3PUYA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 96
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puyA01
2F52A 3QF7A 4H9GA 5LBIA 2GJAA 3LVQE 1WP9A 5EE3A 4AG5A 3I73A 1DELA 1I4TD 1GL7A 1G8PA 2PEYA 4OI1A 3X1YA 3KXIA 2VQEQ 3IFTA 4G5QA 4TLEA 4TL8A 1WQ1R 3IBYA 4C0QC 1DTSA 1YKSA 3FTQA 2ZT9C 1KK3A 3PEVA 2YOGA 1QZXA 3WY9A 2RHQB 1YZTA 4UP9A 1AJEA 2VHUA 3S1QH 1XD2A 4HEJA 4XVUA 2F1MA 2AL7A 4XSGA 1KNXA 2DHRA 1SLJA 2IL1A 4BRUA 1G7TA 4LBZA 3T1OA 3T53B 3ADCA 1GNRA 2JA5G 3QKTA 4EPTA 4DT1A 2O8FB 1GHJA 3UG7A 2ZU0C 4BFTA 4DSOA 1W2GA 2V1CC 4GLVB 3QKRB 4URUR 4LCBA 3QE0A 1P60A 3KJIA 1LM0A 4R4CA 1MOZA 1XX6A 1X8JA 2V7QD 4K46A 4OBEA 4M9ZA 1UBEA 2JA8G 1Q7YC 3D7MA 1ZCAA 3BIFA 3B9PA 3U4QA 1KGDA 2OG2A 1E6CA 3GJ3A 2HXSA 1GO3E 1VYUA 2R6DA 2QY9A 3PO3H 3S1MH 3K0EA 3EARA 2XZOA 1G21E 4NXMQ 3CCUA 5BYKA 3PEYA 1O7LA 1B7YB 4RD3A 1E2MA 3HYTA 3SZRA 4BLRA 1A63A 2B92A 3SHFA 4DIDA 2E2IH 3LBNA 5M04A 2EJGC 2FSIA 5C0XJ 3A7AB 1PH3A 3CNNA 1W0JA 1L1OC 2VIIA 1AIPA 4Q4AA 2E74C 4DK1A 5FJ8G 1E2VA 4NPSA 1KMHA 2GF0A 2GXUA 2YYZA 1FL0A 2JDIA 4DK0A 2Q2HA 1SQ5A 2LKCA 2ZETA 3DHWC 3DKPA 4XD7D 1VIAA 3FPAA 1CEEA 2W6JA 4DC9A 2ZJQA 1GJXA 5C18A 4DV0L 3E1SA 2YHSA 2OT3B 2Q8IB 3KFXA 4A36A 3CCJA 3I4MH 2O0JA 2JLYA 4R1JA 5JHHB 1RJ9B 3KF8B 2PL3A 4JIMA 4BLQA 1XNJA 2KSQA 4GZYC 2JA8H 4NE2A 2V6JA 2G6BA 3LNCA 4OWTB 2A2ZA 2BJWA 2QROA 1I6VC 4GOPA 4WJ4A 4JC0A 1MIUA 2ZU6A 1TQ4A 4LY6A 4A0FA 1KO1A 1YNNC 4HJ8A 4Z54A 1P61B 3D8BA 4A2WA 1ZYRC 2WMNB 1OXUA 4UNQA 1G64A 4HDCA 5SZKB 2VQFQ 1HZBA 4B73A 4C0JA 4FWTA 3QVVA 1N6PA 1Q46A 1KIXA 2R7ZG 4MTNA 5GAEC 3CP0A 5FBQB 5FTKA 5C2JB 1KZ7B 5IP7H 5L3QB 1E2IA 3OW7A 2ZTEA 4TMWA 3AP3A 2Q3HA 3TJZA 4GOPC 3LLMA 4DPGA 4A15A 2WJHA 5ELXA 4F4IA 3ULJA 2RGNC 3TSOA 5JHGB 3STBD 1GNQA 3I55A 3K0FA 1G7SA 1RVDA 2IHEA 2G88A 2WWYA 2N42A 1G3RA 2XX3A 4WJ3M 2YWHA 4BZQA 1II0A 4KKTA 3W3AA 2JK8A 4O2DA 4Q1AA 2EFCB 3O8BA 2HF9A 5FI1B 4FN5A 4KU4A 5C4MA 2HQLA 1M74A 2PX0A 4HB3A 4B3TQ 2JA7G 2BE5D 2EQSA 2OTLA 4PQYA 4D6PA 3AVUA 4JLAA 3ZJYA 2ZR7A 1UF9A 4Q47A 1HR0Q 3JAMc 4Q1CA 4XIGS 2YNMA 4DR7L 3DOEA 1OPXA 5FL3A 4RSGA 3I32A 5FI0B 4CF7A 5K8IA 1X3FA 4YDSA 5HE9A 1Z7TA 1R7RA 5JI2E 1A1VA 4D26A 3QY0A 4DV7L 4JBKA 5GJWC 2RCNA 3GJXC 1G3IA 3K09A 1GIAA 1H9RA 3PGZA 1D2EA 3WNCA 3GTKH 2F3IA 1KK1A 4JG2A 1ZC3A 3EAQA 2DYKA 1OIVA 2RGXA 3RDPA 2FF7A 2JLWA 4QBHA 3PVSA 1AS2A 4IPCA 1AE2A 5KHOC 2HJGA 4GL2A 3DVLA 4KHPQ 1OV4A 3VX3A 4JI4Q 4CEIA 4HI0E 1X55A 1XCMA 5EAYA 2A69D 1GD7A 2N46A 2P2LA 4EPWA 1ETUA 4HIOA 5EP2A 3UIEA 1K3RA 4TYQA 3KJGA 1OB2A 2IT1A 4JL5A 2GAAA 3HOZG 1XXHB 2F1JA 4DIEA 2AUJD 3PO3G 1KC8C 2QEXA 4HUQB 5M5XH 4Q7LA 5JWOA 1DAGA 3UMRA 4ARZA 1S9DA 4A4DA 4FW9A 2CL6X 3DPUA 2JE6I 3KUCA 3OEED 4A3DH 3VTKA 3VR3A 4HUTA 1KL9A 3VFDA 2C5LA 1RYHA 4PV1C 5FUXA 2R62A 3THXA 1Y1WH 1E1RD 3QKSB 1WCMH 1EIYB 1NVXQ 2QRZA 1J6QA 4PHFA 2ZJ2A 3K9LA 2PLRA 4JI7Q 2LXKA 4DV4Q 1C0AA 1IL2A 1H9SA 2D3WA 2IUSA 4M22A 3EZ2A 3S1RH 2ZVQX 4RFSA 5IWAQ 2ANCA 3E2IA 5BQ5A 1MO5A 4UNRA 3EWAA 2D0OA 1JJVA 2QQEA 1WRBA 4MDEA 3K7AH 5KYKA 1X54A 1Q1EA 4RKEA 1V43A 3TZUA 4DV1L 3MJRA 3GTMH 1DEKA 2O8EA 1KXLA 3GLGB 1M6NA 4ALPA 2EYQA 1NSFA 2ZSBA 3EIQA 4XWOA 2C04A 2QI9C 3RVBA 1CKNB 4DDWA 4GKKL 4LX0A 2KBNA 2QT1A 4JI5L 3UDIA 4JI3L 2NVXH 2DWOA 3T06B 4AYWA 1MABA 4OI4A 2NGRA 4YONB 1XFAA 3EA5A 4NYMR 4URWR 3NIBA 5C44H 1IBLQ 4LF5Q 1W48A 1GL6A 3IGFA 5AJYA 5C44G 1N6HA 4KITB 1AKEA 1XB2A 2FH5B 3I4LA 3KLWA 1CR1A 3BJUA 3CO5A 5IK2D 4QBIA 4FDBA 3W6PA 1CKNA 1B23P 4GNXA 3L0SA 2E76C 3T35A 1EK0A 1QDEA 4XWAA 5HKKD 1QUQB 4IOMA 5DYGA 4P3YA 2J5XA 4YMSA 4IOCA 1XMSA 3NG1A 1A62A 1EFHA 5GVSA 5HZKA 3KF6B 1X86B 1CKMA 5C1BA 4YWKA 3B1WA 4ZO4A 1P2TA 3FVQA 2DUDA 1E3MA 4DR4Q 1CSPA 4DUZL 4AY2A 2Z0SA 3MXUA 1L2TA 2BEKA 4KFTA 1CJUC 3RC3A 3ERSX 3D31A 1KRSA 4G7OC 4GOJA 3RSLA 2IYXA 4C2UA 2NN6G 3OIYA 5FL7A 3X1ZA 4IJMA 1T6NA 1XMJA 3U3JA 3U7EB 5AJWA 2QF7A 1VCNA 4AYBG 2ZE5A 4IXMA 2MO1A 3WHKA 4A6XA 2BBTA 3QSYA 4QBGB 1QVFA 3GTLH 3LY5A 1XEXB 4GKKQ 3CC4A 4POFA 4A3JH 4G7ZC 1M7HA 2IC5A 4LF6L 3OESA 2IUUA 3AB3A 3AVYA 1VQ5A 1ZW6A 3QI2A 3DO6A 1UADA 1CJVC 2NTYC 1SXJB 4DV4L 2IYTA 5G3YA 4ZDKA 2VHTA 5TVKA 1FFHA 1JPJA 3DL0A 2NZHA 2ZRFA 5FBRB 1EX6A 1HR0L 2P6UA 4X66Q 1NLYA 1OYWA 1TKWB 4YCWA 3IRBA 2EIFA 3PF5A 5GQOA 2C96A 2BH8A 4PR0A 4L5BA 3QJYA 4TQ9A 2GA8A 1G3QA 2Q9CA 3KOJA 3I56A 3P27A 1OXVA 1J90A 3SGIA 1S1MA 2AFHE 3J80c 1NY6A 3U4VA 1Z83A 4GBMA 2QGZA 3M1IA 1GUGA 1GRRA 1KDTA 1ONBA 1V1QA 3C41J 3CONA 2NO7A 4GOPB 2FZLA 1E2ZA 1YZ6A 5CITA 2F1HA 2QAJA 4DB4A 1XTJA 2P5TB 1H65A 1E4VA 4DLTA 1Y3AA 4U5XA 2O8BB 4BASA 3GLHB 1I5FA 1F60A 2HJVA 5FOUA 1KAOA 4PO8A 3LW8A 2MSDB 5BN4A 1WMSA 1II9A 1Z63A 2EFDB 4Q21A 3A4MA 2GF9A 1JALA 1H8HD 3PR1A 1W49A 1W3SA 2D4HA 4RCZA 1E0AA 1P2UA 2ECKA 2Q3FA 3AM1A 3CRVA 5EQTA 3Q5DA 3QPWA 2WMOB 4Q9IA 3K09C 5IYCG 1NKTA 1T3HA 2WOOA 4M1MA 1FJGQ 5H68A 3LX8A 2V3CC 4DNTB 2PMZE 3HOYG 1SHZA 2EFHB 3NEJA 3U3RA 4OONA 2V1XA 3TQCA 2ZJYA 3SE0A 2ZI4A 3L8YA 4CT4B 2GNOA 1VCOA 1IBML 1G8HA 1GUAA 2ZTSA 5J4VA 5KDOA 3B6YA 1GITA 3HKSA 3GLIA 4FMCB 2RAPA 3LA6A 1UDWA 5TV2A 4DV3L 2ZUCA 4Q9KA 