3PUYA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 96
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puyA01
1L2FA 1E9SA 2XJ9A 1CRQA 4D4MA 4BBSG 4KI0A 2O8DB 3ULJA 1ZKOA 2OCYC 1W44A 2OCBA 1PJRA 5IYCG 5IY0A 2XZOA 3EQLC 4TMKA 2LWIA 2QT1A 2H92A 3KL4A 1GKYA 1GKIA 4ASUD 5CDFA 3A8JE 4X65L 4GL2A 4KLKA 4B3XA 5DI3B 2ZSDA 5J4KA 1JPJA 3EA0A 1OYWA 2EVBA 2J0VA 3U3KA 1QZHA 1EUJA 1YHBA 2FFQA 1MR3F 1EESA 2BJWA 2J7KA 3R8CA 2UUCQ 3AVTA 5LBIA 1R8SA 1QVRA 5FR2A 1E98A 2BE5D 1JJCB 1IOZA 1SVWA 2WJJA 4R4IA 4DR2Q 2HCBA 4TN1A 2DFLA 2G83A 3BGWA 4B33A 4RZ3A 3THOA 3HKSA 2QE7D 2ZJ5A 2OQ0A 1FR3A 2VSXA 2J3EA 3GTQH 4OI0A 4GKJL 1Q44A 1HEIA 2BKUA 2EIFA 2OO7A 4B44A 4Y0VA 1G51A 3ULLA 3RN2A 1GOTA 4Q48A 2JLVA 1BMFD 4XTRA 2ZRDA 4F4IA 4QJ3A 2J0UA 1E1OA 1ZC4A 5LD2C 3OPOA 1IYJB 2G6BA 4F91B 5TMPA 2AKAB 1G8GA 4B3TQ 1F5NA 4A3LG 1DAMA 1UKYA 2HXSA 1YZ6A 1W48A 2WJVA 5FL3A 4MKGA 2FX3A 1XPRA 1GWNA 2ORWA 4BFWA 4QHSA 5DNYB 3FMOB 1ZM2A 3A58B 1KRTA 3WMEA 1EFTA 1EFUA 5LMNQ 1QHHA 4DUZL 1N6LA 2FFHA 2Z0MA 2CNWD 4QHTA 3V4RA 5SZJA 2XZLA 1L0WA 4LV5B 2OG2A 2H17A 3KKQA 2JA7G 1VQ8A 4KODA 4A3IH 4N1AA 2AX4A 1Q82C 2MFIA 2CCZA 1HNXL 4GSYA 3C5CA 2JA6G 4I1VA 1HZBA 2NZ8A 2FPMA 1B7YB 4QY7A 4G5SA 3THYB 2XTZA 2CWAA 1QUQB 4O0AA 2WFWA 3WYGA 1QDEA 4EAQA 2E2IH 3AGQA 2D5DA 4A3GH 2NVYH 1ZYUA 2B7CA 4I1OA 5FBQB 4IXMA 3J80i 1OW3B 2P5SA 3SQWA 4V0LA 4MITA 5A4JA 1WP9A 1VQCA 4DR1Q 5JRZA 3SS8A 6Q21A 2MNAA 3I3SR 4IEEA 2Q0HA 2DB3A 3VR4A 4A92A 2UXDQ 2QQ0A 4Q03A 1KSHA 3ZD7A 4KVGA 2BIFA 3BB3A 4DC9A 1GNRA 4MGIR 3OEHA 2PX0A 3GLGA 4A3MG 4TYQA 4A36A 5L3RA 3UWKA 3HU2A 3OIWA 3GTMH 1R0YA 5HPYB 1E2KA 3CQZH 2AXNA 2A8VA 5EE5B 2A5YB 1FW6A 2GCOB 1G41A 3IPXA 3J81c 2PMDA 5FPHA 4U7DA 2JIZD 1B23P 1IYUA 4JZKA 5EP4A 2NO1A 4JI5Q 5E7NA 3R9IA 2EFCB 4JT2A 1KSFX 1TKWB 3QVVA 3EWAA 1E2JA 4US1R 4DRZA 3CX6A 2ZRMA 1V8QA 3SN6A 4NYMR 4M1MA 4V03A 3RANA 2C96A 5JRJA 1ESNA 1GRNA 4DV0Q 3KUCA 3BZKA 2IHYA 2QMHA 5TVKA 5BW8A 5JEDA 2RHQB 3RS5A 3VNUA 3QEJA 1SN8A 3KFUA 4Q18A 4NCNA 4E22A 1L1OA 1ZD9A 2F1JA 1S96A 2I5HA 4V02A 1GSIA 2ZM5A 5JS7A 5IF9A 2RCNA 4TVAB 1W4AA 3JVVA 5M5YH 1IBRA 3CW2A 5FL7D 5JI2E 1G4AE 1U81A 5DIFA 5M5WH 1D2NA 4JVNA 4YMSA 4X8HA 3U6KA 1N25A 4G01B 2JCSA 5CIQA 2W2VA 3HPRA 2VHQA 3NE5B 4TL9A 2GTPA 1YVDA 3SE0A 1GO3E 3R20A 2R7ZH 2XGJA 4OK5A 4BEJA 2VP9A 1LABA 2QPTA 4EDHA 1NMXA 2FMXA 1QHNA 2CJWB 4M1TA 2VL6A 4PXAA 2YC2C 3TQFA 2ZSEA 5JSZB 1AJEA 1RZ3A 1L8QA 2VHJA 2IL1A 1E0AA 3RABA 4YHHQ 4FCTA 2WM9B 1MJCA 1CUKA 2PLFA 5AUNB 3A1VA 2GILA 5LDDC 4MZ9A 3GLIE 2NVQH 3ZJYC 5JEAG 1CR0A 5KNDA 1MOZA 4DUYL 3QI2A 4W5WA 4LPSA 4IVQA 4PSAA 2QPOA 3EPJA 3NBZC 4S2EA 1LF0A 2IYUA 2R2AA 1J8MF 5FTLA 1WBBA 1XMJA 1Q86C 2NO0A 4B2PA 1CJKC 3JZMA 4EKDA 2VEDA 2VIIA 3L7ZC 1WRBA 2AWNA 3EG5A 4TLBA 5KTYA 5CK5A 4DCSA 1PUJA 4ACAA 1G5PA 2WMNB 1W0JD 1XEXB 4FCWA 1M1YE 2QEXA 1Z83A 2X2EA 3CC7A 3IHWA 4RFSA 2IXFA 5FBWB 2Q2TA 1ZAKA 1SKQA 2NZJA 1OTCA 2FXQA 1AIPA 4HLUA 2C99A 4NZYA 3TGPA 3K9LA 4NCHA 3B6YA 1K8OA 2QAGB 4Z1MD 4Q7KA 3OAAD 2GVDC 2LCFA 4QGFA 1PVOA 2VHUA 3Q72A 3SBEA 3T15A 1XXHE 4PZYA 1D6JA 3HOXG 4RD0A 4KYIB 2BMJA 3LD9A 3QXJA 5CIWA 2DNCA 2R6AA 1KO8A 3U7FB 1I2MA 4ME3A 3CBQA 4PC2A 3B8HA 1OHHA 3CR8A 3H84A 3T06B 5K8LA 5L3QA 2W6IA 4OHYA 2E74C 1JQJC 4DV6L 2ZM6Q 3CRRA 1ZM9A 4JCVE 2FOLA 4UY8C 1CXZA 2VLIA 1P75A 4LYHA 4M8NE 4X64L 1J8YF 4QBIA 2H8KA 2WAYA 3A37A 1KSJA 4Z8YA 3LWUA 4QM7A 4TMTA 4BLTA 4WJ3M 1TEVA 4G0NA 5FOWA 1E2VA 1OFTA 2FPLA 2WPDD 2DNEA 3S2HH 1DVRA 2VP0A 3LW7A 4UXHA 2D0OA 4W5HA 4F38A 1WF3A 2A6HC 3FYHA 4WVFA 1NP6A 2AN9A 5JZVA 3CCRA 2QN6A 1CKNA 1ASZA 3HOVH 1LF5A 5E3HA 4EPWA 1PH3A 4BXXH 1Y8NB 2ASEA 3FDIA 3M4OH 3D3QA 1WYDA 1NY6A 4PPNA 1TMKA 3F3YA 1N0WA 4MRPA 2XZPA 4BLRA 3CCVA 4B2IA 1UWVA 2H1LA 1Y1VG 2RGBA 4CIDA 1E32A 2B7BA 4DK6C 2OSBA 2XSZD 3QG5A 4LV8B 4OQNA 3I4MG 4TQ9A 4WAUA 4QKQA 4BZPA 2A3RA 3CCMA 4PC3A 2BA0A 4LW1A 1NLYA 2GK6A 4MYTA 4RFVA 4HIDA 1XCMA 3FOZA 2PI2A 1OB5A 3GD7A 3ND8A 4Q21A 4C7OA 5C3EH 4GRAA 5TB5A 2J0UB 4A8JC 1VQ7A 3NC1C 4NKRA 1HR0Q 2K5VA 1BYIA 3AP3A 2J0QA 1HT1E 4Q1DA 2ATWA 1PYBA 1DADA 1AGRA 3L82B 2WWYA 3RAPR 1CEEA 1N6NA 3SI7A 4GZLA 2ZSAA 3EZ7A 4YDSA 1NN3A 1QHHB 2DUDA 2ZI9A 3F5FA 1GVPA 1RJ9A 1SFOH 2HXYA 2H5EA 4KSCA 2A6HD 3FKSD 1K5GA 4K81B 1U98A 1OH8A 4PX9A 1XNRQ 4WW0A 4BY7G 1R0XA 4KVAA 1V43A 1ASYA 2UXBQ 2VH5R 3U4VA 3A4NA 1YR9A 2KBEA 3MAAC 1Q1BA 2G77B 4F7WA 3BE4A 3I92A 1U8YA 1N9WA 4LF7Q 2OM2A 4OQLA 1VCIA 3ERSX 4PPFA 4DDWA 3PO3H 2AR7A 1IN5A 4Q7LA 3GFOA 4DDUA 3H94A 4LUVA 2PLRA 5KSOA 4KCGA 2F1RA 4A3DG 1XMOL 3FHCB 1TAGA 4LX0A 4M1KA 2ORVA 1WI5A 5JMTA 1G8HA 2XAUA 2IS6A 2RB4A 2ODNA 5C4XG 4G1UC 2HV8A 2FU5C 3SYKA 2D06A 1Z0AA 4KKSA 5GVSA 3GLGB 3V4FA 4GN4B 1CTMA 3VHLB 1N33L 1W36B 3WWVA 3BBPA 5GQOA 3DZ8A 1NBMA 4A93H 4JBWA 1SHZA 3LVQE 3R7WA 1D9ZA 4OO1H 1SR3A 3E9HA 1S3SA 5AK0A 4NYJQ 4OGQC 5IP7G 3AKDA 2D4HA 5C18A 5GAGC 3AUXA 2E1RA 2JLRA 3GLIA 1TU2B 4HAUA 4B32A 4Y7NH 2KA7A 1II8A 2CLCX 3F2BA 1E2EA 5L8VA 1TQ4A 2IS1A 4KSBA 1YQTA 2VP5A 1OKKA 3CR7A 3LA6A 2WMOB 4P74A 4LJYA 4B3BA 1AZSC 1I4DD 1IXZA 2CXXA 1NVUQ 4JG2A 3CIOA 1K5DA 2FSGA 