3PUYA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puyA01
4H13C 3CCRA 1FYCA 3W34A 2PI2E 5AJ3L 3MLEA 4B3DA 1YR7A 4GSYA 2KENA 2OQKA 2E5LL 2F6RA 4ARZB 4WBSA 4EPXA 4HAXA 3A1SA 3VNUA 2A6EC 1X1RA 4FMCB 3J81c 3LH5A 1II0A 4Q1FA 3HOUH 1EQQA 4JI4Q 3W6OA 2ZRGA 3JVVA 1W49A 5HTKA 4YHHL 1XP8A 4KJZA 1UPTA 2ASBA 2D2FA 4IFDG 4LPSA 1II9A 3BG3A 4PC7A 3AVWA 5JJKA 3AF3A 1LVGA 4QM7A 1TWGH 1UE7A 4JV5Q 4JYAQ 1E4YA 4QHTA 3ZIAD 2Z6KA 2Q9BA 4HZUB 4N0DA 4DKAC 2HEIA 5HKKD 4XWOA 1OSNA 2FG5A 3LQQA 5BXQC 1Y1VG 1XPUA 4DJTA 1G20E 4FW9A 2G83A 3R7WB 4DK1A 2BBOA 2R6FA 2FV8A 4C0HA 1Q1QA 2A19A 5JEDA 2CHGA 3K9HA 5KNCA 3B1VA 1XRJA 3SYKA 2IS6A 4IFDJ 2Q9CA 1Q0UA 1NSFA 2JDIA 2MSDB 4LBZA 1DAHA 5B58C 1LS1A 3STBD 4BY7G 2ZT9C 5IF9A 2GK7A 1RZ3A 4L5BA 3KOJA 2OV2A 4HUQA 3A58B 3LBIA 4GP7A 5FTLA 5ELXA 2FX3A 1I2MA 2F7SA 3ADDA 4FCWA 4DR1L 1PFSA 3U6BA 3CCVA 5EP3A 3VR2A 3NENA 5DO9A 4M9XA 3QIAA 4IOKA 4C0QC 1G3UA 2LXKA 1Q1BA 2XSZD 3CZPA 2DFNA 1E2MA 2ZE5A 5L3QB 4AKGA 2IYRA 4CT4B 2PJRA 5C0XG 2R7DA 2DHRA 4BUJA 4Q1BA 4JJZA 3WMGA 4YLGA 1QUQA 1BS1A 1NF3A 1P2VA 2R6DA 1SZPA 1VQPA 1T8TA 3QY0A 5EZ6B 4UXJA 4LUVA 1C1YA 3CRQA 2EVBA 1UKZA 1AA9A 2XITA 3BC1A 4LJ8A 5TV2A 4BFXA 3B9QA 2LKCA 4QGAA 2CJWB 4DV3L 1IHUA 2D06A 3DLLA 1ZD9A 2BM0A 5DI3A 1KDPA 4A4DA 2R9VA 4LFAL 2ORWA 4KFTA 1RPZA 4GDFA 3BIFA 4JI0Q 3NDBB 1T3HA 2QNRA 3VQTA 2ZS9A 4A93H 2BMFA 4Q7LA 3J81j 1P6XA 5KSYA 3ZS9A 1CBUA 5CK5A 5C0XJ 2K7VA 1GNPA 4Q9IA 1RVDA 1Y8OB 2EQSA 2OCEA 1GD7A 4E09A 2J59A 1H9KA 4JI1L 4RD0A 1Z2AA 1YJ9A 2BA1A 1PLLA 5JFGA 2PNHA 2GCNA 3M0EA 2Z0MA 3ZH9B 2NMVA 4HJ9A 3THWA 4LF6L 3MEFA 1IBLQ 1ZCAA 2A6HD 1MR3F 3I8SA 4QHSA 4KKUA 2WKRA 2R62A 1N34Q 5G53C 2IS4A 2O8CA 4IDOA 4YMSA 1CRPA 4HR7B 1ZU5A 5B30A 5L3VA 3AVTA 2O0HA 4IO9A 2R92G 2IC5A 4R4CA 2VP9A 3IIMA 3W9YA 1TQ2A 3BD9A 4LNQA 3IBGA 4EFLA 2LXJA 3BFKA 2FPMA 1W2BA 2AN9A 3BRWD 1K0RA 2FMXA 3AB3A 6Q21A 2QQ0A 1VQAA 2EW1A 2GWHA 2KHIA 3ADKA 4OBEA 2AFHE 1A7JA 3LFUA 4JI3Q 1FNNA 2ZROA 4KITB 3GTGH 2R44A 4UP7A 1W3SA 2UXBQ 1R5OA 3OE7D 2A68D 1XNRQ 3QXSA 5L3SB 1AJEA 4PZ6A 1CSQA 1H9SB 2DWQA 4A3KH 3CLVA 4RD3A 1OFHA 2FU5C 4EJSA 3CCSA 1BKDR 4NKRA 2WWXA 4AI6A 2QE7D 2BJVA 2RGXA 4D26A 1U90A 3H3VI 1NMXA 1RJ9B 2CCJA 1IM2A 2NZJA 1SN8A 3LNCA 2VIIA 5CM9C 3D8BA 3T1VA 2XTMA 5EXXA 4QM6A 1JQLB 4OGQC 5LMUQ 1P72A 4HB3A 3KJIA 1GL6A 1HPCA 3G48A 1UE1A 1MO5A 1NKSA 1OFTA 1YZKA 1JECA 2PCLA 2ORVA 4P31A 3TW4A 3RRZA 5AJWA 1TUEA 2O0JA 3RS7A 3MAAC 1M7HA 1NBME 2TMKA 4D4LA 3TR0A 4A3FH 4CYMA 3RS5A 2J0UB 2VP6A 2XX3A 2A5GA 3EXAA 5FH9A 5TDHA 3AVUA 4DPGA 2K33A 3SE0A 2Q3MA 4CIDA 1A63A 4H0LC 2KA7A 3A7LA 1GOTA 2J0VA 3DKPA 1QHIA 2JXMB 1OHHD 3C41J 3CRVA 1YU9A 3SFVA 5KHOC 3M7NA 3DHWC 3U61B 4PO1A 2KBNA 4JG2A 3LV8A 4M9SA 4RKFA 1UKVY 1ZM4A 1PHJA 3WRXC 4KI0A 3KKOA 5CJPA 2GVZC 1IL2A 4TT3D 5EE1A 2ERXA 4TKOB 1T0JB 1E22A 1G3RA 1LB1B 3GEEA 3OPOA 2HLDD 3GPLA 2Z43A 2VHQA 3B1WA 3P4XA 1KO4A 2C96A 2OUKA 4HJ8A 1NG1A 5TARA 4BRWA 1YJNA 1KSHA 3DOEA 2BHRA 1HNWL 3I5XA 4AURA 1HEIA 4N1AA 4BECA 4B71A 2REXB 3CRMA 1S3OA 1US8B 1FMLA 2OBNA 4LHVA 4B3TL 1Z63A 2XTIA 2YZ2A 3DDCA 4LK2A 4OK5A 1N36Q 3P32A 4AC9A 3I1FA 2K75A 1E3PA 4NCNA 1VQ4A 3CKLA 1VQIA 3I32A 2QA5A 1G7CA 2OCYC 4PC2A 3UWOA 1DAEA 4UPAA 2E2HH 1Q1ZA 2R6CA 3GQBA 5M5XH 4NL4H 5IYCG 2QPAA 1XMSA 4A3MH 1XTKA 3NXSA 3X1ZA 4G1UC 4A2PA 1CKOA 4LHWA 2VH5R 3P20A 4BZPA 5E3HA 4W9MC 2Q2HA 1YR9A 2Q3FA 5KSZA 2PCJA 3REFA 5AJXA 3GJXC 1SVWA 4OI4A 2JJ8A 3RWMB 1F2TB 5IYBG 2EXDA 1Z6AA 1E2PA 3ZIAA 4A3LG 2ODNA 1VQBA 1GWNA 1EK0A 2BC9A 4KYUA 3SZRA 4AYWA 2FH5B 2DNEA 3A8IE 1UKYA 1XTQA 2DFKB 1IXRC 4Q00A 4R2IA 4RFSB 4XTRA 1W2GA 1G3IA 5GJBA 1KK1A 4N3NA 2ZRHA 3BAFA 3I4OA 2K5UA 3T1HL 4V03A 1N6LA 1PLJA 4C0KA 1XD8A 2ZJBA 2QTVB 2EJMA 2VZAA 2HJGA 2OHFA 2QP3A 3PUWA 2R93G 4QGFA 1R0WA 1G19A 1SULA 2QORA 4BFUA 4B6EA 2J0SA 3K9NA 4TLCA 4QGHA 4PQFA 3HJNA 5LDDC 5SZKB 1HQCA 4MKFA 4X8HA 4A3GG 1JJCB 4WOPA 5IT9c 4QQBX 3K8YA 3WNBA 5TY0A 2ZM6Q 3AKCA 3AF4A 1NVVR 3CCJA 4LHYA 2D2CC 1WMSA 4WZ6A 4MKGA 1JJ7A 1YRAA 2XXAA 3HOVG 4X6AH 2OLKA 4R1JA 3T51B 3DZDA 3L43A 3A74A 3OIYA 1E2ZA 3CONA 5DNYB 4GNXB 3AKEA 1Q20A 4ZIRB 3SYNA 2B7BA 4DCVA 1Y1WG 5FJ8G 3WRYC 3RN5A 2ZYTX 5C4XH 1SMYC 3VDYA 4DR7L 2R92H 1F2UB 4JI2L 1TQDA 2Q6TA 3GLGB 3EPHA 1HZBA 1P2SA 3U4QB 5HKKA 1S40A 5E7JA 2QBYA 4EPTA 3RSOA 1X54A 2PCFB 3FYHA 3TUZC 1U8ZA 4NYMQ 2YTYA 1CLUA 4BA2I 1ZMXA 5IHPA 2F43A 2V1UA 2Z6VA 2LWIA 3SQWA 5HR5A 2ZTCA 3RR5A 4QL5A 3HOZG 2Q8IB 3OTOL 3C15C 4HI0E 4IOLA 5FOVA 4A8JB 4D2IA 3HKSA 4JOIC 2MNAA 3I62A 4DV0L 3LD9A 2CLSA 5IDVA 1GAJA 2FFBA 4DV2L 1XD2A 1IN8A 5EXSA 3GTJH 3GP8A 5ELNA 5KSOA 3OEED 5UKDA 5BYKA 2B3GA 5JI2E 1PH2A 4DR3Q 4M53A 1VG9B 3GFTA 4L5RC 4A0FA 3T56B 3CW2C 1EYGA 3A4LA 1N6HA 4GLVB 4AKHA 3P27A 4JYCA 1IW7C 1EOVA 4WJ3M 4XWAA 4GOPA 2B63G 1QF9A 1KI6A 1NVWQ 5IP7G 4GN5A 3SEAA 1J6QA 3T61A 3ZZ0A 5JECA 4P32A 1H9MA 2VSFA 3PITA 3CPJB 4DLVA 2PNRC 1FP6A 4GBMA 3AF1A 3CRLC 3GTMH 2XJ9A 1ZAKA 4JL5A 4Q9LA 5DYIA 2WWFA 4DCUA 1UKEA 3VHXA 2FSHA 3GEIA 1VECA 1L1OA 3KFUA 1YVCA 3OE7A 1T5IA 1Z0IA 3U58A 2W83A 4TYWA 1UEIA 2JGNA 1XCPA 1CULC 2D2EA 4IVQA 