1JB7A 4BXXH 1S96A 2JJ1D 4MYCA 2NQ2C 4YWLA 3A8TA 4NPHA 3HU3A 4O2LA 4A0GA 3TSZA 1F48A 1E2LA 3G82C 1JB1A 2GCOA 1YNXA 4AYXA 2FSFA 3NBXX 4JVNA 5IDVA 5DI9A 5J40A 1Z6XA 5DN6D 5IF9A 2QE7A 3CD6A 4DWJA 3W1GA 1XCPA 2GRJA 2ODNA 3BH0A 5EXTA 5DI3A 3ZD7A 4TTPA 2MNAA 2E2JH 2I1QA 2XJ4A 3J81j 2ZI3A 1SVSA 3CUEF 3LD9A 4YY3Q 4OQMA 2PX3A 4Q4JA 3WMGA 5KPJA 2A5DA 2B29A 4Q4HB 3TAHA 1TU2B 1XPRA 2K5VA 2AFIE 3H1TA 5F9FA 2OAP1 3KQKA 1XNRL 3CCLA 1QHXA 1WDTA 2OBMA 5M3FG 2RGDA 1VQHA 1U81A 2Q21A 3T1YL 4BA1I 1XMQL 5E7NA 3HJNA 4GSYA 4QOSA 2K5HA 1E79D 3GLFA 1E3PA 4A3EG 2ONKA 2ZRHA 4TQUS 4AQYQ 1M1YE 4P73A 3LXRA 4JBXA 1OW3B 3L8ZA 1TL7C 4DV5L 2JAQA 1RL2A 2PJZA 1PA6A 2C9OA 4PX9A 3WYFA 4CVNA 1M7GA 3PEWA 5HE8A 2ATVA 3JVUA 4PG3A 1WB9A 1Y8OB 4JI0L 5FLMG 3QXSA 2EU8A 4CIDA 1V9PA 3AV0B 4Q1BA 3FMCA 4G01B 4BA2I 2VW9A 2QMOA 4Q1EA 821PA 4LF7L 2G9NA 2R44A 5J4KA 2EWWA 4URXR 4JLBA 2UU9Q 4A3CG 1DAEA 2D7CA 1HYQA 1UEBA 3KLRA 1CI3M 3GFOA 4YQFA 5CYPA 2WAXA 3DMNA 3DKVA 2ZS9A 3IPYA 1EOVA 3CCEA 1PH4A 1P72A 4HJ9A 2J46A 4A1FA 4FXPA 4A8JB 2ZRIA 3I5YA 2E5LL 4HLDA 2R2AA 1UBFA 2B7CA 4DLRA 4P4TA 4HB2A 4NZYA 4X8MA 2CWAA 1FNMA 4QGAA 1TTTA 2QMUA 721PA 2PNRC 2V4DA 4G5OA 1M90C 1IZ6A 3ZJYC 1IJEA 1XD2B 3C16C 4DV1Q 1PHJA 3DM5A 1S40A 3UWOA 3OPOA 4A93H 1GHKA 2NZOA 2Q3MA 5KSYA 1QHNA 3VKGA 2GKSA 2QRNA 3FFAA 5FLMH 4HDOB 4RZXA 1U5KA 3A74A 3UATA 1JJGA 1CS4C 4MZ9A 4AK9A 4DT1B 2O8FA 1KO4A 3SNHA 4I1SA 3TW4A 1Z22A 1T91A 1M1KC 1E9EA 2F6RA 2XSZA 2ZUDA 4JL8A 4EFMA 2IS6A 2A8VA 2HDNB 3IDQA 5L3SA 2ZRCA 3SHWA 4PHTA 2QGQA 1R6BX 1W46A 2IXGA 2Y8EA 4HAYA 5J4LA 1S3GA 3B7GA 5A35A 3ADBA 5CK4A 4IRUB 4D80A 4IPDA 4RD6A 3C5HA 1US8A 1I50H 1NVUQ 4JSYA 1FQJA 2CDNA 4Y0VA 1T5IA 2NPFA 3M85A 1RRGA 1Z9FA 3L0OA 4O0AA 1EGAA 4LHVA 3VQTA 4HLCA 3X1WA 4B6EA 1ZM4A 4X8LA 2JASA 4ITRC 1ESMA 4V0NA 2CCGA 5DN6A 3GMTA 1YZLA 2BMDA 1HURA 3KJEA 1Z5ZA 4BE7B 1GILA 1OHHA 3U3OA 4HZUB 2G1JA 2JEBI 1HZCA 4YCUA 5E7IA 5JRJA 4NTZA 3T1QA 4GN5A 1COWA 3RLOA 1H8EA 4IEEA 1FUKA 1XMOQ 1XMVA 4K0KQ 4ME3A 2LWIA 4A3FG 4CDGA 4BEBA 2VP4A 1VMAA 2W6JD 1X8KA 3WYAA 1YR7A 3RR5A 4IVQA 1B9MA 4DV7Q 5LMNW 1DD2A 3PSIA 1CR0A 3TVTA 2ZRNA 3ZVNA 2O52A 1XDBA 2CHGA 2IWHA 1PUJA 1BH2A 3GJ8A 2OXRA 5KSOA 3CCRA 3BOSA 4NONA 3A5UA 4BZPA 4YMVA 5KNDA 3Q5EA 1TUIA 4L5QA 2QN6A 2CKZB 2FOLA 3W1BA 421PA 2R9VA 1G8YA 1WOCA 1FTSA 4XTRA 2HT6A 3KXKA 4JI2L 2NN6I 4V0MA 4YHHQ 1J8MF 3H15A 4OX9Q 2RGEA 3K8AA 2B21A 2I5MX 2ZRDA 4QGHA 1KI6A 3TR5A 1R8QA 3T51B 1VQ9A 4N3NA 3U4ZA 2WJIA 4M4SA 3SJAA 1G20E 4B3GA 3THYB 4AKHA 4DB2A 2QEQA 1EWIA 3WRXC 1DBSA 1Q57A 1GAJA 2FE4A 1Z6HA 5CDFA 2V8OA 2H5XA 1E24A 4MUBA 1G7RA 4I1UA 3KQHA 2JJ8A 1KDPA 2ZE8A 1F2TB 3TUZC 1KOFA 3M4QA 3T1YQ 5KU1A 1PYSB 1DE0A 4H13C 3BAFA 3HPQA 1KKLA 4TSFD 2JLUA 2R8RA 4R4QA 1SVOA 4IFDJ 1HV8A 2QM8A 3B13B 2REBA 1NIPA 1JEDA 2VHCA 4G3XA 1KZGB 1EUJA 4M0LA 1HUQA 4R98A 1FNNA 1Q22A 2VP0A 5TARA 3OTOL 4O0MA 4ZCMA 3LBHA 4RMFA 1AE3A 4BGDA 3QUSA 1N33L 1RJ9A 1K5GA 1KD1C 1KMQA 1YHNA 4AH6A 3KKQA 4B3DA 1SXJA 1OXXK 2EFEB 3AF4A 1JQJC 3K9NA 1FJGL 2WWHA 4NCJA 4Y0AA 5EE0A 2OFWA 1ZM9A 2ZR0A 1GSIA 1ZUNB 2J9RA 5D3MA 3VR6A 4ZCLA 5JJKA 1KI3A 1NSTA 3G71A 1AQYA 2FN4A 3CIOA 3A4LA 4JJKA 3I2ZA 1UJ2A 3KB2A 3BRWD 1RIPA 1AKYA 4P4UA 4D2IA 3CLVA 4PC1A 3IUYA 2DCUA 4NCHA 3S14H 5AK0A 1XNQQ 5HY6A 3U9SA 1F3OA 2VO1A 2A19A 1GKYA 3AF3A 4AWXA 2CCJA 3E70C 3RABA 2Q9AA 1QZHA 1NIJA 3AEZA 3PENA 4P0TA 1PH8A 3I4MG 3A1WA 4Q1DA 4CT5A 1SR3A 5HKKA 1VQJA 1XPUA 4N1AA 3R7WA 2WBLC 4F38A 4IFEA 4IPHA 4A3GH 1X1RA 3TMKA 5C46F 1N6RA 3NTUA 3U60B 2E75C 3K0SA 2DNCA 4JYBA 2YJTD 2OZEA 2G0TA 4IDNA 1MO4A 5CK5A 3HDTA 3NHBA 3I1FA 1NN5A 1BKBA 4B2IA 2NZ8A 4ON9A 3U7FB 4DKXA 2WPDA 1XZQA 5C3EG 3NWJA 1C7YA 5M3MG 4GS3A 1ELOA 1N0WA 3CRW1 2IYSA 4OO1G 2NPIA 3GLFB 2BKEA 4HR7B 2XJ9A 2GZHA 3KXLA 5G41A 1VQ8A 2DPXA 2MMGA 4ERNA 1OB5A 1U90A 3Q8DA 2Q0HA 1YITA 4URYR 5BN5A 2KBEA 3JZAA 1W2BA 4BFSA 2PT5A 4KYIB 4HSEA 3K70C 1DXMA 4BBSG 2XB2A 4OHVA 3BFXA 1D9ZA 2OLJA 3WBKA 2CMKA 4Q7JB 3X2SA 4OHWA 3S2HH 4Q7MB 1A6XA 3R8FA 3BXZA 1J7KA 2W83A 3SI7A 2XGJA 3RZDH 4M2LA 4IFDI 2XXAB 3QVUA 1ZNZA 4E09A 4K0KL 1UKVY 3HOXH 3RNLA 1NMYA 5JZVA 4CEIB 3L2PA 3T1HL 2YU9H 4FD2A 3THWB 4M1KA 2FG5A 2N1BA 5C4XG 1Z06A 1XTDA 3L0PA 1Y14B 2F7SA 3BB4A 5C0XI 4NYIR 5GADC 1I94Q 1JXMA 2F4VQ 2GK7A 3VHLB 2XXAA 2ZTDA 4LBWA 4IXNA 2PCJA 2QMEA 1U94A 1NY5A 5JS8A 2VP9A 3F3YA 2GEUA 1BDOA 4IHQA 3FB4A 3FE2A 4MYUA 2ZRPA 3OAAA 3PF4A 3C15C 1SE8A 2I1VB 1OIXA 3NXSA 5K36G 2R92G 4Q9JA 4BLSA 3Q3JB 3O8CA 2Q9BA 4D0GA 2ES2A 2PT7A 3R9IA 4I4LA 2IA5A 3OF5A 1M8PA 3VR4A 2Z4SA 3QEOA 4DXAA 1K83H 4IQZA 3LQRA 3U3MA 2VS1A 2A68D 1AH9A 2JJ2D 4MNOA 4P33A 1JE5A 1R0YA 3NBYC 4HATA 4KFRA 4TLCA 1N36Q 3IIJA 4BRWA 1E0SA 2CWPA 5DHFA 2JA9A 1ZM3A 2ZEJA 3AP1A 4D82A 1TWGH 1KI8A 2CHQA 4LPKA 4GRAA 3F2BA 4ZI3A 1A7JA 4DZZA 5E4FA 3UPUA 4HZUA 5BN3A 2GXAA 4QXAA 4LJZC 1U8YA 5EXXA 1IN5A 2UUAL 2REOA 4POGA 1G6PA 3WHLA 2ASEA 4JI0Q 3AQ4A 3QKRA 2OUKA 4ASUD 2H5EA 4RJLA 1IBKL 4DUGD 4DBLC 2VP6A 1VQGA 3BZKA 4KI0A 2AK3A 2EDGA 1E2GA 3OEHA 1D2NA 1CUKA 3SC3A 3BDOA 5EXSA 3WYGA 1JR6A 1DARA 1W47A 4HLQB 1GRQA 4NXNQ 