2NZOA 2FFAA 1L1OB 3PEUA 2YWFA 1CS4C 2FEOA 1IBKL 2UXCQ 5E7IA 4K46A 4Q9IA 4CEHA 3OEED 3CNOA 2MO1A 2R6CA 3FFBA 3GLHE 4YLGA 5DHFA 1FUUA 1BYUA 2X19A 2CBZA 4QBFA 3AUYA 3CF0A 4LF8L 2UU9Q 3PF4A 1S8FA 3D4RA 4DAYB 2BMEA 4R1JA 4MRRA 4QJ5A 4B76A 2FJUA 4CZ2A 3M0EA 2MMGA 4L5SA 3RR5A 4HLQB 5E7JA 1LVGA 2DWQA 2BH8A 1LS1A 1AA9A 1PH4A 1EFRD 2A9KA 2C04A 3H86A 4Q01A 3HOYH 4LJ7A 1FTNA 4QFMA 4DEYA 3GP8A 4JOIA 4QM6A 3DHWC 2IY5B 4BFYA 5JECA 2JATA 1HV8A 4IDNA 4EFMA 3AVYA 1Z0IA 5BR8L 1VQ5A 3HOUH 4W5JA 2EWVA 3CM0A 4H0LC 4TL6A 1TF7A 2NN6G 1E9CA 3RZDH 4TZ0A 1NF3A 4DR6Q 3I4NH 2F3TA 4S35A 3SYLA 1OXUA 2HLDA 4ESHA 1N6RA 3DOEA 4FD2A 3E9IA 4DDTA 4YMVA 3C8UA 1GITA 1XMIA 2W6JD 5IHPA 2CE2X 2FGJA 4CGZA 4JI7L 4LBWA 3TNFA 5FJ8G 4A3CH 2J5XA 1CKOA 1QRAA 1IONA 3KQHA 3RRMA 5C0XI 3SDZA 4P71A 1K3RA 2QRNA 3R9WA 2O8BB 1SZPA 2YC4C 1NBWA 2JA8G 2ZU6A 5IP9H 5FUYA 2A6EC 2EJFC 4RFSB 2QAGC 2Z6VA 3B78A 2YWGA 5FUWA 3W5IA 3FGNA 4FCVA 4YONB 3EARA 4ERNA 3B1ZA 3NXSA 5JHGB 5HGQA 4PQYA 1SXJA 1KL9A 2GRJA 2GEDA 4LUZA 2WHXA 4P31A 5GJBA 1PLLA 4D82A 1G8YA 1VTKA 4LF6Q 4IQZA 3I4OA 1T3HA 2ZSBA 2CE7A 3HWSA 4DV1L 2W83A 4LF5Q 2B63H 1F6BA 3NHBA 4XSGA 4ZO4A 5L3QB 4A3JH 4WIAA 1NTGA 4MRNA 4UP7A 1CR4A 2KCMA 2RF4A 1MJEA 1E1QD 1XJCA 5EXXA 4ZI2A 1A63A 4LWZA 5AJZA 4DV4L 1JXOA 5M5XH 4G7HC 4LFCQ 2JLYA 1G3RA 1K8GA 1QZXA 1GHKA 1S2MA 2JJ1D 3Q7QA 3KJGA 3CB4A 2F9MA 3WP1B 3VFDA 3CRQA 5KDLA 4B43A 1G5TA 4UNQA 2A78A 1GAJA 1CF4A 4GZYC 2CHGA 5B57C 4OKSA 3L8YA 2IUTA 1DXMA 5KPDA 4HB0A 4D2IA 1KK1A 1E2PA 2JJ2D 4Q1FA 4IDOA 1CKNB 2QGQA 2GF0A 2BVNA 1N6OA 4KN7C 1RRFA 4B3RQ 3KLRA 2H5XA 1EIYB 3Q85A 2A6ED 3E2IA 1S72A 4P0TA 2V1UA 4PC7A 1MO6A 4ARZA 2ZI3A 2E5LL 3U4QA 2C77A 4C3ZA 1G9XA 2V7QA 3OZXA 3R9XA 3UWOA 5FPTA 4QHYA 4AD8A 1R5NA 4Y52H 5JCPA 5KSZA 4Q1AA 2CWPA 4OX9Q 2ATXA 2ALYB 2IS4A 3KQUA 4DT1A 4UP9A 1S9HA 1GD7A 2OHFA 2CHVA 3QG1A 2A19A 2OUKA 2ZETA 821PA 2F55A 1VQAA 3A1SA 2GAAA 2OBLA 3OE7A 5H1YA 1JECA 1VQDA 1OFUX 2O8CA 5IT9c 4WA7A 3I56A 2R65A 5J4VA 1KDTA 4FMBB 4PR0A 4LHYA 4IEIA 5JWRA 5B2ZA 1ZIOA 1NN1A 2DFNA 3ULPA 3DOFA 3PR1A 3IO3A 2BJVA 5LB4A 3RDPA 4DBLC 3GJ8A 3C16C 1S3OA 4GLVB 5LMNW 5IK2A 4XWOA 4EUNA 1DE0A 4MKIA 4BFTA 4AG6A 1UE6A 4TYPA 3A1TA 4E5UA 1AS2A 1TQ6A 3KXKA 3NDPA 1NI3A 4NONA 3FHOA 5L3VA 4PQFA 2KCCA 4X65Q 2WKQA 5DO9A 4IJMA 2GWHA 3LV8A 4URYR 2YTYA 4YMWA 1ZNYA 3G4SA 1X1SA 2J7PA 3IHLA 3MGCA 5CM8B 3SOPA 4CVNA 4IDHA 3KJOA 3W90A 2R92H 1Q81C 4A3FG 2C78A 3NBFA 5EXSA 5GJWC 4WZBE 1W36C 5TDHA 3CZPA 3QEOA 4HJ7A 3TQCA 3ADBA 1F48A 1KZ7B 5KUTA 2ZJAA 5LMUQ 1H95A 5C4JH 1WXQA 2VHTA 5FTMA 1NMGA 3R7WB 3KKMA 4GKJQ 2ZRCA 2C95A 4P4TA 1E0JA 2QA5A 3PSIA 1E9RA 1F3OA 3GTGH 3GLIB 5EE3A 1DG1G 4ZKDA 4C0SA 3LQQA 1II8B 3VKHA 4KHZA 2VQFL 1CI3M 2Z0SA 5CITA 4M1SA 3T1YL 2NQ2C 3B1YA 3CWZA 1GUSA 1L1OC 1DD2A 3QQ5A 5DH9A 4HAWA 4OK3A 2ZVQX 3H1TA 1O3YA 3PVSA 3TW4A 4POAA 1UEJA 1F2UA 4DUZQ 3CW2C 4CEHB 1XU4A 4V0ME 4RD4A 4A4DA 1P16A 1U0JA 3EPKA 4DUGA 2ZI5A 1KNXA 3BRWD 3TE6A 4AWXA 2WTUA 5H8WA 1FP6A 2BMFA 1NSFA 3OEHD 4GT1A 2HUPA 2UZ3A 1HNXQ 3NH6A 4PC6A 4M1OA 4XJXA 1W36D 1WJJA 1KI4A 1LTQA 4JYAL 1CSPA 2IYWA 2Q9CA 4C30A 5DSZA 4P4UA 3AYHB 3A4MA 3UXMA 1VPLA 1JR3A 1M90C 2XGTA 2G88A 3W5JA 1S3GA 4OI1A 4DCNA 4H13C 4DV3L 4WOPA 1Q1ZA 2MQHA 4DK1A 4GOJA 2OILA 1C0AA 1G19A 2N46A 5C4GB 1KHIA 3AH8A 2GZHA 2H7VA 2MSDB 3HDTA 5JEAJ 3MG9A 3VMFA 4A3KH 3U5ZB 2WB1G 4KHPQ 4DR4L 3RN5A 4I7ZC 4BBRH 2FH5B 2J87A 4LC0A 5CJ2A 1K83H 2J45A 5SZKB 1YHNA 3TKLA 2WWWA 1IN7A 5GROA 2QQEA 1DAFA 1W5SA 2GA8A 2ZI4A 4PC1A 1E2QA 3IIJA 2PCJA 2O8EB 4FXPA 1N8RC 4LSGA 3W3ZB 3UDXA 221PA 1OXVA 8OHMA 3JAMc 4HLUC 3T1QA 4OONA 4MUAA 2B21A 2CEAA 2P67A 1WCMG 4PZ8A 2P3SA 1X56A 1Q3TA 2PX3A 3FHWA 2K14A 3AV0B 3LBNA 3W6OA 4KITB 4CF7A 1Z6YA 2GHIA 1NLZA 2F43A 1J90A 2K33A 4HZUA 4PSVA 5BYJA 3TR0A 2IX3A 1OXTA 3GFPA 4LFBQ 2VHCA 2Q8IB 4PG3A 4TTRA 3BXZA 3TH5A 4B3DA 3U3RA 1IXRA 1VG8A 3IDQA 4HB4A 1AKYA 3FMPB 1I94Q 4V0NA 1Q3HA 4DV2Q 1E2MA 1HUQA 1XX6A 2ERYA 4DV7Q 2CJWA 1SVOA 2Z4RA 1EK0A 1Q21A 4D25A 1IBLL 2UUBQ 4NP6A 5J40A 1E0KA 1ZP6A 3OOCA 1V5WA 2J46A 1TQDA 2P6NA 4ZIRA 1XD2A 2Z43A 4D0LB 2PNHA 2EJMA 1CFMA 2ZJPA 2EWWA 2GZDA 2NPIA 4Q4JA 4TWZA 2VS1A 4ZV4A 3W3AA 1BS1A 3PIOA 2OQKA 1S9DA 5EP3A 2ZRKA 4AI6A 1G7CA 1XJ0A 4FMCF 3PGZA 1VMAA 5AJXA 1QHXA 1VG9B 2A1AA 1ANKA 4FINA 5EQTA 1Q90A 1EFHA 1OH6A 4MTNA 4HJ9A 2ES2A 3BD9A 3CC2A 3MJRA 3I8XA 4LDJA 4XTCS 1ZINA 4BFZA 1G17A 4A3BG 1Z3IX 3QPWA 4ARZB 3CF6R 3U4QB 2GBLA 3T56B 1R5BA 3SJAA 3E5HA 2BDTA 3TSOA 4E09A 3THXB 2FFBA 3RS4A 1OHHD 4HJAA 1M8PA 4JI2L 2BKEA 3W8RA 2W6ID 1VS0A 3RLFA 4AURA 3PFIA 1HYQA 2R7FA 4WBSA 1AE2A 1UBGA 1AZTA 4IKEA 1EFWA 3HOZH 3IEUA 1Z7TA 4HAYA 5FLXc 5EAYA 1IN8A 1QG2A 2WKPA 2N78A 4DKAC 4JS0A 4DT1B 2ZSFA 3HP1A 1VCNA 2GAOA 3VX3A 3EC1A 3SJBA 1QVGA 3IGFA 2UZIR 3PITA 1Y1WG 1S1MA 1MO5A 2O8CB 4TTPA 1OIVA 721PA 1HR0W 1KAOA 1UBFA 4IFEA 4YC7A 2CW0C 4OHZA 2F4VQ 1G16A 3PUZA 3QJYA 2B8WA 4IFDH 4A75A 4JI4L 3CKLA 4JI1L 4EPVA 1KI7A 1TWAH 1VQ4A 1Z08A 2QTHA 4DV6Q 4HAXA 1JI0A 5C44H 1PH1A 2D2EA 4ZCIA 3MEFA 5K36G 4P32A 2ORIA 2OTLA 4EX5A 1XEWX 2K5NA 2W00A 4QL5A 3LXRA 