3PUYA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 96
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puyA01
5CLLA 4KHPL 3N5CA 1DGSA 2K5VA 3BWDD 4JVSB 4YQFA 3T35A 4BY1G 3JC66 4X8LA 2QMHA 4NU0A 1I4DD 4OJQA 4QOSA 1N8RC 1U2RA 3WY9A 2OSBA 4WBSA 4LF9Q 3X2SA 4P73A 3QXSA 4HAYA 4B6EA 4DAMA 4JVNA 1U0LA 5ELNA 1XCMA 1G8HA 1KSHA 1X1SA 2VP9A 4U02A 2VA8A 3UWOA 3K09C 3ZS8A 4D4JA 3UDGA 1PVOA 3WNCA 1RC8A 2JA6G 5KDOA 3F2DA 4NCHA 1P8LA 3SNHA 3PO3G 1G41A 1MJEA 2WHXA 4IHQA 2UUAQ 1TQ2A 1QUQB 1N0VC 1BH2A 1GD7A 5GQOA 2ZE5A 3KXIA 1OE0A 4JBMA 4KFRA 3SS8A 5H1YA 2ZROA 3EZ6A 4M4SA 5KOYA 1VQOA 5J4KA 4IFDI 3PG5A 1YHAA 4BY7H 4TYYA 3IBGA 2C77A 2UU9L 1IW7C 2OEPA 1Y1WG 4DUGA 2OFXA 4Q7JB 4B48A 4UNSA 1OHHD 5J4LA 1Z28A 2D0OA 3U4QA 1X3SA 4I1VA 3ZLJA 1CJTC 2QTFA 4UNQA 1KD1C 1SULA 4GMXA 4E03A 2DWPA 3HOXH 4U5XA 3HYRA 1KY3A 4QIWE 4Q19A 4DV7Q 2NGRA 4R4TA 4Y0AA 1R0ZA 1UJ2A 2XB4A 3G6EA 1PH3A 2GEUA 2NPIA 2WV9A 3W8NA 2B6HA 5E7NA 1GVNB 3D8BA 3CR8A 3AYHB 2IWRA 4DLRA 4MKIA 1ZMXA 2QN6A 2ZR0A 4IVPA 2JLRA 4IFDH 1XXHA 4TLDA 2YWFA 4NXMQ 4AH6A 2V1CC 1AE3A 1CR4A 1S3SA 4Z1MD 4P4SB 3VFDA 5KPDA 1WF3A 1XEXB 2REBA 5FBLB 3THWB 3QPUA 3U44A 5JCZA 5GAHC 3E5HA 1YBYA 2IX0A 4JK1C 1HV8A 4LWZA 4DIEA 4A3GG 4I7ZC 2OAP1 1Q20A 3DHWC 3M0EA 3PUWA 4X64Q 4NYJQ 1W36D 2QBYB 4PHFA 2H8KA 2IYRA 2RCNA 1DADA 1BOFA 2QAGB 4Q4AA 4XWAA 4XJXA 2O8CB 4JVMA 4W5HA 2NZJA 1T6NA 4RY2A 1JQLB 4HJ5A 2W6IA 1G3QA 1TWFH 1R0WA 3QVUA 3PEWA 3THXB 3M1IA 2VEDA 4B3GA 1KI3A 5FPHA 1D2EA 2EFEB 1Q3HA 4M21A 4EJSC 1U5KA 1XNQL 2PL3A 2F1JA 2K5HA 1P72A 1GO3E 2QMOA 4JI0L 2NN6H 1OTCA 2OTLA 4PZZA 3LRPA 2VRWA 5EZ5A 1SVKA 2Z0MA 3IFTA 2BKUA 2G9NA 3OW7A 5GJWC 5FBVB 2XXAA 2G3YA 3BOSA 1N36Q 1W2HA 4MUAA 2V1XA 4XOIA 1HTWA 1II8B 1S96A 2CJWB 4MKFA 1KKLA 4JI2L 4TSFA 3KLWA 3PGZA 5M5WH 1PH2A 1JJ7A 5HZHA 4PANA 1Q8KA 3WHKA 4ARZB 3GTMH 3BFVA 3QF7A 4A3EG 1P75A 4HDCA 4PSAA 4NXNL 5TY0A 4DXAA 2B8WA 2NTYC 4M22A 1H95A 1FX0B 2IWHA 5KTYA 3GQBA 1G3IA 1VQ8A 2HXYA 2Q9AA 3QF4B 3F1ZA 1R0XA 2PEYA 4KO8A 2REOA 2YWGA 3FP9A 2GBLC 1CRQA 1F3OA 3VA7A 4CEJA 4X62Q 2VQSA 2HCJB 2IHFA 3L2PA 4LUCA 4V0ME 2BJVA 2IEZA 5A0FA 3UANA 1SHKA 2CHVA 5J3BA 4AIMA 1TQDA 3QE0A 2VP5A 4Z1MA 1ZM9A 1I2MA 4A8JC 4MNOA 3CAMA 3C15C 3B85A 3E70C 2CLSA 4Q01A 1VKJA 1GRRA 3M7NA 4I1UA 3C4JA 3T1HL 1VDZA 2JLSA 2TMKA 5HR5A 1EWHA 3CXCA 4ESHA 1DTSA 2OCYC 2R6CA 2UZ3A 2ZETA 4OL0A 4QFMA 3MWYW 2ZJ2A 3K0CA 4DR1Q 4Z8YA 5KNBA 4CEJB 2A6ED 3U7FB 3HOYG 5FTMA 3L7ZC 1CR1A 1KK2A 1ZD1A 3B1XA 3B9PA 2WAQG 1IONA 1LV7A 3LXRA 3LA6A 4XWKA 1IBKQ 1XX6A 2JEOA 1SQ5A 5J5CA 4IEEA 4OKSA 1VCNA 1Z0AA 2CCGA 4RKFA 1H9KA 1HUQA 1VQFA 4ZDKA 3EBEA 2J5XA 3W6PA 3PO3H 3B13B 5EJEA 1EFRD 1MIUA 3QUSA 4F4CA 3EIVA 1ZKOA 1AIPA 1N0WA 1A4RA 4LFCL 2C9YA 2OESA 5FBQB 5JSZA 3BS4A 3A1UA 2FGKA 3R9IA 5IP7H 1E0KA 1NG1A 3GFTA 1FYCA 2RF4A 3NEYA 1OH8A 2IUTA 4BPBA 5K36G 2H7VA 4MA4A 5GJBA 4BQSA 1MJCA 1VQAA 2V54A 4JMPA 1E0AA 2G88A 2FEOA 3IO5A 4B3CA 4HIMA 2IYTA 3LDAA 2Z6VA 3IHLA 1KYIA 1SMXA 2YV5A 3S1NH 1CULC 1GZSA 1RE0A 2C2HA 2QRNA 1XD9A 4ZV4A 2VSOA 5P21A 4EX5A 1HEIA 3KUCA 3DZDA 1AS3A 1A82A 3NENA 1JR3D 3GJ0A 3KKMA 3PR1A 4DV3Q 1WOCA 3OIVA 1GHKA 3AVTA 3L0OA 4AD8A 1G7RA 1WJJA 1G5PA 2AWNA 4DR6L 2XITA 4V03A 2IS2A 3AKYA 3G82C 1HQYE 2YC2C 4LC0A 4TMTA 4QGUA 2O8FA 1QVCA 4MRSA 2WOOA 4LUZA 4WOPA 4KLZA 4QNMA 1K9MC 3WMEA 4DLTA 4LGMA 1XXHB 2Z43A 1OXUA 2J9RA 1TWCH 4A0GA 2XZLA 2BBOA 4JI5L 4X8OA 2BOVA 3OW2A 5IHPA 3T61A 4D26A 5SZJA 3TNFA 1K8OA 3TVDA 2ZI5A 1COWA 1ZIPA 2E87A 5AR1A 2Q2UA 1HNZL 4XVRA 3M4QA 5EZ6B 2ERYA 3K80C 2IW3A 2WIBA 3AQQA 1D2MA 3KF6A 1XCPA 4D4KA 1Z8FA 1RRCA 3KOJA 2KHIA 1VQ9A 1CKOA 1R8QA 4LJAA 2JJ1D 3NIBA 3W3ZB 3B5JA 1OXXK 1FVIA 2VHQA 1SVMA 4LWCA 2ZRLA 4HB2A 4ZDWA 5J47A 4DNTB 1E6CA 2EYQA 1XJVA 2F55A 1G7SA 2GK6A 3ZS9A 1JECA 2B8FA 1NVWQ 3K70D 1IBML 1WB9A 1SR3A 1PHJA 4Q03A 2WJIA 3CF5A 3GTPH 1H9SA 2HIVA 1JAIA 3VR1A 4AYXA 1J8YF 4KSBA 3WXMA 5KDLA 2ZJRA 4LF5L 2HJGA 3ERSX 2IYWA 1LF5A 3SEAA 2JLWA 2J45A 3EW9A 3ADKA 3EIQA 1BO6A 3EA0A 3ZD6A 4B33A 3OYYA 3PVSA 4CGZA 3OEED 2Q0HA 2CFMA 1JQJC 4GT1A 1UDXA 2NN6G 4IFEA 5FLXc 2GZAA 1ZM2A 1FJGL 1DO0A 2O5VA 2FV8A 2QRZA 1Y63A 2F7SA 2D2FA 3EWAA 2ZTSA 3LXXA 2PCJA 3W9YA 2QP9X 2QAJA 5CLQA 4EJSB 3GLGE 1O3YA 2ANBA 3MXNB 2QL6A 2G0TA 4L5RC 2IYYA 2ZEJA 3I3SR 1M1KC 3SI7A 4WXRA 2BA1A 3DO6A 3I4NG 3IGFA 1GUNA 3RS2A 5IT5A 1N3BA 3QF4A 2ZYVX 2HHHQ 4GOXA 1KSGA 1QJOA 1CR2A 3VU9A 2JJQA 4QJ4A 2ZI7A 2CE7A 2WMNB 5EUQB 1UBEA 4JLVA 1C9OA 1MR3F 1VQGA 1PH9A 2XTMA 2XGTA 2WWGA 1CP2A 4B32A 2ALYB 4KLNA 2I5HA 1DAHA 1H8ED 1NN0A 4L5TA 4FIDA 3SU8A 2BMFA 4YY3L 1ANKA 2OLKA 2HHHL 1WYDA 1GIAA 2GXSA 3DMDA 3ZDQA 4QKQA 1GUSA 3W3AA 1TX4B 2J3EA 4AY2A 5FR1A 4KKSA 5GVRA 2ZJQA 3DM5A 3K0AB 1I2DA 1FW6A 1OV4A 4B75A 3AEVA 4A76A 2C98A 3E9HA 2PQAB 4O0AA 2X77A 3QVVA 3THXA 3VNUA 1NTGA 4IPCA 2F4VQ 1NBMD 3F5FA 3SOPA 2MSEB 3NG1A 3BH6A 4Q9LA 4QBFA 5LD2C 1WBBA 1YJ9A 1ZC3A 2QAGA 5IYBH 2ZSEA 4Q4AB 3ND8A 2VS1A 2Z6KC 1KKMA 1JE5A 3S14H 521PA 1TNDA 1JBKA 3KYHC 4JLDA 2KI5A 4P72A 2ZPTX 3TSWA 4JLJA 3MJHA 1CS4C 4DR3Q 2PMZE 3CH5A 5FFMA 4EQ6A 1E1OA 3EPJA 