4NH0A 1WCMG 3PO2H 4PG3A 1CKEA 2AX4A 2QE7A 2BE5C 4LF5L 2FGJA 3EC2A 2EFDB 4JI8L 3FFAA 3K0FA 4ZDIA 4URWR 3CC7A 2ZR9A 4H9GA 3U50C 3O47A 3ZJYA 3KQUA 1JJ2A 3THXB 2B8TA 3CPEA 1R7RA 4NYJR 3TQYA 1GILA 1YE8A 4Q4JB 1V43A 2UUCQ 3SC3A 2QSZA 5FPKA 2OO7A 4QHYA 3NEJA 2JLZA 3GLFA 4PZZA 1GTVA 2ZRAA 5JWOA 5KDOA 3AV0B 1UM8A 3ZD7A 1DGSA 1BO6A 1CKNA 2UUAQ 2JA7H 2AK3A 4PSKA 4DV4L 2AHOA 2QAGA 2QM7A 2O8DB 4FINA 1Z3IX 3QF4B 4M1WA 2WAXA 2ZI4A 4Q19A 1UDWA 1OHHA 1PH7A 3U4ZA 1W2HA 2AK2A 2WSMA 4JBKA 3HR8A 3SJZA 1XPOA 2QZ4A 3D7MA 4Q4AB 4BLTA 5H68A 1G41A 3C5CA 4U5XA 3TBKA 5IYCH 1TU4A 2ZYUX 4PTLA 3PCRB 1Q7YC 2CLDX 2GVAA 3AFPA 4TT3A 5EUQB 2ZJ8A 3D0FA 2H7VA 3X1XA 2A3RA 2HLDA 3I55A 2VP5A 2ZVQX 1RYHA 4G5QA 5CYOA 5EQTA 3ZLJA 1KJZA 3U44A 4JL6A 2GCPA 4A3LH 1QZGA 3CX7A 3U3OA 2V55B 5FBLB 3WBKA 2C35B 5C44G 2QP4A 4NXMQ 4L4UA 1I4DD 2UXCQ 4C3ZA 4AH6A 1O3YA 1T8UA 3QNUA 4FMDB 1XJ0A 2NZHA 4L5SA 3CCLA 1XEXA 3RC8A 2L5TA 2NN6I 2KE5A 4YXWD 2WM9B 4A8JC 1FP7A 2QTHA 3EW9A 2ZJRA 1XNQQ 3VR1A 4TYNA 1OH7A 4JLOA 1PH4A 1XTJA 2OBMA 5FPTA 1FL9A 1YITA 2R93H 3H4MA 3A37A 1ZUIA 3HP1A 1FUUA 2GXSA 4ERNA 5HY6A 3KKNA 2OFOA 4UNPA 3MUFA 2I1VB 1SKYE 3WYFA 4YCUA 3X1DA 4C7OA 1E1TA 4CT5A 2B8WA 2VHCA 1X8JA 2GNOA 3PEVA 5FOXA 1QG4A 3F8TA 2N78A 4ITRC 1YHAA 1FJGQ 2NQ2C 3Q5EA 4G0NA 1E24A 3V4FA 1P4SA 1NLYA 3LWNA 1KAWA 1VQKA 1GO3E 3A5UA 4OX9L 1CP2A 4DV5L 1S72A 3EA5A 4RKEA 4WXPA 2O8EA 2HHHL 1YZGA 2G3YA 1VQ7A 3SBDA 4ZCLA 1K3RA 3TMKA 3ZDQA 1VQLA 1Y1WH 5FJ8H 1DAIA 5BR8L 1KZGB 1XMQL 3H2YA 4Q47A 4DV7L 2ZTEA 1HNXL 2G9NA 2FWRA 1G5RA 4DXAA 5J40A 3KYHC 4YCVA 3AVPA 2OBLA 3THOA 4DDVA 2IUTA 4A9AA 1LFDB 4MUBA 1WI5A 4AQYL 1CJVC 1YZNA 2H17A 1PYBA 4I81A 4GZLA 1KI8A 2ZQ5A 3DMNA 3EC1A 2AXNA 3EZ2A 1FX0B 4I1UA 5AK0A 2DYKA 1E9AA 2AFIE 821PA 4DUZL 3HOZH 4MRVA 2RAPA 4YC7A 1E1RD 4LF9Q 1VHLA 4I7ZC 2UUBQ 4BBSH 2ZRKA 1I50H 2G0TA 3FKSD 4OI2A 1X3EA 2IYSA 3MXUA 1KI9A 2B6HA 2DR3A 2Z83A 4B47A 3AQQA 3J81i 1J70A 1B9MA 1XPRA 1HZ9A 4DLUA 3T53B 3RRNA 3U3KA 3L8ZA 2ODWA 3IUYA 4NDZA 1UDXA 1P2TA 4MRPA 2A69D 2CCGA 2ORIA 1GKIA 5IE8A 1BBUA 1Q81C 4C2TA 2AUKA 3HDTA 4DT1B 2G0NA 5M3FG 2X2EA 1FR3A 2GF0A 1GNQA 3KDFB 1KC8C 3WY9A 3RAPR 2J46A 5JS7A 2ODBA 1LYLA 4A6XA 4F4CA 1OIXA 5DHAA 1QDEA 5HE8A 3PF5A 1PV4A 1JPNA 1KMQA 2JLRA 4G5SA 4D0NA 1Z07A 4K81B 1E0AA 5JJLA 4ZCIA 4TMXA 4M8NE 2EVWX 4AG5A 5GAHC 3FKQA 3X1YA 2JLSA 2O5JC 4P73A 1CJTC 1XJQA 4QJFA 1VCIA 2AL7A 2WFWA 4HUQB 5FBWB 3H3VH 1WCMH 3HFZB 3OEEA 3ZVMA 4ACBA 4MRRA 3UANA 2ATXA 2VQFQ 1F5NA 2ZJYA 2VQSA 4KXFB 5K8IA 2PMKA 4RD4A 4OQLA 1Q3HA 2RGAA 2O8BA 3TRFA 1S3GA 4WZAE 3HOUG 1S9DA 5JI3E 3ADBA 4MTNA 1UJ2A 3KB1A 4DLZA 3EIEA 3CH4B 2YKGA 3T15A 5FI1B 4PSAA 2O8FB 1AIPA 4G5RA 2OTLA 1ZIOA 4KVGA 2IUUA 1QUQB 2ZYWX 1GITA 1NL3A 2BVNA 3A5ZB 2K50A 2PT5A 4IHQA 2ANBA 1ZW6A 4LFAQ 1CRQA 1E2LA 2ID0A 1HNZL 2Y0SE 1IYVA 2IYQA 3FMFA 2C8VA 3K09A 3BXZA 3D31A 2RGNA 2NVYH 4W5JA 1HTWA 4JL8A 4B3MQ 4JLVA 5CB6A 1YKSA 2QUZA 721PA 3UPUA 1Y8NB 4UKDA 2GEDA 2CVHA 5D3MA 4HUTA 1P60A 4Q1CA 4CEIB 4A3EG 4KHPL 2QPOA 1AZTA 3SDZA 4JI7L 4OK6A 1P61B 1W0KA 1E69A 1XX6A 3DM5A 1Y14B 4LYHA 5K8UA 2OZEA 4LW1A 1JMCA 1KGDA 5E7IA 1KDRA 1GUNA 4G5GA 3EX7C 3RDPA 3PUXA 1CI3M 3THWB 5CJ2A 3FPAA 1N6PA 4DR4L 4DK6C 1AQYA 4JKIA 2F3TA 4OHYA 4TL9A 2GN5A 3GCGA 1C0AA 4DNTB 2EJGC 3S1NH 3WHKA 1U0JA 4GOJA 3AB9A 1KI7A 2O8CB 5AWFC 2HT1A 3GTKH 3GLFE 3RS0A 1CR2A 1C4OA 1HR0W 1M34E 2JA8H 2JEBI 1OIWA 3ETLA 1W4CA 4QFMA 1LACA 4DSNA 4B32A 4HIKA 3KXIA 1VIAA 5DSZA 1GSIA 1ZM2A 2WJIA 3BFVA 3RSLA 1G8GA 2EYUA 3IPYA 1ZNYA 1I5FA 3IQXA 1V5WA 3T5GA 4A82A 4Z51A 1E3MA 2GBLC 3KJEA 4FWIB 1NSTA 3IHWA 4ABYA 5DLQE 4Q7KA 4QXAA 2BWJA 4PANA 2GJAA 5CLQA 1BVSA 1UBEA 4LV8B 3SOPA 3W8RA 2NPIA 2CK3D 1UBCA 2QG6A 2Z6KC 3IEUA 4XJXA 5B57C 4ZI2A 1KHTA 4EJSB 4HDCA 5ANRB 3TSWA 3G71A 2FSFA 2NO7A 4R4QA 2JEAI 4P75A 5EUMA 5TB5A 4LC0A 2K5NA 1N8RC 1FQKA 4LYFA 2BMJA 2A6ED 4B2IA 3LLUA 4YXWA 5LD2B 1SVSA 1KSFX 4LY6A 1EXMA 4RZ3A 2E8GA 5E4FA 1IBKL 2OXRA 1ZINA 5FFMA 2CQOA 4LRWA 4TLDA 5FOWA 2AKWB 3BERA 4IXNA 1X3GA 4QGUA 3THYA 4BE7B 1DARA 2C9CA 4X64L 4XSHA 4C4PA 2IT1A 3TS0A 3PEUA 4XH9B 3WNCA 5AJZA 4LI0A 5P21A 1JB7A 1BMFD 2CEAA 2H5EA 3CWQA 3K9LA 4TLAA 3FGNA 3IKJA 3BBPA 2J9RA 2WJJA 5IK2D 4MDFA 2CE2X 2EFCB 3LO5A 3TZUA 2YWGA 4DUGD 1VQJA 3MGCA 3IPXA 1KI3A 3M85A 3MWYW 3T1YQ 3G0HA 2N1BA 3KJOA 3GD7A 1C9OA 2JJQA 1MIUA 1HY3A 3H84A 4P3YA 5DE3A 1NIJA 4BLPA 2X77A 2ODEA 1RFLA 1WP9A 4KSBA 4K0KL 5M3FH 3REGA 4A92A 4LF4L 1IN7A 1ONBA 5EE3A 4BFZA 4O0MA 3NIBA 1Z9FA 1N6KA 4B3TQ 1FTNA 1N5JA 1XTSA 2EWVA 4F7WA 1EESA 1X8LA 4TMZA 1U94A 1E2JA 3ULPA 2EDGA 2JA6H 3AM1A 4BQSA 1AZSC 5JZVA 3A7AB 1VQCA 1E99A 3H1TA 4LF7L 1E1RA 2AWOA 4U7DA 2HUPA 1JB1A 3I73A 2MO0A 4P74A 3FKSA 4YWKA 1T0HB 3B78A 3FFBA 1QVCA 4PXAA 3WWVA 4A3FG 2VP2A 1VQNA 3RZOH 3ASYA 1SKYB 3U7EB 4B35A 2PL3A 4B74A 4D82A 1MO4A 1OYWA 2RGEA 4P4TA 5JHGB 2L15A 4D4JA 1L4YA 4JSTA 5DGXA 3KTAB 1DO2A 1GUAA 4ZDWA 3SBEA 1E6CA 1S96A 4BFVA 1XEWY 2L0XA 4D81A 3LX8A 2IHBA 1ESNA 1TXYA 2IYYA 4U02A 3K70B 1P7CA 1NP6A 2OFXA 3MRSA 2O52A 3DM3A 2A7QA 2RGGA 3VX3A 1V1QA 3S1QH 3D4RA 