4XOIA 5KHOC 3LWNA 3EPHA 1PLJA 4DSOA 1YZKA 1NLFA 2D3WA 3C7KA 3M7NA 3C41J 4B3CA 1E9EA 4A8JB 4TKOB 2A68C 1I3QH 1LACA 3IBYA 4B75A 1JALA 1OSNA 3LLUA 4JVMA 4XSHA 5KNBA 3KJEA 1NIJA 1I6VC 1X55A 1XTDA 3H15A 4TZ6A 4AYBE 2ZRJA 3KFVA 1KJZA 2EYQA 1ODFA 4B3ML 3OW2A 1E94E 2GZAA 4JLAA 3QF4A 2VUMG 4PHGA 3LLMA 3CUEF 1GJXA 1UEIA 4DSUA 4DEXA 4QQBX 1R0WA 1OIXA 3UANA 1EWRA 2FEMA 3PCRB 4R7ZA 3PO2H 2QA4A 5KNCA 2IYRA 3BIFA 1A82A 4OBEA 2HT6A 1ESMA 1Z6GA 1IL2A 1IM2A 3A1UA 1OT3A 1W47A 4D4LA 3ZVNA 1K0RA 1I50H 3A5ZB 3AQQA 2PH1A 2W58A 1C9OA 4C0QC 4GZMA 3WNBA 1XNQL 2A5JA 5FLMH 1PFSA 2GXQA 2G1KA 4QJ4A 2D62A 2KHIA 3J81i 5BN5A 1PMRA 1AQUA 1Z07A 2ZIAA 4LFAL 4A9AA 4JI0Q 1ZU4A 3C15C 2F1MA 3S1AA 1N0VC 3SQXA 3QKTA 4WXRA 2I3BA 2QPAA 4MRSA 2JAQA 1JXMA 2ODEA 4UPAA 2OTJA 1G5RA 3BH0A 1N34L 3GCGA 3W1BA 3HYRA 4ZKEA 3I5XA 1VQIA 2A68D 1KK0A 3HKZE 1T8TA 5G53C 4F4CA 1F2UB 4AKEA 5LPNA 1RFLA 2GNOA 3L8ZA 4M9SA 1O7LA 3WNCA 1CP2A 2ZYUX 1P72A 2HIXA 2L5TA 1Z0KA 2BMDA 1L4UA 1D8TA 1KQSA 3A8TA 4RD6A 1TU3A 4WZ6A 1HE1C 4JK1C 2IXGA 1GUOA 1G7RA 1NBMD 1P73A 5IYBG 2CKZB 3L0IB 3ONWA 4BE7B 4QGUA 2VQEQ 3KXLA 1G291 4HIMA 3NENA 4LBYA 4L5TA 4NCJA 4L5QA 1NVVQ 3PEVA 3C5HA 1ZNXA 4JOIC 5FBVB 2GJAA 3P32A 5FTJA 4ZCMA 3D6TB 2PPBC 2FZ4A 3W34A 4IOMA 3ICQB 4Z51A 1Z9FA 1PUIA 3X1WA 2NVTH 3CPEA 4QJFA 4R4OA 2WICA 2XNDA 5F2EA 2C98A 4A82A 4F4JA 2YKGA 4C0KA 2NOAA 3DLLA 4UJ3A 1W46A 1OKKD 2IWHA 2JLXA 2XTMA 3CNLA 3B7GA 2DCUA 5IWAQ 5FOTA 1IY0A 3FPAA 2YTVA 2CL6X 4TMVA 1RRCA 1T91A 4KKTA 4BY1H 3SJZA 5L3SA 1N33Q 4OO1I 4NH0A 3T51B 5M3FG 3E1SA 1KI8A 5IDVA 4YXWA 5KDDA 3C4JA 2V9PA 1PLKA 4ABYA 3FMFA 4XD7A 4HDOB 4IXNA 4OI4A 3RSLA 5KSYA 4TT3A 5CM9C 1RC8A 3AP2A 3EN2A 3DXJC 521PA 3BB4A 4G5GA 4R98A 1KI3A 1Z6XA 3IILA 4NYIR 1XZQA 2H18A 1KD1C 2IYVA 1OPXA 1SXJC 1E79A 4KYUA 3MXNB 2OFWA 3B60A 3CF2A 1SGWA 4TLDA 4JV5L 1J70A 2F43B 3TS2A 3A36A 4HZUB 3SHFA 3CNNA 4DLWA 2BEKA 1JJVA 4M9QA 1Y8OB 1EQQA 1T5LA 5GVRA 4AYWA 1WOCA 3RYTC 2IUUA 5AUOB 1G1MA 3CCUA 4AG5A 1ZUHA 2V55B 2IHEA 2WV9A 3RVBA 2QBYA 1DAHA 1M34E 4M9ZA 5C0XG 2G9NA 3M85A 1GUTA 2IYZA 4LF8Q 2ZR9A 2Q3FA 3LVRE 3M4QA 2RGDA 1HPCA 1XF9A 1YE8A 2HLDD 2ZRNA 4RMFA 1C9KA 2K5HA 3L0SA 2PZEA 3AKYA 1HA3A 1GUAA 2EU8A 5EUQB 5HCIA 2CMKA 2HHHQ 4JVLA 4HR7B 4LCBA 4DDVA 2WWXA 4BLSA 1XD2B 5JJLA 1DELA 1TADA 2IYSA 4NPHA 5IYDG 1W5TA 4Q4JB 3QBVA 3UE1A 3P20A 3LFUA 4QGHA 4D80A 3L2PA 5FOXA 2ZJBA 3B5JA 4DCUA 1NL3A 1EOVA 1VYUA 4XIGS 5P21A 5BR8Q 4DLTA 3NBHB 1IN4A 2OWOA 4E03A 2QL6A 2WWHA 1Y3AA 1SXJD 4QGAA 1XTJA 1RE0A 3BERA 5TARA 1GIAA 2GVZC 2IXEA 3LW8A 4C2UA 4JYBA 1VCOA 3AKCA 3Q5DA 4X8OA 1E1TA 3HPQA 3X1YA 4C0HA 4YWLA 3H0GH 5GJCA 5C46F 4JI7Q 2RGXA 1U5KA 4X66Q 3EWSA 1SE8A 2FE4A 4TTQA 4A3EH 4YMTA 1WBDA 4N0EA 4PAQA 2VPPA 3U44A 4MNOA 1NN0A 4NCIA 1W2BA 1G8FA 2SHKA 2XITA 3KKNA 3UG7A 4YWKA 2UUAQ 2AD5A 2WZQA 1D9XA 2EQBA 4IVRA 4CYMA 3K7AH 2RAPA 2ZE8A 3OIVA 4L16A 3PUWA 5J5CA 3LNCA 3ECCA 2QEQA 1E2GA 4X8LA 2QT0A 1XTSA 3B9PA 3BC1A 2ZRPA 2CK3A 5C2JB 3I61A 4YCWA 1X3SA 2EYUA 5AJ3Q 1XZPA 1Z47A 1IBMQ 1R7RA 3J7A5 1SKYE 1JJGA 2IYQA 1E4YA 5A0FA 4DV1Q 4AYXA 2EFHB 3I62A 1OXXK 4LK1C 1BVSA 1TTTA 2OBNA 2BC9A 4NBSA 1CRPA 3B1WA 2WOJA 2WKRA 2JA5G 2R6FA 4DCVA 1P7CA 3ADCA 3A5UA 4DV4Q 1ZCAA 3A6PC 1EWQA 1X8JA 4Q1BA 2V7QD 4DNRB 1GRRA 3S1QH 3FVQA 1K6MA 3FWYA 4OJKA 5AUPB 4DB2A 2RHDA 3ZS9A 3CRVA 3PJRA 5FUVA 4AKIA 4B3FX 1NMZA 3MCAA 4NDZA 3OFNA 1TEXA 3WXMA 4NXNQ 3QKSA 4BUJA 2V4DA 3P1JA 2HYIC 2VW9A 2VBCA 4BRUA 1OLOA 1P5ZB 2P65A 3DMDA 2UUCL 2Q2IA 1XCPA 1JT8A 2YINC 4AY2A 3EIEA 3BJUA 1E4VA 1JJ2A 1W2GA 3K8YA 3KJHA 3KTAA 4D81A 1YKSA 3OE7D 1LNZA 1T3LA 3QF4B 4DR2L 1CKMA 2PCLA 2I0QA 1W7AA 5FOUA 4B2LA 2R44A 2J41A 4YY3Q 3NBXX 4GNKA 4ZDJA 4RVCA 4KLNA 4E07A 4G7ZC 2D2FA 2EDGA 3O8CA 4IPDA 1W4RA 3IUYA 3RSOA 4Q4AA 4IVPA 2BH2A 1HT2E 1VQ6A 3CRW1 4QXAA 4GMDA 5IK2D 2FDCA 2A30A 2Y0SE 3CCLA 3S1AB 1U9IA 1H8HA 4B3TL 2CVFA 1CSQA 2OAQ1 3GJ7A 3HOWH 3S16H 4L9WA 3AFQA 3QPUA 1A2BA 4JI6Q 2JASA 4GOPA 3FFAA 1CULC 2I1QA 3PCOB 2J7PD 1NN5A 2AK2A 5DI9A 1GRQA 4O25A 2ZRIA 4ZPXA 4DHEA 3GLFE 4B3GA 2PL3A 1KMHB 1LW7A 2JLQA 3A7AB 4UJ5A 2WWIA 1DO0A 1B70B 5GAEC 2QAJA 2ZJYA 1KXLA 4HDQB 1UEBA 4TLEA 2CL0X 2KENA 1TF2A 4MKHA 3TUZC 1YRBA 3N2EA 4KU4A 1P61B 3O47A 2QP9X 4Q9HA 1EG7A 1DTSA 3SHWA 4EJSA 2ANBA 3BS4A 2ZUDA 5FTKA 3HR8A 1P4SA 4JVSB 3FKIH 1N36L 1RYHA 2VQSA 4DR1L 4A76A 4KFTA 4A3IG 3TZUA 5FI0B 3M4YA 4QL3A 1CR2A 2LKCA 2QMUA 1JEEA 2ZE6A 3DZDA 3NWJA 3B9QA 4NYMQ 3FKQA 3OHMA 3V00A 3Q9LA 3NHAA 5E4FA 2L0XA 2FPKA 3FE2A 3JC66 4JSYA 4AC9A 4JI3L 2IS2A 4A3GG 3BB1A 1L2TA 4GLAC 1N32Q 2A5GA 5FFMA 1UBCA 3AVQA 4JLNA 2YOFA 5L3SB 2EVWX 3VR6A 4IOCA 5C4MA 4H1VA 4PMWA 1HH2P 1VQ9A 1EX7A 3LH5A 4LF9L 4B48A 4DUGD 2HDNB 3I5YA 2I1VB 2BM1A 1ZVQA 4DR7L 4JIMA 3TREA 4R4TA 1FP7A 1Z6AA 2Z83A 1FMJA 2AK3A 1IY1A 2B6HA 4DV0L 3H3VH 2CHQA 2CDNA 3T1YQ 2WWGA 5CYOA 3QKUA 2AUJD 4ZDIA 2Z6KA 3CZQA 1JR3D 1NVWQ 3EW9A 3UDFA 3LO5A 5CLQA 2NVXH 2N3SA 1QVCA 3IRBA 3GTLH 2OFOA 1XXHA 1HZ9A 2IYXA 1IXRC 1JE5A 1E7ZA 4BGDA 1J2JA 4G3XA 2QBYB 2BM0A 3AF0A 3KKOA 3A74A 1H8EA 1R9TH 1V1QA 1O87A 2OE2A 3G5UA 4EPTA 