2OEPA 4DNRB 2VF7A 2GDJA 4QGFA 2F4VL 3A1UA 2K5UA 1VKJA 3ADKA 3CF2A 3NBFA 4JI1L 2FU5C 4LDJA 2C95A 2PI2E 4DV5Q 4A3IG 4X65Q 2PZFA 3CH4B 3CC2A 4P75A 2UXDL 3EPKA 2BMFA 2FPMA 2O8BA 3J81c 3ETLA 5KTYA 1UWVA 2TMKA 3BFVA 4MH0R 2F43B 1XMQQ 3H4MA 3KZ1E 3ZQ6A 2ALYB 4WA7A 2FFBA 3G48A 2BEJA 2GCNA 3K0FB 2G83A 1UBGA 2UXBL 3EIVA 2MFIA 1SVIA 1Z8FA 3FKSD 3FMFA 2A6EC 5DO9A 4KSCA 5FOVA 3A7LA 3M4OH 5BYJA 4X8OA 1VYVA 3AFQA 4BBRH 1YR6A 4DCSA 1IN4A 3SFZA 3BE4A 3MAAC 3A1VA 2FEMA 4DR7Q 3V00A 1T8UA 3L82B 1GP2A 3CH5A 3X1DA 2CL0X 3KDFA 3I72A 2EFGA 4LF4Q 3HR8A 3ULPA 4QGGA 3G5UA 4JBYA 1KSGA 3V4FA 3GLIB 5IP9H 2HYIC 1XBTA 1NN1A 4TYNA 4CRWB 1YHBA 2IHBA 1T0HB 3GPLA 5M5YH 2Q2UA 2RHMA 3BH6A 3CB4A 1S72A 1FPMA 2R6FA 1P3JA 5AUPB 2JLRA 3ZDQA 1N6LA 1OH7A 4MDFA 1VPLA 1YJ5A 1KIMA 2HEIA 2OCBA 3PCRB 5SZHB 3RRZA 3TE6A 3MWJA 3HPRA 3TQFA 3OTOQ 1WE2A 3BD9A 3GJ7A 1N32L 2WJVA 4V03A 3SR0A 4Q01A 5B64A 4BFVA 2ANBA 3CMEA 5HZHA 1TX4B 2BHRA 2GN5A 1FMJA 1CU1A 1SVMA 3T1VA 5BW8A 3KUDA 1OYYA 3LNNA 2ERXA 3LX5A 4B43A 4IVRA 1Q3HA 4K81B 4RD1A 4YMUA 2R65A 1NP6A 1O87A 2XOKA 4DAYB 5LDDC 4WW0A 5JJIA 4L9WA 3OYYA 2VQSA 2XEXA 1E69A 3GDEA 1F5NA 1M34E 1K73C 1VQOA 2GESA 4R2IA 2DFNA 3CAMA 3SU8A 3TSWA 5CB8A 3B60A 5KUTA 2J45A 1UE6A 1JJ2A 1UBCA 2H7VA 2AR7A 2IX3A 4LNQA 1QG2A 1NMFA 2F3RA 1KK0A 2RH5A 2PZEA 1FOEB 5C3EH 1FTNA 3GTPH 1UM8A 3CPHA 4QQBX 1NLFA 1SVWA 2DGYA 2IEZA 3J7A5 4NCIA 4CEHB 2EQBA 3LRPA 4JBMA 3D3QA 1N8RC 1W1WA 2ZPTX 3GJ4A 4GZLA 4PAQA 4QJ5A 4C0KA 2NO1A 2RMKA 4G7HC 1IHUA 3FMPB 4MKHA 1V8QA 4PZZA 1KJYA 2ZSEA 4URVR 3CPFA 1EYGA 1Z47A 1QHYA 2WWXA 1HPCA 1RRPA 3CWZA 5TB5A 2BBWA 5ELOA 5M3FH 4BBSH 4ASUA 4TZ0A 4HYYA 1VG1A 2WZQA 4JL6A 2UZIR 1PV4A 3ASYA 4AKGA 1A2KC 2VUMG 1XU4A 1NRJB 2FNAA 3SEAA 3FHTA 1OXTA 5EE1A 2VEDA 4ZIRA 4DV6Q 4PXAA 2WKRA 1K8RA 3N2IA 4HDQB 4QJFA 4DR2L 3QENA 4NCNA 4R71A 5D3QA 3UWKA 3ADDA 4DR4L 3W5OA 5CDFE 4LZZA 4Q00A 3CXCA 4PZLA 4EJSB 4JLKA 4MRVA 2BJVA 3AKDA 3CKLA 4NYJQ 1XPOA 1S3OA 1LFDB 3KTAA 1FX0A 3U4QB 1SVKA 3AEVA 3CF5A 4P31A 1KDOA 3WNDA 3KQNA 1KQSA 3LDAA 1PLKA 3W8RA 4B6FA 4LJ9A 4PFSA 1N34L 1XMIA 2HLDD 4C0HA 5EXPA 3EZ9A 3VKHA 2LKDA 3J7ZC 4GPTA 1GTVA 1L4YA 3N6RA 4NXNL 4LW1A 2BKUA 4PMWA 4LSGA 4DR3Q 4LOAA 1YU9A 3ND9A 2H16A 4ZV4A 1IW7C 1VS0A 1JAHA 1G18A 3RYTC 3NEMA 4DV6L 4A76A 3MG9A 1Z6AA 1KMHB 3BFKA 5F2EA 5C0XG 5B2ZA 2W2XA 1TNDA 2YC4C 3L7ZC 3K70D 2REXB 1JXOA 1XJQA 2YWEA 4W5WA 3H2YA 5DSZA 4J15A 2QENA 4S2EA 2C78A 5G40A 1N36L 4OK3A 4JZKA 1ZAKA 4KLNA 2MQHA 3GTGH 5FR1A 1E1RA 5TY0A 4FINA 2EYUA 1V5WA 1CRPA 1KAWA 2JIZD 2P3SA 5CIQA 3V4RA 4PC2A 1SRUA 3EXAA 4OWXB 1G3MA 4JLPA 1CKEA 1RYFA 2WAYA 4GOXA 4EKDA 5DGXA 1ZCBA 2HCBA 4WBSA 2PQAB 4NXML 3S1AB 1UE7A 2Z6KA 1T5EA 5F9HA 4OHXA 1TPZA 1PUIA 4LUOA 2F9MA 2DFKB 4DSTA 4A92A 1LB1B 1S8FA 5IP9G 3AKEA 4TLDA 2JQOA 1YZUA 5SZIA 6Q21A 2WSSA 3A1SA 4HB4A 2Y0SE 4L5SA 1XCGB 4JI6Q 5C0XH 1MRSA 1DOAA 1N5KA 4HJ5A 3U61B 2V4ZA 1FW6A 1JEEA 3K0AB 3U7HB 1W5SA 4GNKA 4DLWA 1EFUA 4M1TA 4PSAA 2A6HD 5J4YA 3B1ZA 1GRNA 1GL9B 1GG2A 2YTVA 1Q1BA 4S35A 2PLFA 4WIAA 4H1UA 4LJ7A 3SBDA 1ZRHA 1CJKC 1GFIA 1ZD8A 1QHHB 4JLVA 1U9IC 2O0KA 3FPPA 1GUOA 3TIFA 4TKOB 2BM0A 4CZ2A 3U6KA 4IPGA 3QNUA 4IDPA 1ZUHA 5AJ3L 2P6RA 3VMFA 2RGGA 5EE9A 4DCVA 1PH9A 4KVGA 2ZAMA 1E1QD 4W9MC 5E7MA 2E87A 5AJXA 2IWRA 1BMFD 3K70B 1II8B 2YOFA 4AI6A 4R4OA 2YC2C 3SYNA 3AVOA 5IYDH 2WB1G 1FQKA 2AHOA 4KLZA 2VF8A 4EPYA 1NL3A 4KMUC 2QBYA 1Q44A 2CK3A 4A8JC 1KO5A 2MMCA 5B58C 1MO6A 3K9GA 1ASZA 5D3MB 5ANRB 3TS2A 1DAIA 4C3IH 1TWAH 1HE1C 3ZVMA 4PHGA 4YC7A 1Q20A 3BK7A 1NMXA 2D5DA 4KFUA 2CE2X 3O8DA 4DLSA 5JMTA 4GN3B 4HLUC 2Z6KC 1Z3IX 1LY1A 4XOIA 2NMVA 3C5CA 2VNUD 3PUYA 4IJHA 3CCVA 1LTLA 2KENA 1JQLB 2B6HA 3SN6A 3W6OA 2JLZA 1F2UA 4UQOA 4MKIA 4NDZA 2C9YA 2R7DA 1E2FA 4XVQA 2NO6A 5LB4A 1IYUA 3UK6A 1N0VC 4N0DA 3P4YA 4MRNA 1E94E 2ZRLA 4YXWD 4HUQA 3M3YH 4OXPA 4XH9B 1DCZA 2E2HH 1NBMD 1J8YF 4JI6L 4C0AC 1U99A 2F43A 3PUXA 5IT9c 1LF5A 3U50C 1NJIC 2Z43A 3C7KA 5FLXc 3EIHA 3MCAA 1Z0FA 4IOLA 4LC1A 1YEZA 4G5SA 3RRNA 2RB4A 1W0KD 1IYVA 1DG1G 3NDPA 4LV8B 4BLPA 4FMCF 3CRRA 2A1AA 1SVLA 4PAOA 4BEJA 5DISB 3HOVG 2AWNA 2WAQG 3S1NH 2VRWA 4M9SA 1XTSA 3RRYA 3W6NA 3SBEA 5FPYA 4DUYL 5L3QA 1Z2AA 2W00A 4TVAB 2BM1A 2OBNA 3FKQA 4EIWA 4NHOA 1MJCA 4ZI2A 4Y52H 1EIFA 1HT1E 2QSZA 4UKDA 3S15H 1ZM2A 4YXWA 1N0UA 2QP4A 2C9CA 4PSKA 4BQSA 1X8LA 4F4JA 2Q6TA 3CCQA 3PQCA 2BE5C 4A0RA 3P1JA 4B74A 4A3FH 3GLIE 4FMDF 4B32A 4DCUA 1WI5A 1VG0B 3Q85A 4I1VA 4D25A 2GJ9A 2JLQA 1N6IA 4KYUA 2EVBA 5DLQC 2IYYA 3N2EA 3CNOA 1K5DA 4D0LB 2IX0A 1KSHA 1QVAA 2ONJA 1U98A 2BDOA 3KYHC 5IYCH 1ZYUA 4II7A 5JWHA 1JR3E 2VY3A 5FPHA 3AVPA 2EW1A 3LLUA 4B3RL 4OO1I 1OJLA 5JLJA 4LFBQ 4HJ7A 1YZGA 3EWSA 4H1VA 1R0ZA 2GAOA 3M7NA 5KOYA 1VCMA 4G1UC 4O3MA 2X1VA 2PPBC 1C9OA 4A3GG 1GDDA 2FX3A 1XEFA 3B9QA 5M3MH 2A78A 4DR5L 1CFMA 4C9BA 4TYWA 2B3GA 5JSZA 1LUZA 4FCVA 1Z6TA 1VQFA 2Z5FA 2QMHA 1Y8PB 2O5VA 2B63G 1UEJA 3OZXA 3TUIC 1NJFA 1DO0A 2YINC 4MYTA 4NP6A 3RS2A 3FDIA 5K8LA 1OHHD 2BOVA 3QEJA 1PH6A 4WXRA 4PPFA 2VTKA 1CRQA 1JPNA 2BBOA 2HF8A 2XTMA 2IYWA 5CB6A 1NVWQ 4LF9L 2XITA 1IY1A 