1A 4C0QC 1PZJD 1IXRA 1NSFA 1U0OC 3D8HA 2B63G 3P2EA 2UUBQ 3BE6A 1Z0FA 1BMFA 3OIVA 4TTPA 5H70A 4IUPA 1QFJA 3G1WA 4XFKA 1YB5A 2R65A 1NXWA 1UXJA 1PS0A 5CT4A 2ZBUA 3VR5H 2FMTA 1KO5A 3V4RA 1A8IA 1DAOA 4JBXA 3D1VA 1U94A 4AYTA 1CKNA 3IVAA 3GAMA 2CXUA 3GUHA 3TZKA 4R2HA 2N55A 2WSYB 2YFQA 3T9CA 1Z4MA 3FFTA 2F9MA 1IH8A 4C3ZA 2QB5A 4QPZA 3WKAA 2VDWA 3HZOA 4EKNB 1XDBA 1S89A 3MAGA 2E49A 4CKZA 2P9TA 2PX6A 2HTEA 4BB6A 3BF7A 2HMAA 5C0XJ 2QQ5A 4ERNA 4RA6A 2ZSAA 5LL6S 1ADCA 1FPQA 1U9JA 1VSBA 2APJA 3ENVA 3I4MH 4Q12A 3LK6A 3A4VA 3TJMA 4LTMA 5K2MA 3TRFA 3HCRA 5GAJA 2F0EA 1L4NA 3ZD7A 3H09A 3PNBA 3IQHX 1B1ZA 2Q2OA 2IE0A 4JBNA 2EIHA 4GUDA 1F5SA 5CR9A 5LD2C 4RIEA 4PLVA 1XYYA 1RJFA 1PL0A 2G63A 1YONA 3K92A 6CHYA 4C29A 4L50A 3OSUA 1O57A 2GPSA 3PZRA 1RWBA 1JJIA 4KH1A 3TVTA 2YUTA 4WFQA 2IODA 4D8UA 1Y8AA 4YJ2A 4FXGC 1BN7A 4UCXA 3N52A 4HIOA 2XA2A 2EIXA 5LYJA 4GWLA 1VPWA 1O8CA 4Y2JA 3CLRC 5L4NA 4C9BA 1HOTA 5BV7A 2G9QA 4XVUA 4L85A 4H7JA 2QI9C 1ZD3A 1RZVA 3AEKA 3UE0A 1TLTA 5AVOA 2E37A 3LFUA 5BSWA 3AWIA 3PD1A 1U0NA 1TK3A 3H15A 4YN3A 3OFKA 2Z4TA 1NN3A 4Y0AA 1DSSG 2O2EA 2ZYDA 3R5HA 3P9PA 3OQJA 3LX0A 4FYDA 2B2CA 1WX1A 1EFRD 2WQ6A 3RG2A 3FN4A 1TK9A 4CFSA 1KAHA 2ZIEA 4K9LA 3K70B 3FOAA 3VOBA 3UWKA 4EQ6B 5D14A 4KX5A 1PA6A 1JQ5A 2DHRA 4H7IA 2FVYA 5EZ6B 4X85A 2IYQA 4TRMA 1LK5A 2I8LA 2BKLA 1LTBD 3A7EA 4PO3X 3GCXA 4BUZA 4XW2A 5THKA 2BM1A 3GA0A 3GELA 2CVHA 1F2DA 5IP7H 2R66A 3I9MA 2O8VA 1SE3A 2ENBA 5IHPA 1NUTA 1NKTA 2FW0A 1E6EA 2R2AA 4AJOA 3PNMA 2O8NA 3UGJA 2PNFA 3ZD9A 4PSKA 2VRCA 4RZUA 4YQYA 4JFRA 2IA5A 1NAIA 4FI3C 1R1DA 5DGIA 2AMVA 2LCQA 1UE5A 1L3CA 1ONLA 2GZHA 2R8BA 