2ONKA 1NY4A 2JEAI 3GEEA 2PEZA 2OLJA 4X6AH 2GXAA 4BFXA 3T53B 1EYGA 2OXRA 2BDOA 1JMCA 4NCKA 3K70B 1PH2A 1M7BA 3OIYA 4P4SB 5AR1A 3RS7A 2GJ8A 4JLOA 2R6GA 3WY9A 4EPRA 3U9SA 1P2TA 2KI5A 2ZRHA 1VECA 3T1OA 2DWOA 4DV3Q 1RKBA 4X62L 4G7OC 2Q2UA 2PQAA 4KN4C 1YJ5A 1H9RA 1TWGH 5GADC 3BFXA 1CKEA 5EP1A 4HAVA 5F98A 3LGJA 2ECKA 2D7DA 3AQ4A 2NTYC 4YHHL 3H2YA 4W9MC 2O8EA 4DR3Q 2ZTDA 3WYFA 2GBLC 4IOAA 1U2RA 3RC8A 5BN3A 2R7ZG 1OB2A 3D0FA 1QHIA 2OBMA 2ONJA 1PH8A 4KFUA 1V9PA 3LBHA 4PO1A 2QMEA 2JXMB 1LB1B 1TQ2A 4EPXA 2GJKA 3S1MH 1W49A 2J1LA 2X77A 1XTQA 1FNMA 2EFEB 5JLJA 4B3SQ 1TPZA 5AJWA 3U44B 4M1WA 1WQ1R 5IRCD 2ZAMA 4LJ6A 1E2ZA 1JB7A 2KCTA 1XJQA 4J0QA 4LC1A 3ZYCA 3K9HA 3R8FA 5GJVC 2DN8A 1UADA 1SVSA 1UBEA 4B35A 3EBEA 3IO5A 2B8TA 3SR0A 2WAQE 3BDOA 5ANRB 3X1DA 1XEFA 1D8LA 4DKXA 1QBKC 2VP4A 4PPQA 3FP9A 2YU9H 4GKKL 3VR1A 4C3JH 5FPKA 2R93H 5J4HA 3W6PA 1SMYC 3AGPA 1J5EQ 4F92B 3L43A 3EA5A 1FVIA 3ZH9B 4LI0A 2GEUA 4JBXA 4KFRA 2GCPA 4LHZA 5B64A 1VQKA 4PZ6A 2CCKA 2GVBA 3CPFA 5M04A 4LUCA 1BO6A 3BH6A 1G20E 5H70A 1NE3A 4BECA 1FTSA 1G3QA 4URXR 1CIPA 1KRSA 2OCEA 4DV5Q 3TS0A 1NY5A 1X6VA 5EE0A 5K8IA 1U0LA 1DG3A 5K8TA 1A4RA 2IW3A 3RC3A 1YRAA 5UKDA 3OTOL 2P5TB 3RZOH 2ZRFA 4Q47A 3ZIAA 1XTRA 3Q3JB 3QKSB 4ZI3A 3THXA 3SFZA 1HQYE 2CCJA 2B92A 1L7VC 1N3BA 1IJEA 3W6NA 3KTAB 2RGEA 1OYYA 4ZIRB 1JBKA 4HIKA 1NVXQ 2DY1A 2WJYA 1PHJA 3ZZUA 1SQ5A 3K9NA 4JBYA 4DR5L 1ETUA 3K53A 4QBHA 3J7ZC 2AD1A 1G3UA 2IK8A 5DYIA 3HOVG 2OV2A 3WMGA 4BXXG 1DBSA 2VTKA 4JJZA 2HIVA 4LGMA 4Q4AB 4BWYA 4BBSH 3CX7A 3EZ6A 2E2JH 1QHSA 1YNJC 4I1UA 4POGA 3WYAA 5IYCH 1DCZA 4BFVA 1B9MA 2E2HH 2K4KA 1KJWA 2ZE5A 1EWHA 3PUVA 2XTNA 4C2MH 2JE6I 2EXDA 2R7DA 1FJGL 1FPMA 2R62A 3FMCA 2ZI6A 3UATA 2VA8A 1YZNA 2PJZA 5HTKA 1E3MA 2YZ2A 2PMKA 2ZAOA 5HZKA 4GOPB 1M2OB 1YZUA 4IFDI 1N6KA 5LB2A 3ZZ0A 4C0JA 2B8GA 1WDTA 5C3EG 4D4JA 2I5MX 3RLNA 4YQFA 3GLHA 4DPGA 3GTJH 2ZE7A 1JAHA 2ZPTX 4JI1Q 1VKJA 4JKIA 3NC0C 3NG1A 1Q7YC 3BG3A 1XNRL 2ZJ8A 1H9SA 2O52A 1YR7A 2WJHA 5FOVA 4TMWA 3S14H 3G6EA 4A6PA 3ZVMA 1U94A 5DLQC 2Q9AA 1AS0A 3A8IE 4GNXA 2ZT9C 1LS6A 1S4QA 3BOSA 1DO2A 3L0PA 2ZJOA 2QGNA 5G3ZA 4EJSB 1EFCA 3MRSA 1N2CE 3HOWG 2JLSA 3CRMA 1KDRA 3AVPA 3KDSE 5HE8A 1G6HA 1I2DA 2I4IA 4PTLA 3TBKA 1FYCA 2XNSA 5CYPA 3U3OA 4BA2I 4A3LH 4C0AC 4DNTB 1P9WA 5CK4A 3FKSA 2C8VA 4KBFA 1Q20A 1KZGB 2RGCA 3CC4A 3PO3G 3K0CA 1E1RA 4LJ4A 5BQ5A 2V54A 1VIYA 1H9MA 4H44C 1SHKA 4PZLA 3EPLA 3ADKA 3B85A 1MIUA 1QJOA 2DHRA 2YWEA 1U99A 2GVAA 1Q22A 3DKVA 4I81A 2JA7H 3ZVRA 1Z63A 1E2HA 3HGBA 4MQBA 2ZYTX 1R10A 3JZAA 1YR8A 1XPOA 5K8UA 4OHXA 2REBA 2JA6H 3GPLA 3U3MA 3NH9A 1XNQQ 2FWRA 1T0JB 3K0AA 4NHOA 3U3JA 2HF8A 5H68A 5KYKA 2XOKA 4JLDA 4AQYL 4BLPA 4LFAQ 2Q9BA 1E24A 2BBOA 4OJQA 4A93G 3GJ0A 2K5UA 3SJCA 3AM1A 4OO1G 3AVWA 4B71A 3RLOA 1ZM4A 2KHJA 4JI8L 3SU8A 4TYWA 3KDFA 1N34Q 4YCUA 3U4ZA 4JT4A 1W4BA 4CEIA 3RNUA 1XXHB 5C0XJ 2XNDD 4LBVA 3UMFA 1B0UA 1E2FA 1HNZL 3DDCA 4R9UC 4A2WA 4U00A 1U8AA 1LM0A 1NG1A 4A3MH 1MO3A 2HF9A 4XWAA 1G7TA 4OHWA 4OK6A 2UU9L 5CDFE 3E0EA 4C3IH 3AF2A 2PEYA 1IZ6A 5AUQA 1ZRHA 3KQKA 5M3MH 4YXWD 1Z6HA 4JLMA 1VG1A 5JEEA 4JLVA 1SKYB 1COWA 3T34A 4XD7D 4PQRA 3GJ6A 3LAWA 4BEBA 2ANCA 4TT3D 4DJTA 4LJ9A 1A2KC 2ODBA 1XMVA 2YOGA 3CONA 4IO9A 2ID0A 2PQAB 1NKSA 4ITRC 4RD3A 1EX6A 4AKGA 3EZ2A 1YU9A 2V6JA 4LJ8A 4RZ2A 1PH7A 3TSZA 3LNNA 3B13B 1KO4A 3PIRA 1YHQA 1CR1A 1O7IA 1E79D 3GFTA 3D8BA 3KB2A 1VQLA 3MWKA 1B8AA 2LXJA 1PZNA 4US0R 2YNMA 4GLXA 1GL6A 3T61A 4BLQA 1KAGA 3K81C 3HOYG 2MO0A 3BK7A 4RKFA 4HEJA 4DB4A 2EFGA 2O8FA 2BBWA 4MRVA 5H1SE 1T5EA 4OWTB 4YCVA 1CJMA 2N42A 2WWFA 3I4LA 5JJIA 3KXIA 1TWHH 3A0JA 2V1CC 2IF0A 3HOUG 1W2HA 1ZUNB 2ZU0C 2ZUCA 3E70C 3GEIA 4DWJA 1VQGA 3QVUA 4OWXB 3OF5A 3T12A 1DGSA 3I4NG 2IYYA 4U02A 2LKDA 2F9LA 4LJ5A 1OXSC 3VKGA 4LJZC 1FQKA 1JPNA 3RWOA 4DIDA 4C7OB 2K75A 4UXJA 3NTUA 1FOEB 1KO1A 1G3MA 4L8GA 2ZYWX 3UG6A 4A3CG 3W9YA 1AGPA 2HJGA 4PAOA 3WDNA 3LX5A 1CTQA 2UKDA 3N2IA 2ODWA 2YJTD 5FOSA 3NVAA 3X1ZA 4A4IA 2GKSA 3U7HB 4URZR 2REOA 2QZ4A 1XB2A 5IP9G 1FX0A 1E2NA 1P8LA 4LF5L 4LK2A 2ZR0A 5JEAH 4L5RC 2GDJA 1CJTC 1SVMA 2GJ9A 4GFDA 2BOVA 1G21E 4UP8A 1N0UA 3VAAA 3REFA 2O8BA 2DFTA 2EFDB 1YZLA 3B6EA 2B3GA 3GLFB 2JJ8A 1KMQA 1RRGA 3VDYA 2D74A 4LYFA 1HZCA 4YWMA 2C5LA 3BFVA 4URUR 4RCZA 3QSYA 4C2TA 4DLRA 3GLGE 2B63G 1XP8A 2XX3A 3PUXA 4A3JG 1KJYA 2QTVB 4DUYQ 1R0ZA 3F8TA 1KHTA 1XD8A 2VF8A 4LYAA 4W7SA 5HR5A 3U2QA 4K0KL 3PF5A 1VIAA 4D0GA 5A35A 2K50A 3MLEA 4AIMA 2D2CC 1P2SA 3HOXH 2CK3D 4HATA 4EIWA 4TQAA 4UNSA 4M1YA 2NG1A 1K73C 1HZAA 1GILA 1XD9A 1Z28A 1X65A 3PQCA 2REXB 2ZJQA 2Q3MA 1FFHA 3CWQA 1G4UR 1KKMA 421PA 2AMCB 2RGNA 3KB1A 1F2TA 1GNPA 5J3BA 3CCSA 2QSYA 1UE1A 3SYNA 1KGDA 1U9IC 3BFKA 2GETA 1R5OA 3QENA 2HQLA 3HJNA 3VTKA 1HNWL 2XJ4A 3ZS8A 4GOKA 4GOPC 1CJVC 3NBYC 1PV4A 1DAGA 3VNVA 3Q5EA 4HJ8A 1VYTA 1L4YA 1P9NA 1KTVA 3CX8A 2IHFA 1AH9A 1GG2A 4O2LA 3OFND 4Q1EA 1WB9A 1KI2A 3TAHA 2OLKA 4HUQA 3AP1A 4LHXA 4V0MA 4X64Q 1UE7A 1GL9B 5E95A 3GLHB 2XB4A 1UDXA 1P2VA 1T8UA 1G64A 4U5XA 2GJSA 5KSPA 3UDIA 4TL8A 5ELOA 1Y1VH 2GEVA 1H9SB 4LZZA 5EZ5A 5JBQA 1KC8C 5EUMA 