2F1RA 3VAAA 1VG0B 1II8B 3W8NA 2P6NA 4L16A 1NY6A 2VBCA 3B82A 1GP2A 1IN4A 4PV1C 4LFBQ 3N6RA 4Q9KA 4BBRH 5H1SE 2KBEA 1BIFA 1OJLA 1G1MA 3LW7A 3NTUA 2IK8A 1ZUHA 2QEQA 3FMCA 2ZREA 4M4SA 1X56A 4LZZA 3HKZE 4WVFA 5JLJA 2FSIA 5IWAQ 3TRZA 1IZ6A 1PA6A 4HYYA 4LCBA 3EIQA 2ZRFA 1I4TD 2FPKA 1Y8PB 3A1VA 4EJSC 1KJYA 2V1CC 1GRRA 4A3EH 1N5LA 2IYVA 3RS3A 4ACAA 3AVXA 1KY2A 3HPQA 5C4MA 1NI3A 2BA0A 3AQ4A 4OYHA 4X8OA 1EFTA 2NVXH 3PSIA 1R8SA 3ND9A 4A3CH 2N3SA 3UE1A 2C98A 4A3MG 2HYDA 5FUWA 4GOXA 4LFCL 4NCJA 2FXQA 1K83H 1VKJA 4C9BA 4E5UA 2WMOB 1HQYE 2QTFA 2XXAB 3GJ4A 1NIPA 5LMNQ 2DN8A 2PH1A 3VR6A 4DWJA 1H9RA 5FTNA 4NZYA 3T34A 2JJ1D 4JYBA 3GJ6A 2QMEA 4URUR 1QHHA 3FDIA 2ZAMA 4ZCMA 2VP0A 3QJYA 3BH6A 4KN7C 2QBYB 1ZYUA 1E9RA 2R7ZG 5CDFA 2AKYA 1EQRA 3CCQA 1C7YA 1S2MA 2Y0SG 4HATA 3CF5A 2W6JA 1YI2A 1U81A 3B85A 2VF7A 4GP6A 4Q9JA 3ADCA 1YHNA 2Z4RA 2NO6A 3EPKA 3K0AB 4LF8Q 5KDDA 2GVBA 1GZSA 2BKEA 4DV6Q 1G8PA 3AP3A 1U98A 1XD2B 1YIJA 1XU4A 1EFRD 1ASYA 1E9BA 1Z6TA 1UEBA 3S2DH 1N25A 2FEMA 2QN6A 1DBSA 1N2CE 1TF5A 2GJ9A 3CH5A 4A2WA 4RD2A 3OW7A 1XDBA 4Y52H 2X19A 2YVUA 4V02A 4C0LA 2NN6H 4D25A 5EXPA 3OESA 2ZPTX 4MGKR 1QHNA 3UDFA 1EGAA 4DUYL 4X8MA 3B6EA 3LVRE 5HZKA 4XOIA 4BPBA 4CGZA 2X2FA 3W1BA 2VSXA 4GOPB 3QXXA 4BA1I 1QJOA 3GO5A 2QY9A 1G17A 3K0EA 4PSVA 1G8YA 1KMHA 2ZUBA 4JIMA 1TWFH 4NB3A 1VQ9A 3PR1A 4MRSA 2V1XA 5DI9A 3RABA 4JBJA 4BFYA 5C4XG 4YY3Q 1YQTA 2P0EA 2Q9AA 1G5PA 2ZI6A 2XAUA 2W6ID 4B3BA 1KD1C 2ZM5A 4IFEA 3PENA 1UAAA 2PX3A 1K8AC 3L0IB 1W48A 4NCKA 5LB4A 3SHFA 3TUIC 3RYTC 221PA 2D5DA 2YWEA 3HU2A 4JI6Q 3U7GA 5HCNA 3LLMA 2KB0A 3GLHA 4I4LA 2CK3A 2XNDD 3K70C 3CBQA 3WP1B 2CKZB 4B44A 1ANKA 4GZYC 3CPFA 2GJKA 3PUVA 4R4IA 2H16A 3EG5A 2BJWA 4JBXA 3K0FB 1QVFA 3E5HA 4HDOB 1GUSA 2FEOA 1OXUA 1R10A 5M3MH 3C7KA 3QXCA 1LY1A 2KCMA 4R4TA 2UU9L 1TWAH 2IA5A 1R0ZA 3AP1A 3QKTA 4NONA 4Q4HB 3PO3H 1U9IC 2WJVA 4MYTA 2MSCB 2IX3A 1D9ZA 2N42A 3GJ0A 1MRSA 1DELA 2ANCA 3QKRA 1U99A 5F2EA 1JAHA 3GLFB 3QSYA 4IDQA 3U7FB 1VQGA 2IXEA 1JEDA 4V0MA 2NG1A 2AHOB 1GRNA 4MYCA 3SGIA 1L2TA 1TNDA 3U4VA 3I56A 1MRNA 4IDNA 2J41A 3QPWA 4QY7A 1O78A 3X1WA 1DXMA 1BMFA 1RRPA 4H1VA 4TLBA 1D2NA 3T12A 4ZKDA 2BH2A 3GEHA 3E2IA 5IK2A 4KLKA 4DV1Q 1G8HA 2CE7A 4MRNA 3UWKA 4RZ2A 4S35A 1FL0A 1E9SA 2QU8A 1VS0A 4DUGA 5F9FA 2F4VL 4TTPA 5BWMA 3MWJA 4OI0A 2JAQA 4POAA 3CMAA 2IS1A 1J8MF 2CWAA 4BLRA 5C2JB 4P4SA 1YZLA 1Z0KA 1WBBA 1MOZA 4KYIB 4UNNA 1V8QA 1E2WA 2KJQA 2GAOA 3NDPA 3U44B 3PO2G 2J7KA 2A30A 2G88A 2JASA 3B8HA 1VQOA 3HR7A 1G18A 1W36B 2VUMG 1AS2A 2B7CA 1KK3A 3G5UA 4B3SQ 5K8LA 2VO1A 2BV3A 1I6HH 4M1TA 2ZETA 3VHLB 2NZOA 3B1ZA 3MXNB 4FI3C 3RRMA 2ZE6A 4TTRA 3A6PC 4II7A 1TU2B 4FD2A 2PZGA 2EYQA 5GAGC 2OCAA 1S3SA 2DB3A 2IBMA 2JA7G 2QGZA 4ME3A 4X66Q 2FFHA 4X65L 2ZTDA 1KO1A 4HLUC 4AD8A 4TL8A 5BN3A 1G5TA 5KNDA 5GJCA 3B5JA 2RF4A 1CXZA 3SU8A 4Z54A 4KLZA 3QXHA 5J5CA 1SGWA 2C77A 1CF4A 2OE2A 5FBRB 2NVQH 4DSOA 4Q1EA 3HOXH 2ZAOA 4ZPXA 3SYLA 4C3IH 4DV5Q 1XXHE 4JI5L 2JLWA 4Y0VA 3GDEA 4B3RL 1EWHA 2ZSFA 2IXFA 3PIOA 1GHJA 1F60A 3DO6A 1VYTA 5FPHA 3V4RA 1XTDA 3BB4A 4TN1A 1XMQQ 2O8EB 4Q7MB 1HNXQ 2YTVA 3W5OA 3U2QA 2YWHA 2EFEB 4QNMA 4HIOA 2HF8A 4MNOA 3P1JA 1W5SA 1LW7A 5AR1A 5JRZA 3EPJA 3B2EA 3TAHA 1NLFA 1U0LA 3MJHA 4LJ7A 4BZXA 1T3LA 3CRW1 3KJPA 3GJ5A 3VKGA 4MH0R 2R7ZH 2WIAA 1DVRA 2VQEQ 1VMAA 1HR0Q 1SXJB 4PC6A 1IW7D 3BJUA 5IYDG 4B6FA 2CVFA 5JSZB 3HKZG 4LHZA 2EQBA 1RYFA 2BOVA 2Q0HA 3EZ9A 1VCMA 5TXGA 4DAMA 2P2LA 5HCIA 1VPLA 4LHXA 1PH9A 1ZC4A 4QRHA 2C99A 5KSPA 1XJCA 2Q2IA 1Z29A 2IYZA 3EZ7A 1OTCA 4C30A 3Q72A 1QHYA 1SVLA 2BH8A 4G01B 1FTSA 4JI4L 3IO5A 4PHFA 2JJ1A 1AE2A 2XSZA 4B3CA 5LPNA 2FDCA 4R4OA 2ATWA 1X6OA 1EX7A 2H57A 2I1QA 4PPNA 4UNQA 3KFXA 4MUAA 2D4HA 2MO1A 1TL7C 3CO5A 4O0AA 2BE5D 4JLBA 4JYAL 4JV5L 1Z6XA 4Q18A 4BLSA 4LBVA 2DUDA 3KJHA 2DFTA 3FHOA 3CCEA 3R7WA 5M5WH 1NN1A 4NTZA 1NMFA 2C04A 4K46A 2PPBC 3K81C 1GL7A 3HU1A 2D0PA 5CDFE 1VCNA 1GUTA 4KBGA 2OG2A 3DL0A 1E9CA 1DEKA 1E2NA 3Q85A 3LBHA 3Q7PA 1PYSB 1YEZA 1YRBA 3UATA 4RD6A 3PGZA 2J1LA 1EFRA 5KOYA 3B7GA 2BKUA 4AK9A 3J81k 4A3IH 1LV7A 1QVAA 3F2DA 3CPHA 4QGGA 4RCZA 1N6RA 4FCVA 1W36C 1LUZA 3FPPA 1PZNA 1KOFA 4BBSG 1G21E 2CBZA 4KCGA 4DLXA 2QPTA 1JJVA 4V0KA 2XGTA 4GN4B 4HIMA 5FBQB 4B75A 4TMKA 2C9OA 3F2BA 2O8BB 5FTKA 2D0OA 5L3QA 1PVOA 2A5YB 5BN5A 1NVVQ 2ZSBA 4NE2A 4D4MA 4DCSA 2CL0X 4EQ6B 1YR8A 1EUJA 4R7ZA 3U3JA 4DR6Q 2ZSDA 4F4JA 3U3MA 3W6NA 2Q2TA 4O25A 5H1YA 2IX0A 3EPLA 5GROA 4JVNA 1G7RA 2W6IA 4ON9A 4D0GA 3R9WA 4TSFD 3CC2A 3C14C 5FLXc 2P3SA 4P4UA 2D7DA 2IS2A 1IN5A 2CJWA 2OFWA 4PFSA 3W3ZB 5FR2A 1OW3B 5JMTA 1BOFA 2WWYA 1NNEA 2WTUA 5AUOB 4Q1AA 5J4LA 1S9HA 1N32Q 3HOYG 2XNDA 3AF2A 4QBGB 4R2HA 1P2UA 4JI7Q 4ZKEA 3B60A 1MABB 2F9LA 1HTPA 4RG1A 1KJWA 5D3MB 2VEDA 4JI0L 2IW3A 3GLHE 2IHFA 1XEWX 2IF2A 2REBA 2WWGA 2MQHA 2FSGA 4A6PA 3M9BA 4EPWA 2GCOB 4DR4Q 3AEZA 5G3ZA 2IEZA 2RHQB 2VRWA 1KDOA 1MO6A 2HYIC 1GVPA 3RS4A 1E0KA 3L0OA 1XMIA 2I5LX 1CFMA 2VUMH 2EWWA 3AVVA 1OFUX 1KKMA 2ZI7A 2ZVPX 2V54A 4P71A 1U8AA 1IBLL 2VHUA 4EKDA 1RRGA 4DDUA 3EBEA 1SXJC 1TEVA 2A1AA 3M1IA 2ZE7A 1N34L 