1CUXA 3TQOA 3I5MA 4DLTA 3TIVA 2N3ZA 4JXXA 1W88A 1WWKA 1ZJ5A 1RNLA 3FRHA 1QG7A 3M9WA 4XQEA 2PGNA 4BNNA 3EOZA 3J7AF 4P4SA 5HY6A 2HPHA 1SNPA 5A6SB 4MUNA 4ZOAA 4ZO6A 2VJOA 3Q8WA 5BVHB 3SK8A 3UUFA 1TWHB 3DHVA 2X76A 4IDDA 4YGYA 1AZQA 1QVVA 1Y42X 4QYIB 1SCUA 4KH0A 1DELA 1KYYA 3ILYA 3ZQUA 5EIBD 4QPNA 4HWOA 3WLJA 2NSJA 1BCPF 4RKQA 3GTLH 1IEWA 1Z0KA 1IUOA 3GRYA 2IKQA 3EOAI 5DT2A 1G51A 3B48A 1ML3A 1UAGA 1LPBB 2AG5A 2QJRA 4OX9B 3KYJB 1SM4A 2CWAA 5DT9A 1P0IA 4DUYB 2XQIA 1L5FA 1UJ5A 5K0JA 5I9SA 1MRSA 4CETA 3JQFA 2PL3A 2Q0HA 3QV2A 4MLPA 4NICA 4U68A 2HJVA 3U9TA 2VKTA 4JI5L 1WQ3A 1QDEA 1Q6YA 2GJKA 3AW9A 1EBFA 4IUVA 3NAGA 1FDUA 4GKJQ 3QOFA 5ESXA 2VDJA 5FA8A 2C1EA 7YASA 3NTOA 5BV8A 1U0JA 3KZNA 1N3IA 1WP4A 1C3VA 3CLUC 1PKEA 1Z5PA 4GOLD 4M9CA 1T2DA 3K1JA 4DV6Q 4LHZA 4HJ7A 2D6FA 2JJYA 4NYIQ 3ITDA 1O5TA 1X13A 1UC4B 3USES 4CKXA 3RVJA 4TLMB 5BPFA 1AGRA 2FE1A 1T4MA 3BRWD 1PKXA 5FO8B 1TW3A 2QTHA 1QBGA 2PUDA 5DNEA 4KMSA 4AQDA 1QF7A 4JCOA 4N9TA 3GLGA 3SF0A 1ICFB 1HDEA 3C3EA 4LRSB 2JLXA 3VYUB 5C5MA 3OU2A 3S7ZA 3CEJA 5LQJA 2OO7A 2H1RA 5ELBA 5KJCA 4JXZA 3MF4A 1G59A 2B8GA 3Q5DA 4EPYA 1M73E 1CV2A 3FYTA 1SNDA 2BFWA 3RBZA 3IHLA 3IPRA 2E4UA 3GBPA 3BILA 4OB7A 1ULSA 3QNWA 2VYCA 1XKQA 4LNHA 4LOAA 1BGVA 2QG4A 3AV0B 1NJFA 3FDZB 5H3CA 1RL2A 3FUVA 1NP7A 2HUGA 1I8TA 5TB5A 5CXXA 3P1HA 2ZU6A 4IHAA 1RYHA 3OA2A 1IHPA 4UM9B 1W25A 2QQFA 3BBLA 1FNDA 5SY9A 2ZVPX 1N6IA 2XF8A 3COYA 1I36A 2HJGA 1YBHA 5HNKA 3F3KA 2ATVA 4DV4L 1F4LA 4X66L 1R8XA 1K5GA 3D0FA 4WK6A 2ZJZA 1DOHA 5DHSA 2ZRDA 3OZWA 2Y1WA 2CH4W 3MXOA 2IYEA 5IBRA 2O2LD 1U9CA 3HL0A 2PKEA 2XN9C 4IJQA 3V1YA 1C9EA 3PC2A 