2FDCA 4R1JA 5C3EG 2JLQA 2Q3MA 4YDSA 3CZPA 4FINA 2Z83A 3R7WA 1H65A 1C4OA 4P4SA 3THWA 3TMKA 3GJ4A 1WA5A 2EWWA 2GESA 4MGKR 5KSPA 2PQAA 2ES2A 2GEDA 5JWHA 4ZPXA 3IDQA 4P71A 4TKOB 2KCTA 1EIYB 5AJXA 2R92G 3NEJA 3C5HA 1S40A 2EYUA 1A5TA 2ODEA 3A58B 1WFQA 1G7CA 1TUIA 1G64A 1S8FA 4OI4A 3RRYA 2H1LA 2A5JA 1HR0L 2UXDQ 2BH2A 1E32A 4GLVB 2AX4A 2GK7A 421PA 1W7AA 2E5LL 4ZDIA 4CEIA 4LK2A 3W5OA 1UDWA 2NVTH 1CKNB 1ZU5A 3GLIA 3TEHB 4A3KG 3U6KA 2HXSA 5LPNA 5JBQA 5CM8B 2ERXA 2R6DA 4GOPB 1F60A 1H8EA 3B78A 1ZCBA 4JYBA 4W5WA 1N6IA 3CR7A 1LTQA 1YRAA 2OCAA 3I4LA 5EXTA 1SFOH 1G4AE 3MCAA 2O8DA 3TBKA 3M4YA 4EUNA 1B23P 4EFMA 4Q1FA 2CLCX 3BXZA 3GLFE 5LD2B 3N2EA 1BBUA 4A75A 2KCCA 2GZHA 4KBGA 4Q02A 1DVRA 1XNRL 3C14C 5C0XG 2IYSA 4DLZA 3GLGB 1E1RA 4HAZA 2A5FA 4US1R 4RJLA 4EJSA 1VQ4A 1UBCA 1X6VA 4LBWA 4XH9B 1OXSC 4YMUA 1VQMA 2HCBA 2OFOA 4DUYL 3AF2A 2VL7A 3CCLA 5FL3A 5M3MH 1CIPA 2IEYA 4DLVA 1VMAA 2IXFA 1DARA 4XD7D 2YWEA 1KI8A 3QBTA 2WB1E 3K9LA 1L8QA 2PMDA 4XVUA 5FOUA 1C7YA 1KOFA 1A1VA 3UATA 2GXQA 5D3QA 5E7IA 3UMFA 1IXRA 1XEWX 4JOIA 3AFPA 3CWZA 3IRBA 2VQFQ 2EFDB 1SZPA 3B1WA 3NH6A 3QXCA 3MEFA 1E2DA 4RD3A 1H9SB 4I81A 2O8DB 2NO6A 2R6FA 3AF0A 2GJAA 1JJCB 4DR2Q 5CK5A 1T5LA 3K0SA 2VF8A 4JG2A 4X8HA 1X8LA 3PIRA 3CCSA 1PLKA 3ASZA 3AV0B 3CNNA 2BDOA 3ZVMA 2ZJAA 3THOA 3HOWH 2D74A 3QNUA 3K70B 4KJZA 2VQFL 4OWWB 4P75A 4CEIB 4DR5L 1ZYRC 4Q7KA 5AJ3Q 2VF7A 4LJ9A 5FPSA 1ZUNB 1N33Q 1UE1A 4KKUA 1YRBA 1GJXA 5IYDH 3S1RH 3HDTA 2OT3B 4URUR 4EPYA 5K8TA 1RRPA 2W00A 3CX8A 1X55A 2A1AA 2FWRA 2QT0A 3W5JA 4YWKA 2J41A 1CR0A 1TF7A 5GADC 4BLQA 4Q66C 1U8ZA 3VDYA 4A93G 4ZI3A 2H92A 2JJ2A 4FWIB 2H57A 1WE2A 1G6PA 4IW3B 2GHIA 1HH4A 3AH8A 3M4PA 4OHYA 2HJVA 1VG8A 1X3FA 2MFIA 1U0JA 4IRUB 4MTNA 4R2IA 4AK9A 4D0GA 1HCZA 2WFWA 2L15A 2AWOA 1RW4A 2OBLA 2R2AA 4H1VA 4B76A 1M90C 2R93G 4YC7A 3PIOA 3NVAA 3NBFA 4DV2Q 4JBWA 2ZJZA 3T1QA 3VX3A 3AVWA 4YXWD 4HATA 5FOVA 5EP2A 1WI5A 2OCEA 4LC1A 1VHTA 4LBZA 1DS6A 2W83A 2XTNA 3PCRB 2VO1A 4RCYA 3R8CA 3FMPB 2H5EA 1N33L 4YCVA 4DBLC 2X2EA 3A4LA 4M53A 1EYGA 4UY8C 2AMCB 2ZI6A 2WPDA 3IEUA 1Z29A 3KQNA 1YHBA 3WHLA 1N6HA 3B8HA 3T34A 4ZKEA 2GCOB 4IOJA 4QGGA 1OFTA 2RB4A 1X54A 2OBNA 4PHHA 4YWLA 3D7MA 1TUEA 5FUVA 1Z0DA 4DDUA 3AVXA 3MWJA 1EFTA 1W4RA 3C5CA 4O0MA 1GILA 5JSZB 3OAAD 4DEXA 3OZXA 4HZIA 2XSZD 1EUJA 4FMCB 4DSOA 4H44C 5BR8L 2D62A 1PH4A 3CC2A 1RFLA 2F1RA 3AGQA 1G3RA 1K6MA 4HZUB 4LPKA 4TLCA 4XVQA 4C0SA 2H17A 3A7LA 3OFNA 5AWFC 3C16C 4NCKA 4QNRA 4UJ3A 2FFAA 1UE5A 1US8A 1K8MA 1FP6A 1NSTA 1XCGB 1XNJA 2WOJA 4PQRA 4LV5B 1GRQA 1VQCA 3U2QA 5A35A 3ADBA 3ZJYC 2FE4A 5L3SB 5JEAJ 1KZGB 3T56B 1OKKA 1T8UA 1Q81C 4TL8A 3QKUA 3RN5A 4N0DA 3A8IE 1XZQA 3QKRA 4L5BA 2JEAI 4BFZA 4C3ZA 4CRWB 3RNUA 3REFA 1SVSA 2ZRDA 2J87A 1EWIA 2ATVA 2WMOB 3R9XA 2P65A 4QBHA 4AYTA 3GPLA 3TW8B 2JIZD 1SXJC 5KSZA 2GDJA 3ADDA 4ZIRB 4KN7C 3BB3A 4IFDG 3HKZG 3MLEA 4PXAA 5JWOA 3NHBA 1KGDA 2QY9A 3HGBA 4GPTA 4LHXA 4OI0A 2AKWB 4AWXA 2GVDC 3CCUA 4DR3L 2X8AA 1G7TA 3HOZG 4C3IH 3H1TA 1SVLA 1W46A 4G5OA 3AF1A 4GNXA 1YZTA 3PEUA 1JEEA 2Q2TA 3ICQB 3S1AB 1GNQA 1FX0A 2FPMA 3GLIE 4LJ5A 1ZNWA 2F1HA 1B9MA 3ND9A 2PCLA 1KI4A 4ZDJA 221PA 3IIMA 1NJGA 3LH5A 2W6ID 4I1SA 1J2JA 4DV0Q 1VCMA 2WM9B 1T5EA 1Y3AA 821PA 2ZS7A 4E5UA 1SRUA 1E2GA 3RWMB 1DAKA 2B63G 1CKMA 4IFDJ 3JVUA 4TLEA 1IY2A 2WWHA 3LY5A 1V43A 1BKBA 3RLFA 2HEIA 4IVQA 1KI6B 3UG6A 2KBEA 2WICA 2AUKA 2ANCA 3TQCA 1Z0KA 4L5QA 1VHLA 5HPYB 4PAMA 1JJ2A 2BEJA 1I94Q 1ASZA 1W36B 4B6FA 1M7HA 2AHOA 5EE1A 1VQ5A 5M3MG 1PJRA 4AURA 4EPVA 2QUZA 3DDCA 2LCFA 1X8KA 4EAQA 2CXXA 1NMZA 2WZQA 1LW7A 1R7RA 1F48A 2C99A 1G18A 3H3VI 2IYVA 2JA9A 1UKVY 2RMKA 5FOWA 5HCIA 3R8FA 4L16A 3U44B 2ZJOA 2O52A 1XEXA 5EP4A 1ZUIA 1OYYA 1PLJA 1NVUQ 3UDIA 1DOAA 2ZIAA 1UEJA 3VR5A 2N1BA 4TMKA 1AJEA 1IYUA 4IPGA 4MDFA 4RD4A 5KNCA 4R4CA 2P5TB 3CRW1 4GBMA 4ASUA 2CL6X 1H9MA 5F3WB 2GBLA 4HIOA 5JLJA 4C0LA 5J40A 4X66L 4F91B 2Z0SA 1SXJE 3A8TA 1AZSC 3S1QH 3T1YL 4B3SL 4Q4HA 1UEIA 4TYQA 4M9XA 1FPMA 5FOSA 4TT3D 4DSTA 4L9SA 4M2LA 2PH1A 3TQYA 4OX9Q 1H8HA 4DC9A 1G1MA 2BCJQ 1NLZA 4HSEA 2VIIA 3OIUA 3I5YA 3KKNA 4EPTA 2IC5A 3B6YA 1XB2A 5IYDG 4RFSA 4IDNA 3PCOB 3K09A 3NXSA 1Z6YA 4Q48A 1RIFA 1EIFA 1YVDA 4II7A 1WXQA 2ZI9A 2O8EB 3TUIC 1HNWL 3CCEA 4DCSA 1G20E 1XPRA 4AI6A 1KQSA 1YJNA 4RZXA 4X8MA 5ANRB 1PH5A 4MYTA 5DHFA 3RRNA 3FE2A 1BBWA 2B21A 5HKKA 3GLFA 2ZT9C 5KDDA 3BZCA 4NYMR 5DYIA 1I6HH 1F2UA 1HURA 4NL4H 4A0HA 5ELXA 4K81B 2KBNA 2JA8H 1NVVQ 2XJ9A 1N6NA 4BFYA 1XTRA 5IK2D 1IM2A 3AQ4A 3T5DA 4NZYA 3KKPA 4TWZA 5HE9A 3UXMA 4FCWA 3H0KA 3S24A 2JA8G 3V4RA 1IN6A 3VKGA 4AG5A 1L7VC 4JI7L 1JT8A 3AVOA 1HT2E 4GKJL 4R71A 5C44G 3FDIA 4JV5L 1ONLA 2QGZA 3OIYA 3VMFA 1CFMA 4A6PA 1E3MA 1TWAH 5JECA 1UF9A 1DAEA 2QSYA 4QM6A 5B30A 1ODFA 1TADA 2R65A 3STBC 2V55B 2ZR7A 3V00A 5L3SA 2JLYA 1Z22A 3GTKH 3QPVA 3W90A 2ZR9A 1VQLA 2ZS9A 4BFTA 3NBXX 5K8IA 2W0MA 3HOUG 1E9SA 4C3JH 3ULJA 3BU2A 1K0RA 1XRJA 1L1OB 4Q21A 5FJ8G 4KMUC 5LMUQ 2UUCQ 2AK2A 2BKEA 5TB5A 2ZXUA 1KDPA 3LLMA 5JHHB 1G8GA 4KAXA 4JLPA 1R10A 1Z0JA 1II8A 4JZKA 2NO1A 3O8CA 4H13C 5AJ3L 5C46F 2JJ2D 2OO7A 