3PUYA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 96
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puyA01
2EWVA 1C9KA 1QZXA 3JZMA 3ZLJA 4HB3A 4KYUA 3I4LA 4C3HH 2E76C 1NIPA 1ZIPA 2P5SA 2UUAL 1EWRA 1EFHA 4Q4AB 1Z6GA 1OKKA 4TL9A 5TY0A 1TAGA 1T3HA 2OTLA 1IBKQ 3CPEA 2PJRA 3OOCA 4ACBA 4TN1A 4V0ME 3T1HL 5EUMA 4F4IA 3GTJH 1HJPA 1VQ4A 2EFCB 4DV3L 4B2PA 2JAQA 4AKGA 3GJ0A 1VG8A 4C3ZA 4DB2A 4LJ9A 2VNUD 1JQLB 121PA 1XWIA 3SBEA 4DSNA 2PLFA 3F8TA 5CDFE 4PO1A 3CC7A 1EQRA 2BJVA 3A1UA 2QA5A 1E98A 5FTJA 4OK6A 3REGA 2E8GA 2KENA 1KSFX 1SKYE 3QEOA 4JI2L 4OX9L 1M8PA 5CIWA 2FEOA 1ZNZA 2QT0A 3FMPB 3WNBA 3ZD7A 3RAPR 3PJRA 3K9HA 3MCAA 4A8JC 1J8YF 1S8FA 3CCMA 4A3FG 1JR3E 2I5HA 3IHLA 1L1OA 3I73A 1HNXL 2QU8A 2J7PD 2NTYC 3A37A 4BZQA 2BHRA 3RN2A 4CIDA 1S1CA 1V43A 3OTOL 1SVKA 2P2LA 2ZSDA 1OXXK 3I1FA 4J15A 4HAVA 1Z8FA 4QHYA 5EE5B 1CSQA 1M7GA 5J4VA 3LRPA 4LJ5A 1UAAA 4W5HA 5FTLA 3RLFA 1SXJB 4IOLA 4X8LA 2CL0X 1JI0A 2YOFA 4JBJA 3STBD 5HTKA 2K5NA 4M1MA 2ZM6L 1TU4A 2WVJA 1H8HD 3U3OA 1Z3IX 3AF1A 1VHTA 1L2TA 3GLIE 1B9MA 2ZE7A 2LMCB 5L3VA 3TKLA 1G5TA 2F43B 1GP2A 2GZHA 2P65A 2HCBA 3CM0A 1Z22A 5FUWA 1RL2A 1Q1ZA 2A1AA 2AFIE 2P6UA 1M6NA 4GL2A 1S96A 4PC2A 2QPOA 2QM7A 1W47A 2WM9B 4JIMA 2CWPA 1XMOQ 1E79A 5KDDA 4JI8L 1ESMA 2VHUA 5C0XH 3KXIA 1XXHA 4IJHA 1CI3M 2UZ3A 3EWSA 2A7QA 2H1LA 2IYUA 3PO3G 1UKVY 5H8WA 3QVVA 1Q1QA 1KRTA 2IW3A 4POFA 3ZD6A 3SGIA 3OW7A 1E22A 3GJ7A 3KQHA 1VQAA 1MRSA 4KHZA 2QP4A 3HYTA 3FB4A 4PAOA 4PPNA 5FUYA 4GOKA 4GLVB 1CJVC 1EX6A 1WCMH 4DV2Q 5LD2B 1F48A 4JI7Q 1Z0DA 2E75C 4F92B 1TADA 4D4JA 3U6KA 4BFWA 1QBKC 4U5XA 4MRSA 2F1RA 1GIAA 2V54A 2WOJA 4DLTA 1JPNA 1E3MA 3PIPA 4LF4Q 3D31A 2ZU0C 4PHGA 5FR1A 1Q44A 3GLGB 4N3NA 4BBRG 4LFAL 1U99A 5AUOB 3U60B 2B29A 1JJ2A 2ANCA 1HQYE 3CNOA 3EIQA 3AF3A 1YHBA 3D0FA 1K0RA 2L0XA 3FKSA 3VTKA 1N6HA 3HOVG 5HKKD 3U44A 1ZM2A 3HOZG 2K14A 4RZ2A 5EP4A 1SMYC 4OJQA 1Y8PB 2YOHA 4NMMA 1CXZA 4BY7G 3H3VH 1E2WA 4PZLA 