2WTNA 2IX3A 3G2MA 3AHGA 2YDXA 5BXQC 3A5ZB 2XRZA 1MB0A 2VEDA 4PZDA 4YDQA 1OBCA 2AG6A 3K5HA 5E6RB 3FPCA 1MP0A 4DYDA 2WF6A 1SAPA 4WMLA 2PPBC 2V45A 4N8SA 3LCUA 1XNRL 4NDXA 2YN0A 3VPGA 4UAJA 2D5BA 3KFXA 5FX2A 1XJ5A 3HR7A 4N76A 4MS3B 5ITVA 2QEJC 2QA4A 4IHJB 4EPXA 1GG2A 2F1OA 3HOUB 3EGXA 3IPXA 1R5JA 4Q7LA 1O96A 4MMYB 3OPVA 4DPMA 1I9GA 2Q5QA 4BZXA 4RTNA 4OAQA 4WNAB 2KEDA 3CCJA 4BO9A 3QB3A 4DQ0A 4LV6A 3R77A 2LGJA 2VWPA 1BXKA 3IKVA 2PRIA 1GZVA 3MHPA 4NL4H 3AFIA 1HDYA 4YJFB 2O7RA 4RGBA 3S7TA 2VZ9A 1VOTA 2XE4A 1A0IA 3WLRA 4LOLA 2D7DA 1NOKA 1JDTA 3C6QA 3S68A 3DS8A 3BIFA 2G77B 1TCAA 4AB1A 1AK1A 2L9HA 4DBZA 1DS6A 1ZM4A 3PUHA 5D6NA 4NAUA 4M9RA 3DEFA 2J8ZA 1DQRA 3R3SA 4PO9A 2BI4A 5C3EB 3R3XA 3CW9A 1P2SA 2GYUA 1RSZA 1XVUA 3OUZA 4RKYA 4K9SA 3CISA 3HKEB 1IEXA 2PD6A 1KWGA 4BPBA 2ZWPA 3UWOA 1RCUA 2PSHA 4YJ3F 2GEJA 2B8EA 2X6GA 4HDNA 2WB1B 4GLBA 3QEKA 2H6EA 2D5IA 4M9QA 4XDZA 3T1YB 1GY8A 5FUVA 1PF7E 5CVVA 3C3LA 2XZDA 3L92A 4ULLA 2BA1A 1GTVA 1NP3A 1T43A 3LZ6A 1BD3A 3ER0A 4TLEA 3OE1A 3CCFA 4TWZA 5BVGB 3KXLA 3EBPA 4KV7A 1A9SA 2R7ZH 5CAEB 3FPGA 1UWCA 3PWSA 2FR8C 3X1JA 3NENA 4GP9A 3IQFA 4EUHA 5FOTA 1ZNZA 2WTAA 5IUJC 3BE4A 3L6RA 1SUAA 5J39A 3LHSA 1OU4A 3H5RA 2DT8A 1RWQA 3NTHA 1W44A 2DR2A 4FB5A 4U3JA 4RHFA 1MAVA 3KB2A 1ZYRC 1BWQA 4FC7A 4B4OA 1LYLA 2I66A 1UBRS 3SX0A 1QONA 2A9OA 2Q9AA 1M10A 3KVYA 3PNVA 3NORA 5KKAA 1JIJA 1K8GA 3PCXA 4EUEA 4M7PA 5DSZA 1ACMA 2PQAA 2GAFA 5EFZA 4JJ4A 2JK0A 5GMOA 4BYMA 1FXWA 5DM1A 3QVJA 1I9CA 5FOXA 3MINA 4S0ZA 4KAFA 3OH8A 1P9NA 1FNSA 5DTQA 2JFOA 4FNFA 1XGKA 3OIDA 3INTA 4ETNA 5K0NA 1ZY2A 4S2UA 3TTSA 2MCFA 4J2HA 4UOEA 3NXWA 3IEXA 