4BBRG 1OSNA 3PV0A 1OH8A 4DCTA 1ZNYA 4W7SA 5JS7A 2XNDA 3OE7A 3TVDA 1FX0B 4QHTA 2ORIA 4NYJR 3TR0A 4LUCA 3VX4A 3REFA 1AA9A 2XTIA 1G4UR 1BIFA 1VQNA 2J7PD 1PLLA 1ZU4A 3OHMA 4TQAA 3WMFA 3CPEA 4JYAL 3NELA 2DY1A 3MD0A 5LMNQ 2ZJBA 3I3SR 1G5RA 3PITA 4B2PA 3AVQA 2ZS8A 2OWOA 4Q5IA 4C2TA 1RIFA 5J47A 2ZM5A 3QIAA 4NCKA 5H1YA 1BS1A 2K7VA 3WP0A 5AR1A 2IS2A 1A8VA 5GAHC 3RS7A 3KQUA 2BC9A 5DHAA 4CEJA 1AZTA 2QE7D 2X2FA 1K8MA 4U02A 3F5FA 4B3XA 1YBYA 3TRFA 4IVPA 2VLIA 4QBFA 2ORWA 3GTQH 3AF0A 3GJ0A 2HUPA 3AVWA 1G7CA 4PO9A 1HQCA 2JLSA 4WXPA 1WBBA 5TXGA 3UMFA 4NYMQ 2O8CB 4DV2Q 4IKEA 2FPKA 4TMVA 4B3ML 4B71A 4JLDA 4MRPA 3KKMA 4WZ6A 1QVGA 1Q3TA 2OSBA 1IN8A 3I8SA 3FHCB 4WZAE 2CXXA 5GJCA 1ODFA 3AGQA 1EWRA 1K8OA 3NDBB 1Q90A 1K0RA 3ZVRA 3AB9A 2JJQA 1AN0A 1TAGA 5DIFA 1B8AA 3GFTA 4JBWA 1A82A 1YJ9A 1LYLA 1XJ0A 2PZGA 1P4SA 5GROA 1Q21A 3Q8XB 2NN6H 4KCGA 3A6PC 1XEWY 2R6CA 4TYPA 4F7WA 4DK6C 2C35B 3RLNA 2V1UA 2H18A 3ICEA 2EVWX 3LGJA 3ND8A 2GBLC 2HLDA 1Q8KA 2QSYA 3NHAA 3PEUA 4TMXA 2ZI5A 3ZIAD 3VNUA 2OTJA 1W44A 4XVRA 2E5LQ 3MRSA 2XZPA 1TADA 2QM7A 1KI7A 1UKYA 4BY1G 2K4KA 2RHDA 2FDCA 5TDHA 1IYJB 4EPRA 5K36H 1N9WA 4B44A 5LD2C 1P6XA 1E2HA 1XTIA 3L43A 1MT0A 3HOWG 2I3BA 3WDNA 1ZNXA 3R20A 3RSOA 4MQBA 3G4SA 1AK2A 2ZJOA 4DR3L 5LMUQ 1FR3A 3LBIA 2NO0A 2P6NA 3EQLC 1BO6A 2PQAA 2KB0A 3QF4A 2Z0MA 3GEHA 1GOTA 2O0HA 3GEIA 4FCTA 3UG6A 5JCZA 5JEAH 3PG5A 3RS4A 4LF7Q 4IDQA 4B35A 2AN9A 1CKOA 4WAUA 4DDVA 1T8TA 3AUYA 3FMIA 4A0HA 4EFNA 2CVFA 5M5WH 4FI3C 4GFDA 1QRAA 3Q7QA 4UNSA 4F91B 4PZ6A 4A3IH 4QL5A 3W5JA 3H0GG 3EIEA 2ZSFA 2J59A 4D4KA 1E96A 5JEDA 3MUFA 3FHOA 1D6JA 3ZZUA 1SZPA 2AMCB 1QHIA 5FL7D 1F2TA 1T3SA 1IXRC 4L5TA 4PC3A 3IKJA 1E1TA 1VECA 2LCFA 1LF0A 3GTOH 4DHEA 1VIYA 3RS0A 3B1VA 4D4JA 2AXNA 4I1OA 4OK6A 4LFAQ 2QTFA 1LV7A 2ODEA 3F8TA 1LS1A 5GJVC 3NE5B 4DLXA 2G77B 1FP7A 4IJLA 2H17A 3IQXA 2DB3A 4ESHA 3EZFA 1U8ZA 2IF0A 2XZLA 1N5LA 1CJTC 4X8HA 4KKUA 3I7FA 1IM2A 4BY7H 2ERYA 3CF6R 4BECA 4P32A 2OILA 4E5UA 4L8JA 3BBPA 5LMUL 3T1TA 1LABA 1TF5A 1NN0A 4DKAC 2AD1A 1EX7A 1EXMA 4TT3A 1JNYA 1XTQA 3P26A 5IK2A 1VTKA 2E9SA 1E2EA 3QXHA 3LWUA 2BVNA 4TL6A 3UMSA 4LJAA 4WZBE 3M9BA 4JI8Q 1IBMQ 3W90A 4LJ5A 3AQQA 4DR1L 1KSJA 1NMZA 1ZBDA 3QF4B 1FGUA 3C4JA 2QAGA 4D0NA 1G16A 1E2JA 2HV8A 4LUZA 1VQAA 1ZU5A 4A82A 3EC1A 2XNDD 3OE7D 2BV3A 3FKIH 3A5ZB 2IY5B 3T61A 1R5NA 2DFLA 4WOPA 4H02A 5EUMA 1OF1A 1VF5C 2VPPA 4UNNA 3RS5A 3REGA 5J5CA 1S9HA 1BYIA 2J41A 4CYMA 1S2MA 3LVRE 2XOKD 4Q48A 3QPUA 1G19A 2YZ2A 1VQPA 1TU4A 1DAHA 4IOKA 4KVAA 3R9XA 1BKDR 3ZS9A 2FFQA 1PFSA 4TL7A 3WXMA 5JWRA 1IBKQ 2DN8A 3DMDA 1VQ6A 1P9RA 1U2RA 3KF6A 1CULC 2PMKA 3AUXA 1X1SA 1FUUA 2ZJRA 4DV2L 3A1TA 4LJ4A 4US0R 3TRZA 3DDCA 3NENA 1KK2A 4RD2A 1SHKA 2J3EA 2OQKA 2GVZC 4TTQA 3FP9A 2CHVA 3N70A 2JXMB 3E9IA 3PO2H 1G17A 2PMDA 2XAUA 4TMKA 1FP6A 4L8GA 1N5JA 1HT2E 1MKYA 2N78A 1Y1VG 2AXPA 5IYDG 2P0EA 4B3BA 2IHFA 3D6TB 3RWOA 1L2FA 3FFBA 2KWIA 3AVVA 1VQEA 2EJMA 1W4RA 4DVGA 2NOAA 1D2MA 1YJNA 1SKYB 1TEXA 2IS4A 1CP2A 2OFOA 2AD5A 4QHSA 3DZ8A 4JVMA 2H8KA 3ZS8A 4XWKA 3ZIAA 1NNEA 2WKQA 4HIDA 2X8AA 3U44A 1HY3A 2WWGA 2K14A 3A0JA 5IYBG 5JEAJ 3PIPA 4JYAQ 4X6AH 2V54A 4ZKDA 5BWMA 5CLLA 4LWZA 4TZ6A 3K9HA 4GOKA 2ASBA 4JV5Q 3GQBA 4ZIRB 5IYBH 2BDTA 3FMOB 4LPSA 1P2SA 2V7QA 4Z51A 3WBJA 1QVRA 1X56A 2ATXA 4PPQA 2PBRA 1ZVQA 5FOXA 4BFXA 2O5IC 1U0LA 1L4UA 4B3SQ 2RGAA 5KDDA 3H84A 2WP8J 3KB1A 5JSZB 1D9XA 1N6OA 4US1R 5H8WA 1JAIA 4I99A 1Z6YA 3HOWH 5SZJA 3EPLA 2I4IA 2KI5A 3U44B 3AYHB 5AUNB 521PA 2I5LX 4DR5Q 4OJKA 4R9UC 4F4CA 5L8VA 2A6HC 2O5JC 2DFTA 3N5CA 4YMWA 2VP5A 2KCCA 1P16A 5FBWB 1GZSA 1AM4D 3ZZTA 1TWFH 2VL6A 2ZJPA 2E8GA 2PJRA 4AQYL 3FKSA 4D81A 4DCNA 3QG1A 4Q19A 5EJEA 2PNHA 3JAMi 1YZNA 2GXSA 3NH6A 1TQ2A 4V0KA 3B78A 5HCNA 1VQMA 1IJFA 3EA0A 4XD7A 1I94L 3IEVA 1LNZA 5JCPA 4RY2A 4OI0A 4MKFA 1SMYC 3IILA 1XD9A 1E2QA 4QHYA 2QNRA 2CFMA 3TGPA 4JKYA 1G291 2RGCA 4B3RQ 3D0FA 4MGKR 1JJ7A 1G4AE 4JCVE 1N6NA 2KA7A 1LVGA 1VHLA 3W9YA 1WBDA 4C3JH 1JT8A 1Z0DA 2GCPA 4QC2A 2ZJAA 4PZ8A 2AK2A 3BGWA 2HIVA 1DG3A 2ZSDA 1PYBA 1HTWA 1EFWA 2J0VA 1B0UA 3F2DA 4C3HH 1E9FA 4DV3Q 1CF4A 4PANA 1GUNA 5DH9A 1OTCA 3CWQA 3EW9A 4ACAA 4QM6A 3S16H 2VH5R 1WFQA 3GD7A 1HZAA 2ZITA 3LH5A 5DYIA 5IWAL 1ZKOA 2WB1E 2NVTH 2UKDA 4Z1MD 1WCV1 2ZQ5A 4KAXA 1W4CA 3TREA 3U2QA 2J0SA 1I4DD 3GEEA 2FMXA 2FPLA 1G1MA 4JOIC 3B85A 1BBWA 2FXQA 3UDFA 5IE8A 2XGTA 4M1YA 4A4IA 2OQ0A 4GLXA 4LFCQ 4Q1FA 3VHXA 4DR2Q 1NJGA 2ID0A 2CNWA 2WJYA 3TW8B 3J80i 2FEOA 2IYLD 3M0EA 4K8OA 2V6IA 2GXQA 2JGNA 3DOFA 4YY3L 1GUTA 2JJ2A 2ZYWX 4RZUA 4BFWA 3A8JE 3U58A 5KDLA 4OWWB 4M53A 3F0TA 1Q1ZA 3A37A 4M21A 3TBKA 3CRQA 3I4OA 4LJ8A 3S24A 2DBYA 3MWYW 1E1OA 4RG1A 5EE5B 1UFQA 3Q9LA 4KO8A 4YHHL 1TWCH 1I4LD 1N32Q 1T3LA 3GCGA 3MGCA 2GEVA 2GTPA 4HLUA 4HIKA 4L9SA 2WTUA 3THYA 4IO9A 1GVNB 3IEUA 5LPNA 4OHZA 4EPVA 3JC66 1KY2A 4X64L 1FVIA 4X66L 2IX1A 3S17H 2F1IA 2ZAOA 3UDGA 3HP1A 4QGUA 4KSBA 2JCSA 4BXXG 5DI3B 5G3ZA 1G6HA 2IW3A 1HQYE 1W36D 3GP8A 3EBEA 1BVSA 3RN5A 1HNXQ 2Q2TA 1P75A 3ONWA 3PIOA 2W6ID 2A5GA 3EX7C 4YMTA 2RGNA 5C4JH 1HNXL 2ZJ8A 4NU0A 3PUVA 1QVCA 