4TTRA 1D7QA 2BMEA 5SZKB 4JI2Q 2OTJA 3NTUA 2O5IC 2R7ZH 1XMJA 4DUZQ 2QQ0A 4LRWA 2XTIA 4TN1A 1QZGA 5CITA 2JEBI 1E9RA 4LFAL 3ETLA 5HE8A 4KITB 1A2KC 2V4ZA 4LV6A 2IX1A 4D82A 4LFCQ 4GKKQ 4LV8B 5D3MB 1KMQA 5IYCH 1W4CA 5SZIA 3AP1A 3MSXA 1RIPA 1IYJB 4JOIC 3ER0A 3SBEA 1EQQA 2DCUA 2YVUA 2O8CA 1HZAA 3NEMA 1GNPA 3MAAC 1XWIA 3RLNA 4QL5A 3G71A 4A3EH 1IXRC 5IT9c 2OCBA 4A6XA 2OUKA 1N32L 1G21E 3A74A 2ASBA 1YZKA 2FPKA 4FXPA 1N9WA 4POFA 2A5YB 2VTKA 4Q1CA 2ZSDA 4URYR 1ZNYA 3M9BA 1NLFA 5H8WA 3CX6A 3F3YA 3MUFA 2A19A 4V02A 5AUPB 3A8KE 1PMRA 2PJRA 4KV9A 1XEWY 1K73C 2EFHB 2ODBA 1QG4A 2UUBL 2A78A 2KSQA 2DN8A 5IYBG 1Z6HA 2QQEA 4JS0A 3AB3A 3RSOA 4A8JB 2CL7X 1PUIA 4B3DA 4DUZL 4URWR 4MQBA 4AG6A 1HTPA 3T51B 3PUXA 4A9AA 2G1JA 2O0HA 5DN6A 5JHGB 4CEHA 2JAQA 5BXQC 3K0XA 1GUOA 4QHSA 1OHHA 2E2HH 1JXOA 1YHNA 4EFNA 1E9BA 1KTVA 2FSFA 3S17H 2QAGC 1VQBA 4TYWA 2IYQA 5AUNB 1N2CE 3U9SA 1E96A 1N6RA 3SJZA 2VHUA 3AUYA 4TQUS 1TQ6A 3QIAA 3OEHA 5EE3A 4C0KA 4YCWA 2CE2X 5FUWA 3TW4A 2UU9Q 1MABA 4V0KA 2A6HD 2K33A 1WRBA 1E99A 4LF7Q 5BW8A 2E2JH 1IQPA 1IBKL 2FX3A 5EE0A 4C2TA 2WWXA 4IJHA 1X1RA 2GWHA 3K0CC 4GDFA 4WAUA 4D80A 1NG9A 2ZJYA 121PA 3GFOA 3K9GA 3OF5A 4WJ4A 1CU1A 4B2IA 2IS6A 1NI3A 3RSLA 1KDTA 3S16H 4CYMA 4NPSA 1GUTA 4JV5Q 4FI3C 4H0LC 4YHHL 4BWYA 5KHOC 3AVYA 1N25A 4X62L 2CKZB 3I2ZA 1W44A 1E2NA 1G3UA 2C35B 3GJ8A 3KB2A 4G0NA 2IXGA 1QF9A 4YMWA 4A3DH 3NBZC 5E7JA 4C7OA 5CYPA 3OPOA 2JCSA 4UXJA 3LV8A 2E8GA 5GAEC 3JVVA 3P32A 4QBIA 4KSCA 5EP3A 3THYA 3GMTA 4DUYQ 2KENA 2GVZC 4DB4A 2F4VL 4JI4Q 1AM4D 3P4YA 2DBYA 3UKDA 4LF9L 1XMVA 4Q4JA 2J0UB 1M8PA 3I4OA 1KK1A 1Q46A 1H9JA 3U3MA 2IX3A 3LW8A 2QENA 2KCMA 3CP0A 4C0JA 3Q5DA 5AK0A 2CHQA 2QP4A 4GOPA 5HZKA 4NMMA 3VX4A 2B29A 1RYHA 3BJUA 2BM1A 3KJOA 1CKNA 4A3CG 2FSGA 4N1AA 1CJVC 2ZRNA 5DI3B 4LF4L 1W2GA 2C78A 2ZRPA 4MYHA 2JXMB 4ABYA 3SJCA 2GRJA 2C04A 1BS1A 1AQYA 1NLYA 1LFDB 1R5OA 2HLDA 2ZRMA 4HB0A 3ZJYA 4RVCA 1PH1A 4U00A 4RMFA 1N5IA 2NVQH 4LI0A 1YZQA 1X3EA 4DV1Q 1XD2B 4G5QA 4C0QC 1UKEA 1VF7A 1B70B 3G5UA 5F98A 2YTXA 4LBYA 3C41J 3GLHB 3VR2A 3VAAA 3LX5A 3SYKA 2GJSA 2UVQA 2ZYUX 1XMOL 2DFLA 2CCJA 2Q8IB 5L3QB 3D0FA 1ZYUA 3IO3A 4LYAA 3ZQJA 2YZ2A 2RGNC 4TVAB 1PH7A 3D6TB 1E94E 2G6BA 1KRTA 3B1VA 3CQZH 1DD2A 5DI9A 3FGNA 1FGUA 1SROA 3G0HA 1VQJA 4YHHQ 2ZU6A 2F3TA 4M1OA 1OW3B 1PH8A 1HE8B 4LW1A 2Q3HA 1IXZA 3U5ZB 3X1XA 2K14A 2OHFA 3B60A 2BH8A 1Y1WH 1U8AA 1ZINA 1EFHA 1Z5ZA 2Q9CA 3J7A5 4LF8Q 4OK3A 1Q12A 4QM7A 1DPFA 1YITA 2X2FA 2L5TA 1BMFA 1WQ1R 2N49A 2PEZA 3FKIG 3PO2H 2BBTA 4B2LA 2CEAA 4PAQA 2NO7A 3HU3A 1E2HA 3M3YH 4DV7L 2GTPA 3K0AA 3I4MH 4IOMA 4PPFA 5G3YA 1AA9A 1G19A 3F2CA 1JPJA 2YC4C 4D0LB 3U61B 1T5IA 4RG1A 2Y0SG 1JMCA 1SE8A 2XX3A 4JBJA 3TSOA 3CRVA 1SMYC 3PQCA 2CNWA 5JJKA 3PF4A 1F2TB 1G9XA 2G1KA 3AUXA 2NO9A 1OFIA 1WCMG 2E9SA 2SHKA 2ZM6L 1T0HB 3U3OA 5EE9A 3EASA 4LPSA 2ZAOA 3MJRA 4N0EA 1YQTA 4A0FA 4KI0A 1KNXA 3Q8XB 1O87A 4LFBQ 4NTZA 4BA2I 4X65L 3PUVA 2KHJA 2V4DA 4Q47A 4GN4B 2MSDB 5FOTA 3BB1A 4FDBA 4MDEA 3UE1A 4UKDA 5JJLA 1QZHA 1HNXQ 3QY0A 3K0FB 4JI3Q 1BVSA 4Q1BA 4GFDA 4JI5Q 4LJ6A 4Q1AA 1LYLA 5CK4A 2W6JA 4OI1A 3O8BA 1GUGA 1HZ9A 2W0SA 3L8ZA 3GDEA 2JATA 4KYIB 4LJYA 2YU9H 3A4NA 1WCMH 1E2FA 4PSKA 4A3BH 1GUAA 1P60A 1P9NA 3FYHA 3WNDA 4US2R 3I62A 3QENA 4B2PA 5A5GA 1OH5A 1FL9A 3DLLA 3RZDH 2IS1A 4DR4L 5M3FH 2AXNA 2IYUA 3SBDA 1U8YA 4Q9IA 4HLQB 4G7OC 4QJ3A 4XWOA 5FPKA 4WZAE 2B92A 2R6GA 4A3LH 1GSIA 2W2TA 4QGAA 5KO2A 4AKIA 4BLTA 1V5WA 4JLBA 2GAAA 3OAAA 2DPXA 1P2VA 2VY3A 1Q44A 3KFUA 3H0GH 1S9HA 4IOLA 1UE7A 2I5LX 3QKTA 1PLLA 1YZ6A 2L0XA 1KAWA 3KKQA 4GL2A 1RRGA 1KO8A 3I8XA 3T1TA 3ZIAA 4JSYA 4B71A 1S4QA 1NVVR 1KK0A 3GTGH 3I5XA 4UP9A 4NHOA 3TREA 1B8AA 4LJ8A 4HAVA 4POAA 1JR3E 1QHGA 2ONKA 1YI2A 3TAHA 4JJKA 3U3KA 3W6NA 5C1BA 2OXCA 2EWVA 3CF6R 1VG9B 1HY3A 5KNDA 2JASA 2IYLD 3UIEA 1YHQA 4A3IH 5E95A 1CSPA 2DB3A 3BG3A 5AUQA 2K5UA 1KMHA 4X66Q 2Y8EA 3KF6B 5J4VA 2CMKA 4DEYA 5AJZA 1IY1A 1KDRA 1QHHB 2ZI4A 4JL5A 2CQOA 1F6BA 1T4GA 2IS4A 1P9RA 1Z83A 3KB1A 5FTKA 1Y8PB 4A3BG 2MSCB 1TTTA 1GTVA 4QQBX 3B1ZA 2AFHE 4A2WA 4A4IA 3RZOH 2LXJA 4Y0VA 2ZITA 3E2IA 3EG5A 4LY6A 2IT1A 2RAPA 4LHZA 1FL0A 1TU2B 1L0WA 1Q82C 4MYCA 4AKHA 1EFRA 1FJGQ 2J1LA 1P62B 4A3IG 2EJMA 3ZH9B 4DNIA 2RKOA 3NC1C 4KKTA 2CCKA 2LXKA 1LY1A 3OOCA 3E9IA 2V6IA 4JLAA 3CCJA 3AVQA 4M9SA 1X3GA 2YJTD 4NDZA 1ZU4A 2A9KA 2AK3A 3DKPA 4LF5Q 1ZVQA 2VHCA 3T53B 1X65A 1TAGA 4A4DA 3KTAB 4OBEA 1HR0W 1BYIA 1FTSA 2N42A 4LBVA 1P61B 1N5JA 5JRZA 3F8TA 2A6EC 4MITA 4XTCS 4DR7L 3HR7A 1Z06A 4HAWA 5AUOB 4NB3A 3LBNA 2WJGA 1X6OA 2GNOA 5HCNA 3KZ1E 5IF9A 1ZIOA 1G3MA 4BFXA 3KKOA 3U58A 1G4UR 2OAQ1 5FJ8H 4FMBB 1VCIA 4KHZA 2FSIA 1KRSA 3OTOL 4B3RL 2YNMA 1E4YA 1IN5A 3QKSB 1GKHA 4JBYA 2VW9A 1MO3A 3K7AH 3SQWA 1G8PA 2O8BA 3SGIA 1LS1A 3MWKA 2IHBA 4DVGA 3CF0A 4FCVA 3SDZA 4FW9A 5EQTA 2ATWA 1KO1A 2J0QA 2JLVA 1QRAA 1KO7A 4G01B 4PHTA 3RYTC 1E2JA 5A4JA 1E1RD 1FTNA 1PUJA 3X1ZA 3O47A 4DV5Q 2I1VB 3I32A 3S15H 2ZE8A 3QEJA 3AM1A 2PJZA 5C0XJ 1G8YA 1FQJA 4APVA 4URZR 3BDOA 2P6NA 1JNYA 4RCZA 4P31A 1JB7A 2OG2A 2BDTA 1LS6A 2NQ2C 3A4MA 2PT7A 4P4TA 