2WJIA 1R4AA 4D6PA 3ASZA 4A2PA 3CRLC 3REGA 4LUOA 2IUSA 3I4MH 4EJSC 1US8A 4D0NA 4GNXB 4TYYA 1QZGA 4BASA 4JLPA 4KV9A 3ZD6A 2W2XA 2Q21A 2ZRAA 4LRWA 3M1IA 3W5OA 3CAMA 4EQ6A 4OL0A 2AUKA 2IX1A 1KDOA 3FMIA 4A0HA 3CPWA 2VP6A 5BYKA 2HEIA 1H8HD 1YZQA 1K8RA 3F1ZA 1E9DA 2RHSB 3MMPA 1DAIA 1ELOA 5LMUL 2O5JC 3T5DA 2AL7A 1HQCA 5A5GA 2BV3A 2RMKA 1R2QA 1P62B 4Q7MB 1BBWA 4ZDWA 1WA5A 3I73A 4GP7A 2R92G 2GXSA 3T1VA 5JWOA 4BY7H 4HIOA 1D2EA 3IBGA 2JLZA 4HLCA 4BFSA 1X54A 2N49A 1A1VA 1SRUA 3K0AB 1Z0FA 2ZANA 3QOFA 3EASA 5HKKA 1GHJA 3L0OA 4OQFA 5G41A 2Z6KC 3CMAA 5JJKA 1KMHA 3I1FA 1N5LA 2BWJA 4TSFA 1VQOA 1SLJA 4JJKA 4AKHA 2NO9A 1LV7A 1VQJA 1TX4B 1YEZA 2Q3HA 2JK8A 4A3DH 3KDFB 1DS6A 2JLUA 4G5RA 1S1CA 4CEIB 3VKWA 3AB9A 3CH5A 5C4XH 3GMTA 3D7MA 1OH7A 4EPYA 1NG9A 5JI3E 1YIJA 1UE5A 3B1XA 4RKEA 4PO8A 4KKUA 4AH6A 1XJVA 2NMVA 1AKEA 4Z54A 1VHTA 5FPYA 2C9OA 2RGGA 1XMOQ 1BOFA 3EX7C 4UQOA 1EGAA 3EZFA 2PT5A 5IP7H 2X2FA 4PZ7A 4PHHA 2ZREA 1GTVA 1SVKA 3M6AA 4BZXA 2C03A 3MD0A 3TW8B 1N36Q 2V4ZA 3U61B 3A8KE 1UM8A 4C3HH 1Z6TA 4JBJA 2QMOA 4OI2A 4EQ5A 4LF4L 1N6IA 2JQOA 4C0LA 3NDBB 1FL0A 3DEFA 4P72A 1SULA 3TSWA 4LHVA 4JLKA 4H9GA 1XMQL 4IOJA 3VR3A 4KBGA 1H9JA 4JI3Q 1YNXA 1C4OA 4LHWA 4KHPL 2V1XA 1GDDA 1T3SA 2KJQA 2DPXA 2PI2E 3HYTA 4L4UA 3K8AA 1A62A 3KLWA 3DM3A 2IA5A 2KBNA 2ZRLA 4GOXA 3RRYA 3T5GA 5B30A 1HH4A 2JJQA 2GF9A 2EW1A 2O8FB 1Q8KA 4PFSA 5M3MG 1YJWA 3UIEA 1TNDA 2A2ZA 4LF9Q 1C1YA 5D3MB 3P26A 4DR7Q 1H8ED 4ON9A 1X3EA 4A3KG 2IWRA 2VO1A 3H3VI 2B8FA 2GN5A 2ZRGA 4B6FA 1IBKQ 1AE3A 3TJZA 2NIPA 2LMCB 4BBRG 3A7LA 1H65A 4IDPA 4JLBA 4OQXA 3SC3A 3TUIC 1LUZA 4LBZA 2Z5FA 4NYJR 3U7EB 3V9PA 5HCNA 1EIFA 2QF7A 1LYLA 4P75A 2GESA 3S24A 2F1HA 3FTQA 4LNQA 3RS0A 2AHOA 2BEJA 4B34A 4BRWA 5KOYA 3T1HL 1RRPA 1FGUA 2XTIA 1T6NA 3HR7A 4LFBL 2OT3B 3QF7A 2QP3A 4LWCA 3J80c 2KWIA 3I7FA 4URVR 121PA 1IY2A 2ERXA 4TMXA 2OCAA 4MYUA 2NN6H 4P4SA 3P4XA 2KB0A 2CFMA 1FX0B 2RGAA 4FWIB 3GJ4A 5FH9A 4O3MA 1HURA 2DFKB 4GDFA 3KF6A 3TEHB 4HI0E 4R2HA 1I94L 1HTPA 2ZJ2A 4DV2L 4H1UA 2JEBI 4KXFB 4H02A 3CCJA 4DV7L 1ONBA 1DAEA 2OCPA 3RWMB 1T5IA 2XXAA 1ONLA 4NXML 2JA1A 2UUBL 3QIAA 2F3IA 4O2DA 5FJ8H 3UDGA 1W0KA 4FIDA 3GQBA 2H16A 4I1SA 4DLYA 1SMXA 1RL2A 2OZEA 4DLUA 3O8RA 3ASYA 1ZU5A 4KMUC 3GJ3A 1QG4A 1ZNWA 5HE9A 2JA8H 4DCTA 4X62Q 3DL0A 3THWA 3GJ5A 3CPHA 2ZITA 1XPUA 1E2DA 1NBME 3Q8DA 3K09A 1AM4D 1P9RA 3WBJA 1DARA 1LFDB 4JBMA 3VQTA 2XEXA 5AJVB 1Q12A 3AF3A 1Z0JA 1KI1A 4WXPA 4Q5IA 1RW4A 1EQRA 4KO8A 4QOSA 3M9BA 5DN6A 4MA4A 4A0GA 2ZTEA 4L5BA 1GUGA 1KOFA 3GTKH 1WE2A 3L2OB 1JQLB 1G6PA 1OFIA 2JA9A 3AB3A 1T4GA 2F7SA 1UKEA 4O0MA 3TQYA 4BA1I 4D4KA 1XBTA 1Z0DA 1A7JA 1OV4A 1EWIA 1BBUA 3TRZA 2JGNA 5IE8A 2ZRBA 2W0SA 1NJIC 1F2TB 2ZS8A 5CLLA 2VY3A 1GM5A 2AXPA 4ESVA 4MUBA 4QBGB 1XCGB 2OEPA 4R4CA 4XWKA 2FN4A 2PZGA 1ZYRC 1W3SA 4Y0AA 3SGIA 3CF5A 2FF7A 2P6RA 1HCZA 1K8AC 1W1WA 3PUYA 3KYHC 1IN6A 3OW7A 3J81j 4B47A 4Q9JA 2C35B 4GKKQ 3I55A 2QP4A 3ZIAD 2YYZA 2A69C 1RPZA 1GKHA 1GL7A 3HOZG 1Z06A 2F4VL 2W0MA 4HUQB 5IT5A 2E87A 1UDWA 3TMKA 1TXYA 5C1BA 1JNYA 4AYTA 1K8MA 1YITA 1KY2A 2UVQA 4XH9B 2AWOA 3ICEA 1P3JA 4GNXC 1QHGA 4DZZA 1PA6A 1O78A 1XRJA 1XNJA 4OXPA 1NRJB 2B29A 2JDIA 2VZAA 2QSZA 4RCNA 3IQWA 3TAUA 2LSSA 2WSSA 4AYBG 1VQFA 1US8B 1KK2A 1E9BA 4J15A 1CLUA 1XTKA 4G5QA 4LV6A 1U8ZA 3WBKA 1E2WA 4IFDG 2K52A 3OTOQ 2FSHA 3DPUA 2Q2HA 4EQ6B 1NNEA 5C44G 4AIIA 2E5LQ 2RHMA 1WMSA 1CJUC 2FGKA 4CDGA 4M2LA 3K0CC 1FQJA 2ZS7A 1X6OA 1G18A 3PIPA 2O5IC 4ASUA 5DHAA 1T9HA 3AF1A 4NU0A 1YVCA 2O0HA 4RG1A 2YTXA 1E2LA 3WRXC 4DR5Q 4IJLA 1IQPA 2WAXA 3H0KA 2F6RA 1P60A 3QE0A 5KPJA 5GADl 3NIBA 2A69D 2K7VA 4Q19A 1KSGA 4A15A 4TLCA 1SXJE 4MGKR 1HE8B 4DAMA 4HDCA 5B58C 1VHLA 2AFHE 4IJHA 2JLWA 2QE7A 2X1VA 3B2EA 2V3CC 3HKZG 5LMNL 3LDAA 3STBC 4JI0L 4NE2A 3MWYW 3AEVA 1E9AA 2OFXA 1FJGQ 3PO2G 1ZMXA 2ZYVX 4LY6A 3W1GA 2BA1A 1R6BX 4C4PA 1ZD8A 4P73A 5AWFC 1E22A 1BMFA 1X8KA 4Q7JB 1Z29A 3TK1A 5FLMG 1X86B 4A3FH 1YZTA 3MWJA 3NELA 4XVRA 4RSGA 2IYLD 4M9XA 1C7YA 1WFQA 3M3YH 1M7GA 2PNRC 1VQBA 1QVAA 3F0TA 3DO6A 3S2DH 4APVA 4QC2A 3SBDA 1XMSA 5FI1B 2XB2A 1IAQA 2QI9C 5KDOA 1RVDA 1E1RD 1E69A 2QGZA 3X2SA 2F1IA 5G3YA 5SZHB 4P3YA 2CNWA 4FW9A 1NMYA 2UXDL 3BAFA 3RHFA 1X3GA 2VQEL 1M74A 1NSTA 2IYTA 4K8OA 4DXAA 4HUTA 3G0HA 2GCNA 4UXIA 5CJPA 2P0EA 1IJFA 1FL9A 5HZHA 5F9FA 1YHAA 2F52A 5DGXA 5KO2A 3GO5A 3QBTA 1J6QA 3P4YA 1KO7A 4CT4B 5F9HA 4NYIQ 2XOKD 1VF5C 2IBMA 2VYFA 5EZ6B 2VF7A 4HJ5A 2CCGA 2QU8A 2X8AA 3QKRA 2ZVPX 2QG6A 2QY9A 4CRWB 1I6HH 3STBD 5IWAL 4JI5L 1VQPA 4RZXA 4QIWE 1E99A 4HB3A 4IPHA 3CPJB 3WMFA 3FB4A 3WHLA 1TL7C 3PEWA 3ND9A 1MV5A 2VQFQ 4Z8XA 4UNNA 3K0FA 2ZI7A 4TL7A 4MYCA 2ZXUA 4TLAA 1G3IA 2RKOA 4PHFA 5J4LA 3OESA 1UF9A 1OH5A 1N5IA 2QROA 4Q00A 1DAKA 1HTWA 2DR3A 2FZLA 4M21A 1FNNA 3IEVA 2YV5A 1LY1A 1TUEA 3QXCA 4IDQA 1S0UA 3S1RH 2QM8A 4P33A 3SFVA 3AVUA 4BY1G 1UFQA 4AQYQ 5JFGA 5GAHC 2EJGC 3BJIC 4L9SA 4B6EA 4DK0A 1P2UA 2BHRA 5JWHA 2JIZA 5JHHB 1COWD 2IF2A 2JEOA 3RRNA 3WP0A 5ELXA 2YVUA 3K80C 4QNRA 4JI8Q 2AHOB 3KQLA 2ZTCA 4JL8A 3BORA 1UAAA 3G48A 3WNDA 1KO5A 1MH1A 4JYAQ 3ZZTA 1HNZQ 