1WCMG 4I7ZC 5LB2A 2ZVPX 3GLHE 4IDHA 2QPOA 3QXXA 1N33Q 1Y63A 4B2LA 1YJWA 3CF0A 3RC8A 4GP7A 4TN1A 3IHWA 5TMPA 1NLZA 2UUCL 2ZXUA 2WFWA 3ZLJA 1L1OB 1E9AA 1N25A 3BWDD 5FUYA 2J7KA 3K53A 3U6BA 4JVLA 3A8IE 1EQRA 1R4AA 3HYRA 4LFAL 2HYDA 5DLQE 4QM7A 1Y8NB 1NVVQ 3DM3A 4A3EH 1XZPA 3ZVLA 1P73A 1E2NA 2KCMA 1E2PA 1U8AA 4B48A 3CMAA 5IT5A 1ASYA 1E0JA 2HCJB 1GKIA 4POAA 4V0LA 2VQFL 1R5BA 2QAGB 4YWMA 1Q1QA 4P4SB 1AGPA 1P7CA 1Z07A 3K80C 1UE5A 1L1OA 3X1XA 2FSGA 1W0JD 4GP6A 4KBGA 4M1SA 2NG1A 4NBSA 1G5TA 3CZPA 4OI2A 1E2WA 1ZMXA 1EG7A 1ZP6A 2O8EB 5E3HA 1HH2P 3CX7A 4J0QA 4AG6A 4EAQA 3MWKA 2L5TA 2BMEA 4OX9L 1JBKA 3J81i 1SGWA 2IYVA 1T5LA 3EASA 3RHFA 3UE1A 2J0UB 2WWFA 5HPYB 2J0QA 2LXJA 1UPTA 2ZYTX 2IHYA 4O25A 3ZGXA 1IBLL 4LF5L 3PJRA 1U0JA 1A2BA 3KJPA 1XXHE 2XTNA 2LSSA 3Q7PA 4RCYA 1H9KA 4P72A 1YHQA 4JV5L 1E9BA 4LF8L 2JA6H 1KY3A 3EC2A 3LXXA 4UY8C 1E32A 2CJWB 2QP3A 2PCFB 3QXJA 4R2HA 2XTZA 3R8CA 4HAVA 4FMDB 3WP1B 5FFMA 1BMFA 4B75A 4JK1C 2A5YB 4ZPXA 1NG9A 3HOUH 5FTLA 3HOYH 1PZNA 4MRSA 5FOWA 1C9KA 1SN8A 4B47A 4I81A 5JBQA 4Q7KA 3AVTA 4L5RC 2OCEA 2R93H 5BR8Q 2KCTA 3NKVA 4YLGA 5KPDA 1OFUX 1HA3A 1XMOL 2WJJA 5CM8B 3PUWA 3AFPA 3FGNA 1CTQA 4LF8Q 3IPXA 4MGZR 5AJVB 5L3VA 1PH5A 2W2VA 3QQ5A 4PAMA 1OFTA 3SQXA 3CRMA 2B8TA 2G0NA 1K8GA 1XP8A 2MO0A 2CW0C 3I8XA 4PQRA 3RRMA 4A2QA 1YRBA 2OLKA 4G5GA 1OXSC 3ER0A 4CW7A 4DSUA 2C2HA 5GAGC 2VL7A 2CE7A 1DGSA 4QFMA 2AKAB 4B3MQ 2ZYVX 4PZYA 1E7ZA 1P8LA 3GO5A 2CLSA 4QRHA 1IY0A 2F3TA 4UP8A 1KI6B 1UEIA 3QPVA 4W5JA 4ARZB 3I92A 4DLYA 1N34Q 1BBUA 1COWD 3CC7A 1Q81C 1H8ED 5JJLA 4B3SL 1R8SA 1XD8A 1H9MA 2OO7A 4O2RA 4RZ2A 4JI2Q 2Q2IA 2DR3A 4B3CA 3QBVA 3ZQJA 4EJSC 4PC7A 3MJHA 4Q9LA 3H0KA 4OK5A 1Y69U 2N8NA 3EN2A 2UUAQ 3TNFA 3VNVA 4JI5Q 4JVSB 3CRKC 1RRCA 1MO3A 3P4XA 1RC8A 1H9SB 2GHIA 3I4NG 4RFSB 4JLOA 2FWRA 3BC1A 2XNSA 3IO3A 3OIVA 3HOXG 4KXFB 4PC6A 2QT0A 4A93G 5EP4A 2W6IA 3B8HA 1MH1A 2BCJQ 1ZD9A 2RKOA 1B70B 1D5CA 1A4RA 1NVVR 3NVAA 3WMEA 3W34A 2VQEL 4A75A 2QPTA 1N3BA 4GI7A 1OFHA 1RRFA 1D8TA 1TF2A 3BB1A 4B76A 1II8A 1E9RA 3B1YA 3B6EA 3H0GH 5A0FA 2A7QA 2C99A 2HHHL 3QKUA 4MITA 2OFXA 4LUVA 2IYRA 1VQKA 1C1YA 2SHKA 3HU1A 1HTPA 2PH1A 1E98A 2AWOA 2UU9L 4TLBA 2ZUBA 5KNBA 1K9MC 2BH2A 1D7QA 4WVFA 4AYTA 2FJUA 2K5NA 2CEAA 2GEDA 2A6ED 2YKGA 3LQQA 3GJ5A 2O8CA 1IXZA 4GNXB 1KHIA 1SFOH 3VKWA 1S1CA 2PEZA 2UUBL 4LGMA 3LV8A 4PHHA 4DJTA 1YRAA 2KE5A 1GKHA 3CCSA 4C2MH 3CNLA 3TQYA 1F2UB 1CIPA 2BMJA 4LHYA 4M9XA 3I5XA 3DXJC 4DEXA 4OQXA 1SKQA 1Z6GA 3TUJC 4LFBL 4JI4L 1CBUA 4OO1H 1ZD1A 2GVBA 3H3VH 3T1HQ 4Z1MA 3RZOH 4GNXC 2ZI6A 1OKKA 4QG7A 3UXMA 2D74A 5GADl 2RGBA 1NBME 1K8AC 1YZKA 3DLLA 4P74A 1S3SA 3T15A 1A0IA 2GJSA 2UZ3A 1LACA 1CLUA 2OAQ1 2ZR9A 3R9WA 1BOFA 4DUGA 2K50A 4TLAA 3OOCA 4F92B 1YVDA 3HFZB 2FV8A 1T4GA 4GZMA 2ZJ5A 4KBFA 1E0KA 4R4TA 4U7DA 5LD2B 1HZ9A 2EJFC 3THOA 1E9DA 2AUKA 1M7BA 2IBMA 2WICA 2CCKA 2QTHA 5CJPA 1TQDA 2A9KA 4C7OA 2A3RA 4RD4A 3ICQB 1CSQA 4AC9A 3SYLA 3IIMA 4ESVA 1NY4A 1AS0A 2VBCA 4PTLA 4URZR 1OKKD 3R7WB 5L3RA 1TU3A 2OESA 1R2QA 1KRTA 2DNEA 4A3CH 4P71A 2QU8A 5AUQA 4NH0A 2FFHA 4UXIA 1VQCA 2N49A 1ZUIA 1NTGA 4LRWA 1X9NA 2ZANA 3EZ7A 4M1WA 4OQLA 5G53C 3MSXA 1Y1WG 3KFVA 2YOHA 4HAZA 4IEIA 4KN7C 4MKGA 4C3ZA 1S4QA 4DUZQ 3B2EA 3QG5A 4TMZA 3UKDA 1HQMC 1J5EQ 2GCOB 4PZ7A 3STBC 4HAXA 3TS0A 2EXDA 1IN7A 4XJXA 2IS1A 2ODBA 3UE0A 3OIUA 4Q18A 4EJSA 4L15A 3AKYA 1OIWA 3SDZA 2V9PA 1Q12A 1JR3A 1E79A 5EUQB 4BPBA 2JEAI 3UDXA 5CM9C 3C14C 4Q4JB 5FBLB 4MGIR 1EWQA 3IBGA 3P20A 3JZMA 4LYHA 2UUBQ 2QGNA 2W0SA 2QBYB 1L8QA 2GK6A 3K0CA 4LI0A 4E22A 2IYUA 4IFBA 2L0XA 5KO2A 2JA5H 8OHMA 1F6BA 1H95A 3ASZA 5CLQA 1L0WA 1UKEA 4BFZA 5FH9A 4LHWA 1W5TA 4HJAA 2EWVA 4UJ3A 1W36C 2A30A 1G51A 2R7ZH 2UXCL 1ZC4A 4DNIA 5FUWA 4ZKEA 1OFIA 3TKLA 1SULA 5IY0A 1DVRA 1KAGA 2ZE6A 4FMBB 4KFSA 2WWWA 2ZTCA 1EQQA 3THXB 1QBKC 1EFCA 3PIRA 4LBYA 5JFGA 4LC0A 3K81C 1VQIA 1RKBA 2QL6A 4TTRA 5FPTA 4CEHA 2GETA 1HJPA 4QNMA 3PFIA 4FWIB 1W0KA 4KJZA 4UNPA 3I62A 3MXNB 3KJOA 4B34A 1QHGA 3EZ6A 121PA 1FL9A 3M6AA 1VQ7A 4JI7L 1G5PA 1NBMA 2JLVA 2HT1A 4JLNA 4M1OA 4JI1Q 1XXHA 3RNUA 4DDUA 4AKIA 1QG4A 1HNZQ 3A4NA 2NO9A 3KJHA 1O78A 3FYHA 3SJBA 1SKYE 1VQDA 2WKPA 3BJIC 4DK3C 2I0QA 2WAQE 1HNZL 1K6MA 1HCZA 3VR5A 1I6HH 1U9IA 1MABB 2XB4A 2Z83A 1QUQA 5KNCA 3MMPA 3V9PA 4A2PA 1MJEA 1ONLA 1WYDA 2CL7X 1PMRA 1VCIA 1X3GA 1IBRA 2WSMA 1R0WA 4A3JG 4KKSA 2OV2A 3LW7A 3MEFA 2GWHA 1VQ4A 5K8UA 5HCIA 1H8HA 4JI3Q 2QP9X 4V0ME 4TMTA 2OHFA 2KJQA 4G0NA 1R9TH 5FOSA 4AKEA 3M4YA 2HHHQ 1NF3A 1Z2CA 4LJYA 1TMKA 2BWJA 4Q4LA 5A4JA 3SFVA 4JT2A 2ZROA 3CX8A 4KHZA 2CJWA 2G1KA 3A36A 3S1AA 2ZRMA 4LF6Q 1EFRA 1RPZA 2ZI7A 5LMNL 2P67A 1YR8A 4GKJL 1ZM7A 3I61A 1PJRA 1ESNA 1SXJC 1OT3A 4RZ3A 3RWMB 3DZDA 3DEFA 4L4UA 2OXCA 2IK8A 1WA5A 2W0MA 3T12A 1ZIOA 4DSNA 1KYIA 1E4YA 3AGPA 5DNYB 1PH7A 3OFND 4D4MA 2VSFA 5B30A 3SOPA 3E9HA 4JKIA 1E2DA 4OQFA 4YDHB 4TYYA 2UXCQ 2VP2A 4A9AA 3THWA 1EESA 2K75A 3LAWA 1H9JA 1YIJA 3K1JA 3NBZC 2IXEA 1TXYA 3NEYA 4FCWA 4V0OA 2GZAA 2ZI9A 3T34A 2A68C 1QJOA 3GJ6A 4N0EA 4APVA 4RKFA 3SJZA 2IXFA 1W4AA 4GDFA 2E1RA 4LF9Q 1IXRA 1NMGA 