4TYPA 1TWHH 2CWAA 2WKQA 2QT1A 2OQ0A 4JYAQ 4K0KQ 1M1YE 4NH0A 4PO9A 2MMGA 4YCUA 3I7FA 3VTKA 1Q1EA 1KC8C 2ZREA 3H4MA 4PR0A 4Q7MB 3EX7C 1RZ3A 3EPLA 2ZJ8A 4DPGA 1A0IA 3PF5A 5C4XG 1VTKA 2ZRGA 1Z6XA 3MWLA 3OE7A 4DZZA 1FR3A 3K0FA 1MV5A 1OPXA 5E4FA 1LABA 3Q72A 3GEIA 3AKDA 4NONA 3RVBA 4D25A 1Z6GA 4QGHA 3TUZC 4BY1H 4O3MA 2Q6TA 4AIIA 2W6JD 1S72A 1KI9A 1SGWA 1XMQQ 1IBMQ 3AP3A 4KVGA 4KVAA 4A92A 2FZ4A 1D8LA 2DHRA 2YYZA 2O8BB 1E1QA 3TE6A 1SVIA 4C0BA 4ZKDA 4O2LA 1S3OA 4ARZA 1M2OB 1L2FA 3WWVA 1YZUA 2BHRA 2CJWA 3HPRA 1J8MF 4PAOA 2JLZA 4A36A 3CB4A 4JI4L 2BBWA 3LGJA 2BA0A 2RGBA 2QMUA 3A37A 2Q3FA 4E07A 1CSQA 4HEJA 4EIWA 4DV1L 1F2TA 2CW0C 1B9NA 4Y52H 3HOZH 3DVLA 5JEDA 1EG7A 4M1YA 4MGIR 4FMDF 1IXSB 5DISB 1FMLA 5BN4A 3ICEA 1XF9A 4TZ0A 2NN6I 2VYFA 1Q1BA 3WYAA 4M9QA 2LKCA 4TTPA 1PYBA 1V1QA 4FMCF 1ZM4A 3EPHA 3T1HQ 2UXCL 2E1RA 3IUYA 1W49A 3BH0A 4JC0A 1TF2A 3WMFA 2J0SA 3UE0A 2PLRA 2QBYA 5JCPA 2RHQB 2G0NA 1X8JA 1E9AA 2PBRA 4BZXA 4OQFA 1A63A 3UDFA 2PPBC 1XMSA 2F3IA 4JT4A 2ONJA 1AS0A 1XD8A 4PPQA 2CVFA 1GDDA 1VG1A 2DWOA 3BFXA 4HJ7A 3DZ8A 3GTJH 3A36A 5H68A 1VYVA 1Z6TA 1V9PA 1KK3A 4BGDA 1VQNA 1XNRQ 1E79A 5J4HA 4R4IA 1ESNA 4A3MH 1XMOQ 1GL6A 1R2QA 5DGXA 3J7ZC 1KO5A 2F1IA 5IK2A 1G17A 1TXYA 2DFNA 4URVR 1R8SA 5FLMH 2KJQA 3LD9A 2V8OA 1W0JD 1ZM3A 3CX7A 5FOXA 4LF4Q 2QF7A 1GL7A 5JMTA 3CPFA 1KO4A 1S0UA 3HOVG 2NVXH 2BE5D 1AK2A 3KJHA 4OGQC 3MD0A 1Z2AA 1FUKA 1GG2A 5G53C 1KZ7B 2XZOA 2A8VA 5CIQA 5DI3A 2A30A 1DO2A 4GSYA 1S1MA 2QTVB 1EOVA 1HT1E 3AFQA 1IL2A 2HLDD 2P5SA 4TLAA 4BLRA 5CB6A 4M8NE 5TDHA 4PZYA 4EDHA 3WYFA 1NY6A 1MO5A 2QEXA 2G83A 3SHFA 4C0HA 1ESMA 3SHWA 3SYNA 4ZI2A 1VF5C 3HPQA 3G4SA 5LMUL 2ZU0C 3SJAA 1IY0A 2WVJA 1I3QH 3DL0A 2R9VA 4PZ7A 3CBQA 2P6RA 2J46A 1A62A 3D31A 3H15A 1GL9B 4HJ8A 3ZZTA 4DLSA 4WW0A 4MH0R 4ASUD 5C0XI 1IBLQ 3UK6A 4R9UC 4OHZA 3CNOA 1HE1C 5SZHB 1J99A 1QG2A 3CWQA 3REGA 4C9BA 2WSSD 1CJUC 2DR3A 3V9PA 4D4LA 3BK7A 5DN6D 1SKYE 1ELOA 4B35A 1ASYA 4DKAC 4CT4B 3PEYA 3C7KA 2F9MA 5IP7G 3PENA 2HDNB 2D2EA 4KCGA 3RS4A 3FKSA 4GI7A 1L4UA 3TKLA 1DBSA 4L8JA 3GTLH 4RKEA 4RFVA 2C9OA 4MRPA 2J7KA 3CRMA 4L8GA 3B1YA 2A68D 4GRAA 4K8OA 2D3WA 4UQOA 1PYSB 2FXQA 4JL8A 2UUCL 1Q86C 3IQXA 1CI3M 1U94A 2GF0A 3L43A 1RPZA 2XGJA 1SXJA 4F93B 4LK1C 4WXPA 4TLBA 1DXMA 1UFQA 4HI0E 5FBRB 1CTQA 4DJTA 4NYIR 1NBWA 3QEOA 3CCMA 1Y1VG 2EJGC 1SVWA 2JJ8A 1CJMA 4W7SA 1UAAA 3VKHA 4H1UA 2AR7A 3WP1B 4A82A 1HNZQ 1JR6A 2DUDA 3KJEA 2UUBQ 4PC1A 3BORA 4A3DG 4HJ9A 1JPNA 2E74C 1SVOA 4UPAA 3OE7D 4IDQA 5AJWA 4ZCMA 2CK3A 3F2BA 3CRLC 3AB9A 1Y8OB 1YZLA 4O25A 4A8JA 1E7ZA 3TVTA 3QG1A 3T1YQ 4B3SQ 1P2TA 2PI2A 2HT6A 3BIFA 5F9FA 3GJ3A 2JA5G 2RGGA 1Q7YC 2HYDA 1OH7A 1RYFA 2FJUA 3U4ZA 4RZ2A 3I4MG 3KFVA 3TUJC 5M04A 5TMPA 2W2VA 1G6HA 2GVBA 4DV5L 3K53A 4RSGA 4EQ6B 4KODA 4LYJA 2DFTA 4MGYR 2E76C 4HLDA 3GJ6A 4DR4Q 4DDWA 4GKKL 1DE0A 5CJ2A 3JZMA 1U90A 1T9HA 1KI1A 2GZDA 1BKDR 2ZVQX 3EZ9A 2JIZA 3KQKA 4POGA 2XNDD 3CH4B 3CF2A 3T15A 1GHJA 3H84A 2PCFB 4O2DA 4DSUA 3VKWA 1YVCA 5D3MA 3I4NH 3S1MH 2OFWA 4TTQA 3SZRA 1QHYA 4HJAA 3FHWA 4OHWA 3HR8A 4URXR 1XJCA 2VPPA 1NE3A 2VUMH 4PO1A 2FN4A 2FH5B 3I92A 1IAQA 4YLGA 1RJ9A 3ADCA 3M4OH 2EJFC 2ID0A 1JALA 1E9DA 1E9CA 1NN1A 3FWYA 3ZVLA 2ZJBA 3SFVA 1NY4A 2MQHA 1FP7A 4DV0L 1Q3TA 2GETA 1VECA 2Q2HA 2KE5A 3EZ7A 5EE5B 2DFKB 1QHXA 2PX0A 1FZQA 2BIFA 1TU3A 3GJXC 1KAGA 2LSSA 3TS2A 4HUQA 3A0JA 2ZRFA 1A2BA 3AKEA 5HKKD 4PV1C 2WWIA 2ZM6Q 2CLDX 1YR8A 2ZRCA 1CBUA 1Z6AA 1N6PA 4MKHA 1AGPA 3AF4A 1OFHA 4HR7B 3CPEA 5CB8A 1Y8NB 4Q4JB 2JE6I 5IWAL 4BLSA 1H9RA 4DLWA 4UNRA 3ZGXA 2WWFA 1XTSA 4BRUA 1KI2A 1OB2A 4OQNA 4TZ6A 2Q21A 3CONA 1J6QA 2AUJD 3NELA 1I5FA 3NBHB 1HA3A 3EIHA 1M34E 3RANA 5TV2A 1RL2A 3B2EA 5EXPA 1R9TH 1DAFA 4JYAL 1S9DA 1AH9A 1ZC4A 2WKPA 4YXWA 1BIFA 1Q90A 1VCOA 3ULLA 3RC8A 1FFHA 3ONWA 2AXPA 4B47A 4PX9A 5B2ZA 3CMEA 1JAHA 2JA7G 4TSFD 4G7HC 3FPPA 3FKQA 3KX2A 4MRRA 1RVDA 2CL0X 3IIJA 4JBXA 3CRRA 1KIXA 4A3FH 4JT2A 3U60B 1CRPA 5HGQA 1XZPA 4DR6Q 1O78A 4J15A 3OEHD 4YMVA 5G41A 1E22A 2OWOA 4Q00A 4A3GH 4EKDA 2DGYA 3B7GA 2RGNA 1FUUA 4OQXA 1TQ4A 3CPHA 1MABB 1OT3A 4JI3L 4DK6C 3A5ZB 2A2ZA 2QE7A 3FB4A 1YEZA 4R4OA 1N34L 2FU5C 1AZTA 1DAIA 1JEDA 2CK3D 2K7VA 2PX3A 1D5CA 4U7DA 3CPWA 1O7IA 4BECA 4BA1I 5LMNL 2YOGA 4GNXC 1N34Q 3S2DH 2YHSA 4NKRA 4LDJA 4V0OA 3OTOQ 4B3RQ 1GFIA 4PPGA 3CNLA 4LX0A 4DIDA 1RKBA 2IUSA 2ORWA 1OH6A 2JA6H 2GVAA 2QNRA 1PV4A 4Q9HA 4CEHB 1EESA 4IJLA 5C44H 2KA7A 5LB4A 3VR3A 4A3JH 4JI0Q 2WAXA 3K8YA 3PSIA 3LQRA 3ZZUA 3O8DA 4DB2A 4IDOA 2UZIR 2ZYTX 3IQWA 4WA7A 4HUTA 4FWTA 1MH1A 5BQ5A 3L82B 5JI3E 1S2MA 5C4GB 2RGDA 5C18A 3DM9B 1C0AA 1SKYB 4PC6A 3GTOH 1Q1ZA 2CHGA 3KTAA 3CRQA 2JA7H 2WJYA 2A69C 2R7DA 1PA6A 1XJ0A 2WJVA 2OILA 4KFSA 3CD6A 2R62A 4PFSA 8OHMA 3KQUA 4PQYA 1Z0FA 5FTNA 1N5KA 3D4RA 4WJ3M 2ODNA 4IVRA 1NKSA 3KLRA 5C4JH 1QBKC 3A5UA 5CJPA 4BY7G 3L8YA 5TARA 1XJQA 1N5LA 3TRZA 1BYUA 1OF1A 4DCVA 5KU1A 4DR1L 4NE2A 4GLXA 1YR7A 4CDGA 1ZCAA 3IILA 4S35A 1IBRA 2J0VA 2QI9C 5IDVA 4NYJR 3FHOA 4AQYL 4DK0A 2WAQE 1MRNA 1VQPA 2VBCA 4DV6Q 3AP2A 1VQHA 2J7PA 4PC2A 3GD7A 5JI2E 1VIYA 4UNNA 4NCJA 3RR5A 