1LV7A 3PQ2A 2QDXA 2XUQA 1UQUA 2FZ5A 1C9KA 4DXDA 4K6FA 1CUCA 2G9NA 2O3UA 3LUKA 3H42B 3QGMA 3UMSA 1OHHD 1WZEA 1KERA 1QCZA 3DVLA 1CXZA 1RM3A 2D1YA 1YMVA 1HA3A 1U4MA 1CB0A 2WWWA 4D3YA 3D6VA 3EPHA 2WZDA 3BYTB 4L4YA 1XMXA 3RC3A 1N8KA 2OV2A 2XRSD 4C4PA 1GQSA 1KRXA 3JAME 4GZMA 4WY2A 2OXCA 2Q5JA 3RSHA 3RM3A 1EB9A 1UWKA 4C3HH 4BBZA 1B0PA 5JFOA 2SNMA 2GCNA 2XIQA 1I2DA 2RK6A 1DLJA 4Q7JB 3OC0A 3GPLA 3RBXA 3U58A 4AP6A 1COWA 2XTNA 2AC7A 1MCZA 4CEJA 4R7GA 4AECA 3TXXA 3P4XA 4BOYA 4P7KA 1H6BA 4CLHA 1YJWA 4ZMRA 5C8XA 4LHYA 2AOUA 4OX9Q 2ZETA 4YH1A 5EUQB 3PL1A 1P9WA 3KTFA 1HDIA 3LXRA 1WIWA 4YV1A 4DUYQ 3NIGB 1J09A 1ZUIA 4YRMA 1I1QB 2ANCA 4R6WA 1SKUA 1O6GA 1X3EA 3FWKA 3SEZA 4CIWA 3QYFA 2VHTA 3RHZA 5ADWA 3DM9B 4OQPA 4NDNE 3BREA 2H1LA 3GRPA 4OV6B 4CIDA 2H2GA 5AJWA 2IXBA 1Z3IX 1CZHA 1IIBA 1W93A 4US0R 5KAPA 3TS1A 2Q1WA 4OO1H 2GM4A 3QPWA 1M8FA 2BF4A 4B40A 2ZR0A 3MEFA 2V5VA 3S15B 3TP6A 3SC6A 2W2LA 2V0CA 1KYVA 3LLMA 1WCIB 2Q1XA 5CDYA 2V7QD 4MPJA 2HLDA 1Z07A 3Q8XB 4NYJQ 4GX0A 1HFKA 1SHJA 4QUCA 3FZQA 3RU9A 4M87A 2FCRA 1G5HA 3TINA 3I0NA 4M54A 2RD2A 5DTMA 1Z39A 5FUWA 4RGOS 1V8OA 1JT8A 2ZKLA 3PRYA 1KARA 5UKDA 2WFWA 3ZKWA 1R8SA 1NOIA 4JW0A 2WP8J 2WILA 4D0SA 2RKOA 3FGNA 3WNQA 5BMVB 2EJCA 4EJSB 3WRVA 2RSLA 4YRRA 2RCYA 5M04A 3K8YA 3QOXA 1CK4A 5ARCA 1E0DA 2A1TS 1QNLA 3CRVA 1FYWA 1DKRA 3ETGA 4TS4A 1GA6A 4A3GH 2JJQA 3ED1A 4WLUA 2GDJA 2BTOA 1BJRE 2F4IA 1NI5A 2WWRA 3KYBA 1YR3A 4ZK9B 1JAZA 3QMMA 4IDNA 4UFOA 4IFDH 1Y8QB 3IL2A 3OEED 3Q9SA 3QE9Y 4GDFA 3L46A 4QLAA 4MW2A 4EEXA 4WLVA 2AI3A 1JHVA 2X9LA 1TVMA 1CF4A 4JLAA 4GX1A 4QUDA 4IJUA 1XRLA 3P0RA 3DV0B 3N8HA 3F2DA 