4E03A 2C98A 4AURA 2DWQA 4V02A 2QA4A 1RZ3A 3U3KA 1Z0IA 4BY7G 2JEOA 4BUJA 5F3WB 2NVYH 4PO1A 3K0CC 4X62Q 4OYHA 1WXQA 3CZQA 1I2MA 2K52A 5CIWA 3CPWA 4GN4B 2P5SA 1KI2A 4LYAA 5KSZA 1BYUA 2ZRBA 1T9HA 1HR0W 1LTQA 4EPXA 3CRLC 5CYOA 5FJ8H 3F1ZA 2AHOB 1N6KA 3GTJH 3E0EA 1XNRQ 2WM9B 4QL3A 3RAPR 4AIIA 4BWYA 1TEVA 1Z0AA 2Y0SG 1VQLA 2ZM6L 3RS3A 3OW2A 1KTVA 4BLOA 4BZXA 2VYFA 1JJCB 1GNPA 4UXHA 5FPSA 1IQPA 4A3LH 4EFLA 2X19A 4HAWA 3VU9B 4UXJA 1O7IA 4KLKA 3HOZH 4LWCA 1OE0A 4UPAA 1Q86C 3SS8A 2V55B 2CQOA 1LS6A 1GKUB 2H92A 2YWFA 2HXYA 1B9NA 2ZRAA 3HU2A 1MKHA 1UAAA 3BS4A 3PUZA 2R7FA 2NIPA 1NE3A 3GLGE 1GUSA 1IW7D 1L7VC 3TLXA 2WVJA 1TWHH 2Z4RA 5JEEA 1YNJC 3U5ZB 2C03A 2D7DA 4DV0Q 1YE8A 5B57C 5C4XH 4C0BA 1MRNA 1KO8A 2GJ8A 1NG1A 1OH6A 1WJJA 1FZQA 1RFLA 1C4OA 3FWYA 3VU9A 3KDFB 5AJ3Q 4R7ZA 2D06A 3LFUA 4RVCA 2W58A 3OFNA 1EWHA 2B8FA 3UANA 4AYBE 2CNWD 4JMPA 4JJZA 5EP3A 4LFCL 4C7OB 3A8KE 4A3BG 2NZJA 1JMCA 1NI3A 4KODA 4IW3B 4RFVA 5FPKA 2O8DA 1FYCA 3WRYC 4US2R 2CLCX 4F93B 5GJBA 1WF3A 1N5IA 1AZSC 1VYTA 4M9QA 2IF2A 4OKSA 1E2KA 1P62B 1J2JA 1E9CA 2GVDC 3SJCA 4LK1C 5FOTA 1NKSA 2UUCQ 1DAMA 4NB3A 2ORVA 5JEAG 2YTXA 3HKZE 4DR1Q 1Q82C 1DADA 2P65A 2FFAA 3IIKA 2YWGA 4ZDJA 3OEHD 4ABYA 3RLFA 3OEEA 2R93G 1IONA 5FUVA 4B3FX 1KI1A 2RHSB 5E95A 3AVXA 1XJVA 2CVHA 4HIMA 1A5TA 4GT1A 1Z0KA 1X6OA 4MA4A 5HR5A 221PA 1G3UA 4L16A 5IP7G 4C0LA 1X6VA 4C4PA 4H0LC 4Q66C 5CJ2A 1SXJD 5FTNA 4ZDIA 4EQ6A 4LBVA 3VAAA 2OM2A 4PQFA 3TAUA 4DRZA 1KI4A 1G8FA 4LYFA 4NYIQ 1G9XA 1CTMA 4A3MH 3TH5A 2AKYA 1JECA 1SXJE 2J7PA 2WHXA 1NN3A 4GLAC 4BY1H 3FOZA 4JBJA 2MSCB 2ZM6Q 4A3LG 1KDRA 3PO2G 4MRRA 3HOUG 1I3QH 5J3BA 1AGRA 2UXBQ 2WOJA 2D0PA 1VF7A 3QXCA 2DWPA 1XEWX 3FKIG 1T0JB 1N2CE 1RE0A 5KSPA 4CGZA 2QPAA 1W4BA 3BG3A 2B8WA 1HE8B 1R5OA 4OQNA 4A8JA 2L15A 4Q4HA 2QTVB 2BIFA 4JSTA 3B82A 1P2VA 4NMMA 4ZDWA 1YR9A 3DM9B 4RD0A 1ZNWA 2CBZA 1Z29A 3AF2A 4PSVA 2J1LA 2YV5A 3PCOB 2PCLA 3B1XA 1G6OA 3ECCA 3K7UC 3U7GA 4FIDA 2VHJA 3H94A 4A3KH 1EFRD 3KFUA 2QAGC 1P9NA 2OCYC 3RN2A 1ZIPA 2R6AA 4C0SA 3KL4A 3P32A 4X62L 1G8GA 2F1RA 2F9LA 2OCPA 1R0XA 3HKZG 4DAMA 2ZREA 2BA0A 2JDID 2ZRGA 3CR8A 2BCGY 4IFDG 3BZCA 2C8VA 3CPJB 4GMDA 3CCMA 1PLJA 2AX4A 2A5FA 4Q9HA 3QKSA 4EDHA 3KX2A 3GLGA 3ZYCA 2F55A 5HTKA 4ZCIA 1Y1VH 5BR8L 5L3SB 3GLFE 4BFYA 2QUZA 2BBSA 3E5HA 2A69C 4LV6A 3TEHB 2OBLA 4C30A 4Q4AB 2R6GA 4LK2A 1M2OB 2ODWA 4CEJB 4HZIA 3BU2A 1US8B 3WNBA 5K8TA 1Q0UA 2FGKA 3ZZ0A 2K33A 1CXZA 1Z28A 4UJ5A 1YZQA 2IYQA 3T5GA 2FA9A 2JJ1A 1X3SA 2WIAA 3K0XA 3BORA 4NKRA 4QKQA 2WJGA 5FR2A 2WIBA 2QG6A 3LO5A 1W36B 3CQZH 1LW7A 4MUAA 2H57A 3CR7A 4EQ5A 5UKDA 1X65A 1P5ZB 2GJKA 5EP1A 3MLEA 1D8LA 1UKZA 1Z0JA 4B33A 3LWNA 4E07A 2FZ4A 1GM5A 2ZYUX 4TL9A 3CW2A 5F98A 5IRCD 1FMLA 4LV5B 3M4PA 5EZ5A 3VDYA 2FGJA 4PPGA 2VUMH 3HGBA 3MFYA 1CR2A 1RW4A 2ZE7A 1QHHA 3BH7A 1KJWA 3G0HA 4DLZA 3ULLA 2GILA 5H70A 1U0HC 3HWSA 4M8NE 5AWFC 1ANKA 1NBWA 1PH2A 3L0IB 3FHWA 2VA8A 2XSZD 2CK3D 4KV9A 2VHQA 4Z8YA 2UVQA 5HGQA 1E22A 3MWLA 1XJCA 3GLHA 2WV9A 1XEXA 1J5EL 2QA5A 2GVAA 1O3YA 3ZH9B 3KQLA 3NBHB 2ZRKA 5C4GB 5J4HA 1YHAA 4A3DG 5GVRA 5JRZA 4IFDH 3NC1C 3AH8A 1VG9B 1JR3D 3EG5A 3KKOA 4PPNA 3W5IA 1YVCA 1YQTA 2YTYA 4TT3D 1EFTA 3Q72A 1UDXA 3K0AA 4ACBA 4ILEA 2FSHA 3VR2A 3OIWA 4JI8L 3J81k 1XTRA 3C8UA 4OGQC 4HB0A 1XWIA 4QJ3A 2BA1A 4B3TL 1E1QA 2X2EA 3BB3A 3O8RA 1KI9A 1DAFA 2GBLA 1XTKA 4U00A 1IY2A 2JA1A 3K8YA 1VQBA 4MYHA 4RCNA 2X77A 2H1LA 3ZD6A 1SROA 4X64Q 4AIMA 5AJZA 3HOVH 3IHLA 2D62A 4XTCS 1HEIA 1R10A 2J87A 2WWIA 1VG8A 4QNRA 2D2CC 1VHTA 3KDSE 2JATA 2CLDX 2QQ0A 2HIXA 3WWVA 3CW2C 5A5GA 3OAAD 2RF4A 3HR7A 5IHPA 1S0UA 4IOJA 1YI2A 5JI3E 3SQWA 1TQ6A 4Q02A 4JYCA 2I5HA 4A3KG 1HNWQ 1AS3A 1J99A 1KKMA 2QZ4A 2VSOA 2KHIA 1G41A 2YVUA 3H86A 1PVOA 3KKPA 4H44C 2ZRJA 1SMXA 4A6PA 1HNWL 4QIWE 4YCVA 3A58B 3L2OB 4X65L 2N3SA 4LYJA 4Z8XA 4A3BH 3AKCA 4QJ4A 5DE3A 5FTMA 1UE1A 1XNQL 3GFPA 4DEYA 4DDTA 4LJ6A 621PA 4EQ6B 4KN4C 4KHPL 2D2FA 2GZDA 4LHZA 2VZAA 5ELNA 4BFUA 2IYZA 1P9WA 5FBVB 3EPHA 3AP2A 1DS6A 3PXGA 2MSEB 3I4NH 4LHXA 5EZ6B 3D4RA 2JA7H 1IN6A 1GWNA 2VSXA 2O8DB 1VDZA 3KKNA 2LMCB 1QZGA 1IAQA 3NH9A 3T5DA 2Z6VA 1KSFX 2AKWB 2KBFA 4TSFA 3QBTA 1ZJ6A 1JI0A 4DR6L 3IQWA 2W2TA 3QOFA 5AUOB 4NL4H 2K32A 1PH1A 1ZINA 1W2HA 4GMXA 4OJQA 4DR6Q 1IXSB 3AF1A 1QHSA 3CX6A 1W7AA 4EX5A 1AQUA 1X3EA 3S2DH 1CR4A 2ATWA 3G6EA 4DUYQ 3F2CA 1DO2A 5H1SE 1E99A 1KO7A 1XF9A 2OE2A 2WSSD 2ZS7A 4Q03A 5E7JA 4TWZA 4A3MG 5P21A 4JS0A 2CCZA 4LF4L 3CBQA 4JLJA 4R4IA 4GKJQ 1TUEA 1E9SA 3W8NA 2WPDD 2JA6G 3KTAB 5FTJA 1OLOA 1CJMA 2ZJZA 3H3VI 1MV5A 4EUNA 2UXDQ 1KHTA 3NC0C 1XRJA 4JLMA 1KJZA 4W5HA 1J70A 2JLXA 4IOAA 1TF7A 4MGYR 2D2EA 4IDOA 4DLVA 1GVPA 1HH4A 1KNQA 4BLTA 2JIZA 4D4LA 3B5JA 4G5RA 2KHJA 4DLUA 1DAKA 1QF9A 2J0UA 3SYKA 4P4SA 1Z08A 1DPFA 2A5JA 5JECA 1MR3F 3EPJA 2NVQH 1I2DA 2OCAA 4JT4A 4XSHA 2B63H 4JOIA 4OL0A 4AD8A 3TK1A 3O47A 5BXQC 3IO5A 4QY7A 2IEYA 4UP7A 2PI2A 2B7BA 3BERA 2G3YA 2QORA 2ZIAA 3RANA 3VR1A 1OH5A 3T56B 1IOZA 2B8GA 2ZSAA 2R92H 3VA7A 2C77A 3JVVA 4HAUA 2IUTA 4Y7NH 3W3ZB 4OHYA 3CM0A
chains in the Genus database with same CATH superfamily