4MDEA 3ADDA 2FG5A 5G40A 3I8SA 4EFNA 3KF6B 4AK9A 4DIEA 1E3PA 4L8JA 2PBRA 3BH7A 2HT1A 3A1WA 1GUNA 2XXAB 1NKTA 3KF8B 1K9MC 1Z2AA 4Q4HA 1PH5A 4WJ4A 2PT7A 3A4LA 4RJLA 2HHHL 5FL7A 3VHXA 4CT5A 2AFIE 2QTFA 4FN5A 2IEZA 3LY5A 4DR4Q 4LOAA 2YOHA 1NJFA 3LX8A 4I99A 3THWB 1WCMH 4URWR 3NEYA 1ZJ6A 1YI2A 4UNPA 5EP2A 3KJPA 3LBIA 1N5KA 4DK3C 2E75C 2FV8A 1U0HC 2WVJA 1ZD1A 1VQMA 1HY3A 4C9BA 2WB1E 1D5CA 3PG5A 4IRUB 5TXGA 3C14C 1W4CA 4LPKA 1B9NA 4F93B 4IW3B 1ZUIA 5DISB 3LXXA 2CLSA 2J9RA 2ZR7A 4YDHB 5JS8A 2ATVA 2RGNC 4TYNA 3MFYA 1VG0B 3UMRA 4X66L 5SZIA 3U58A 4R4QA 4PZZA 1I4LD 4GP6A 4Q1CA 3QPVA 4LYJA 1CU1A 4C0BA 2A5DA 2DWPA 2H57A 4PV1C 1H9KA 4QGGA 2N1BA 2J0SA 2PCFB 2QUZA 1II9A 2UUAL 1BH2A 4HZIA 4ZDKA 3ZLJA 1X9NA 3H0GG 3ZDQA 1KI6A 1NJGA 4MH0R 4A0RA 2J59A 3GTOH 1TUIA 2ZM6L 4A3EG 2IX0A 2QRZA 1W0JA 3DKPA 3J81k 4DLVA 1IW7C 2AKWB 3EAQA 1IYVA 5AJ3L 3Q7PA 5FPSA 3GLFA 1IBML 4RY2A 1IBLQ 4DNIA 3UK6A 2PZFA 2G0TA 3N6RA 3EIVA 4BLOA 3KZ1E 2CQOA 4BPBA 1JR3E 4OYHA 2N8NA 4RD1A 4Z1MA 2VL7A 1AS3A 4A3BH 1VCMA 3DM5A 3OAAA 3KQNA 1UPTA 4GPTA 4CEJA 2PJRA 3O8DA 2Q6TA 2QM7A 4DVGA 4R71A 4PANA 2I5LX 1KYIA 2W2TA 3PV0A 1QHYA 4IPGA 2HJVA 2E76C 4HAZA 1A0IA 1BKBA 3N70A 3P27A 1NIPA 4M4SA 3TUJC 5JCZA 1SVLA 3AF4A 1MRSA 2OESA 3K1JA 3QXSA 1OF1A 2P6UA 3B82A 1F60A 3CP0A 3AVVA 4JBKA 4JKYA 2MMCA 1D7QA 2WIAA 4NXNL 4GN3B 2DYKA 3DMNA 3VU9A 1Y63A 3ZJYA 1BKDR 4FWTA 2MSCB 4K0KQ 1AQYA 1Y1WH 2NO6A 4IHQA 5EXTA 3O8BA 4UNRA 2ZS9A 4MYHA 3M4PA 3NEJA 1M1KC 4JI2Q 1A5TA 1MABA 1N6PA 2VRWA 4XVQA 2ZTSA 3SEAA 2WPDA 1X1RA 4PSKA 2ASBA 2C2HA 5AJYA 3RS3A 4JC0A 4IOLA 1MT0A 2MSEB 1DEKA 2O0JA 3SZRA 3WHKA 1Q1QA 2ZJRA 4YY3L 3K0EA 3K9GA 4HLDA 1HR0L 3KJIA 2FNAA 4Q4LA 1HQMC 2Y0SG 4PHTA 4A2QA 1IW7D 1XTIA 3IKJA 2WP8J 1R8QA 2GXUA 4DSTA 2E8GA 1I5FA 5K36H 3CD6A 2IEYA 3QXHA 4JMPA 4TMZA 3PXGA 3TVTA 2E9SA 4D26A 1FZQA 1UKVY 4A6XA 3FHTA 4HSEA 2XSZA 3JVUA 2FA9A 3Q8XB 1HNWQ 1VF7A 1T0HB 2G0NA 4CW7A 1JR6A 5FBRB 3PEYA 4JI4Q 1Q46A 2BBSA 3EIHA 3GJXC 2BCGY 3S17H 1JB1A 3QNUA 3KFXA 4JI6L 4JYCA 4IOKA 1P6XA 4B73A 2UXBL 1ZM7A 3T35A 1VQHA 2O8DA 3VA7A 2TMKA 3AVOA 4LF7L 4HYYA 1RJ9B 2VUMH 1VQEA 3U50C 2DGYA 4ILEA 3ETLA 5DI3A 3IIKA 3W8NA 3GEHA 1GFIA 2K32A 2EQSA 3KX2A 1AK2A 1IHUA 4B3MQ 1YZGA 1YJNA 5D3MA 3U60B 4POFA 5DYGA 1G6OA 1JJ7A 3ZVLA 1OJLA 4UKDA 2R9VA 4Q9LA 3AVXA 3CO5A 1KIXA 2OXCA 2BCJQ 4MKFA 4YMUA 5EJEA 1BDOA 3F2DA 1KK3A 3KUDA 3QUSA 4Q9KA 4BZQA 5HKKD 2P2LA 2IT1A 3UKDA 2HCJB 4BQSA 3IQXA 1EXMA 1Z8FA 5J47A 1KY3A 3QKRB 4TSFD 4PO9A 1PH9A 1CBUA 3QY0A 1N32L 1IXSB 3D31A 3FKIG 1G8PA 1ZW6A 2O0KA 2G3YA 3FPPA 1OIWA 3K0FB 1Z22A 4A8JA 3GDEA 3JAMi 1XWIA 4GBMA 1A8VA 5LD2B 1VDZA 1HJPA 3CRKC 4L15A 1GZSA 3AKEA 3NEMA 1E0SA 3G82C 5IYBH 1M6NA 3NKVA 5D3QA 2UXCL 2ZEJA 3UE0A 3KOJA 2RH5A 4PAMA 5TV2A 3MUFA 4DLZA 3ZQ6A 2ZUBA 2CLDX 2WIBA 1J99A 3ER0A 4NPSA 1VQNA 5E7MA 4QNMA 3AFPA 3GTPH 1ZM3A 4FMDF 2R8RA 4O2RA 4A1FA 4ACBA 3K70C 2D7CA 3THYA 1D2MA 1QUQA 1E9FA 2G1JA 3K7UC 2NZHA 1M7HA 4DLSA 5KU1A 4US2R 4RZUA 4R2IA 3I2ZA 2KE5A 3I32A 3IIMA 4II7A 4Q02A 5CB6A 2QENA 4NMMA 1Y69U 2IHBA 5BN4A 5M3FH 4KFSA 2L15A 2VSOA 2ZROA 2V6IA 1KNQA 3VR5A 1ZBDA 3OEEA 1JEDA 2AKYA 2QNRA 4GN5A 1YR6A 1A6XA 4MGZR 4Q4HB 4B74A 4FDBA 5BWMA 4GMXA 3U7GA 1TWFH 1ZCBA 4DR6L 3K09C 3EIQA 3CH4B 1Y8PB 5FTNA 4RCYA 4LF4Q 1GP2A 4FMDB 2GCOA 3TLXA 1NVVR 3DM9B 4Q66C 1DOAA 1TWCH 3MXUA 4ALPA 1XMQQ 1JAIA 1EFRA 3CCEA 4DR3L 1RIFA 3PENA 4FI3C 3X1XA 1GVNB 2GK7A 2VP2A 2VNUD 1MO4A 3EXAA 621PA 2ZQ5A 2DBYA 5BXQC 4EFLA 3IFTA 1DPFA 2QORA 5CB8A 3I72A 2WSMA 4BFUA 4ZCLA 5C0XH 3K70D 4KJZA 4PPGA 5FR1A 2HYDA 2LXKA 2WBLC 3MJHA 3KKPA 4JV5Q 4I4LA 1XFAA 2WAQG 4WZAE 5FUXA 2V8OA 2VSFA 3H4MA 5J4YA 1QF9A 4B3SL 1YBYA 3G71A 2C9CA 1SROA 5HY6A 2F3RA 1ZC3A 2YWHA 4XVUA 4LF6L 2W6JA 3EC2A 4JSTA 4LJAA 4MGYR 3HFZB 1W0KD 4NTZA 3UMSA 1XDBA 3TRFA 3S15H 1ZIPA 5IYDH 4M0LA 3VR2A 1PYSB 1KI6B 1N5JA 4DLXA 3S1NH 1G7SA 1SXJB 3T1HQ 2CVHA 1TU4A 1RIPA 4OWWB 1I4TD 2KBFA 2NN6I 3WRYC 2PMZE 1SVIA 3K0XA 4JL5A 2IC5A 1N6HA 4LFCL 1MRNA 1J7KA 4RD2A 2FSFA 4OQMA 5DLQE 1KDPA 1J5EL 2Z4SA 4QRHA 5F3WB 3ZQJA 5EE9A 5DN6D 3CCQA 1OE0A 3U6BA 2OAP1 1Y14B 1Q57A 2KSQA 4N3NA 3CLVA 4G5OA 1II0A 4JLJA 4QG7A 3OIUA 4V0OA 3UPUA 4CEJB 1ZNZA 3RNLA 4NXMQ 3LQRA 5JSZA 4IFDJ 4DV5L 1MKYA 4B3RL 1Q0UA 2R93G 1X3FA 3CXCA 2FSIA 3MWLA 1YNNC 4TQUS 1GKUB 4M53A 2O5VA 1E1QA 4V0KA 1WCV1 1U90A 1KAWA 1Z2CA 4JL6A 3BWDD 1NMFA 3HU1A 4NB3A 1TF5A 1KKLA 1VYVA 3VU9B 4NL4H 2JJ1A 2NGRA 5ELNA 3F2CA 1KIMA 2ZJZA 2R6DA 1KI9A 3BZCA 2CL7X 3AEZA 4OHVA 1MABB 4A0FA 1FMLA 4OX9L 1XEXA 1BIFA 1Z5ZA 2A5FA 3IPYA 4IFBA 1MKHA 3VX4A 3T1TA 1UKZA 3MSXA 3RS2A 2JJ2A 1GNQA 1Q1EA 2BE5C 1S40A 4KAXA 5TY0A 4GI7A 2D0PA 3N5CA 2YHSA 1LTLA 3B1VA 4N0DA 2NO7A 4X8MA 1PH6A 4KLZA 3DVLA 4GS3A 2QAGA 3TIFA 3EZ9A 3SNHA 2BBTA 2JA5H 1E6CA 4HB2A 4M22A 5DE3A 1YJ9A 5FBLB 3LRPA 4IPCA 1UJ2A 2JDID 4DSNA 3CMEA 2WOOA 1AN0A 1RYFA 5EXPA 2WSSD 3HU3A 2NPFA 3RRZA 3TVDA 1E96A 3TR5A 3BU2A 1FUKA 3QXXA 3ZGXA 1OFHA 1X8LA 1QVFA 2WJGA 2C9YA 2Y8EA 4FMCB 3K0SA 4MDFA 1E2IA 2A7QA 5EE1A 3OYYA 1XEWY
chains in the Genus database with same CATH superfamily