5G3YA 4NYIQ 2YNMA 2JA8G 2V9PA 4HI0E 2RGAA 2I4IA 1QUQB 2FNAA 4E03A 2ZRDA 4QM6A 1BMFA 4RCZA 3VQTA 1NE3A 3QKRA 1PJRA 4TMZA 1HT1E 3LW8A 3BXZA 1M74A 3OAAA 4Q7JB 5K8TA 4L9WA 4NXNL 1MJEA 4MDFA 1FPMA 3QI2A 1XTDA 2H5EA 5C0XI 4OHVA 5DYIA 2XNDA 1E2LA 3RRNA 4U7DA 4V0NA 4YONB 3ZJYC 5FPHA 1DD2A 1PVOA 1H95A 1DG3A 1ZW6A 3FFAA 4BLPA 4DVGA 1DO0A 1EFCA 4F91B 1MR3F 1X8KA 2WWHA 1XPUA 4RFSB 3ZVNA 3PO2H 1W48A 3QVUA 2ZJBA 4YMVA 3KXKA 5HCNA 2UU9Q 4KFSA 4QRHA 3E1SA 3BOSA 2IYVA 2J5XA 1WQ1R 3RDPA 3ND8A 3OTOQ 5FOUA 4HR7B 2HIXA 1E1RA 1RIPA 3J81j 4B43A 2QROA 3ZVRA 1IXRC 2O8CB 4G7OC 1J90A 3MG9A 3GEEA 4DLVA 2AKAB 4UNQA 1ELOA 4D4LA 1KK3A 2OWOA 3G5UA 5SZJA 1TF2A 4JI2Q 2QT1A 4D0LB 1Y8OB 2W58A 5IP7H 1B0UA 2IYTA 4LW1A 1E2PA 4B33A 3TSOA 2X8AA 3U4QB 1KAGA 1W36B 3PUZA 1G6PA 3SJBA 3WMGA 2K75A 2GCOA 3K0AA 4JLMA 3EIEA 1TPZA 5GJWC 1IY1A 1P9NA 3UG6A 4BFSA 2NZHA 1IJFA 5IYDG 1KD1C 1RYFA 2PEZA 3HPRA 2ZTEA 2OT3B 5IK2A 5KPJA 4JOIA 2FMXA 1KI4A 3W5JA 1WBDA 1NKTA 5JRZA 3IQXA 1B23P 1ODFA 1SLJA 5DLQE 1R8SA 1XTJA 4G5GA 2DBYA 1KGDA 3HU1A 5DGXA 1HCZA 3Q5EA 3RRMA 4BY7H 1HTWA 1P9RA 4R7ZA 2HJVA 4F38A 3QXHA 3CRRA 5CM8B 2VQSA 1NJIC 3CCLA 3P27A 3RS0A 1KRSA 1XMQL 1G6HA 4I1VA 2OZEA 4C0AC 2PQAA 3QY0A 1W5SA 3DKPA 3AFPA 3K0FA 1KSJA 2ZUCA 4HDOB 5FPTA 3BGWA 3NTUA 4GZYC 5IT9c 3MWLA 5FLXc 3SYNA 2A6EC 4JBXA 2FPKA 2BV3A 2A19A 1TNDA 1DS6A 2MFIA 3LO5A 3SU8A 2VP4A 2QMOA 1IBKL 2XJ4A 1NBWA 3ZS9A 4D81A 2OSBA 3CF2A 4PO8A 5DH9A 1OKKD 1LF5A 2F43A 3KJOA 1BIFA 4BRUA 5C1BA 3NEMA 4KHPL 1N8RC 3I2ZA 2B3GA 2BBTA 1Y63A 2PJZA 4JLAA 1MKYA 2ZJ5A 4PC7A 1LS1A 4PPQA 4Q4JA 3QF4B 4M1SA 4IRUB 4EDHA 2FSHA 2GVBA 4LBVA 5ELNA 3RRYA 1NMXA 4HATA 1FTNA 1P7CA 3MLEA 4IW3B 1KO8A 1ASZA 3TUIC 4IO9A 2ZUBA 1XXHB 2Q2IA 1YZTA 2XGTA 1Z2CA 1SR3A 1AQUA 1X56A 1YBYA 1EG7A 1N5LA 3VNUA 5HGQA 2EU8A 3TK1A 2BM1A 4A3GG 2HJGA 2A6HC 2BDTA 2IK8A 4CEIB 3UIEA 1C0AA 2HT6A 4IQZA 1IBMQ 4GNXA 2CE7A 5G40A 4R2HA 1FTSA 5EXTA 2WAQE 1LB1B 3NHBA 4P4TA 