2QRJA 3BSWA 1WP9A 5EE3A 4AG5A 3OCYA 3I73A 1V41E 1TQ8A 1I4TD 3CEAA 3E9YA 3S0JA 3T9FA 4DHWA 4EHKA 3KXIA 4G5QA 4TLEA 2VXBA 2JIOA 4GXNA 1UODA 1F9EA 3ZV5A 4ZCKA 1CG6A 4C0QC 1AKUA 2RBMA 1YKSA 2I33A 2ZT9C 1E3QA 1KK3A 4FFNA 2YOGA 4OLJA 5AHKA 3OZCA 2Z6BA 2RHQB 3S29A 4AB1A 5F5XA 3HNRA 3T94A 4U3JB 3P9XA 3S8EA 1KYQA 1Z3CA 1T0PA 4XVUA 3GNSA 2CVZA 1TWCB 1RPNA 1HZZA 3E2PA 3NRCA 1T1SA 4ZQFA 3ZY3A 1F9QA 2AEEA 4G67A 4XPZA 3FTEA 4AAYA 4BQNA 1F4VA 2UVPA 1V7CA 3T53B 2VLBA 3IUPA 4L4RA 3DVQX 4X92A 3IJPA 3T1OA 3S17B 1P1BA 4LZLA 1T2VA 4EPTA 4BFTA 3P9QA 2O8FB 1THGA 2X1HA 5LZ7A 3H3JA 4EY8A 4R16A 4URUR 4XYEA 2XQJA 4LCBA 5T6BA 1CY4A 2XZDA 2QRLA 4DUYB 4OBEA 1XX6A 1EUZA 4CTNA 7REQB 4M9ZA 1UBEA 4BWVA 2G04A 2Y1WA 1B6RA 5B6IA 1T1GA 2XWSA 3T4PA 4E1BA 2VATA 3IXMA 3UV7A 4D9IA 1ET6A 4GM4A 1UOOA 3HBFA 1PFGA 2R6DA 1XNHA 1F0NA 4RXTA 4UDXX 5HJ7A 1JG2A 1HDGO 3HBAA 3QITA 1M1YB 1E3EA 1VJ5A 2I7VA 4RV4A 4YP5A 3HKZB 1VZ3A 2ZB8A 3F6CA 1O7LA 3GZNA 2NM0A 2PBLA 3R3HA 1JEQB 3HYTA 4B8YA 1U9RA 5FKAC 2J5RA 2OK7A 3CLSD 4I9UA 2WM3A 2XA2A 1HL3A 1WZCA 5M04A 2EJGC 4H59A 1PH3A 3A7AB 3CNNA 3HM2A 2ENBA 1L1OC 2VIIA 5J9FA 1EDZA 1KMHA 4NPSA 2GF0A 1PLFA 4DK0A 2Q2HA 1X7DA 4MA0A 5CXSA 4RORA 1LXCA 2C5HA 3SZGA 4B7ZA 4F3KA 1IN1A 4G63A 1X19A 2W6JA 1YMUA 4ZK2A 1NULA 1NXWA 5LMNB 1NMEA 1O5IA 2IRWA 3PDHA 3I4MH 3D4WA 4A36A 3H65A 5JHHB 1RJ9B 3LM8A 1TZBA 3V96A 2AN4A 2FWPA 5DLPA 3LWZA 4NEQA 2BUCA 3OBBA 1XUOA 4GZYC 2AQKA 1EIZA 1RHJA 2E37A 2J9FA 1IUNA 2G6BA 4OWTB 4O4JA 3RFTA 1GUWA 2A2ZA 2XYVA 3SSAA 3IEIA 4WJ4A 1DQPA 2EHJA 2NU9A 2BRUC 2CDCA 4K8JA 2IYAA 1EHIA 1SC1A 2DPHA 2H48A 1PP4A 4HJ8A 2CFSA 4ZOLA 4Z54A 3D1LA 3D8BA 2L17A 1DRUA 2OD2A 1ZYRC 1O96B 4FR0A 5FWXB 2FP4A 1F2LA 2B0JA 1T4CB 1XZ8A 4ARAA 4UNQA 1G64A 2P35A 3LIPA 4HDCA 5SZKB 2KOLA 1HZBA 1P3DA 2YWCA 3C4VA 1IPFA 3QVVA 3S7TA 4F2HA 5BVHB 3NHZA 4HG2A 2XYPA 3HA3A 1JHDA 1SHLA 5AHWA 1KIXA 2BKVA 5GAEC 3AJEA 2BM9A 3KEMA 5FBQB 4F71A 5EZSA 3TQRA 2RCYA 3E3MA 3SX0A 2JIMA 1UM9A 4Z6KA 3HXKA 2EEZA 3UC5A 4A15A 1UP6A 2WJHA 4ZO6A 4F4IA 5A2QA 3ULJA 2RGNC 3DOOA 3KLSX 3I55A 1G7SA 2IHEA 1B6TA 1G3RA 2YWHA 3MC1A 4BZQA 3WMRA 1K8XB 2JK8A 3UK7A 2CXTA 4E6PA 5LZ2A 4H3KB 4C5AA 4TRDA 3FNBA 3H17A 4TVKA 5C4MA 4NBWA 2PS3A 3R76A 5KOJB 2PX0A 5JDIC 2EQSA 3OCJA 2O8VA 4NARA 2RHWA 5M5BA 1UOEA 1DC8A 1O95C 2G40A 3GAAA 3JARB 4XWYA 3TQSA 3JAMc 2IU4A 2Y05A 4Q1CA 5CTJA 3ERCA 4DR7L 1MA0A 3N0TA 2HBRA 2ZLBA 3I32A 3OPNA 1X3FA 5HE9A 2UDPA 1R7RA 4CTOA 4D26A 1AGNA 3QY0A 3H11A 3J7TA 4ETIA 5BYBA 5LA6F 1PGPA 1YFKA 2RCNA 1TZMA 4BNIA 3OQ1A 1P18A 1D2EA 1FVHA 3G49A 5CXUA 1BN7A 3ZW8A 1PDOA 1WXGA 3H87A 4MW6A 3L77A 1OIVA 3PQEA 5TPZD 3RDPA 3ZUGA 4D3ZA 5D65A 1JHUA 1SXGA 2XRSD 3DWPA 1KS9A 1P0MA 3DVLA 1OV4A 1ZGGA 3NYRA 5M2QA 1NX6A 3BIJA 5EAYA 1P5RA 1DOKA 1MI2A 3O7MA 3F1LA 4TYQA 1JZTA 4R8MA 2IT1A 3IAS1 4BC0A 1WMEA 3HOZG 3FPLA 4AULA 4DIEA 2AUJD 2ZBFA 1TA4A 4AJLA 2QEXA 4L72A 5M5XH 4WLUA 2A73B 4DEVA 2YS6A 2X1MA 4NXNB 2RHHA 1JHZA 3A6FA 1S9DA 2E4WA 3TJZA 3W4KA 4Z4QA 3HG9A 1DAPA 1CFZA 1PSWA 2VK1A 3JYQA 2JE6I 1QQTA 4A3DH 1YZHA 1BU5A 1XTBA 1G2SA 4YGXB 1KL9A 2GKOA 4FBLA 4HEHA 4JZYA 3RSFA 3B3JA 4YASA 3ZQKA 1RYHA 2R62A 3MJCA 3SXUA 2QRUA 2Y0PA 3THXA 4ZTZB 1AB5A 1YU6A 4B3CA 1PQYA 2B25A 1W75A 4CQMD 4EQZA 5M5YB 4DV4Q 3ABIA 3CXUA 3VXKA 1IL2A 1XZKA 2IUSA 4M22A 3BMOA 4RIFA 5F4BA 2A14A 2CNLA 3K96A 4NCBA 1XAJA 3I76A 2I7XA 2QQEA 3BZUA 1SURA 4C21A 3QLEA 1V43A 3TZUA 3L8GA 3I05A 1W85A 1B16A 3P5BA 7GPBA 2O8EA 1KXLA 1TXGA 3GIDA 3IV7A 4KG7A 4ALPA 4N54A 4NZPA 1YFZA 4G0QA 3EIQA 4GDMA 4XWOA 1RWMA 2C04A 3WAJA 1I4EB 1REQA 2HIGA 2B2CA 3IBTA 1ILEA 3NANA 1CKNB 1MSHA 4GKKL 5BWNA 1N2HA 1PK7A 5HOEA 3PX7A 4LF6B 2EX4A 4RM3A 3T06B 3NXWA 1MABA 4ODIA 2NGRA 1T15A 3M3YB 1XFAA 2Y1CA 2ZB2A 4G37A 4RA9B 3L7BA 4WK4B 3UT5A 3NIBA 4G57A 3LFHA 3HOZB 4J1TC 4ZAGA 1I30A 1NUAA 4G84A 4YLYA 5JNLA 4ZA2A 5ELCA 4KITB 1ZVMA 3I4LA 2OL4A 3CO5A 2ZIWB 3TOVA 1F1BA 1B23P 4A10A 1QDEA 1RQ2A 4GQAA 4QUKA 4X00A 3STHA 2PZLA 4YMSA 1WSBA 2XCOA 1O9BA 4QOHA 2F0MA 1NAHA 1Y37A 1ENPA 3K9WA 3NG1A 3AR8A 4AO7A 4BN4A 1X86B 2B5WA 3A6JA 4CIWA 3L7NA 4A6EA 5I01A 3B1WA 1OBFO 2XUZA 1P2TA 3FVQA 3QZUA 4ZO4A 4AX4A 4JC5A 4UQPA 4AY2A 1QO9A 2HA5A 3L5KA 4KFTA 4RHXA 3RC3A 3ERSX 3D31A 1CE8A 4YJ2F 4JLSA 4G7OC 4LY3A 4BBSB 4GOJA 1E1DA 1LGYA 4KW7A 5FL7A 4IJMA 1XMJA 4O6VA 3U7EB 3ZJVA 3PC8C 1Z4MA 5AJWA 4PWZA 2B61A 2MO1A 4IXMA 1L5YA 2WV7A 4A6XA 2CVQA 3ZTTA 3T7RA 3UCFA 3GTLH 1IIRA 1OTHA 1XEXB 3COJA 4MHSA 4ZOLF 3FTDA 1LUAA 3L9XA 3IQDB 2YIVX 1E1CB 3CINA 2VHTA 3FZNA 2RGWA 4XSVA 4KO2S 4OFXA 1KVQA 4X3KA 1XZFA 1RQNA 3BMCB 4FUTA 4TKMA 2QRVB 5FUMA 4X66Q 3TW8A 4YCWA 3IRBA 1CEQA 2BGTA 5GQOA 2H4ZA 2BH8A 2I5PO 3OE1A 3D3RA 3QJYA 4TQ9A 4XUEA 3EMKA 5FYQA 2JI6A 2C3YA 3I56A 1MQSA 2BFFA 3P27A 5H3CA 5B1YA 3BGSA 5CURA 5H83A 1J90A 3SGIA 5BN4B 4E5PA 3U4VA 1O1YA 1O2DA 1S8NA 1FYXA 4EGSA 1GUGA 2GBCA 2R7NA 4ZGGA 5IF3A 1V1QA 1JIIA 2NO7A 2XDAA 1YB5A 3VPXA 1VMEA 1T9AA 4E08A 1XVUA 1E2ZA 5AIAA 2F1HA 2QAJA 1YDWA 1XTJA 1Z35A 2CLMB 1H65A 3CC8A 2HEGA 1JOQA 1JS1X 3H42B 3I9NA 3PRJA 4U5XA 5KNCD 3ER8A 