1Q3TA 5EXTA 4URVR 2F1MA 2GTPA 4V0ME 2ZI3A 1O7LA 3N70A 1VYUA 1X9NA 1IXRA 1C9KA 1NN0A 2WIBA 1SVKA 1WDTA 3E9HA 2JCSA 3FHTA 4B2LA 1A4RA 3OHMA 2W2VA 4JZKA 1TF2A 4M1MA 2R6GA 5AUQA 1W1WA 4O2LA 4W7SA 4DR5Q 3GJ3A 4LWCA 3WYGA 5L3SA 4IJHA 2RGBA 4NPHA 2UXDQ 1H9SA 1I6VC 4JC0A 4UP9A 5E7NA 2UXBL 4OQMA 4PO8A 3V9PA 4BGDA 1WF3A 5KYKA 1XNRL 1HE1C 1H95A 2OT3B 3EQLC 1CR0A 1Q1EA 4DR2L 2GXUA 2P67A 1A2BA 3KKMA 4I1SA 3BORA 3KF8B 4GFDA 5GVSA 4BXXG 1UBFA 4GNXC 4JK1C 1ZYRC 2FF7A 2RH5A 3BJIC 4MA4A 3G82C 5L3RA 3TE6A 4JLJA 4A0RA 4A0GA 4XVRA 2IXGA 2XZPA 1CEEA 1N0WA 5IT5A 5CITA 4Y7NH 2VHTA 3BFXA 4NYJQ 4A76A 3AH8A 4FCTA 1R2QA 2VL7A 2KI5A 1NN5A 5LMUL 4PC1A 2DWOA 4WAUA 2O0KA 1T9HA 2XOKD 4LX0A 1IY0A 4YONB 4MDEA 3LWUA 4Z8XA 5IYDH 4NXNQ 1YZTA 2JA8G 2VA8A 4JT4A 3RVBA 4LOAA 3L2PA 3QENA 2IYXA 4EPRA 3SR0A 3QI2A 5FL3A 4OI1A 3CXCA 2CMKA 3ERSX 3UDIA 2IUSA 3TVTA 3NEMA 4JLKA 3I3SR 4Q03A 4CRWB 5EJEA 2B8FA 1LF5A 4HAUA 3NEYA 4QNRA 3SQXA 2PQAA 4C2MH 3NC0C 3VKWA 1IBMQ 1VQFA 1M1YE 3I61A 3QF7A 4JOIA 1R8QA 1HH2P 3GTPH 4K0KQ 3K0CC 1N6IA 4LF4Q 4NBSA 4EUNA 3CB4A 4YMTA 3S15H 3FE2A 1D7QA 5JRJA 4KKTA 5A0FA 2F9MA 5JS8A 2JLUA 2ATVA 1E1QD 2AD5A 2FNAA 3W3AA 4AY2A 1IY1A 1LS6A 2B21A 4KMUC 3DM9B 4LF7Q 3NH6A 1KIXA 3CW2A 1FPMA 1JPJA 4LV5B 3AGQA 1KRSA 4EIWA 2P5TB 4HEJA 2CCKA 4HIDA 4LJ5A 5DISB 3QE0A 1M1KC 1IY2A 2YU9H 1CU1A 1OT3A 1FVIA 1DG1G 3IHLA 5G3YA 1H8HD 3ICEA 1N36L 5AJ3Q 1JEEA 3FMIA 3MMPA 5K36H 2E5LQ 3PV0A 2JIZD 4POFA 3KFVA 1N0VC 5CB8A 4G7ZC 1K5DA 3UKDA 4IPHA 4F4IA 3E0EA 4M22A 4PPQA 4YHHQ 4FIDA 1G3MA 2WPDD 4UQOA 3SN6A 1W4RA 4HJ5A 1ZCBA 3VR5A 3A36A 1EFWA 2NTYC 4PZYA 4UJ5A 4OO1I 1KSGA 3GTQH 4AG6A 2QRNA 3R8CA 1Q44A 1ASZA 4D0LB 4PPFA 2F3RA 1EX6A 2KBFA 4RFSA 4PQRA 2CCZA 4I1OA 2QGQA 1Q90A 1D2MA 3TSZA 1YJWA 2ZJ2A 2JLVA 4DC9A 1T5LA 3K0XA 3BZCA 2ZITA 4A3JH 2ZRMA 621PA 1NG9A 2A9KA 3B1YA 1JXMA 4LPKA 3EA0A 1X55A 3JVUA 4QKQA 2JA6G 2VL6A 1VQHA 1WJJA 3HOYH 1E94E 2F1IA 4ESHA 2XZOA 3MWLA 5F3WB 3J7A5 2WAQE 1G4UR 1CJMA 2ZJ5A 2VTKA 5GQOA 4MGYR 2ZUCA 1OXTA 1HCZA 2ZRPA 4EPYA 5FPSA 2PLRA 4DDTA 4LSGA 5B64A 2QGNA 4LFCQ 2I3BA 1RIPA 3GTLH 4DR1Q 2ONKA 1VG8A 1TQ6A 1GKYA 4KODA 1SVOA 1Z7TA 3IRBA 1AKYA 4OWTB 2ZM6L 1PH5A 1KAOA 2QP9X 1XMVA 3HWSA 4OJKA 3Q5DA 4OQXA 2XZLA 2WOOA 1IYUA 4TVAB 1GVNB 4UNSA 2WMNB 4IXMA 2J45A 4Y0AA 1E32A 3GLGA 4IFDI 3ZVNA 1IAQA 1P73A 4TSFA 3ER0A 1YNJC 1KL9A 1KI4A 1QHHB 2JK8A 2VSOA 1YVDA 3S2HH 3QBTA 3WMEA 3IGFA 2ZYVX 3U4QA 2WHXA 1KO7A 2YINC 4IOMA 521PA 2NVTH 2IYLD 3NBYC 2BMEA 1MKHA 2JLQA 3LDAA 3SHWA 3WXMA 1KXLA 2BCJQ 1G4AE 3QVUA 4RD1A 5L8VA 4DV3Q 1SHKA 1SHZA 4LJAA 4O2RA 1B23P 1SROA 4IRUB 4BBRG 121PA 1SFOH 1T91A 3DVLA 4I1VA 3I72A 1F48A 4JT2A 5DI3B 2ONJA 3FMPB 1W5TA 2ALYB 2RCNA 1RRCA 1GKUB 1KDTA 2WZQA 3KL4A 4IEIA 1EIFA 4GS3A 1Z28A 1M7GA 4CEHB 4JI1Q 4Z8YA 3BOSA 4EFMA 5FUVA 1AH9A 2K14A 1JAIA 3UG6A 4BXXH 3EARA 1S8FA 4DUYQ 2I0QA 2K5HA 4D4KA 3BU2A 3CC4A 2DBYA 4LC1A 4V0OA 1YHBA 4LF6Q 1N5KA 2V4ZA 2BMDA 1FUKA 1XTRA 4A3CG 1HT1E 3KQHA 2EJFC 3CF2A 1FW6A 1MJCA 1Z0DA 4DBLC 1AGRA 3CMEA 2A78A 3L0SA 4Q02A 4A1FA 1DE0A 1KMHB 4CEJA 3TNFA 1MH1A 5C0XI 1W47A 1NTGA 1Q22A 1OPXA 1Z8FA 3ECCA 4F92B 1P16A 1E0SA 1QZXA 2HF9A 4BLQA 5SZIA 1U2RA 2ZIAA 4TZ0A 1Q8KA 1YJ5A 1Q21A 3QKSA 2WSSD 4M21A 3PQCA 4DB2A 3GLHB 1CJUC 1Z0JA 2NZ8A 1YBYA 1VQ6A 4IEEA 4NMMA 4PPGA 2QMHA 1YNNC 4UY8C 4GKJL 2A5DA 3F0TA 4NHOA 3NHBA 4PZ8A 1CTMA 4M9ZA 2O8DA 3THXA 3W5IA 2C2HA 5KTYA 2J5XA 2R6AA 2FOLA 3M4QA 1VF7A 1L8QA 2GETA 4YCWA 4Q4JA 4AYBG 1MT0A 1D8TA 3OAAD 4JLNA 1TX4B 3QKRB 1P9RA 3WNDA 4QJ3A 4PR0A 4LJYA 4YMUA 4GLXA 2NN6G 1QHGA 4B43A 5C1BA 2XOKA 5HPYB 3NC1C 1E2DA 4JMPA 2JQOA 1N0UA 2XEXA 5EP2A 1LABA 3QF4A 4MITA 2B8GA 2UUAL 2QENA 1SVMA 4US2R 3S24A 1K8MA 1IJEA 2ZJZA 3WHLA 2E2JH 1PH1A 2JEOA 4IDHA 2H18A 2X8AA 4K8OA 1Z6YA 4Q4AA 4JKYA 4M1SA 1P3JA 2VHJA 3DKVA 4DCTA 4XIGS 3M4OH 4JVSB 5J47A 4IPDA 4QBHA 4M1OA 1GKHA 2WV9A 3U6KA 3A1WA 1W4BA 3V00A 5A4JA 3VKHA 3I2ZA 3S1AA 4BRUA 5FTMA 3VU9A 2YOHA 4APVA 2QMOA 4DLSA 2XTNA 4MYUA 3JAMc 1HE8B 3VX4A 5JCPA 2AD1A 4WZBE 3ZD6A 1E1QA 3TUJC 3CNNA 1K9MC 1D5CA 2GHIA 4X8LA 1W7AA 4ZIRA 2C5LA 5M3MG 1A6XA 5EE0A 4TQUS 3C8UA 3KKQA 1KAGA 1WOCA 4CZ2A 2YYZA 1XFAA 2WWIA 4M0LA 2WWWA 3U9SA 3OIUA 3A4NA 4NXML 1HNWQ 3PO3G 3CF0A 4LDJA 1XMOL 1K5GA 2Z5FA 4AYXA 1U8YA 4X65Q 5ELOA 4X62L 3PG5A 1R9TH 4MQBA 1H8HA 4C0JA 2ZEJA 3GFPA 3BS4A 4RJLA 1Z47A 4JCVE 3OF5A 3WP0A 1HV8A 2OSBA 2R7FA 3NBZC 2ZU0C 1UEJA 4HAYA 4TL7A 1XNQL 3RWOA 3WYAA 4HB4A 3AEVA 1K73C 2JA5H 1P9WA 2YTXA 4DSTA 1K8GA 1J99A 1ZU4A 5C4GB 1VIYA 3UMSA 4A3BH 4B3RQ 1D6JA 3AUYA 3ZQ6A 5H8WA 3CF6R 4DLRA 3AYHB 4BY1H 1TU3A 2WPDA 4MZ9A 3RS2A 4KU4A 3U7HB 2BM1A 3LA6A 1M90C 4OL0A 3VFDA 3KZ1E 1Z83A 1I94L 2YOFA 4MKIA 1O7IA 1XXHA 3TJZA 4IOJA 1FJGL 2HV8A 1WQ1R 1G9XA 3I5YA 2JLYA 5E95A 3U3RA 3PEYA 4F91B 3FMOB 2YJTD 1VQ5A 4DRZA 2IHEA 4JVLA 1PUJA 2IEYA 2BBSA 3R9XA 1EWQA 3HOWG 2WAYA 1RIFA 3SJAA 4GKKL 3RN2A 3CZQA 4LUOA 1LNZA 2G6BA 3NKVA 4OQFA 4HAWA 3T1HQ 1TWHH 1Z06A 2HQLA 3QPUA 1NJGA 2V8OA 4GRAA 1CR1A 4JSYA 1SKQA 3RLNA 2NO0A 2GESA 4URYR 1J5EL 4PAQA 1JI0A 2RHMA 4KFRA 4RZUA 