2B7CA 2QG6A 2QPTA 2JA1A 2PZFA 4J0QA 4QJ5A 1CXZA 1W4AA 5KPJA 4GP7A 3RRZA 2AD5A 1YJWA 4LCBA 4BEJA 5C0XH 3PITA 2JGNA 5B58C 3CUEF 3D3QA 2HIXA 4OO1I 1GKUB 4IQZA 4LOAA 3BFKA 4ILEA 2GCNA 1OKKD 4QC2A 1ZBDA 1KY2A 4CIDA 2BMDA 2JDID 1L1OA 1QVRA 2V6JA 3STBD 4D6PA 4QHYA 3EN2A 4OWTB 3HOXG 1ZP6A 3MG9A 1YNXA 4JL6A 4JKYA 3TRFA 4ERNA 3A1SA 3DKVA 3KFXA 3WDNA 1VQ6A 2ATXA 4HLUA 4GNXB 1W1WA 5DSZA 1WMSA 2FMXA 2FFBA 3LAWA 2QE7D 4HDOB 2K75A 4M0LA 1NY5A 3DOFA 3SC3A 3U4VA 4WIAA 4DSNA 2BJWA 4DR2L 1D9ZA 1W0KA 3TR0A 4Q1EA 1WDTA 2R7FA 3A1TA 4B3FX 3ZD7A 1XBTA 4TQ9A 5LBIA 1IW7D 4JBKA 1W0KD 3LBHA 4M1TA 1NRJB 2EVWX 1DAMA 3I61A 3GJ7A 3FMFA 3K8AA 3W34A 5EAYA 3UMRA 2YKGA 1G16A 2JA5H 2P2LA 4W5JA 2BM0A 4AC9A 3ZQ6A 2ZSBA 1J90A 1X86B 2GEVA 2EQBA 5BN3A 1GVPA 3PEVA 3CM0A 4K46A 2GKSA 4IXNA 1WBDA 3ECCA 1I6VC 2Q9BA 3B82A 4BFSA 3ULPA 3AKCA 1C1YA 1LB1B 1WP9A 1Y69U 4P74A 2VHJA 3P27A 4OJKA 1DCZA 4TMWA 1ZNZA 2F6RA 4M1MA 1H8HD 3H94A 1NBME 1ZD8A 3PXGA 4BEBA 4TT3A 1P3JA 1E2PA 4PSVA 2RHDA 2D2CC 2ASEA 4NPHA 1NMYA 5BYJA 2B7BA 3LO5A 4GP6A 3QJYA 1NJIC 2ZE7A 2FF7A 3BD9A 2K5NA 1TF5A 4A3LG 1RJ9B 3QXHA 4P33A 5FR2A 4V0NA 4A3JG 4AYBG 4XTRA 2E5LQ 1TWGH 4C3HH 1CLUA 3IBYA 4FMDB 3AF3A 2HYIC 3DM3A 1YJ5A 1XDBA 2ZSFA 2A5GA 2F52A 3EZ2A 2WP8J 4M1WA 4Z54A 2WPDD 3GFPA 3IPXA 4Y7NH 1KIMA 2OXRA 1UE6A 4C30A 5C4MA 5EP1A 4BFVA 4HIDA 2AFIE 2D4HA 1KDOA 4DNRB 3HKZE 2UKDA 2GCPA 5IRCD 2ZUCA 4R2HA 4XSHA 4ZO4A 1VQDA 4LUVA 3CW2C 3OHMA 4JVLA 5DIFA 2ZI3A 1UBFA 5H70A 1NP6A 2XNDA 3RS0A 2NZ8A 3BZKA 1B0UA 3NC0C 4LHVA 3UWKA 3F0TA 4A2QA 1C9KA 5EXXA 5KUTA 1CJKC 4G3XA 1QDEA 1VQEA 2YWHA 3UG7A 3QI2A 1UKZA 1VQ7A 4OONA 4PZ8A 2GJ9A 3N6RA 1EFWA 3OEEA 1KSJA 4MRNA 2NMVA 3NH9A 3J81k 1AE2A 1PFSA 5DH9A 1FOEB 3RS5A 1I50H 4GS3A 1ZD9A 3OESA 4A3CH 1N6OA 4B3TQ 2AL7A 5JEEA 4C2MH 2NVYH 3RHFA 2QTHA 4GLAC 1XTQA 2VH5R 3AGPA 1OB5A 1HNWQ 2DYKA 3CCRA 3HP1A 3Q5EA 1EFCA 4AKEA 3M85A 1YE8A 2AKYA 2O0JA 3CZQA 3EARA 2B63H 2JK8A 2IHYA 3K9NA 1W36C 1AKYA 3WNBA 2OQKA 1P2SA 2WB1G 3T1OA 4GN5A 2X1VA 4OX9L 1IOZA 3HWSA 2JJ1A 1NL3A 2IYZA 2P6UA 1SLJA 2HF8A 3EIEA 2P3SA 4AKGA 2BV3A 1DAGA 1U9IC 3CIOA 2J0UA 4I4LA 2VUMG 4R4QA 1GKYA 2GJKA 5DLQC 3Q8DA 5JJIA 3R20A 4KBFA 2IA5A 1SXJD 2EQSA 4O2RA 2FNAA 3Q7PA 4OQLA 2RH5A 2DNEA 2QROA 2Z5FA 1U0HC 2P0EA 2IHEA 4A93H 4H9GA 3HJNA 3W6OA 4QHTA 2QP3A 2IY5B 4ZIRA 1L1OC 1UPTA 4OO1H 5GVSA 4C7OB 4I99A 2PZGA 5FPYA 1GWNA 5FL7D 4DR7Q 3HFZB 2BE5C 1G6OA 3DEFA 4ESVA 4MUBA 4AQYQ 1VYTA 1W47A 2NO0A 4BE7B 3CCVA 2I4IA 1QVFA 1R0YA 3H3VH 4ON9A 2O5JC 1UKYA 4CZ2A 2QPOA 1QHNA 3KUDA 3QKRB 5DE3A 5IP9G 1SKQA 2A5DA 3IPYA 1GOTA 4C4PA 3IEVA 3OFND 3ZZ0A 5BN5A 1P4SA 5LMNW 1E9EA 2EFGA 3FMOB 3BBPA 3KJIA 3X1DA 2WJHA 4JIMA 2Z6KA 3KDFA 1T0JB 1US8B 1YZNA 4ACBA 3SFZA 4MRVA 4BFUA 4QJFA 4DLXA 2F9LA 2V9PA 4DT1B 4F38A 1OLOA 3FMIA 1EX6A 3HOVH 1S3GA 2HT1A 2BWJA 1K3RA 4PO8A 4L5SA 2GXAA 5DLQE 2Q2IA 3HOWG 1J7KA 2C8VA 3QXJA 3PUZA 4HUQB 4JI6L 3KJPA 1E2QA 2IK8A 3LX8A 4JJZA 4TMVA 1K8GA 2K4KA 1TMKA 4G5GA 4CW7A 2RGEA 3ZVNA 3RC3A 4DWJA 4TL6A 3PJRA 1XPUA 4EQ5A 4JI6Q 2GCOA 4FN5A 5TVKA 3X1WA 2D5DA 3M6AA 4D2IA 3TH5A 2A3RA 4UXHA 1QZXA 5GJCA 3MMPA 4QG7A 2GILA 2WSMA 5M5YH 5DNYB 2OV2A 5FPTA 4JLOA 1M7BA 1SHZA 4Z51A 3SQXA 2N3SA 1FNNA 2WBLC 2ZAMA 4NCIA 1MOZA 2RHMA 3O8RA 3U3RA 1AKEA 2C9CA 2NIPA 4QGFA 2QU8A 3ZIAD 3H2YA 4D81A 3RN2A 3TQFA 2ZSAA 1GKIA 5M5XH 1R5NA 1NJFA 4UXIA 4GN3B 5TXGA 3MRSA 1W5TA 1GRNA 2AD1A 5JFGA 1NMGA 1M74A 3LWNA 3KQLA 4KU4A 4KLKA 2RGXA 5L3RA 4E22A 2EVBA 2C03A 4FCTA 4A3KH 4OK5A 1E3PA 2VLIA 3G48A 1QVGA 4Q7LA 2WWWA 3EWSA 1FMJA 3KJGA 5L3QA 1JJGA 2JLXA 3VHLB 2D06A 2MMCA 2ZYWX 2N78A 3LNNA 4YY3Q 1G5RA 2NG1A 4DRZA 1HYQA 4B74A 5DYGA 4DV4L 1TL7C 2V1UA 4IDPA 4QL3A 5GJVC 2OE2A 5FL7A 1U9IA 3RABA 2R92H 3ASYA 1NN3A 3WMGA 2A7QA 4P0TA 1E9FA 2QA4A 2G77B 1P5ZB 3HOUH 2I3BA 4EFLA 5LMNQ 1VS0A 5JS7A 1YR6A 1W3SA 1Q0UA 3EXAA 1EWQA 2IYXA 4RD1A 1LTLA 3T1VA 3U50C 3VU9B 1ZNXA 1SXJB 4JLMA 5L8VA 1T3SA 4DT1A 2NZHA 4LFBL 1KHIA 1N6LA 2IF0A 1CEEA 2ZJPA 2E75C 1XP8A 1K8RA 1EX7A 2VSFA 1XEFA 2YOFA 2K50A 4UP7A 2E2IH 5FLMG 2HV8A 1VPLA 4BASA 2ORIA 2J59A 4XD7A 4MYUA 4CT5A 2NOAA 2CCZA 4UNPA 4Q9JA 2QGQA 2WSSA 2ZVPX 1GITA 2OBMA 4JI1Q 4IXMA 5EXSA 5FBWB 4A0RA 1GM5A 1P73A 2XEXA 5B57C 4TYNA 3FHTA 1NN5A 4KYUA 1KL9A 3A1WA 5HTKA 2VP2A 4BBRH 3BJIC 4PZLA 4HLUC 5DO9A 2V7QD 3DXJC 2CBZA 4G7ZC 4GKJQ 1IN4A 1DELA 2FA9A 4V0LA 3EQLC 3L0IB 4B44A 4JI7Q 4IOCA 3KQHA 2W2XA 2Z4RA 2D7CA 4XSGA 4BRWA 4LF6L 3RAPR 2GF9A 1M7GA 3GLGA 5FI0B 4QY7A 4LF8L 1MT0A 1W48A 1HQCA 3CPJB 3PUYA 1T3LA 3FMCA 1F2UB 3TSZA 3KXLA 3L2OB 4M9ZA 3GLFB 2VQEL 1PZNA 3RS7A 1IBLL 1KJYA 3OIWA 1MKHA 1GAJA 3DPUA 1R5BA 3FFBA 1XTIA 3T5GA 3I1FA 721PA 3E0EA 1XPOA 3I56A 1Z3IX 3GO5A 2YOHA 1UM8A 4RD0A 1X9NA 4Q18A 4ME3A 3AEZA 5E7MA 1VIAA 4ACAA 4B3MQ 3QKSA 2QA5A 2GJ8A 1NNEA 1EFUA 4PG3A 4RFSB 3K9HA 1PH6A 1P7CA 1N36L 2BVNA 4A3FG 2VNUD 4KXFB 3Q3JB 5KSYA 5BR8Q 1FQKA 1L2TA 4AYBE 2XZPA 4HIKA 4GOKA 4P3YA 2FGJA 3LQQA 1E79D 3SYLA 1NMFA 1MO6A 4Q4HB 2BC9A 2RGCA 3DOEA 3I73A 1D6JA 3B9QA 2YTYA 4TMZA 1CUKA 3SE0A 1A8VA 4GOJA 4NP6A 3RS3A 5JZVA 2GXUA 