4KIJA 3SXUA 1T3GA 3BZBA 4IFBA 3MRXA 4IIXA 2Z8LA 4TTSA 2YU9B 2FPIA 2VUTA 4HDAA 4JJ8A 3KWFA 3LUJA 3JQ6A 3C8HA 1XL0A 2HV9A 4KMUC 4HWSA 5AVZA 2L1BA 2B78A 3K6JA 3FHWA 2EBWA 2VATA 1O7ZA 4OHVA 4RVHA 1U2DC 3KKNA 4L8VA 4TRRA 3GXBA 3BDCA 3FSRA 4MH0R 1B3QA 2PZ8A 3S2SA 1C3OA 2ODTX 1EVJA 2EJVA 2ENWA 3E8MA 2P3LA 1XZMA 3CCMA 1HWYA 1E2MA 3J81A 2WSLA 4PQXA 3R9IA 1CT9A 3DV9A 1EYGA 5G3LF 2HPZA 5JZMA 3QY9A 1SVNA 1FFYA 5IXJA 2IYPA 3ZBTA 2D0PB 1NDQA 2BDOA 3F1ZA 1L2TA 3J80c 2M9VA 2WWGA 1QAOA 2CFMA 1E2VA 2CL7X 3RF6A 4AN0A 1XTJA 1RIIA 1SYEA 3BTVA 5E6UA 4MITA 1CR6A 4DLXA 3NHLA 1YQWA 2XX3A 3L6OO 4KO2S 2XRYA 2SNIE 3P9IA 4O0MA 2JK8A 3SLGA 3ZVLA 3DCJA 3VJLA 1C1XB 3EGWA 1T3TA 1SGWA 1ECJA 5JECA 4FEEA 4ZV9A 1Z4JA 2JLZA 3NHAA 1JIKA 1XAIA 1Z17A 3L4EA 1WF3A 4AZSA 4C7BA 3WGMA 3FR8A 1QU2A 3W7AA 2JGNA 5HKOA 2C3MA 3STWA 4DAVA 1DTEA 3ZD6A 1G19A 3OE7A 4KQKA 1LBTA 4EB0A 1R6BX 1CUGA 1H2HA 1V3UA 1QGUB 2PV7A 1CEQA 4RJLA 5LC1A 2XNDA 3AP3A 4FOOA 5C4GB 1MAWA 4HSGA 4F06A 4L5YA 5AHRA 4OYRA 4FKMA 5EQFA 4Q4JB 4TTQA 4HPWA 4UUOA 2WM9B 5CBPA 1H5NA 4IV8A 4DMFA 1MVOA 2DUWA 5H9WA 3RAFC 4BLQA 2OQKA 1CIPA 2GH1A 2HK9A 1HDGO 5B57C 1HDXA 2J85A 1SXGA 2P8SA 3KQMA 4ZN6A 4J8QA 1XQYA 2OCDA 4Y6PA 4BWVA 4JKOA 4XB1A 1NBIA 3LOUA 1DQSA 1LVHA 1NQVA 3T1YQ 3B3QA 2E2HH 2BOVA 2QIPA 1RRKA 3QPVA 3UIEA 3BTOA 1TVCA 1NQAO 1T25A 5GOTA 4L3OA 3RADC 5ALIA 5D3IB 4KIFA 4ND8A 1C7IA 2ZU0C 1XZEA 4CFYA 2AXPA 3LECA 1JECA 3A05A 2VYFA 3ZC3A 1W5SA 3RSOA 3AJEA 1N5IA 1UBGA 4CJ1B 4MWBA 3JTMA 1FFCA 4KQIA 4ZGGA 4Y6OA 3JYPA 5EJGA 2Z6AA 4QDZA 4KUHA 4R9NA 4I3FA 2YWBA 2DUMA 1RVDA 4UPAA 2YH2A 3LT2A 1YVCA 1RAAA 4EHHA 4DA9A 1K0SA