5G41A 4DIEA 1S1CA 1QBKC 1YZ6A 1SQ5A 1XF9A 4D80A 1OH8A 3SS8A 4AKIA 3TS2A 1N33L 1AKEA 2WAQG 2QT0A 4LYAA 4LF9L 3SNHA 1K8OA 3KQKA 2UUBL 3J80c 3KX2A 2OQ0A 4OJQA 1BDOA 2IF0A 2GBLA 2Y8EA 3TEHB 1GG2A 3SJBA 3VR3A 1RW4A 4OKSA 4URZR 1IXSB 3T1OA 4PZ7A 1DAFA 3T5DA 3HOXG 4L5QA 5KNBA 1OB5A 1EG7A 3BE4A 4A4IA 3KUDA 4DT1A 2PJZA 1G6HA 2RKOA 4CW7A 1A62A 3PF4A 3K70D 5LD2C 2P6RA 2XGJA 1J2JA 3H94A 3KDFA 3GLGE 2K52A 4DR7Q 4JLAA 3CP0A 4JI2Q 1WCV1 2V7QD 1KI2A 3D3QA 4LV6A 4TMTA 1MJEA 1ZNXA 3N5CA 4BFWA 1BYIA 2GRJA 4PO9A 4TL6A 3WBJA 1B0UA 1YZQA 2F1HA 2K4KA 1UBGA 1Z0FA 5IP9G 1Y3AA 1OXXK 3AFQA 2ZTSA 4FDBA 3MFYA 3Q8XB 3PCOB 1H65A 5FTJA 4G5OA 4DIDA 3OTOQ 2IHYA 1ZNWA 3I4MG 4DV0Q 2F43B 1E4VA 1PLKA 2C03A 4NP6A 1E2FA 4DV2Q 2ZRNA 5A5GA 1GDDA 3OEHD 4B2PA 2G77B 4HAVA 1GFIA 4IOAA 2KSQA 3NH9A 2VQFL 4DNRB 1JNYA 4PX9A 4ALPA 2AR7A 4QBIA 3A8TA 4DLYA 2Z4SA 5FBVB 2ZSEA 2O8FA 3A8KE 3RANA 3AVQA 5GADl 3MD0A 2E75C 2K32A 4IPGA 5D3QA 1T5EA 1OF1A 1G7TA 3QOFA 1NE3A 4H44C 1QVGA 3W90A 1OB2A 1N5IA 2A5FA 1VCOA 2AXPA 3H15A 2C78A 1G51A 1KI6B 1TMKA 2UVQA 2O5VA 1P5ZB 2PLFA 3LW8A 3B9PA 4M1YA 4XSGA 3UMFA 1NVXQ 4P0TA 2WSSA 2ZI9A 3VA7A 4GMXA 1ZRHA 3G4SA 3UE0A 3P4YA 1DO0A 1KK2A 1E1OA 1TQ4A 1UFQA 3O8DA 1L1OB 4B3ML 2CHQA 2RB4A 4MKHA 4CEIA 1M2OB 4ILEA 4Q01A 2QF7A 3MCAA 1RC8A 2V9PA 2NGRA 4CEHA 2YHSA 4EX5A 3SJCA 4UJ3A 4LF5Q 3KF6A 4JI8Q 2ZE8A 4GMDA 3EIHA 5K8TA 3TLXA 2F55A 1NJIC 3W5JA 4A3IG 2R2AA 2PZFA 3OAAA 2FZ4A 1PH3A 2YC4C 4C2UA 1VQEA 3TH5A 1CSPA 3OW2A 2MSEB 1KZ7B 4I99A 1AE3A 2WICA 4MGIR 3ULJA 3FTQA 4BLOA 2FZLA 2KWIA 1Q12A 1LTQA 4HSEA 4O2DA 4OWXB 4DV4Q 1MKYA 4O3MA 4LBYA 1VF5C 3STBC 1Z22A 2ZRDA 3HU3A 3GLIA 1ZVQA 2QL6A 2GZAA 2HXYA 1CKNB 1XEFA 4PC3A 1PH8A 3T35A 2N49A 3C5HA 2QAGB 1EWIA 1JR3D 3ZVRA 4LK1C 1EIYB 3BWDD 4EFNA 2JA9A 1FNMA 1OXVA 2WJHA 3KXLA 3CRRA 1J90A 2HJVA 4KVAA 3KLWA 1QHSA 4HJAA 1L0WA 1G3QA 4OO1H 2OTJA 2MMGA 3OZXA 2IX1A 2CDNA 2QAJA 4DR2Q 4G3XA 4KV9A 4Q66C 3AVYA 1G8FA 3FVQA 4DLWA 2H1LA 2WVJA 3EASA 1EFHA 2XB2A 2WB1E 1FGUA 1NMYA 4YDHB 1QHXA 3C4JA 4GLAC 1Z0AA 3SI7A 3QUSA 2RGDA 3QBVA 4EAQA 5FLMG 2HT6A 1D8LA 2CHVA 2E87A 2JE6I 3AVOA 4LWZA 1TKWB 4TYQA 5H70A 4C0SA 4D6PA 2ZJAA 4EDHA 3O8RA 2OAQ1 1JT8A 4E03A 3HOWH 1OFIA 3EN2A 1G6OA 5EE5B 1HT2E 1NRJB 4GL2A 5KPDA 1R5NA 4L8JA 3EWAA 4IDPA 2WBLC 5F9HA 4RVCA 5JHHB 5DH9A 3TW8B 4A75A 3QG5A 1XEXB 1M74A 3W1GA 2NO1A 3QEOA 3UK6A 3TKLA 2Z0SA 1JQJC 2OAP1 3FP9A 2VP4A 4GOKA 4AKEA 2W2TA 3ZS8A 2GEVA 1OH5A 1E98A 4P33A 3TVDA 4IKEA 4FMCF 4YWMA 4NYIR 2QI9C 5JEAG 2CLCX 2VF8A 1SE8A 4RCYA 4MYHA 2A6HC 2FFQA 2PQAB 4LJ4A 5FI0B 5JWHA 5C18A 3TK1A 4C7OB 4GPTA 3ND8A 1OKKD 4OXPA 4IFDH 1TUIA 3ZZTA 5IY0A 4B3GA 3GTOH 2D3WA 2ZJQA 5C3EG 4OX9Q 2J7PD 4ESVA 3I92A 2OXCA 1WA5A 2HHHQ 4RMFA 3CD6A 1B7YB 3T1YL 4KKSA 1UF9A 1N3BA 3MSXA 4JVMA 4GOPC 5BR8Q 4C0BA 1COWD 4DV7Q 3T1QA 1W36D 1EFCA 3M4PA 1R4AA 2XB4A 1Y1VH 4M2LA 4OK3A 1E2QA 2I5MX 4RFVA 2GAAA 2JLXA 3CRKC 5FR1A 1L2FA 3L7ZC 5JEAJ 1GM5A 4AQYQ 4KSCA 4PAOA 2A68C 1L1OC 5IP9H 3RZDH 1Q57A 2GVDC 4DK3C 2OLJA 4KAXA 4OQNA 5TVKA 3UXMA 4DUZQ 1QZHA 4BY7H 1S0UA 1KK0A 4ZDKA 1A1VA 2W0MA 1E2GA 3I4MH 2OESA 4MGZR 3HYTA 5DHFA 1EFUA 4HJ7A 4NYIQ 1KQSA 1HA3A 4KN4C 3KTAA 2FGKA 1MO3A 2C9YA 4M1KA 1X1SA 3ZJYC 3CCUA 2YNMA 4ARZA 5CM8B 2YC2C 4GI7A 4J0QA 1SMXA 1KNXA 1NJFA 1R0XA 3QEJA 2ECKA 3ULLA 1QRAA 3AGPA 4JBWA 3IILA 2ZRLA 4HLCA 1P9NA 5C0XH 1FOEB 2CXXA 2V7QA 1KY3A 1II8A 5AUNB 3CIOA 4B3FX 4IPCA 1DAGA 1Q86C 2GZHA 2QAGC 2QSYA 4U00A 3NBXX 1WB9A 3K80C 3CNLA 1U9IA 1ONLA 4HZUA 4OONA 3GMTA 5A35A 4DNIA 4RY2A 1SR3A 2IYWA 4NYMR 2WWHA 4LFBL 4TMVA 1Q46A 1R0YA 1KHIA 5G40A 4TZ6A 3KB2A 3BGWA 3KXKA 5DLQC 2RMKA 4DVGA 1SXJD 3ZZUA 5C46F 2OEPA 4Z1MD 2PEYA 4NCIA 4URXR 1ESMA 3OEHA 3H0KA 1ZM3A 5IWAL 3CCMA 2OILA 3LAWA 1E9DA 1A0IA 4KHZA 2FA9A 4LJZC 1JJGA 2V6JA 4LJ6A 3CAMA 5K36G 2I4IA 2ZJOA 4DK0A 3NG1A 4A2QA 3FHWA 4CF7A 1A5TA 5BN4A 4J15A 1WE2A 1FFHA 3KKPA 3L82B 1U0HC 3PUZA 4HAZA 5BQ5A 4DB4A 4YQFA 3IO3A 4QIWE 3I4NG 5LMNL 1ZM7A 1B9NA 3K0SA 3BB3A 3A4MA 3ZYCA 4EQ5A 3CUEF 1HYQA 5C4JH 5EP4A 3DMDA 4PMWA 1ZUNB 3L0PA 1HNZQ 1G7SA 3UG7A 2YWFA 3NBHB 2E9SA 2BIFA 5FOSA 1YZUA 2QA4A 3L2OB 3W6PA 4DDWA 4BFSA 4A3JG 1S1MA 1PJRA 1DTSA 3HGBA 1E79D 2KCTA 5EAYA 3DPUA 3K0AA 3QKUA 3O8CA 4LJ9A 2XTZA 2RGCA 3OFND 1ZKOA 1E7ZA 1XZPA 2H92A 2E76C 1G291 4KHPQ 2LKDA 2ZR0A 1PMRA 4R98A 1XWIA 2NPFA 1XJVA 1QVRA 4LF8L 4HLUA 4QC2A 1WFQA 2ASEA 4QOSA 5BYJA 3HYRA 4DV6L 2CNWD 2KHJA 2QRZA 1D2EA 2WP8J 5FLMH 1IBRA 3T06B 3NE5B 2QMUA 3TSOA 4PAMA 3ONWA 1WXQA 4L9SA 3A8JE 3SFZA 3TGPA 2AUJD 2BEJA 2ERYA 1VDZA 3RLOA 1BYUA 3O8BA 4PHTA 2D62A 1JXOA 1E2HA 3RNLA 4G7HC 1ZBDA 2ZRIA 1GHKA 2QQEA 3LVQE 1GIAA 2KCCA 1ZD8A 1GJXA 1LF0A 2EFGA 4CEJB 2AMCB 3AKDA 1JR3A 1MV5A 3ZQJA 3GLIE 2HDNB 2JATA 3VR4A 2B92A 2JA1A 1RE0A 4US1R 3S16H 1IQPA 1E96A 4YY3L 1X86B 3MG9A 4ZO4A 4BASA 1GUOA 2IWRA 4BWYA 4IVRA 3FOZA 4GKJQ 3QKSB 3DZ8A 1QG2A 4A15A 3HPRA 4R71A 4HB0A 3AKYA 1KI1A 5JEAH 2VPPA 2EIFA 2OM2A 1W46A 1DCZA 8OHMA 5JWRA 2MMCA 4IJLA 4JI6L 4QJ5A 1A82A 4US0R 2PMDA 1HH4A 3IDQA 2GA8A 3WDNA 1H8ED 4JI3L 5CYPA 4F93B 5C3EH 