4DKXA 2CCZA 3TMKA 3A7AB 3S16H 1XD8A 4ZKDA 3GJ5A 1Z63A 2ZJOA 1R0ZA 2W0SA 2VEDA 5CLQA 1TUIA 5JEEA 1XNRL 4XOIA 2PMZE 2ZM6Q 3BB4A 4V0MA 2P6RA 1Z29A 3NDPA 2O8EA 3HOWG 2A69D 2J45A 1T3SA 4XTCS 1D9ZA 2OHFA 3C14C 3I3SR 3K53A 3UK6A 4TLBA 4NXNQ 1Q86C 5M3FH 1TMKA 1II9A 3X1DA 4W9MC 1KK0A 4A3LG 4B76A 1PH2A 1EOVA 2IHYA 5F3WB 2O5IC 1F60A 2YTXA 1QHHB 1GUOA 2XOKA 1Z0KA 1IXSB 2UUAQ 4M1YA 4F7WA 2PCLA 3L43A 4L5SA 3OHMA 1HPCA 4Y0AA 4FWTA 5GADl 1V8QA 4JI8Q 1XU4A 4YWMA 3KLRA 3N5CA 2BH2A 2C9YA 3A1WA 5D3MA 3PGZA 4IPHA 1JQJC 4M21A 1GUTA 2QY9A 5BW8A 1E1RD 3FKIG 4NBSA 4B6EA 5IRCD 1VQIA 2GVAA 1N6NA 2AK2A 3OESA 2OTJA 4DV6Q 2J41A 4LBZA 3CUEF 1JR6A 1G3IA 3IILA 4P74A 5TMPA 5EP3A 4TZ6A 1Y69U 2FXQA 3Q5DA 4A3DG 1X3GA 1V9PA 4JI7L 1II8A 1BBWA 5AUNB 1YNJC 4YHHL 1E9DA 2Q3FA 1S72A 4I1OA 2BWJA 1U90A 2D7CA 3NEJA 4ITRC 2OLJA 4PC3A 4DUGA 3K09A 1GTVA 3I92A 1Y8NB 4A3MH 1VF5C 2B7CA 1K5GA 2KE5A 2XNDD 2QRZA 4PC1A 4KSCA 3WY9A 1SGWA 4QL5A 4DR3L 1VIYA 4Q9HA 5FBRB 4C0HA 2VBCA 3OAAD 2CHQA 3TZUA 1LY1A 4I4LA 3WMFA 2FG5A 4A2PA 2MNAA 4ME3A 3L2PA 1W0KA 2BVNA 4P32A 1VKJA 2C5LA 3BS4A 2O8BA 1TF7A 2J87A 3QBTA 2OAQ1 4DAMA 2Z5FA 2NO6A 1AGPA 3FHOA 2ODEA 3F3YA 3K70C 4NPHA 1Z06A 3IIKA 1Z0JA 1ZUHA 4N0EA 5GAHC 3CH4B 3CKLA 2RGEA 3UDXA 3VDYA 3VR2A 4JI4Q 3I55A 4GOPA 3EZ7A 1YNXA 4IDPA 3PG5A 4C30A 3HOXG 3FKSD 5HKKA 4QC2A 5C44H 1U8ZA 2OQKA 2XSZD 4HB4A 4IFDH 4LC0A 1S0UA 4Q7KA 4QJ5A 4A6PA 2GCOB 2JJ1A 1U0HC 2BBWA 3JAMi 1K5DA 1N5IA 1XEXA 4LJZC 4AG6A 4ZDKA 3H3VI 1KNQA 2EW1A 2Y0SG 2Z4SA 2ZI4A 1X8LA 1QF9A 4OQNA 4ARZA 4KCGA 4DSOA 2VP9A 1W4AA 4KV9A 1F2UA 2QNRA 5EP1A 1VQHA 2JA5H 3VMFA 4BLQA 2YKGA 2W6JD 4DR4L 3Q3JB 4OWWB 4QIWE 3UKDA 2QTHA 3GJ3A 4RY2A 4LPSA 4HDCA 2Q9BA 3RZDH 1NMZA 1J99A 2DN8A 1C1YA 4GPTA 1KY3A 2NVTH 1UKZA 1E32A 4PQFA 1WF3A 4QBHA 5CM9C 4ZV4A 3A4LA 1P60A 4Q9LA 2ZTDA 1FX0B 3GMTA 4R4QA 3VR3A 3RS4A 5M5XH 3J7ZC 4Q9JA 5BYKA 3PEYA 4LUOA 3BH0A 2J0UB 3F2DA 4R4IA 1CF4A 2OESA 3W6OA 2QSZA 3SN6A 1W3SA 