1RACA 2O8DB 4Y2HA 1KS2A 2VHEA 1NVMB 1GKYA 2QX9A 1CYEA 2CXHA 1CDEA 2J0VA 2GGSA 5BVGA 4U7WA 2NO4A 3H1PA 4YAOA 3H18A 2DPGA 1C7RA 1PYWD 3G88A 1FR3A 3MOIA 5TGZA 1ZLXA 1ZLYA 1BMFD 3FOFC 1E1OA 3UK1A 3E9YA 2W9XA 2PQMA 1WTXA 4AY3A 1G8GA 4D9GA 3TSYA 3UC9A 4B81A 1V4BA 3KT0A 3VC3A 3HYLA 4W99A 1K3FA 4KN9S 2PXCA 1NNUA 2WFWA 1IB0A 2DULA 3G3EA 4AMYA 1OQAA 1NBHA 3RC9A 1SBTA 4Q03A 5H3HA 1G20B 1BGVA 4DC9A 4WKBA 2G9QA 2AXNA 2YU9B 2I22A 3WADA 2PVCA 2JIZD 1F9AA 2VDRB 5TVKA 4Q3KA 5LQMA 3LQ2A 4DQLA 1RWWA 4TVAB 1IBRA 3TZQA 2X2PA 1VHDA 2GD6A 4RPIA 1U2QA 2Z8LA 1QUFA 1GO3E 1XI2A 2R7ZH 1LABA 4BTVA 2CJWB 4BATA 4CMGA 2WM9B 1KMCA 2PLFA 4L9RA 2C8LA 1AN9A 1B8UA 1CR0A 4IHJA 2HHLA 4OXKA 2IYUA 4WH0A 4TLBA 1WRBA 4GO1A 5FBWB 2IXFA 1OTCA 3MIIA 2L4NA 4DWOA 4QGFA 1MORA 2DNCA 1OLXB 3NHFA 4PC2A 4P53A 1OHHA 4N8X1 2E74C 3PNLA 4RTKA 2XB6A 4XB1A 1T9BA 2F67A 4Z8YA 3LW7A 4W5HA 3TIVA 5GZ3A 1WF3A 3FYHA 3H3VC 2AN9A 4KP7A 3L84A 2P2GA 3BRQA 3CF4A 8MHTA 4MIUA 1VMKA 2FK7A 1ENFA 3QG5A 1VJ1A 3T13A 1O1YA 3L8FA 2A3RA 3PE4A 4FM9A 4Q21A 3U7JA 3ZHYA 2J0UB 1PZHA 2F0WA 1VQ7A 3IT0A 3HSSA 2Y9PB 3W2DA 1BX1A 3RJ5A 1IE3A 4R1LA 3IIEA 1F0NA 4HPJB 3UW3A 2Q2VA 4K81B 2RKBA 2V59A 3F78A 2VQ3A 3AV3A 3C3KA 1HPLA 1ASYA 3L6RA 3T7DA 3LFHA 4LF7Q 1IN5A 2GSWA 4K6HA 2YJNA 1T8SA 2AZMA 2XAUA 3PIO3 3WZ2A 1A71A 4P5PA 1Z0AA 4BP1A 2TYSB 1CTMA 2B2NA 4ZOBA 4ES6A 1GTRA 3YASA 1QUEA 3OZBA 4FSHA 1Q0RA 4ZAXA 2YW2A 3WLTA 2VQEB 2IS1A 2P79A 3WKAA 1UC4B 1AZSC 4MAAA 4LAAA 2UXCQ 2RGUA 3OEED 5IWAB 2JBAB 3R2JA 1WCYA 1WBJB 2PRIA 3G2OA 1T4CA 3W5CA 4CZ2A 5LQDA 3EBOA 2BH8A 3N8IA 4BNLA 1S4MA 3LZDA 3NTVA 1N1DA 4HRXA 4AROA 4B5LA 1PTOH 2CE2X 4UD6A 4CGZA 1FC0A 1C41A 4ZP1A 1X15A 3NAMA 3VR2D 1QRAA 4JZYA 4H4EA 4DIMA 2Z6VA 5EPUA 2GI4A 2GEDA 1T9GR 2GN4A 1F9RA 1L7QA 2ZSBA 4XWWA 3VVLA 2VJBA 2WILA 3ISTA 4FYMA 1WTQA 4W6ZA 1SJED 1QZXA 2SDFA 2NWQA 3L8YA 2VAMA 2JGKA 2W98A 1N6OA 3U5TA 2IU4A 4HUJA 3U4QA 4AJNA 1QFMA 1L4FA 3Q0AA 1P8JA 2C7VA 3IFSA 3O84A 3VKUA 2A7XA 2GR9A 2O2LD 4FVTA 1BU8A 1JECA 2E21A 2ONCA 5K6AA 2W2QA 2MCFA 2BJVA 3D4DA 1FXSA 1AMNA 4MWGA 3A1TA 4E5UA 4ZGBA 3LV8A 4AM8A 3P2JA 1BQ3A 3TQCA 3P9IA 1F48A 1BQQT 4RQBA 1G2IA 4TV9B 5FTMA 3KHUA 3DE6X 3TOZA 2IBSA 5EE3A 3RBAA 1CI3M 4DLNA 3KXPA 1DD2A 1MEEA 3KUPA 4K40A 1RYDA 4DUZQ 1L7MA 1TVEA 3HABA 4O1IA 2ZI5A 3DDNA 2HUPA 1PT9A 3KYCA 1KDVA 5BV2P 5E0KB 3W5JA 1QIIA 4CIAA 1OTYA 3W04A 2CLMB 2HSEA 1DYQA 1OBVA 3G17A 4S24A 1E92A 1A8HA 3C1EA 2EZ4A 4RNCA 2YS6A 4D44A 3VVCA 4IQ0A 4M8LA 5C8VA 1OXVA 4YRNA 3LYAA 1ZSNA 1JZTA 5IS2A 1OXTA 4R3WA 5KKCA 1ZEJA 3QYJA 3QEBZ 3RJ9A 2OYCA 2BCEA 1G38A 4HR7A 2EJMA 2EWWA 1EK1A 4ZV4A 4ICIA 3PQ5A 3E7WA 2UVPB 3GN1A 2PWZA 5TX7A 1BA2A 3TLMA 1YO6A 2CSUA 1X70A 2WR8A 4BVFA 1XZAA 4AURA 3K5NA 1OIVA 4IFEA 2CW0C 3KT3A 2VF5X 1SQSA 4JI4L 2HO5A 2QSUA 1XEWX 1RYNA 3OD1A 2WUEA 4F85A 1EDDA 3F47A 4B75A 1PUXA 4ERXA 1NIJA 1T6YA 1XTDA 3JQ7B 4FJ2A 4JLAA 4L0QA 2VUMG 3R7BA 1NJ1A 3Q1KA 3NV7A 5IEBA 4RX1A 4LVUA 5KNCA 1TVKB 1BE6A 1LSOA 4K5QA 1VI6A 3OPXA 1JW9B 2X5KO 3NOOA 1EDOA 5G53C 1NA5A 4QTTB 3OU7A 1Z0KA 2ZJ1A 1VE1A 2IXGA 3LQYA 1F7UA 2PMBA 4MVJI 5IYBG 3L0IB 3QOJA 2CHBD 2PUFA 1W0CA 1SA0A 3CPEA 5CT5A 4R4OA 5ITWA 4C0KA 3R7NA 1EFLA 4ABNA 4XUGB 5FOTA 2Q49A 3GTOB 3T51B 3E1SA 4PLHA 1RP7A 1RC8A 3C3WA 3PICA 4PV7A 1X8XA 1Y8OB 1OI7A 5AVWA 4J16C 4BV3A 2E89A 3M85A 4KIFA 4J2TA 1ZCZA 2AV6A 3KFLA 1KVQA 5E9JA 3R5XA 1FBNA 1ZG3A 3OMGA 2CMKA 4RWZA 4ZIRB 3DBRA 5IYDG 3WGMA 4B9EA 3JY6A 4PGFA 1UDBA 4QRIA 3IVXA 4RIEA 4CKEB 5TJ9A 4DMFA 1GIAA 3LW8A 1G8KA 3SJUA 2BGNA 2W37A 2H31A 4J7XA 1D4AA 4OM7A 2HSZA 1Z7GA 3M3DA 3DVAB 3OZEA 3K7AH 2ZE8A 3LS2A 3ECCA 5L4NA 3EQ2A 2WTAA 4RC9A 2ZVJA 2JFFA 3N2ZB 1KZ6A 1JJGA 2IYQA 5CYFA 1X80B 1HDRA 3B8EA 1HG0A 1XYIA 3FWYA 3FVQA 5CLHA 1DWUA 4WCVA 5AUPB 2RHDA 3RVQA 2XVMA 5IVHA 1J42A 4BUJA 4I7EA 1BRTA 2YMLA 3FSGD 3QZUA 4FFNA 1CVIA 1ML3A 3EEQA 1XVVA 5HK8A 2QDKA 3TX6A 4W1RA 4YY3Q 5ILOA 4MZDA 2EDGA 1TYBE 4R8VA 3NRBA 4KRFA 5IZCA 4F3YA 4LHSA 4EHFA 2OAQ1 2C9DA 4WZAB 5KJFA 4DHEA 5DVZA 5FWNA 2O59A 1IG0A 4CV3A 1RHQA 1XQXA 3LXMA 5J2UB 2WF5A 1P61B 1I4OA 4MIYA 3KP1A 4Q3CA 4H6WA 4H7BA 3Q9LA 3JC66 3F49S 3S15B 2A5GA 4UMDA 1Z0ZA 2C2KA 4JELA 3FPFA 2HDNB 1ZVQA 1L7NA 1FP7A 5G0WA 2GAFA 3T1YQ 1IXRC 5JARA 4G3XA 4B7AA 1Q1GA 4FQ5A 1JIXA 1R9TH 2JGDB 4TM8A 5GGXA 4PNYA 3TPFA 5B1EA 3N7TA 4WKPA 4JLOA 1HL3A 4EPRA 2BTEA 1P2TA 1UAPA 3OZSA 4Z2AA 2Q2UA 1B1ZA 2ECKA 2UZ1A 4UARA 2OTCA 2J09A 3WYFA 2GBLC 2NXJA 5BN3A 2O7SA 4QXRA 1JHRA 2AYYA 3LBHA 2KECA 3EYAA 1FVOA 1XXLA 3SBOA 1HG1A 2O2YA 1K1EA 5L45A 1FS4A 5AJWA 1WCWA 4YECA 2C8JA 4J0QA 4O3FA 3ZYCA 3LTEA 2VP4A 2PT9A 3TWOA 3GEPA 2R93H 4F92B 2I71A 4LI0A 2Q6VA 5K3BA 3WWPA 3CN9A 5KQRA 5K8TA 2QTVA 2ZRFA 3ZIAA 5FUBA 1ZX1A 5KTRA 5JISA 2CV1A 3CCCA 5EPEA 1SUFA 2ZE5A 2YXEA 3JARB 2FLVA 4E94A 3KUXA 5LHY1 1KH3A 3MYRA 3U7IA 1M2OB 3AEXA 4DPGA 2Y92A 4NCXA 1GG5A 1CRZA 3A9VA 3WA6A 1F4LA 5IP5A 2Q9AA 4HGQA 1S4QA 4HMOA 4ZO6A 3NP7A 1N2CE 3SG0A 2VAXA 1I2DA 5CJJA 4BA2I 3AOEC 2OMKA 3BSSA 1GZ5A 3IT1A 3MJCA 3HGBA 1R10A 3WAGA 2REBA 1YUNA 3TD9A 2Q9BA 3V4ZA 1J97A 2IHTA 