1ETUA 1W0KD 3QPVA 3PIPA 1T4GA 3CR7A 3LX5A 5FPYA 3ASZA 2WB1G 4Q5IA 1BH2A 4Q4HA 3VNVA 1ZM9A 4P72A 1G16A 3TREA 3AF0A 4B76A 1N9WA 2VY3A 4AYBE 4QBFA 3Q7QA 1XNJA 1H9JA 1RJ9A 4L8GA 5FOTA 3Q3JB 4OHZA 5SZHB 2UZIR 4NCHA 5EE9A 3RNUA 3EAQA 1IBKQ 1TF7A 4PHGA 4B73A 1Z5ZA 1GUGA 4GN3B 2ZU6A 5CIWA 3MJRA 1E2VA 1BBWA 2VW9A 1OXSC 2AWNA 1DS6A 1HZAA 4LBWA 3RC3A 4B33A 4X64Q 2PT7A 2BDTA 4YMWA 3OOCA 3KDSE 2J0UA 5J4KA 3THYB 1X8KA 1DAMA 4IJMA 5GAEC 5M04A 4OHVA 4BFTA 3IIJA 2EU8A 2B29A 5TMPA 3KQNA 2Q3HA 1P75A 5FUYA 4XD7D 2IY5B 5KU1A 1OKKA 4DV1L 4N0EA 2V4DA 1E9FA 3S1AB 2J7PA 1CIPA 3VU9B 5LMNW 4LUZA 2G1JA 3DOFA 4A3DG 2WJYA 3GJ7A 3R9IA 3H0GG 4NPSA 5IYBH 1XMJA 2ZR7A 2ZS7A 3JAMi 1ZJ6A 4KLNA 1COWA 3KQLA 4F38A 3CPWA 1YHQA 1DOAA 2DGYA 1W44A 2DPXA 2F1JA 5HE9A 2JJ2D 2BCGY 2RHSB 1IONA 5EP1A 1CKMA 1XMOQ 2NIPA 4ZV4A 4DEYA 4CDGA 4X62Q 3FHCB 1KO8A 3U60B 3S14H 3F2CA 1RRFA 4B3SL 4BEJA 2ZJPA 2IWHA 3LRPA 3K09C 2CW0C 2OCBA 4Q21A 4Q48A 2RGNC 4JLDA 3DXJC 5J4HA 1BKBA 1NVUQ 3I8XA 3R8FA 1US8A 4LGMA 1V9PA 3G6EA 2ZUDA 3WMFA 2IYTA 3CR8A 3L8YA 3NHAA 1NBMD 1P62B 4JBYA 5GADC 2LMCB 4L9WA 1AQUA 4X66L 3N2IA 1J7KA 4A3GH 1W0JD 1Y63A 4DKXA 1D9XA 3M6AA 5E7MA 3TIFA 1I94Q 2BEKA 1UE6A 5BW8A 3CWZA 4KBFA 4DZZA 4JBMA 5CK4A 3HOVH 5CLLA 1XBTA 1NMGA 1XXHB 2NOAA 2BBWA 1K6MA 2G1KA 1OIVA 2P5SA 2EFHB 3KUCA 2ZRCA 4JLMA 3VTKA 4XVUA 1CS4C 3PFIA 5B2ZA 1E9EA 1X6VA 3DEFA 1IJFA 1F2TA 1L7VC 3I4NH 4GKKQ 3LY5A 4IVPA 1B8AA 1HQMC 1F3OA 4ASUD 3CM0A 3CQZH 4V0LA 4B3XA 3BK7A 4M9QA 1G6PA 3LXXA 5DIFA 4YWLA 4HLQB 4C3JH 3UDGA 1E0JA 5DYGA 1J5EQ 4WA7A 2UKDA 4E22A 1ODFA 2HXSA 1VHTA 5EZ5A 4YMVA 1SXJA 2NO9A 4DCNA 4Z1MA 3S17H 3K7AH 4R9UC 3PUYA 1AS3A 5FL7D 1N33Q 5JSZA 3T1TA 2VQEL 3MWKA 5DN6D 1AGPA 1HR0L 4AYTA 1E2IA 4KO8A 3FKIG 5M5YH 2E1RA 2W58A 3ZVLA 1IXZA 5KO2A 5J4YA 3R20A 1VQ8A 4XVQA 3M4YA 2PI2A 4DSUA 1M7BA 2BDOA 3LXRA 3NBFA 4LYJA 5J3BA 4Q7JB 4ZDJA 4AIIA 1JR6A 2BBTA 2JA5G 5HGQA 3J80i 4POGA 1OLOA 1NLZA 3GFOA 4TTQA 2E74C 1P8LA 3JZAA 4A3BG 1IN6A 1HURA 2QROA 2P65A 5IRCD 1WYDA 4BY1G 1UE5A 1OH6A 1X3SA 3X2SA 1I4LD 3J7ZC 2VLIA 2GILA 2B63H 3S1MH 5IP7H 3CNOA 3IEVA 2LSSA 1AN0A 4XWKA 2DY1A 3JC66 4GNXA 3OYYA 1SVIA 2GJ8A 3LBNA 3P26A 5FUXA 5LB2A 5SZJA 2W00A 2D7CA 3NELA 1AS0A 2YOGA 5JCZA 1F2UA 3FWYA 1HJPA 5KPJA 1U5KA 3B6YA 3LQRA 4NU0A 1O87A 3F1ZA 1E79A 1OE0A 4UNRA 4A0HA 3M3YH 2W2XA 2F3IA 3OFNA 2PEZA 1T6NA 2RHDA 4PHHA 2FE4A 2WKQA 4DHEA 1SRUA 3BDOA 5JBQA 1LM0A 2W0SA 2GXAA 4KFUA 4HLDA 3RRYA 2SHKA 4FN5A 2WOJA 4W5HA 4BZQA 5JEEA 1TTTA 2CNWA 4A8JA 1XZQA 4C3HH 2HIXA 1KO5A 2HCJB 1VYVA 3F3YA 4FWTA 4JJKA 2DCUA 2JDID 2GJSA 4TYPA 2CWPA 4TQ9A 4WW0A 3NVAA 3QQ5A 3RHFA 1DG3A 2YV5A 2MFIA 3U5ZB 4Q9HA 2HCBA 4EQ6A 1LTLA 2H8KA 4UXIA 1Z6HA 4BEBA 1JBKA 3BB1A 1DPFA 1KIMA 3NWJA 3E9IA 3K0CA 4G7OC 3GJ8A 3LNNA 2ZSAA 4QJ4A 1N6NA 1N6OA 4DR3L 1I2DA 4DAYB 3EWSA 1IYJB 1J8YF 4DR6L 3A0JA 2VNUD 3K9GA 1S4QA 1JR3E 4AIMA 3A1TA 2ZRJA 1JE5A 3TQCA 1KTVA 1AK2A 2FJUA 3D6TB 3TR5A 4RCNA 5GVRA 4H1UA 1Z6GA 2C95A 1CJKC 1I3QH 3Q9LA 1CR4A 1MABA 1XD9A 3K1JA 4TYYA 2W6JD 1UWVA 3E70C 2I5HA 2A69C 1VQDA 1N32L 3RLFA 1CTQA 3I4LA 1JALA 1H8EA 1K8RA 1KNQA 2R65A 1A2KC 2FN4A 3IFTA 3CX8A 3F5FA 1Z08A 3H86A 4JS0A 4ZI3A 2GCOA 4A3DH 1G64A 2FFAA 1R6BX 3H0GH 3KF6B 3LGJA 1XCMA 2FPLA 1X3FA 1ELOA 4DLTA 1M8PA 3OIVA 2UU9Q 5AJVB 2GK6A 3PXGA 1X65A 2ZRBA 3OIWA 3QVVA 5C44H 3BZKA 5AJYA 4A36A 4QL3A 5GJWC 1Y69U 2O5IC 1GRQA 2ZS8A 1KSJA 3PIRA 3PVSA 4UXHA 4AWXA 3PEWA 2J3EA 4FMDF 3KLRA 2DFLA 3QXJA 4HDQB 2GF9A 3IQWA 4Q1DA 3UMRA 1NY4A 4TWZA 1B70B 3IIKA 2PZEA 1ZP6A 2OWOA 2Q21A 4PZLA 1TWCH 2UUCL 3GLIB 2F52A 3UDXA 5AUPB 1TPZA 3EIVA 1Q82C 1XB2A 1R5BA 4IW3B 1XTIA 4L15A 1FZQA 4OHXA 4CVNA 1YNXA 4WJ4A 2X1VA 1NY5A 4XD7A 2V3CC 3PJRA 2R8RA 1T3SA 3CX6A 5FOUA 2J0QA 1F6BA 5J4VA 2VS1A 2UZ3A 2IL1A 1SLJA 4OHWA 4PQYA 4E07A 1GL9B 3TAUA 5KUTA 2F4VQ 2ZANA 3EZFA 4WIAA 2DWPA 5LBIA 4A93G 4DR5L 2H5XA 1DAKA 4Q4LA 2OCPA 2WKPA 3BH7A 1FQJA 4XTCS 2ZI5A 2UXDL 4HZIA 4KFSA 4TLEA 4V0NA 4DEXA 1VG1A 3Q8DA 1VQMA 3KJGA 4QG7A 1PUIA 3I7FA 1PH6A 4P4SB 2JJ2A 3ZGXA 2GKSA 4RSGA 4RZXA 1KKLA 3JZMA 2N8NA 4HB2A 1AM4D 3A1UA 2HIVA 2PX0A 3UIEA 4IOCA 2A2ZA 1HZCA 5KDLA 2QEXA 3K7UC 2IYUA 5GJVC 4C0AC 2WJGA 1NKTA 1TAGA 2GDJA 4JLPA 1ZIPA 3S1RH 1A8VA 1E2EA 4GT1A 1XCGB 5F98A 2XJ4A 2UXCL 1NBMA 2J87A 1GNRA 4TQAA 2AKAB 1TADA 1DADA 1W0JA 3IBYA 2PBRA 4S2EA 2K5VA 3FKIH 1OV4A 5CIQA 4NXNL 2P6UA 3TQFA 1L4UA 1E2KA 2REOA 4LUCA 4UP8A 2ES2A 4IQZA 1NMZA 1EWRA 1NBWA 5JJIA 1WRBA 1Z2CA 1ZD1A 2JIZA 4W5WA 1VTKA 2A8VA 2VYFA 3C16C 3E1SA 3EZ6A 4OWWB 2V6IA 3QG1A 4JI5Q 2GXQA 1W4AA 1HUQA 4GNKA 4OO1G 1ZC3A 4FMBB 4H02A 5HZHA 4A3KG 3K8AA 4IFBA 4WXRA 4EPVA 1IBML 2Q2UA 1TEXA 1DD2A 2DNCA 2LCFA 4ASUA 2E2IH 2A5JA 3AUXA 3FB4A 4YDSA 2N46A 2QT1A 1M6NA 1CUKA 3N2EA 2PMZE 3B13B 2ZXUA 1NN3A 1WBDA 1KRTA 1FMJA 4B48A 4L5TA 3AP2A 3B1XA 1RL2A 4FXPA 5FL7A 1ZNZA 4GZMA 2QM8A 5DN6A 4B34A 1IOZA 1SXJE 3BH0A 4TMWA 421PA 2CL6X 1UADA 1KYIA 1YR6A 2CL7X 2GZDA 2XNSA 3ICQB 2GEUA 2D74A 3K53A 1RKBA 1OYYA 3VMFA 2CFMA 1FX0A
chains in the Genus database with same CATH superfamily