3L0PA 1COWD 1ZM7A 4GOPC 4BXXG 2FPLA 2N8NA 1Z07A 3CCQA 4QRHA 3W5IA 4PMWA 3HKSA 1AS2A 3WRYC 1XXHE 3KDSE 3E1SA 3PIPA 2FEMA 3I55A 4ALPA 2PMKA 3LVQE 5FTJA 3WBKA 1UADA 4F4IA 2O8FB 1Y1VH 4LYFA 1N32Q 2OM2A 3P20A 5JS8A 1TU4A 1KJWA 4IPDA 2QORA 4OYHA 2PI2E 3LVRE 2AHOB 2BMJA 2O0KA 1E4VA 2YINC 3QOFA 2EW1A 1IN8A 4D0NA 2ZANA 1HNXL 2REXB 1E2IA 2ZM5A 5CYOA 3L0SA 1G5TA 4LYHA 2ZRIA 1E2WA 3KXKA 1Z08A 4PTLA 4RD6A 1VQIA 2K52A 2XSZA 1G291 4IDHA 1VQKA 3NWJA 1W4BA 4UJ5A 4MKGA 4Q4LA 3QSYA 4RCNA 4DDTA 2ZE6A 5IYCG 1KXLA 1DG1G 1ZW6A 2CVHA 2QMEA 1NIJA 4C2UA 2I1QA 3LFUA 4DDVA 3CKLA 1E1QD 4PZ6A 1II9A 1KI7A 3FPAA 3WBJA 1NBMA 4YONB 4QXAA 2Z4SA 4DCNA 3GEEA 4S2EA 3LBIA 5HY6A 1GP2A 4LZZA 1QVAA 1IZ6A 4B3ML 2JLUA 1XFAA 3BE4A 2R8RA 3RLOA 5CDFA 3NBYC 2IUUA 4DR5Q 3UDXA 1XMQL 1LVGA 1KAOA 1NF3A 1KHTA 4AYWA 4BZQA 2LWIA 3W8RA 3AVVA 2QPAA 4WVFA 3S1AA 3K0EA 4IPHA 4IO9A 2B8TA 1UEBA 1YKSA 3WYGA 5EUMA 2JDIA 1FNMA 4LSGA 3TK1A 1OXVA 2K32A 5GADl 4F4JA 2PNRC 2FFHA 4RD2A 5CM9C 5K8UA 1TEXA 4Q9KA 3DMNA 5BWMA 2ZS8A 1E2VA 3EA5A 2F43A 2HF9A 2F3RA 1XU4A 1IYVA 1JXMA 1TEVA 1YZGA 4CVNA 3A8JE 4JLKA 5L3VA 1MRSA 1NIPA 1NKTA 3FFAA 1IJEA 4OK6A 4RZ3A 1Q57A 4WZ6A 4BLPA 2A68C 3P26A 4OQMA 2F43B 4GZLA 2WWYA 4LJZC 1XTKA 4K0KL 2XAUA 1Z63A 4LF7L 4JI8Q 3CRKC 3BERA 3LW7A 4GNKA 1ETUA 3Q7QA 4NXNQ 1UBGA 2H18A 4TMXA 3BRWD 4BBRG 3TIFA 2NZOA 1D9XA 4D4MA 1MKYA 1RRFA 5K36H 1E2ZA 5B64A 3A6PC 2XNSA 1IJFA 5C4XH 2EXDA 5G3ZA 4YMTA 4EPRA 4A2PA 2ZUDA 3PFIA 5LB2A 2IF2A 3J81i 2WJJA 2EIFA 4I1OA 4Q5IA 3ZYCA 2IXEA 1Q21A 2ODWA 1P16A 1BMFD 5F2EA 2W58A 3T12A 4OWXB 5GROA 1N0UA 2DY1A 3WP0A 2H16A 4F7WA 5CDFE 4DK1A 1AN0A 2XXAB 3SR0A 3GTQH 4YDHB 4YWMA 4NCNA 3V4FA 4B3BA 5G40A 1M6NA 1VG0B 3CLVA 1HH2P 5F9HA 4BZPA 4NYIQ 3PO2G 3FKIH 3Q9LA 3QBVA 5AJYA 4DCUA 1E0SA 1CTMA 2MO1A 4HB3A 1VYUA 2VL6A 4MGZR 1HZCA 1HR0Q 2UXDL 2AKAB 6Q21A 4OO1G 1QHIA 2PLFA 3S2HH 3Q85A 2B3GA 3N2IA 4HB4A 1E1TA 4DCTA 4BUJA 1J70A 1OYWA 4L9WA 5H1SE 1E2MA 3J81c 1HPCA 3GEHA 2P67A 3NE5B 2B8GA 4HLCA 2JQOA 3IHWA 3JAMi 4XIGS 4ZCLA 3GP8A 1P2UA 3K70C 4DV2L 3QXXA 3H86A 5E3HA 3CO5A 3KL4A 5FI1B 3AVPA 2FSHA 4LF6Q 4X64L 1T91A 3SN6A 3QQ5A 4DAYB 1DEKA 3NHAA 3P1JA 3QG5A 2ZRJA 4OHVA 1HJPA 2UUAL 1JJVA 4B73A 1E98A 2HUPA 1Z9FA 4NBSA 3U7GA 1P6XA 2IBMA 3MFYA 2NPFA 2WTUA 1I94L 3TAUA 2VP4A 2V3CC 3J81j 2UXCQ 1Z0IA 5IP9H 3P4XA 1V8QA 3K1JA 4NXML 1KNQA 4DHEA 5FH9A 1HQMC 1NSFA 2IL1A 1K5GA 3TS0A 3BH7A 3IIKA 5KYKA 4JLNA 2R6AA 3I8SA 4IKEA 3I72A 1L4YA 1AGRA 4X6AH 1KI6A 3JZAA 4TL9A 3LLUA 2GAOA 1Y14B 2EDGA 4LJ4A 4QBGB 4UP8A 1E0JA 3B6EA 3JAMc 1OSNA 4M1KA 1XD2A 1YR9A 4PPNA 1ONBA 5LDDC 1YIJA 1IHUA 3A7AB 1A6XA 2CDNA 1KSFX 4IJMA 4KHPQ 1JR3A 1QHHA 4P4UA 3NDBB 3CMAA 4A3MG 2R44A 4LHWA 3W1GA 3VR6A 1D8TA 1KMHB 1XTDA 2PT5A 2XOKD 2ZRBA 1G51A 2ZQ5A 4IFBA 4KFUA 2OLJA 1W0JA 2VP6A 5AJVB 4B3XA 3U4QB 2BBSA 5UKDA 2HQLA 1SN8A 2QGNA 4BBSH 1T3HA 3SJBA 3KF8B 1IN7A 2ZTCA 1OIWA 2D0PA 1OFUX 4DK3C 4IOAA 2XOKA 4ZCIA 1EWRA 1W2BA 4B43A 4W9MC 5JRJA 2ZTEA 4DV4Q 1X56A 4IEIA 3TGPA 1QUQA 2KB0A 4TQAA 1NMXA 4DUGD 1U81A 2EFCB 2EU8A 4P32A 1E2LA 1EXMA 2KWIA 4L4UA 2VSXA 3FVQA 4R98A 2WAYA 4YMSA 3THYB 4IOKA 1Z7TA 3EC2A 4OI2A 4V0MA 621PA 2Y0SE 3BAFA 3RDPA 5K8LA 3U6BA 3HU2A 2D7DA 4JI1L 1E2KA 3PV0A 2QEQA 4C0AC 3HOYH 1F5NA 1OJLA 2ZRHA 4BLOA 2RGAA 4ITRC 2MO0A 4E09A 1LUZA 3X1YA 2VZAA 1J5EL 2C5LA 1Q22A 4PHGA 4DV3L 1B7YB 4FD2A 3A1VA 3TLXA 2QZ4A 1T8TA 4CF7A 5BYKA 1EGAA 3HYTA 3WRXC 2YTVA 4LUOA 4LNQA 2GA8A 1AQUA 1JB1A 1Z47A 2CWPA 4DLUA 4LFAQ 1OIVA 1U99A 4KFTA 2RHSB 4NYMQ 1E24A 2XTZA 4M1SA 2R93H 2O8EA 4L15A 3CW2A 4H02A 4R7ZA 3U7EB 1Q1QA 1K83H 2I0QA 4X65Q 1I4TD 4N3NA 2FZLA 5IE8A 4HZUA 3H0GG 1QHSA 2KBFA 2OCPA 4BFWA 1E2EA 5FUXA 1EQRA 4DKXA 4GMDA 4JSTA 3GLIB 2DNCA 1A7JA 1OXTA 1R4AA 1ZAKA 2CNWD 2WKRA 3U3JA 4A1FA 2A6HC 1CKEA 3IKJA 2FG5A 2FFQA 5M3FG 4TL7A 2F1MA 1NVXQ 3FTQA 4B34A 4EPXA 2C96A 1P9WA 1CF4A 3VNVA 3VR4A 2ZRKA 4HDQB 1LF0A 4F92B 1ZJ6A 4HAUA 4LJ7A 3QPWA 1R6BX 4JYCA 2QSZA 5J4YA 2AN9A 4JKIA 2V7QA 2VQEQ 2GN5A 5C3EH 4DV6L 3U7HB 3J80i 2LMCB 3EPKA 1LM0A 3VQTA 1ZUHA 2OZEA 3BB4A 2QM7A 2A69D 1DG3A 4MZ9A 3VHXA 1O7LA 4Z8XA 2UXBL 4GZMA 1K5DA 1XMIA 3LNCA 1EK0A 3BGWA 2ZUBA 3EC1A 3R7WB 3UPUA 3EZFA 2MNAA 4BBSG 1II0A 1KJZA 5JEAG 1JI0A 1LNZA 3GLHE 4BXXH 5JWRA 3W1BA 3K81C 2PNHA 2J7PD 2N46A 2VHTA 1YNNC 3K7UC 4G5RA 3NKVA 4A15A 4OXPA 5IWAQ 3CC7A 4G1UC 1UWVA 2XB2A 2UXBQ 3RRMA 5C2JB 2R7ZG 1J5EQ 1MO4A 1U98A 3FKSD 3R9WA 4PQFA 2ZTDA 3RNLA 3TJZA 2QM8A 2BCGY 4Q1DA 2WIAA 1K8AC 1OIXA 3LWUA 3GLHA 3AVUA 3T06B 4EPWA 4JCVE 4KN4C 2PZEA 2XJ4A 1N6KA 1TPZA 1I4LD 2DWQA 3RWOA 3BC1A 2LKDA 4PC3A 5FTLA 3TR5A 1YNJC 2H5XA 2FOLA 2ORVA 1GNRA 3NDPA 1D2NA 2X19A 4G5SA 1BDOA 3UMSA 4OHXA 4GZYC 2ECKA 4HAXA 3J80c 3EAQA 2BEKA 3HU1A 1Z2CA 4HYYA 4LHYA 4WZBE 5FUYA 1LACA 4DLYA 3ZVRA 3GJ5A 1E69A 1YU9A 1TKWB 4RZUA 5DHAA 5GAGC 3MXUA 1XTJA 1W5SA 3TZUA 2C95A 2VP0A 1HZBA 3MGCA 4PC7A 5IY0A 5KSOA 3FOZA 3FHCB 1ZRHA 4B3TL 4US0R 1S1CA 3N70A 5JEAH 3KDFB 3CC4A 5CIWA 3GCGA 3C8UA 1G8FA 2ZJ5A 2ZRAA 2I5MX 1WCV1 1XNQQ 5ELOA 4JI8L
chains in the Genus database with same CATH superfamily