5G0UA 5F64A 3GLHB 1I5FA 2QSUA 2JKZA 1KAOA 1EP2B 1EVIA 3OX4A 1D1PA 1T4CA 3PHBE 4Q4CA 4QQRA 5JH7F 2P78A 1VYHA 4Q21A 2P4EA 6NULA 1JALA 5KSZA 1W49A 2D4HA 1CDOA 1OZFA 4YRDA 2FSVC 5ADVA 4MINA 2PUFA 3EULA 4MQFA 3VDXA 5EQTA 4LXQA 5SV2A 4H7JA 4CPDA 4Y1RA 4A3KB 5BSWA 5HKAA 1SYBA 2WOOA 2XNHA 1FJGQ 1L3CA 1OX5A 1ZUD1 2YDYA 3G7NA 4DNTB 3LX8A 3N2NA 3NEJA 4FDUA 4HSGA 5CV4A 4IUBS 2V3CC 4Z5XA 2YWBA 3JYOA 2ZJYA 4FU0A 4WDRA 1W73A 3L8YA 1LW6E 3TQCA 1IBML 4CT4B 5MFZA 3A6HA 3ANMA 4N76A 2JEZA 4K88A 4LF5B 4J76A 3HKSA 2D1FA 2HV9A 3EQ9A 4M0UA 4FMCB 2RAPA 4OQZA 2ZUCA 1JB7A 4D4MA 1S96A 2JJ1D 1Z2DA 2BISA 3VZSA 3HU3A 5C5MA 1TD1A 4F56A 3DUFB 1YNXA 4LDAA 3BD8A 3NBXX 4JVNA 3A70A 3NDIA 3SQOA 3O94A 4QUBA 5CYFA 2R751 2DY0A 3T9EA 4MEJA 5IF9A 2Z6UA 2QE7A 4DWJA 3UC9A 2C5FA 1D2CA 3W1GA 1XCPA 2GRJA 2ODNA 1CUDA 2ZJ7A 2QJFA 4YRFA 3CUEF 2XJ4A 2ZI3A 3J81j 2QVBA 1SVSA 4HDSB 4OQMA 4ZEXA 4RY8A 4Q4JA 3WMGA 2I03A 2B29A 1EI9A 2L42A 3RJMA 3TN2A 1XPRA 4P81A 3WV4A 5F9FA 1F38A 3JQ6A 2B2VA 5G4LA 2XCTB 2RGDA 1QOPB 3OT5A 4BRSA 3RBVA 4GX5A 1U2DA 1EVYA 4QOSA 2QDXA 4IQGA 1LK7A 4DXHA 2XYHA 3LXRA 4JBXA 3PTZA 4KRYA 1BHO1 5BW6B 3W8EA 1RL2A 4IICA 2PUJA 3ZQ4A 3L05A 3F74A 4KUHA 2ATVA 3JVUA 3T9DA 4PG3A 1DL5A 5HIIA 1Y8OB 1PJCA 2M6SA 2EFYA 2MPMA 2B2NA 4NCAA 1HNXB 3G9QA 4QVIA 1O77A 2CHFA 4Y1RB 4Q1BA 3R6GA 2VW9A 5KBYA 1FJ2A 2FRDC 2PDAA 4LF7L 4BECA 3G2PA 3OQNA 1A2QA 3JPWA 5H9VA 3ZGVA 4LXTA 2C7VA 4A3CG 2D7CA 4YDRA 1HYQA 3KLRA 1CI3M 3OM0A 1KOJA 5CYPA 1KBZA 4NEHB 2Y9PB 1BVRA 1W93A 4C1NK 1RTOA 1QFMA 1EOVA 3CCEA 2J46A 2O1XA 4HJ9A 4NDAA 4A1FA 2QTVA 4D9NA 4RHSA 3ECAA 3CVVA 2DH6A 4D3DA 5MHTA 2R2AA 1UBFA 2XBUA 4GC5A 4L27A 5JPMC 2D0PB 2IW1A 2QMUA 2GM4A 4DMUB 5IODA 2O0MA 1SXTA 1IJEA 3CWCA 4KB5A 4DV1Q 3R6TA 2JCVA 3OPOA 1RHMA 2PVCA 3QVGA 5KSYA 5IM4A 1N2OA 5K9ZA 4K05A 4UAVA 1P0FA 4TS9A 3GRZA 2W43A 4X62B 2BFDB 5LOVF 1I4PA 1CS4C 2OECA 1RBYA 2F0SA 4AK9A 4D9EA 4DT1B 2O8FA 5I7SA 1JKMA 2PYKA 1SG9A 3L40A 1Z22A 3A55A 2VRCA 4F85A 2D1SA 3GWGA 1M1KC 2XSZA 3ME5A 4JL8A 2F8LA 2LDBA 4YJGA 5D5QA 1U3FA 2G1UA 4YUYA 4Y30A 2ZRCA 2V96A 3NASA 2QGQA 2JNWA 3FI0A 2IXGA 2P90A 2Y8EA 2ZYGA 3LECA 4NQRA 4RH3A 5CK4A 1TZ2A 5IFKA 1OCEA 2F0NA 4J0GA 4NX2A 3A0UA 3DLIA 1PR1A 4XWGA 3WLJA 1RRGA 1AHNA 1FK8A 2PQEA 2P2NA 1ND5A 3CE6A 3RIXA 3WLPA 1SK9A 3HFSA 2QV0A 1BDMA 2X9QA 1QCBD 3QVXA 4HDNA 4XB2A 4JR0A 5KUTA 2KQ3A 1C8KA 1KAEA 1TC2A 1KOGA 4PTYA 1H22A 2QG9A 5DN6A 2E48A 4NMLA 1SUAA 2F3PA 2XTAA 1WF6A 2BMDA 1SBNE 3WGZA 1FY2A 1Z5ZA 2D5AA 1BZYA 1B4OA 1OHHA 3BL5A 4HZUB 4RUKA 4WKGA 3U3OA 3HMQA 4PZDA 1I5OA 2CHEA 1K8YB 2POQX 1CRLA 2MSLA 2RH4A 1PZKD 5JQWA 1COWA 3D2AA 2HSEA 2WY2D 1XMOQ 1OBHA 2B7LA 2ARKA 1X8KA 1RWXA 1AEXA 1EZ4A 1CUZA 1QB5D 2VNJA 2W6JD 2WD7B 4IVQA 1G2IA 1V47A 2FKAA 5EIBD 3ZTYA 3E6ZX 3QWAA 4L5CA 1DD2A 3FDXA 3OT4A 3WISA 4Y6PA 2O52A 4EYQA 1FZTA 3C3XA 4INOA 1PQUA 3ZU5A 3BOSA 2A6PA 3Q5EA 4P7FA 7YASA 1TUIA 3R5SA 4TX1A 1B2RA 4KPUB 4PRKA 1WOCA 2HD3A 1VKZA 5HWSA 1DRWA 1M2VB 5A3JA 5I4BA 2V74B 3KXKA 5DBFA 2NN6I 4U9HS 3W79A 3H15A 4KQ1A 1MJFA 4BY1B 1Q92A 4H7KA 4EZIA 3WGVA 3OCCA 2I5MX 2XN9C 3DEPA 2ZB7A 1KI6A 1NBOA 3P0FA 4H18A 1SUWA 2VZEA 4UATA 2MT9A 2VTDA 3TR5A 4BQEA 2V6BA 5JXJA 1UPXA 1GYPA 2P4HX 4F5ZA 5K4HA 1Q57A 1AHPA 1Z6HA 4XDHA 4P3PA 2K01A 1E24A 4EEKA 1G7RA 2DSTA 1JQKA 1RXVA 1EQAA 1KDPA 2JGMA 3G7UA 2IDJA 3A6LA 3NAZA 4R84A 3UWDA 5KU1A 2Y1LA 3BGDA 3HPQA 4ER7A 2JLUA 1KKLA 4K2AA 4TSFD 3N28A 1O80A 3THRA 2QM8A 3V55A 4XXEA 2ETVA 3G0IA 3CH7A 4FYJA 4FYPA 4JOBA 4Y18A 1KZGB 4OH7A 4ZYYA 1HUQA 3G79A 4QDUA 4ZI7A 3S1SA 2VP0A 3KRTA 3OTOL 3DEJA 5TARA 3L07A 4P8RA 3OCXA 4PZPA 4E46A 4AUKA 3NQIA 2BUBA 4ZCMA 1C3OB 3X44A 4AMUA 5JR3A 4ZCSA 1ZZGA 3OZEA 4J2HA 4CN9A 1RJ9A 4C6TA 4CFYA 1UPFA 3IP3A 1KD1C 1C9NA 1KMQA 4AH6A 1CZUA 1DWQA 1R0RE 1T3GA 1YVEI 2B4KA 1X2EA 1T43A 2EFEB 2RHOA 1JQJC 1E5QA 1Z7EA 2XPCA 3GDOA 3C70A 3K9NA 4NCJA 5LDGA 4G1CA 4GSKA 4OCZA 1ZM9A 2CXNA 2ZJFA 4LNUB 4OFZA 3LS2A 2PL1A 4MIUA 2QAIA 3HTXA 3CIOA 4JJKA 3A4LA 4AMBA 1UJ2A 5DM60 1WTPA 3NYIA 3F6BX 5D14A 1AKYA 1MC5A 1XNQQ 1F06A 2VBGA 2WE7A 3AF3A 2VO1A 3FVRA 3IESA 1GKYA 2XUQA 5EWJB 1X1EA 3ERQA 3E70C 3KAPA 4RKRA 1QZHA 3CLUD 5AVSA 2NUPA 3GLVA 4LDZA 4LRXA 2M2IA 3DNMA 4Q1DA 4YUAA 3EAGA 4LSMA 5L9AA 2O6LA 1T5DX 1N2EA 2HWKA 3NBIA 2QN2A 2JS7A 2Z09A 1NYLA 3EIOA 4JJ4A 2WBLC 4RH0A 3U4DA 4F38A 3KSRA 2F8SA 3LRXA 2O6HA 5J23A 4M38A 4UAUA 2XWJI 3PVCA 4C3JB 2PG3A 4OHJA 2Q1TA 3U7FB 2GBFA 4RELA 2G1PA 3EEOA 1E1LA 4KN6A 3NWJA 1R9NA 3EDRA 1BHSA 3NTVA 2BR3A 3PYXA 1ELOA 2QVCA 4ALKA 2IYSA 4D0RA 4HR7B 2OOKA 3LT5A 2ZYAA 5G41A 3WOEA 2AI1A 3F5QA 5EFOA 3LXMA 4ERNA 5COAA 2XUHA 2W42A 4YRRA 3I34X 5THXA 3KETA 5LMZA 4URYR 3IT0A 1H2AS 2KBEA 1W0CA 1L0YB 4MMXB 5IM4F 3DBLA 1E61A 3HC7A 1ZXLA 3IVXA 4HSEA 4KYIB 4TV9A 4ZVUA 4BFSA 5HG0A 4OHVA 3K70C 1H4QA 2OGZA 3WBKA 3UHJA 3HA5A 4HYEA 3HVKA 1NOJA 3S2HH 4OHWA 1A6XA 2GEFA 2WNHA 3ER9A 1PTOC 3R8FA 3QY9A 2XGJA 3COYA 3DLAA 3QVUA 1K1EA 2VN8A 4E09A 5IC6A 4K0KL 3T1NA 5DRYA 3W6UA 3RNLA 1CZGA 1F77A 1B6GA 2G17A 3HLTA 3LPCA 5FRDA 4M6WB 3FUTA 5TX7A 3VZRA 5DTJA 4ZYWA 2YU9H 2WYVA