1AHPA 3OQPA 3S28A 2KENA 3AINA 3V8RA 3MHTA 3SXJA 2WB2A 3AF3A 1TWGH 4H3KB 3HFGA 3PKJA 4PLVA 1QK5A 2O2JA 1V1PB 1FXWA 2FV8A 3GP3A 3SSMA 3QUAA 4OP1A 3ASVA 2YIJA 2FSSA 3CKMA 2F7SA 3IRUA 3VR2A 4C0QC 5LZ8A 2V7EA 3HVRA 3NFRA 1V1JA 1RNLA 3H91A 3GVIA 4E08A 4UTNA 1FFBA 2BMFA 3OHSX 3D8RA 2R97A 1DP4A 2Z0MA 4HJ9A 5FDFA 4LF6L 3JRWA 2FWAA 4KKUA 4IUPA 3G9QA 3AZQA 3H09A 4YMSA 5L53A 2JARA 2CLFB 1JHVA 4ZCTA 2P9HA 5JVG3 2KHIA 1QIEA 3FYUA 1TJ4A 1IZYA 5B36A 1FP4B 3P9KA 2A68D 1EY8A 1TIPA 2G4VA 1H9SB 4B9EA 1KKUA 3EIOA 4HQKA 2Z6BA 1JQYD 2BSXA 1GL6A 1RHQA 1NBME 4L2IB 3HU5A 3SE0A 2Q3MA 2KA7A 2WJWA 3DHWC 2PAFA 3T1YB 1GRVA 4RMIA 3MAGA 1IL2A 1QYDA 3PWKA 1BFUA 4BP9A 2Z43A 2XRFA 4TTIA 2WVHA 1Z7EA 1HEIA 1U5BB 4N1AA 1XJ5A 4MYSA 4P98A 4TWJA 2RHLA 3BIWA 2PX4A 1ZJZA 5IT9E 1Z8HA 5DNDA 1XTKA 3PGMA 4I5FA 3QTBA 4MVJG 2X9NA 2FPGA 4KYUA 3T52A 4EUEA 2DNEA 5CR3A 4LFBB 1VPTA 1Z4QA 1NVAA 1YFJA 4FI3F 2K5UA 1XD8A 1EGHA 3A25A 2P9EA 2QJFA 2ZXFA 3FY4A 2FX2A 4YRMA 3ANSA 5IT9c 3UPDA 4DDKA 1F8UA 2JD2A 5LMNB 3EJIA 2I54A 4OHBA 1TTQB 2P9QA 1NYTA 3OH8A 4ZK9B 2G71A 1CD5A 4BA2I 1EL0A 2YX1A 4M7RA 2MNAA 3TZDA 3FF4A 5KZMB 1IN8A 3BZWA 3SEZA 3HOVB 4YUZA 2B3GA 1CW2B 3HO8A 3GFTA 2QMZA 1N6HA 3NTIA 3SEAA 3V4PB 1ICEA 5A0TA 4Q9LA 4A3JB 3MM4A 4DRXB 2G1PA 2WJ3A 5LDHA 1PV2A 2B8TA 1O6GA 2B4YA 3OTIA 1JG2A 4F21A 2Y0EA 3LHDA 3S2HB 2OV6A 3BXXA 2WQ7A 4RL6A 3C5CA 4BJ1A 5J39A 2ERCA 2ZYUX 4PTLA 1Q7YC 2CLDX 4GKAA 2GVAA 4XGRA 5DMXA 1QKIA 2L55A 5CYOA 2JCVA 1ZPDA 3A4IA 4MVJH 1HA5A 3CX7A 4Y6SA 1DC8A 1XQ1A 2EKLA 4M98A 4P53A 2NN6I 4P4GA 2QL7A 1SCQA 2XVSA 3A37A 4RLFA 4IEFB 3MUFA 4I9NA 1ENZA 3HB0A 3V1KA 5C44B 1SQSA 1S72A 5ENVA 1K3RA 2ZJFA 2FHTA 4MI6A 2XMQA 3IQDB 3K5PA 1YMVA 4CNQA 1B73A 1I50H 1ZSYA 2IYSA 2C4HA 4RDXA 2PO5A 1U80A 3T53B 1UDXA 2CCGA 2AUNA 2K05A 4QBTA 1XNHA 1GNQA 3OJLA 3KDFB 4BNTA 2JFVA 2XF8A 4YPVA 1WXHA 1UOPA 4PYMA 1E0AA 3WAJA 4TMXA 4JODA 1XJQA 2AL7A 1W5FA 3AG5A 1DB3A 1GAQA 1GNSA 1XGKA 4OQLA 3AHFA 3KB1A 4BMVA 1A88A 3T15A 1KEWA 4ZQBA 3VR6D 1YIDA 4XDYA 1EZ6A 2DMRA 1DCTA 2C8VA 3K09A 3ESQA 2RD2A 2QUZA 3HS0C 3F6EX 1NVTA 2VHWA 5KAPA 3FPAA 2XI4A 4DK6C 1N7IA 5AI0A 4B6OA 2JVJA 4XYMA 3DOHA 1CQJA 3NT5A 4GBED 2Z1NA 2BWJA 5C5EA 3W7AA 4R4QA 4CKCA 4P75A 4FDUA 2CUNA 4LC0A 2K5NA 4LYFA 3PJFA 1EXMA 5G2OA 5IW8A 4BE7B 5I4DA 3ZNNA 1V95A 4CPDA 2PYIA 4UEKA 1O77A 2JJQA 3H84A 3VR6H 3NC4A 1TJNA 3R77A 2FPWA 4R69A 2I55A 4BFZA 4O0MA 1Z9FA 3AR7A 1EK2A 5GQSA 1Z4JA 4BQSA 4AX4A 1VI6A 5FCDA 5AXCA 4YWKA 3B78A 2O54A 2HUGA 4ROSA 4OQQA 3Q23A 2HU2A 1Q1AA 3TLBA 5DNCA 4U02A 4IDBA 4P83A 2PX5A 4PV1C 1H22A 1O97C 4DJ5X 3SZ3A 1B93A 4KO1S 3BHMA 3VYTB 1JPUA 2ZRFA 1A7KA 1V3UA 4XCQA 1NI3A 3F78A 2QN1A 4X8OA 3DG9A 4MQEB 3HVHA 2FXQA 1LSOA 1HQYE 3GJ4A 4ENUA 5E4WC 5C4IA 1VA5A 1YQGA 4OGKA 4JYPA 5FULA 3FDIA 3QJYA 1PSDA 4KV6A 2AKYA 3UAZA 2Y0SG 4BRZA 4R5HA 5CCXA 4QDJA 2QZ9A 1WTCA 5KDDA 2BKEA 3KYBA 4HQNA 4PYOA 1E9BA 4X3OA 1MEEA 3STXA 1V4BA 3OQVA 4X8MA 4NC9A 3CXUA 4PGHA 1QJOA 4LZAA 1TWFH 1U1IA 1QRUA 4JBJA 4BX9A 4PYLA 3SXPA 3I1JA 1TS4A 3RYTC 3HY3A 3WGUA 3V1MA 2H16A 2DKOA 4JBXA 1A0OA 2ZWPA 3AIOA 5M3MH 4QUEA 1EHYA 3AP1A 2GN1A 1DELA 1ZJJA 5IJAA 5BRJA 3G79A 1WEKA 2IXEA 5C4XB 3TBFA 4COOA 1HWYA 1NNXA 1MRNA 4QY7A 1DXMA 4H1VA 1RRPA 1QAQA 5IYZF 3GEHA 2P69A 3N39C 4RZ2A 4X1KB 3C2QA 2VZ8A 1WBBA 3DXYA 3L92A 2J7KA 3SZGA 1AH2A 4ZYSA 1IHZA 4BHTA 1PT7A 4XX0B 4MAFA 4J49A 2IBMA 2JA7G 2FFHA 4C3OB 1E7YA 5ELFA 3B9RA 4EHDA 3TZ6A 3UWMA 1M1YA 2FMUA 1KC3A 1VYTA 4ZPJA 3S4YA 1KP3A 5JQGF 2EY1A 3FDFA 3KJPA 1T24A 2OXFA 2IZZA 5J5VA 5G1NA 4JKOA 1LPNA 3EZ9A 4QRHA 1MP0A 2C99A 5CTAA 4LN1A 3IQZA 1Z29A 1FTSA 4JI4L 3CINA 1H0RA 5FLXE 2VR1A 3BWBA 3VSDA 3B7WA 3GEGA 4KLCA 2DUDA 3KJHA 1U0RA 2DFTA 3FHOA 4NTZA 3G8BA 2PPBC 2QZJA 3Q7PA 4CV2A 4GLJA 3B7GA 2O5EA 2WINB 4YV2A 1QVAA 5CVDA 1LUZA 4A3GB 3NNNA 2QPTA 2V7XA 5DEHA 2A5YB 1YRLA 1EVIA 4MV8A 4YRFA 1SUPA 2H2DA 4ON9A 3R9WA 1JGTA 5ESRA 5FLXc 3JAKB 3IIIA 1BOFA 5J4LA 5AM0A 1N32Q 1E6KA 1ZN9A 3HOZB 1SC4A 2OZLB 3PI6A 5E2AA 1TM3E 2EFYA 4EPWA 4RXUA 2PFKA 1VL2A 4B8YA 4MCJA 5M5BA 3LQFA 3AVVA 3EVGA 4ES6A 5H02A 4Q4CA 4Z2AA 4V0ME 2AQ2B 1VYUA 1X9NA 3AL2A 4Q3BA 4X92A 1IU9A 3QO2A 4BGVA 4GBJA 4OQMA 4C78A 4WLNA 4ZJZA 3W78A 1ZYRC 2FF7A 3KEOA 4MA4A 3G82C 5L3RA 1CEEA 4A7PA 3OIFA 5HUJA 1Y6GA 2KI5A 5GM1A 1BF4A 1PKXA 2DWOA 3TW8A 4H7BA 4RHUA 2BEVB 3A7EA 1O95D 4NNOA 4JA0A 2H59A 1TM2A 1VQFA 2IXDA 1LT5D 2F4NA 3FZEA 2FMCA 3GTPH 3BD8A 4WZBA 3OO0A 3R8XA 2I87A 4S1PA 2AFVA 1XMQB 2SOBA 4EQPA 5CNJA 4KKTA 2JLUA 3DZHA 3C7AA 3LU1A 2YVLA 2RHBA 4AQYB 2P3OA 4L8FA 2R79A 4EIWA 5DISB 3RYCA 2YW9A 2K03A 4LXYA 5DVZA 5IFKA 5CB8A 3CBGA 4ZU1X 3OPYB 3P97A 1SJED 3ITKA 4ZVUA 4HXFB 1C3XA 2XCSB 2WM3A 2I4NA 4V1CA 5AM4A 1J21A 5FBHA 2PMBA 4J0DA 3OTQA 2C1EA 2XKAA 4KQ2A 1K66A 1AKVA 1HSZA 4N5DA 3V7NA 1JILA 4NMXB 1Q6YA 1N9GA 2QGNA 2QQFA 2FDXA 1GKYA 2V7WA 5LQDA 1KAOA 2ZM6L 4LI3X 3B3JA 2FETA 3GLGA 1KI4A 2OD9A 2WG0A 4EENA 1KR2A 2APJA 1ABBA 3JQFA 1STEA 4AJHA 3KL4A 5TGTA 1BQEA 4JI1Q 1CY4A 1G8MA 1Z2OX 1L5FA 4DR4B 2I0QA 1YHBA 1C7RA 2XUHA 4OV6B 4L76A 2BMDA 2QVCA 1XTRA 5JH7A 