1N2IA 3CZ4A 4KHPL 3I64A 5CLLA 4JVSB 2BFEA 5LZ4A 4U2KA 4NU0A 4GGOA 4PFJA 1U2RA 5GV7A 1HXYD 4G0PA 1XQXA 4P73A 4HAYA 4WKPA 1VKRA 2O20A 5C34B 2XF8A 4JVNA 1U0LA 5KU7A 1G8HA 1M6VB 1BCRB 2AB0A 2AYZA 3P2YA 5KREA 1VKNA 4BVKA 4N5MA 1BMTA 1CY6A 2AE1A 3WNCA 6GPBA 1RC8A 4WBXC 3FEWX 4A93B 5FAKA 3EDQA 3PIIA 1P8LA 2F1OA 5EIEA 3SNHA 3FF1A 3HKEA 1G41A 4RVDA 1D2CA 1X92A 1O0CA 3IAS6 4KFRA 5C37A 1B76A 5KOYA 3IJRA 1VQOA 5L7TA 1Z2NX 2MR5A 4BY7H 3AO0B 1DIBA 1R64A 1PTOC 4KK7A 1UOPA 3IBGA 3P0HA 2X6RA 5DM60 1XXLA 5CMLA 1NJ2A 1N2EA 1ZJJA 2OEPA 2XT0A 1N9GA 3FETA 3HUEA 3LT4A 1OHHD 2Y1XA 3LY8A 2G08A 3JQFA 4Q7JB 2VYCA 1T1GA 4OBBA 3A4YA 3PRHA 3RJZA 2D0OA 5T3UA 3U4QA 2JA2A 1AXGA 1J0AA 1CJTC 2QTFA 4NABA 3CUSA 3HXMA 4ZRDA 5BQPA 4E03A 2DWPA 2XWJI 3R5SA 1JHUA 3HYRA 1KY3A 4L75A 1PFYA 3BEDA 2I91A 4QIWE 4ZMBA 3OO0A 4DWWA 3ZX4A 3I62A 2GBCA 4LDNA 1R74A 4ODIA 3BICA 5TC4A 2WV9A 4L0CA 3B38A 3BJRA 2PS1A 4BNWA 4IUTA 3D8BA 3H1PA 3TNJA 4DLRA 1SB8A 2XUGA 3EQ2A 1R16A 1ZMXA 2QN6A 1I1QB 4HGQA 1UEAB 5C35A 1XXHA 4EKIA 5L4SA 1XWWA 2SBTA 2GDZA 4RGMA 2HMSA 4AH6A 2BTOA 2YWFA 4ES6A 1EQAA 1N9ZA 3AIKA 4HXYA 4BNZA 2REBA 4QLOA 2GTIA 1WZNA 3QPUA 5AVVA 1P1KA 1QVZA 4HWRA 5IC4A 5AW6A 1WX1A 1UJMA 4ZT4A 1COZA 1HV8A 3TUJC 4BNDB 3DMRA 5IM4F 1W36D 3D0OA 4L3VA 4ZGWA 5ITVA 4OFBA 4EVQA 2IYRA 3H18A 1P1FA 4R9WA 3K2EA 2WD7B 3BJZA 4UDUC 4FHEA 4O1IA 4Q4AA 4XJXA 3MIIA 5TLSA 1DINA 4QUHA 5A6SB 3VHXB 3U81A 4YALA 4EF6A 5KYXB 1R0WA 2G7MC 3D8UA 3QVUA 4KWHA 4W9RA 4YBRA 3PEWA 1KI3A 3Q3CA 4F9FA 1X15A 1FU7A 1Q3HA 3BXXA 3LQ1A 4M21A 4C20A 2PL3A 2H07A 3U4GA 2F1JA 3IOMA 3HDVA 3X2FA 1FDTA 2X5OA 3B5EA 5TGZA 1BD3A 1U4NA 3ZI4A 2H85A 4JI0B 2TMPA 1ZOSA 1RYDA 5D86A 1LBSA 2J6BA 1QKIA 2Y1KA 2G3YA 4IWNA 1W2HA 3MLAA 3BZUA 2V1XA 4R54A 3WIBA 4HMOA 2UYCA 5ENDA 1WMAA 1II8B 3DUFB 5HQ3A 4MKFA 4GWGA 1A9YA 3PGZA 5ILOA 3HHPA 1C0LA 2PKWA 3H3JA 4IJ6A 3BFVA 4PSAA 4QGBA 3EA6A 1OLUA 1MLDA 1QMGA 1T2FA 1K9SA 2CZGA 3KQQA 5TY0A 3WB9A 1U6KA 4B3IA 2CXHA 2UUOA 5KTYA 5TIIA 2Q9AA 1VQ8A 2L69A 4JH0A 2B2VA 2I3AA 3Q40A 4P7GA 4DLAA 2REOA 2Q5JA 4E88A 1A4IA 1NHWA 2XXJA 4OHFA 5IJXA 3IDAA 3T6KA 4CLXA 2GBLC 2RHWA 3K4PA 1ADYA 5JAIA 1BRMA 4CXMA 2HCJB 2H1RA 1OLXB 2RAVA 4HRXA 1OT5A 1JHZA 3GV3A 3MAGA 1VC2A 4LUCA 4MUFA 4V0ME 4X91A 1CPYA 3U31A 4DS3A 5AM2A 1SHKA 5I3ZA 1GL3A 4AIMA 2PA3A 1TQDA 3UOWA 2HHLA 1I2MA 4ZAXA 1VHJA 3C15C 2Q5CA 4RNCA 5FWDA 3RW9A 1IBLB 2CLSA 4QF4A 1TLLA 1VKJA 3M7NA 1ORWA 3IOYA 5TJ9A 2YBDA 3NUCA 1ADFA 1ZZEA 2UZ3A 2ZETA 4IIEA 4OL0A 3R77A 4QFMA 1GKKA 5HFAA 2JGKA 4DR1Q 3QU4A 2RGYA 3U4IA 1NVEA 3F46A 4Z8YA 3WQBA 3ZHYA 3WTBA 5JNTA 3CF4A 2RI0A 4BVBA 1U0BB 4Y1EA 2BFFA 1TUBB 4Q4CA 1ZCZA 4NFSA 4LSWA 1ODTC 3G1TA 4XOUA 1LV7A 3OPYI 4XWKA 1WTRA 3Q8MA 1XX6A 2JEOA 3FOCA 2CCGA 3FY4A 1HUQA 4R1OA 3L6RA 3UVEA 1QV9A 3MBKA 2P5UA 3SHTA 1B43A 5EJEA 2Q3DA 3N2YA 1E3TA 2Q8TA 1N0HA 2AXQA 3DMPA 3NWOA 1GPDG 2C9YA 4JLSA 1XXGA 1DMSA 1WF6A 2F0FA 3BS4A 1KJNA 3EZNA 3QE9Y 4L9RA 4LF9B 3N59A 3L4BC 2SICE 4V1CI 3DZGA 3NANA 4CIAA 1M2VB 2Z4HA 4QATA 4MQ6A 3GLSA 4RLHA 3W2TA 4BPBA 3ELWA 2YYSA 1NVKA 2OZVA 3QELA 1EQUA 3NHMA 3VU3A 3W7VA 4BQSA 1GEEA 1UPFA 5GJBA 3GZJA 3U80A 7REQA 2FEOA 1W6KA 1O5IA 1X32A 1JSLA 3IJ5A 4B3CA 1O58A 5CGKA 1ZEJA 1LWNA 3LDAA 4GYWA 5TQ2B 1KYIA 1SMXA 3S1NH 1SOUA 1CULC 2C2HA 2ZKIA 4ZAYA 1L8OA 5HG0A 1PJZA 4RH3A 2GGSA 2FHSA 2VT3A 3KZMA 4KHPB 4YCNA 5U9CA 2ZIXA 3O95A 3NENA 1JR3D 1RM0A 2ZYRA 3K2IA 2Y4NA 5DX0A 4DV3Q 3M4JA 5CYGA 3OIVA 1XTUA 2R8OA 1LLCA 1P9LA 2Z30A 2HCIA 1G7RA 2UVPA 4DR6L 2IGTA 4ALMA 1HDIA 1P7YA 3AKYA 3G82C 3CKIB 4Q1VA 2H0AA 2C20A 4R1PA 2CN1A 2HK8A 2VA9A 3GUVA 3SG0A 1ITZA 4EYGA 4UUPA 3L5KA 1Y6JA 2Q6IA 1FBTA 4IMJB 4QNMA 4BNMA 2NNWB 2XR1A 3VISA 3GJRA 2FJ2A 2Z43A 3FUXA 1KOJA 1PTJA 3N0VA 1YJBA 1OILA 4PYRA 4PLGA 1QQAA 4BN5A 5IHPA 3A26A 2AVNA 3HG7A 3QELB 1AZWA 1HMYA 1OI4A 1WTQA 3TVDA 4O4HF 2CGEA 3ESAA 3UWSA 3JXEA 4ALIA 4O02B 1HNZL 3WLOA 1ZUNA 2WIBA 1HYHA 1D2MA 1IY9A 4D9CA 3KOJA 4CM8B 3QWHA 4LJAA 3K0YA 1SZJG 3B5JA 2RDMA 3CC8A 1FVIA 2RH9B 4FR0A 2Z09A 1GGNA 2FK8A 3DL4A 4HB2A 4KIWA 4EGFA 1SG0A 5J47A 4XJSA 2FOIA 1B42A 1XJVA 1P45A 2NV0A 4Y6SA 1T36B 3THSA 3ENVA 1EJ6A 2F55A 1J1IA 3U3XA 1IBML 3Q3HA 2R5FA 3L7JA 2ENWA 3GTPH 4R0MA 2OD9A 3VR1A 4AYXA 4GICA 3WXMA 4AF7A 5DCUA 3VTFA 4ITUA 4BNLA 1OV6A 2HJGA 3ERSX 2XLCA 1OMOA 4F87A 2COUA 2J45A 2BHLA 3KOUA 3N52A 3EW9A 1BO6A 3HABA 1NLMA 1C3OA 2CUKA 2H31A 1IULA 1Y1SA 2Y2VA 2E6UX 1BA2A 3PXBA 1I80A 2CFMA 1JQJC 1GTL1 3ZTTA 4KQIA 4IFEA 2V03A 3ZHRA 1ZM2A 1FJGL 1VI5A 2EJTA 3BULA 2O5VA 3C7TA 2FV8A 1A98A 1NASA 2A73B 1Y63A 3COYA 3LC1O 5AP9A 5LOVA 4UD6A 3LXXA 4K6OA 4EJSB 2G5DA 4BMXA 4FPXA 2P8SA 1OLXA 1Y9EA 3QYPA 5FBHA 1WQ3A 2NM0A 2R61A 3QM1A 2SECE 2WFLA 1ID8A 2YXNA 3MA2B 3K59A 4BP3A 2HA7A 1EFVB 3I4NG 1GZUA 1GUNA 3RS2A 5TT0A 2NVUB 3TXXA 4B4DA 3SEBA 3R5HA 5D7NA 3KDAA 5FEMA 1B2TA 1QDUA 2JVIA 5EMJA 3A9WA 4YRGA 4L8YA 1QJOA 1NFFA 4EDFA 4QJ4A 2NYVA 4YAFA 2ZI7A 1Q7EA 2CE7A 2R48A 1LVHA 4JLVA 3MXTA 4J16C 1IHXA 5DMHA 2XTMA 1PH9A 1KVSA 4X71A 1CP2A 5E1DA 1JDBC 3D9QX 3LM8A 4B32A 1H8ED 3DNMA 1JWBB 2CHBD 