3A3PA 3TNJA 4B71A 1FDUA 2P90A 3KDFA 4JT4A 2F62A 3IOBA 4FBLA 3MT8A 1U8AA 1MO3A 5AOCA 1QGOA 3T9EA 4JFAA 1Z6HA 3COZA 4XD7D 4BEBA 3VYSA 1VSTA 2Q4TA 4DJTA 1CY6A 1JICA 3TSZA 1AQ6A 3DHQA 1V26A 5T6MA 2DQZA 1I3MA 1TUBB 4Q34A 3ZCQA 2WWFA 3FNEA 1NUQA 4LJ5A 2OB1A 1H2HA 3HOVB 5L37A 3WX0A 4A4IA 2REOA 2Z5GA 4TZKA 3QMMA 3ZWWA 4QIHA 1HLDA 1GTSA 3B6EA 2HA3A 1HZCA 1T2UA 4RCZA 3R3JA 3QIVA 1ZJJA 1UZLA 4G0UA 1VMCA 2GH1A 1LVUA 1WG8A 1VB5A 2D2CC 1IBLB 4HATA 1GN8A 2FUKA 1Y7HA 3NRCA 2PRJA 2PLAA 1SBBB 1X65A 1FFHA 3RJTA 3A27A 1PBTA 4F5WA 4P6VF 2AMCB 4X7RA 4B1FA 1UDCA 3UV7A 3EQ9A 5K3EA 4GOKA 3WISA 4LHXA 3VDXA 2A88A 2XA2A 4G5XA 5E95A 3ACCA 3JASA 4E4TA 3UDIA 1H9SB 4D0NA 2QRUA 2Q4EA 2ZRAA 3BSWA 2PKYX 3CPWA 2CVZA 4ZOEA 1LBEA 4ZA2A 2GO1A 4ZDWA 1MF7A 3SZ3A 4KB5A 2ILTA 2XUPA 4RQAA 1A1VA 3HOYB 1T5OA 3EASA 1GHJA 1KMHA 4RS3A 1U0FA 4HFNA 4MVXA 1DT5A 4I9NA 1RQ7A 2C58A 2Z2ZA 3N05A 2ZUVA 1VHTA 2ZREA 3U61B 4UQLA 4I4TA 4KBGA 4FFPA 1T3SA 4F38A 2KBNA 1C4WA 3UIEA 2KS6A 7ADHA 3D02A 3H3VI 2XD9A 2X8BA 3L4KA 2F1HA 4P93A 4DC1A 5IM4F 3I2GA 2O2IA 1WP4A 3GJ4A 3RUAA 1HTPA 4TUYA 3R9XA 1DAEA 3DFMA 3MMZA 1Q16A 3O8RA 5I5EA 2Y9MB 3MB5A 3GJ5A 2IYEA 3ILYA 3LGXA 4QOSA 2I66A 3KRTA 1TS3A 1IUPA 2J31A 1GUGA 4LRUA 3CJQA 5LQAA 4FFWA 3AB3A 3H5WA 4WFN3 1USGA 5J5AA 2PZGA 3RARA 2E5FA 1CRWG 4Z86A 4ZOLA 2C97A 4UTXA 2Q9UA 1CQVA 2H51A 2VJPA 3L3BA 1Z26A 2UVQA 2XGMA 4L5CA 4MRAA 1W5AA 4CDMA 2AZDA 1WKCA 1TCCA 2NVBA 4MVJD 5CV6A 4IV0A 5I48A 3FYTA 3EHEA 4AAYA 7MHTA 1ISFA 3JYHA 3NIBA 4Q19A 3ER9A 1CG6A 4ZCPA 1HE8B 5IG2A 1SCQA 4A8TA 3TB4A 4C4ZA 3R0VA 3AU8A 3MWYW 3FDZB 1EGHA 4MR7A 1JQDA 4AN4A 4P73A 2HWWA 2O2ZA 5EMNA 1GZDA 3S2SA 3RC2A 4RSGA 4M9XA 4H3VA 4EKEA 4C4RA 1E1RD 3LZ6A 5HRUA 1HTLD 5DHPA 1FYXA 2BRUA 4IIDA 3QLTA 2IZ6A 4OSPA 1HORA 3IV6A 2YNMC 3OETA 1CY4A 4RF2A 5ETJA 3W5DA 1E99A 1ACLA 1DBQA 1LBTA 3CVUA 1W85B 2ZXUA 4PHFA 1O94C 1PZGA 2DR3A 3AQIA 3FD8A 4P33A 1T29A 3EW7A 2JEOA 2OL4A 2XDYA 3MW8A 4RGQA 3ZWNA 3GAFA 1NUSA 2P9ZA 3LLSA 3MOGA 3RUIA 3ITDA 4JYMA 1V1JA 4KOEC 3G0OA 3I58A 1E3PA 3ZY6A 4FGLA 1WU8A 5J3JA 5IEJA 3FOWA 2E75C 3GEDA 4ZOLF 2XV1A 4N7RA 3URMA 3KHTA 2XADA 1I8TA 3W2HA 2QE6A 2FZEA 4B84A 3IEKA 3SMVA 2YWCA 3UJBA 3AWDA 3TVYA 4IDFA 3BCUA 2A1UB 1S2IA 2J59A 2QDLA 3NWSA 4A3EG 2IX0A 3DKPA 4JJGA 3ZGYA 4XLLA 2CD9A 3HKZB 4RY2A 4LMPA 2Y71A 4BPBA 1BCSB 4D5EA 2QLJA 5E1MA 3V4PB 4N54A 1QHYA 3T3OA 4M4SA 3ZX4A 2OESA 3BGSA 4RPJA 3PC6A 4L0MA 1BKDR 1ND5A 2MSEB 3Q3GE 4YY3L 3JSXA 2GK4A 4J4TA 4NVRA 3VAZA 4YJ2A 2YMPA 1M1NA 2QTZA 5K36H 3W3AH 2WA2A 1Z3CA 1GGHA 1P17A 3H65A 2V9ZA 2HB6A 4X1KB 3M6VA 3GCXA 4IKPA 1EVJA 2B2YC 3ETLA 2PY6A 3HFJA 5I9MA 1STOA 1U2PA 4FE4A 4X45A 3FFWA 5A9SA 5JH7B 3IQXA 1YI1A 2QJFA 2PQ6A 2C00A 5K99A 4TKVA 3ZHOA 2VDNB 3PJEA 3FDXA 1NAPA 1TLLA 1QGUB 4DLZA 3PDUA 3EGXA 1YHYA 3FTFA 1HE5A 1XA4A 4NMMA 5E7QA 1WCIB 2VWGA 4TS4A 4EECA 4C20A 1JDTA 4EI9A 1KP2A 1PK7A 4KJNA 1YR6A 4MGZR 4Z6KA 3LZCA 1QR6A 4DR6L 4R3NA 5CG2A 4GBED 1U8UA 1ZWKA 3MCTA 3MXUA 2X23A 1EJ0A 3WLRA 1T4BA 2BR4A 3X2FA 2DBYA 3VPDA 2B1JA 5EJ8A 3REQB 1HYBA 2HYDA 1J1IA 3OD5A 2JAUA 5BYBA 5LL6X 1KLUD 2C57A 1ZC3A 2W6JA 3ZLUA 2OXEA 4DR6B 5DTIA 2I2WA 3UMJA 4DLXA 4DPKA 2CYBA 3G8AA 3NK9A 3K0XA 3L8HA 4OH7A 1P1KA 2COEA 4LFCL 1QO9A 3FZQA 5EE9A 3N0WA 3OJCA 5DN6D 1ATIA 1QX4A 1OE0A 5ALZA 4JLJA 4C3JG 1PEDA 4D0RA 1H3FA 1UBSB 1YNNC 3ANMA 4M53A 1NC1A 3TLBA 3V34A 2QHXA 1EGVB 4LFCB 1JIQA 1Q74A 1ZO8A 4GI7A 4DMGA 1HDYA 1ECCA 4GPIB 2WKSA 3LUPA 5DE3A 5COAA 5FB3A 1AN0A 3CW8X 5K0TA 5EYPB 1TYZA 4ZO8A 2V7WA 3AF6A 1L2FA 1CRQA 3DEKA 4XOUA 3ULJA 3AEKA 2OCYC 4TTAA 4G9EA 5FHRA 2OP1A 2CHUA 2YR0A 2X22A 3H4VA 1DRWA 1G60A 2NXCA 4YCLA 3WV4A 1Y1KE 3S7ZA 2OC9A 4B33A 4J0KA 1TPYA 2OQ0A 2VK8A 3ESZA 2RQXA 2W43A 3OLCX 4D9BA 4FNMA 2QI9F 1AO0A 4XVCA 2KJXA 4J1TC 4XIYA 3D7SA 4HK4A 2DJFC 2FMUA 3H42B 3G2PA 2HXSA 1UK7A 4JFRA 2DEUA 1FYWA 1T2VA 4NBUA 1B1CA 3E4DA 3O4JA 4I1VA 3W7BA 3VGJA 1PS9A 2WVAA 1KEEA 3N8NA 5FBQB 4KLCA 1VGQA 5CA1F 5E6UB 2OK7A 3VR4A 3ZD7A 4GU5A 1F12A 1N2HA 2KW5A 3RTAA 3JSAA 2MSWA 3CX6A 4XX1A 1AN8A 4ZFNA 2CXOA 3NONA 3HSYA 4Q3EA 4V02A 1M2JA 1RLIA 3LUDA 4YJDA 1G4AE 3GGGA 1D2NA 3GNTA 1JMVA 2HMAA 1MOSA 4G01B 2VT2A 3MILA 3F4BA 4FYXA 4LOLA 5DTRA 2VHVA 4RAUC 2E2JB 3FVWA 4IR7A 4D9KA 5I7UA 3EPJA 5IN4A 3O94A 2NO0A 2VIIA 3MGAA 4ACAA 1F1BA 1Z83A 2WE8A 3PGKA 3QWIA 5JVDA 3BHJA 3L7IA 3CJTA 3L1VA 2ACWA 3GAZA 4KYIB 1GA1A 3GVPA 1CJCA 1I2MA 5COYA 4ME3A 2Y68A 3B8HA 4RL6A 4N6GA 4IFTA 3CRRA 3TW6A 3DWPA 2O2GA 3VNBA 3OOYA 4P3NA 3HNOA 1RI1A 1KSJA 4TMTA 1QJ4A 4G0NA 5FOWA 3CU5A 3DVQX 4AF8A 4UEQA 5JZVA 4OELB 3M4OH 1N0WA 3FRHA 3OTIA 3DL2A 4EI2A 4BMCA 3EUFA 2J0QA 5CVDA 3OLXA 4P36A 3IUPA 3EIXA 4EY3A 1CEEA 5T4HA 1MXFA 3EZ7A 2ZI9A 5CV8A 1CUWA 1ONPA 5JVH3 4YA6A 3JAKB 3L01A 4KVAA 2UXBQ 3ANXA 3FIUA 4F06A 3FI0A 3JVDA 2FWPA 3CF4G 3JWGA 5J2TB 5KYVA 4B17A 4YT8A 4RDHA 4KCGA 3SWWA 4N3CA 4UPVA 2O57A 2V6GA 1CUCA 4HC4A 5AW6A 1H6CA 1NJ6A 3ET4A 4LNUA 2ECPA 3ZOZA 2D1TA 2EOTA 3QE3A 3FZEA 1K68A 3PNYA 1S7GA 2KEEA 3F6PA 4U4AA 2XQFA 1QKKA 1XTVA 3NP9A 3WYNA 4DN6A 1S5BD 2K1BA 3A3KA 4LF8L 4F12A 4MX8A