1NQAO 1MJCA 4R2WA 4FLMA 3L0SA 1H4QA 1TWGB 5MN4A 1GCOA 2PPLA 1K2VN 2HF9A 1EY0A 2FN9A 2F3PA 4UPEA 4E3WA 5KNLA 2NVXB 4M9ZA 4RGVA 1PNQA 2FOLA 4HFRA 4QJ3A 4R8IA 2CFSA 3NC1C 2FSUA 3ZNQA 1LABA 4X64B 2VJMB 2B8GA 1SVMA 3JQ6A 1PH1A 2WIDA 5FF9A 4DCTA 2W2PA 3MMSA 3GDWA 1Y81A 2P3QA 1RSZA 4MDYA 4UUAA 4CDRA 1PKEA 4ZQFA 5IH3A 3B48A 2FUEA 3K9QO 4LHSA 2WWIA 4W5TA 3PG5A 4FFVA 4MQBA 5CDYA 2ZEJA 3GFPA 3BS4A 3LSYA 4QZVA 4TL7A 5I6WA 1MHTA 2CW5A 1VE6A 3AFGA 1ZJ5A 2P1ZA 1J99A 3MJDA 4G89A 3RS2A 3EEQA 3LA6A 1URPA 2Z3VA 5CR9A 3AFIA 2EX0A 1MG0A 3I5YA 3STHA 3WLPA 2RHTA 1JHAA 1NT2A 2HSWA 2HQLA 5DHRA 2V8OA 1NX6A 2RFLA 1SKQA 3RLNA 2RHMA 5LHY1 3FSGD 1K8ZB 3KO8A 3AB7A 1GEEA 3F2IA 4LFCB 5K8JB 1RW4A 4OKSA 5AQEA 1EG7A 1OZGA 1QTNA 2PKXA 4BFWA 1YVRA 1IATA 4X44A 4IG9A 2IHYA 2VQ6A 2C03A 1E2FA 3ES9A 3OEHD 3QFFA 4JB0A 5AVTA 3P71T 3OT4A 2H2AA 3SSNA 1K4YA 1CY0A 2DUNA 3CT4A 3W90A 1VCOA 1VGVA 5EKKA 5HS6A 5GONB 2NYZD 4GMXA 4NEHB 1X7XA 4NK4A 4F1KA 4E15A 3SJCA 1EFDN 4GMDA 5AI9A 5CW1A 4HBGA 3TNDA 2PJDA 1KZ7B 5TX7A 1IAVA 3ULJA 2NSHA 4G2NA 1N2HA 1NVEA 3VAZA 2HXYA 3T35A 3ETNA 4WJKB 2XVYA 1P91A 4HJAA 2MMGA 2P8SA 4B4KA 1NA5A 5L7WA 3EFOA 4A26A 3SQMA 4WBNF 5IFLA 4AZ0B 4GLAC 3QBVA 5FLMG 2AOWA 2AOXA 3D8TA 2F8SA 4EDHA 1L7PA 2KLHA 1C4QA 1G6OA 2FPOA 5EE5B 1R5NA 3EWAA 1WCWA 2EFJA 1PWZA 2CDBA 3RYIA 1KFCB 1JQJC 4MQ4A 1CUDA 3ZS8A 1E98A 4YWMA 1YDWA 4JP8A 3DKKA 2PQAB 1EP1B 3Q9UA 2VCYA 3GTOH 3FTPA 5E0OA 3T1YL 1NR7A 4X3SA 3KQNA 3W2DA 1HE2A 1P1CA 4BWFB 3H6KA 2JFWA 4ZQCB 4KSCA 2A68C 4OQNA 2UYHA 5A4IS 1A1VA 3GT4A 3J80L 2E2WA 1RWMA 5CM8B 4HAEA 2QX9A 1TT2A 4IPCA 4BNHA 4XVCA 4OQPA 3LX6A 4H18A 1PFNA 4HWGA 1SR3A 4NYMR 4LFBL 4PGMA 2F3WA 2PEYA 1EK5A 1F77A 1ZM3A 4PCVA 1C3EA 4KHZA 2VTBA 3GGDA 2HBRA 3JSXA 1FFHA 5K3OA 3L82B 4HAZA 5BQ5A 2OSVA 4GKBA 4DB4A 2ACKA 5DOVA 5LMNL 1ZM7A 5JS6A 3VO1A 4RMGA 3L7JA 3FFXA 3AERB 3ZCRA 3L2OB 3EHEA 1E79D 3QKUA 5JZSA 1DJOA 1PAUA 1I50B 5FLMH 2QMUA 1QOQB 1EQUA 4IBOA 1YAJA 1N3IA 1ZD8A 1C1XA 3TGLA 4F5YA 1QM5A 3GAAA 4KXQA 2M2IA 4F5ZA 3JVDA 4WN9A 4HB0A 2EIFA 4OYYA 4DR2B 4RKQA 5EPUA 4WCFC 5CYPA 3RHTA 3DD1A 3DBOB 3QPVA 3CNHA 1E2BA 1JOKA 1N9WA 1X14A 2VY3A 1E3TA 5ILQA 2J6BA 1OXSC 2RK3A 3KB6A 1J39A 1Q7GA 1HFNA 3UCFA 3W1VA 3O8QB 1DX6A 2MCFA 2B29A 2CC2A 3IVCA 3O2SB 2GMWA 2OVFA 4MMXB 4WV3A 3SC2A 1EVJA 5TF4A 2AOTA 4EG6A 3AX6A 1FMTA 4BEJA 1JUDA 1I14A 3C7TA 3E03A 4XYLA 2ZUDA 3CR8A 3EXEB 4MQMA 1QH9A 5C5MA 3K6OA 1XXHB 1IG0A 3FSJX 1RDFA 1F3OA 4FM9A 1TS3A 1KBZA 3LMKA 4HLQB 1B0ZA 3S2YA 4UATA 1RF2D 2IHZA 3T1TA 3OOJA 3N53A 3NCTA 5EMLA 1HURA 2P65A 1IWOA 3UJ6A 3RF7A 2I5PO 1ISRA 5EG5A 4FKMA 3DUZA 3NELA 5TLSA 1UMDB 2FZVA 1G20A 3D4BA 1ONOA 2FE4A 2ZKIA 3RW9A 3A28A 4KFUA 2RBMA 1RI4A 1UBNA 5LDGA 4HDNB 1EVEA 1JLHA 3WR5A 3DZKA 1HETA 1Y5IA 3WBBA 2K28A 5HJEA 3Q9SA 1TUBB 2ZIXA 3KT8A 2DLCX 1I2DA 1PK9A 1NW3A 1NBEA 2MWMA 3SLGA 4OQYA 3U81A 1TQ8A 4E2WA 1Z6GA 2ZXRA 3GBVA 4TXLA 3K31A 2BGIA 2FN4A 4J2OA 2GCOA 5DHSA 2PKQO 2ORED 1MEJA 4INJA 3PEWA 3IQWA 2M6KA 3I04M 4HX9A 1ARZA 1X7DA 1NXOA 1RKNA 3MTSA 2J0QA 4U6SA 1F6BA 5KUTA 5JMWA 1WDWB 4XJTA 1CJCA 3Q8DA 1VQMA 1UT5A 2O8NA 4LE0A 3ZGXA 2ONZA 1MQSA 3T4EA 1CQXA 4IIJB 4MLDA 1DJLA 5BV1A 5EWJB 3DVSX 1JI3A 2Q7XA 3S1RH 4GT1A 1H2BA 5F98A 4N47A 2Q29A 1XCOA 1TADA 1TWFB 2H7XA 4CG3A 5CIQA 4KTTE 5JOBA 1NMZA 5BYAA 5EPEA 4UOZA 1TVXA 1F6DA 1LWOA 4H02A 3U31A 3PNQA 2Q2UA 3RV3A 5M3MB 4CF5A 3UMBA 1RL2A 4YPOA 3JAWA 4UOEA 3W06A 4NG5A 3GJTA 4A5OA 3K53A 4LKRA 3T6KA 1K3FA 2BFCB 4ZQGA 3IYLW 2PY6A 4WBSA 5E2IA 4HAXA 3CO0S 3ZXSA 4LPSA 1II9A 4JB8A 1E8MA 3SJ7A 2OXEA 3ZIAD 2Q9BA 5KTPA 3NUCA 1Y1VG 5BR7A 1D2AA 2R7AA 1V5IA 2CHGA 3SYKA 3GVPA 4LBZA 1P1FA 2CMHA 2D1TA 3QUTA 4L5BA 3HO6A 2Z4IA 4GP7A 3ZDZB 4WOBA 4PIPA 1L0YB 3LUHA 2I34A 4N6GA 2DFNA 2D0OB 5L3QB 4RPIA 3FR7A 4YLGA 4YJ3F 4EG4A 3CRQA 4LRSB 3U4DA 4BFXA 4A4DA 2BM0A 1UK6A 1DQSA 1RPZA 4JI0Q 4OLBA 1T3HA 5DGCA 4AKTA 2OCEA 2FJ0A 5CFZA 1BXRA 3G5TA 1NNI1 3C1TA 2AZ4A 2B5OA 1RKXA 2L1BA 1L7XA 3AVTA 3IAHA 2CWDA 4M6WB 1PYOA 2GWHA 3KUPA 4KITB 3GD5A 1Y8RB 2CBGA 4NFHA 1FSFA 2VI5A 1QJ4A 1TD9A 3CZRA 2G9QA 2BJVA 3G1UA 2I67A 2CCJA 5IJWA 2Q8TA 1IM2A 1X42A 4TLBA 1UE1A 1OFTA 1YZKA 1TA4A 3MAAC 3TR0A 2J0TD 2Z8ZA 2XNJA 1L5RA 5AQ1A 2CB9A 3SFVA 4HS4A 3LV8A 3ZGZA 2XDQA 1RBYA 5EE1A 3H2KA 4TKOB 3MTEA 2SDFA 2ZK7A 3P4XA 2Y1GA 1QE6A 3D8UA 1Y6RA 4CM4A 5DN9A 2WG1A 2OBNA 2YZ2A 1TKAA 3DDCA 3P32A 2K75A 1JVBA 2NUTA 4RF2A 1Q1ZA 2R6CA 3GQBA 3NXSA 4G1UC 4XR4A 4X7PA 3DEAA 2BEUA 5C3EB 1PF7E 5DYWA 4OI4A 5BSTA 5G0TA 3LF1A 2BM8A 2BC9A 4GXRA 2P6MA 2FH5B 4COKA 3OCCA 3ITEA 1E5DA 1MX1A 2QVYX 4E5MA 1W88A 2ZJ3A 5JARA 2ZRHA 3BAFA 2WT4A 5CGQB 1N1DA 2NVBA 2VZAA 1GGNA 1ADCA 1P0PA 3CX3A 4R6XA 1M0TA 5T6BA 4WOPA 3MBOA 3GFFA 3HEBA 2E4XA 2JFNA 1PDOA 3RN5A 4DE5A 3K6JA 2ZT8A 2EYFA 3FYHA 2YTYA 1SKBA 2BONA 4TX1A 4JOIC 4HGNA 1OAAA 5EEGA 5ALHA 2JI4A 4J2TA 3SHLA 1ENPA 1O0CA 4KY6A 2ZYDA 3I6YA 1O6ZA 1ZOOA 1GNVA 2RB5A 1MC5A 4RVHA 2B63G 1J6QA 3GAMA 1IB0A 1KAMA 2COKA 5FBKA 2PSSA 2BTEA 4IQFA 4XFDA 3BQ9A 3I2GA 3THXB 4FX2A 3N0WA 3GLFA 4N01A 2F8LA 1PH7A 4BQQA 1G41A 4ALKA 4CBVA