3VO9A 4NX2A 5F9MA 4BU1A 4FIDA 1W1IA 1TQ8A 2I80A 3PGMA 1AUVA 1LA2A 1MD2D 1IWOA 1N8TA 4J94A 3DMDA 4AY2A 3C3WA 1Y48E 3WSTA 2J3EA 5FR1A 3KUKA 4KKSA 4UUQA 3PBKA 5HKOA 3JQBC 4AZTA 1N57A 1NU8A 3C1AA 5I9NA 2JSOA 4DAEA 1O77A 1M8AA 4A76A 3HKZB 2E18A 4LX8A 3UB3A 3VNUA 4K6HA 3A9VA 1C3XA 2JGDA 4MQFB 2Y1WA 3SOPA 1D5XC 2MSEB 3NG1A 1QFJA 4AJHA 4QBFA 2C5CA 3V6MA 4Q4AB 1AKWA 1VXRA 4E46A 4EJMA 3H2SA 3RARA 4LE2A 3ND8A 1PNTA 4XB6B 4JB2A 3FFWA 2GFQA 3IH5A 5K6AC 3OZUA 4XM1A 3KYHC 2JJMA 4IQGA 4JLDA 3TGLA 2BFOA 4H60A 3MJHA 1CS4C 4EARA 2X42A 2AN4A 2ECPA 3R7WA 5LVAA 4NBLA 3CZPA 4YDSA 1H65A 1C4OA 2XVSA 2OQIA 2G36A 4TMFA 2EWWA 4JJEA 2GESA 3FGZA 4MGKR 5LXTF 4OLJA 1OA1A 2PQAA 2ES2A 4OQYA 3T1HB 1SEBD 2HBZA 3OWEB 3FWKA 4LKOA 3T7AA 1V5IA 3DM1A 2R751 3TNYA 3VHQA 2DERA 1HE5A 1RU3A 4ZU1X 3P0JA 3NEJA 2V97A 2A9PA 4H6VA 3WIOA 3FGPA 1BBXC 2H1CA 2CF5A 4TRJA 1JAYA 1KE2A 2ADFA 1TUIA 2IYOA 4E14A 2QX6A 1ZX1A 2W5UA 2MINA 4YLEA 2AX4A 2BH2A 1E32A 2ZPUA 5E1BA 1W7AA 3HI4A 1JJFA 4CEIA 1Y1QA 4IUCS 2FP3A 2WI8A 5IN4A 4CKEA 4J9VA 4LZAA 5KKCA 1P7WA 3L1HA 1ZJZA 3V05A 1ZU5A 2XNCA 5JBIA 1O0SA 3IP8A 2ERXA 3M1AA 2UYQA 3OQOA 1WKVA 3DH0A 3DT9A 2CHEA 2QNBA 1G4AE 3H5NA 3OSUA 2JGAA 4MS1A 2Q5FA 3TBKA 4OSEA 3RLIA 4D6YA 1Z12A 3WLHA 4EFMA 3UFBA 3M5WA 4EUNA 1EUYA 1CUYA 3BXZA 4A75A 1S8AA 2QL7A 2CXPA 4X7PA 2WF8A 2NU6B 1DVRA 1HO3A 2RK6A 4KBGA 3STVA 2B1JA 5CV5A 1IATA 4HAZA 4IUYA 1RIIA 3W77A 4CM3A 1UBCA 4Z0HO 1Q15A 4OLAA 3BF8A 3F5QA 2V59A 2HCBA 3FSGD 4W6ZA 3CVYA 5DWQA 3ZDXB 2VL7A 3GGCA 3CCLA 3GO4A 1CIPA 3LNTA 4YP1A 4DLVA 1W93A 1C1DB 2UZAA 2WM3A 1EDBA 3QBTA 2WUGA 3GWGA 5CD1A 3BWEA 4XVUA 3DYVA 2BFEB 3PFFA 5FOUA 4AM8A 4B6PA 3G8AA 5D3QA 3UMFA 3W78A 4QO8A 4R16A 3IRBA 2VQFQ 1YIDA 1SZPA 2EFDB 3NH6A 1X2BA 3QXCA 4H3VA 4HK4A 1BEUB 5I5GA 4BP8A 4I81A 5A2QL 1ZEQX 1PYOA 3D59A 2R6FA 3KV3O 3EIUA 4QRIA 3ROEA 4C89A 4A3GB 2ZUEA 2NPOA 3I1IA 4CN8A 1QK3A 3IAHA 2JFWA 2YICA 3BL5A 3IMKA 1A8UA 2ZJ7A 3CCSA 2MUYA 3ESBA 1TZMA 1Z18A 2JFBA 4RO0A 2EQ5A 3V2UA 4HH4A 3I0ZA 2QDBA 4J4HA 3ED5A 3QNUA 2GN4A 3TFWA 1ZK3A 3EFOB 2VQFL 5HIIA 2QWXA 2WIFA 1ZYRC 5AJ3Q 1NPTO 2Z2ZA 3PUIA 1NQAO 4LJ9A 4UBMA 4NBRA 4WKGA 3UUEA 3NAGA 4XIJA 1YRBA 3JAWA 2GB4A 3L6EA 3S1RH 2GARA 4MAFA 1ESFA 1FNWA 2OT3B 4P2CB 2I5PO 4IICA 3CX8A 3BM5A 3ZY5A 1GPMA 3W5JA 2J41A 3H6KA 3HY3A 5GADC 5TPWA 1U8ZA 3VDYA 4A93G 2JIQA 3D4NA 5F2OA 5LMNB 3D4WA 2DR2A 3ZIUA 2V7VA 1FLAA 4V3CA 3RG2A 4BQQA 4D92A 4IW3B 4A1OA 3H04A 2WV7A 3U16A 1HH4A 3AH8A 3M4PA 3BVGA 2QD3A 1EB9A 1ZJWA 4DG8A 1VG8A 3LL7A 4R8IA 3CTMA 3CZRA 1WD7A 5DKFA 1SC3A 2WZDA 1HCZA 3EAFA 3AV3A 4D0GA 1U3UA 1AOXA 1RW4A 2R2AA 1T0IA 5KYYA 1L1EA 1P80A 2ID7A 4TQGA 3W7BA 4V1CB 3COJA 3F6CA 4DV2Q 2BEUB 2Q4EA 3ZBPA 5IJ9A 1H9BA 1EZ1A 2EE1A 3N8HA 4QUDA 4EYOA 4HATA 4YXWD 4F04A 5C51B 2J3JA 1I7SB 1IZ7A 2IVZA 2XMPA 1JVSA 1O6GA 1X9HA 2OAEA 2VO1A 4M98A 4RCYA 4V0SA 3FMPB 2CV0A 3P9RA 3E18A 3GARA 4X1YA 5IVDA 4DBLC 4IG4A 2I55A 4M53A 1O8BA 5B7GA 5IN5A 1EJ2A 3TQSA 1S2DA 1R0CA 3UO8B 4ZEVA 3NS7A 1EM8A 2XYQA 2ZI6A 4J1TA 3JYNA 5J2TA 1XU9A 1YHBA 3MHTA 1N6HA 2WHPA 3B8HA 3LBAA 1LDBA 3EEFA 4IOJA 2B9VA 1X54A 3H13A 3INYA 4PHHA 3K70B 4RA6B 4LOLA 4YP6A 2PGLA 3MWJA 4JQYA 1Y5RA 2W4IA 3OZXA 2ZFUA 3R7FA 4TTJA 5EJ7A 1EUJA 1AQIA 1SE2A 4RHCA 1TZBA 2EYPA 2D62A 1PH4A 3CC2A 4LPKA 4TLCA 1QE5A 1K6MA 4HZUB 5T4BA 3OX2A 3UM9A 3AESB 4UPEA 1XA4A 3ONVA 4IN3A 5E7QA 5AWFC 1F9PA 1P4AA 3C16C 4G0MA 3GAFA 4H77A 4NCKA 4NQZA 4UBLA 4ZHQA 3Q5GA 1XNJA 3TN7A 3THXB 2WOJA 4TKLA 4LV5B 4DUYB 1VQCA 1XCJA 5K45A 2FE4A 4R0VA 4K9PA 3T56B 1OKKA 1T8UA 1T1SA 2XWBF 3MPUA 3RN5A 3LUBA 3CGGA 1QQTA 1PTJC 1AGYA 1XUOA 1YD7A 2JVJA 4JEHA 2JEAI 1XZIA 1H66A 1Y1TA 4IDCA 4NV0A 4C3ZA 1K68A 4RDHA 4EENA 1R9MA 3AUKA 2KVMA 3ULKA 4M99A 4HNSA 4MP8A 3OQMA 2P77A 5JG7A 2F0WA 4QBHA 4TWIA 3GPLA 3TIXB 1FJHA 1SXJC 3M3YB 3G2NA 4MW6A 5KSZA 3ADDA 3M7GA 5A2QE 2Z2YA 4ZIRB 2WHEA 3SCZA 1A8QA 3HACA 4RVHA 4X61A 5JZBA 3HKZG 2BRUA 3S7TA 5ADHA 3OZAA 1B6SA 5DAUA 3HJCA 1M1ZA 2WFAA 3H2BA 3SZLA 4LNAA 4AWXA 4ZZ0A 2V9ZA 5T4HA 4NZZA 4RVNA 4FXKC 5HUQA 5ABPA 1JMVA 4IH1A 1H1TA 3H1BA 3L46A 2X4IA 3ICPA 3S1AB 4UU7A 5I9PA 1FX0A 3IVCA 2R60A 4CCWA 2VTBA 3T1YB 4OG2A 1DBIA 1Q7BA 2XZTA 4R69A 5ECDA 2UXBB 4OQZA 1KI4A 3MOGA 4OSOA 2QM0A 1AB6A 1JKIA 1Z5PA 2LPMA 1NJGA 2BT4A 2W6ID 2V45A 3LH5A 3HOUB 2WM9B 3KLSA 3GVHA 4X1KB 5KTKA 4NBWA 4PIVA 4YAKA 4ZVMA 2P4EA 3NDJA 4E5UA 1E2GA 5KOJB 2GHRA 2VNAA 2PLAA 2GF2A 1CKMA 2E2HB 3MINA 1DIGA 1Y80A 4D3YA 1RD4A 1IY2A 5COQA 1I7QB 1BKBA 1V43A 4HNHA 4MV9A 1A69A 1RYYA 1K8YB 2V7UA 4JUCA 5CEEA 4EJ2A 1SOWA 1LLQA 4ZVLA 4BO5A 1VHLA 1B74A 3GGGA 4FNFA 4WCDA 1STBA 4PAMA 1RKXA 1Z2OX 2X3FA 5I7VA 1FCJA 1ASZA 1VGVA 2BHSA 2R7MA 4L08A 1MW8X 2HR1A 2QUAA 1R4PB 1LPOA 2L17A 4FBLA 2ILTA 3KKEA 4K6LA 3DDCA 2QTGA 2EP5A 2F0QA 1SUEA 4LYDA 4QYMA 2CXXA 4EAQA 3IMGA 3W5AA 4U0KA 4ZO8A 4DIFA 3LRXA 1NVGA 5K1ZA 3MJSA 2IYVA 3R8FA 2F0SA 1UKVY 3BIWA 1GNLA 1TRHA 3E3OA 3FCEA 3U44B 1AK1A 4X7BA 3FF4A 4RLSA 4D9FA 2KLBA 2QRLA 1NVUQ 1GUBA 5DV9A 4Z99A 4YRPA 1DBRA 3NM4A 3RYHB 4ETIA 2QQGA 1THZA 3H9CA 1AKMA 5K9ZA 2F8SA 3CRW1 4X7MA