4EQ5A 4H1UA 3C5HA 4LK2A 1FP7A 4A8JB 3UPUA 3THXA 3EPHA 2IYLD 3SE0A 2BE5D 3G0HA 2ZEJA 3FP9A 2GCPA 4TSFA 1WOCA 2K33A 3BAFA 1IN7A 1GHKA 2HCJB 2AKWB 1YHAA 2ZRNA 3WYFA 2IS1A 4RFSA 1MABB 3ZDQA 2JLQA 5AJZA 2DY1A 1OH7A 4R4TA 3AVQA 1NMFA 3C41J 3V9PA 3QXSA 2F1MA 3CCQA 4DR2L 1OIXA 2IYRA 3D3QA 4DLSA 2GK7A 2JLYA 2VQEQ 1UKYA 1T3LA 1FVIA 2OCPA 4LUVA 5IWAQ 3LBIA 5FI1B 2XTIA 1A4RA 4R4OA 3LNCA 4YHHQ 1JT8A 5J5CA 1M34E 1D5CA 2IT1A 4JI1Q 4GLXA 4FI3C 1EYGA 5JI3E 1E96A 3GLHB 2JLXA 2ONKA 4PQRA 1KY2A 1KK2A 2IXGA 2NMVA 4A2WA 3HOYH 3I8XA 5AUPB 2JIZD 1CKNA 1QRAA 4IFBA 1YZKA 5GJBA 2KCMA 4G5RA 1OH6A 3RS5A 1AZTA 1G8HA 1TWAH 2AN9A 3T1YQ 3PITA 3LD9A 1A63A 2GXSA 1YNNC 1XTSA 4DK1A 4XIGS 4HIOA 2G0TA 2EFGA 1Q82C 3CZPA 3D6TB 2PZFA 3OIWA 2DFKB 1CR0A 4DV7L 1EIYB 1ZNWA 2EFDB 2I1VB 4A4DA 4L5BA 5E3HA 4DRZA 3I4OA 3U7GA 3AVXA 4ZO4A 3OYYA 4MITA 4A0RA 5EZ6B 1G3QA 3LLUA 1ZYRC 1E2FA 2PT5A 3H84A 3V4RA 1PYBA 1PYSB 1KO4A 4TQAA 2ZR9A 1XD2B 1VQ5A 1VECA 2VHJA 4HLCA 1TX4B 1CR2A 2XTNA 4DV5Q 1C9OA 2HXSA 4IFEA 5M5YH 3A58B 2DFNA 2F1HA 4J0QA 4F93B 4LF5Q 2H57A 2ECKA 4B75A 1D9XA 4X64L 2RGCA 5FTKA 1UBCA 4HUQA 1E79D 4S35A 5DE3A 2XAUA 4EJSC 4KBFA 1E9FA 1CKMA 2NIPA 2WFWA 4DR4Q 1AH9A 3NBZC 3W5IA 4EUNA 4F4CA 4D25A 2HHHL 3K9GA 2F1IA 5A35A 3NELA 4HLDA 1KI3A 3N2EA 3K70D 3J80i 4IFDG 4NYMQ 4Y7NH 1JXMA 1NSTA 2ZS9A 3AQQA 2QMEA 2ZJPA 4ABYA 1MJCA 3QEJA 4MKGA 4OI1A 3C5CA 5KNDA 4DLUA 2CLSA 4PFSA 2DCUA 2ZJAA 3H86A 4DSUA 1E9CA 3P4XA 1VPLA 2JGNA 3WBJA 4TTRA 5DI3B 1G8YA 3CW2A 5TDHA 3QKSB 3GLGE 1TWHH 1JB7A 3TEHB 1Z5ZA 3HOUG 2J7PA 1PMRA 4C0JA 1WI5A 2F55A 1N3BA 4ALPA 3VA7A 1WFQA 1KZGB 2G0NA 2CK3D 4A2QA 3R9IA 1DAMA 3UDFA 3GJ4A 4OWXB 3RNLA 1Y1VH 1JNYA 1ZD1A 4JG2A 1VHLA 2PZGA 4JVMA 4MYTA 1K8MA 4MGIR 4CW7A 2R93H 4US0R 1XNJA 3QOFA 3SI7A 3UANA 4A3CH 4YLGA 4YQFA 1KYIA 4HDQB 2IHFA 2O0KA 4BY1G 3S1MH 1XDBA 4ZI3A 1OXVA 2YINC 2QENA 4A3DH 2B8TA 3KB2A 4JBYA 4DLRA 5HZKA 2O0JA 4M1KA 4N0DA 3TQYA 4URZR 4ARZB 1VCOA 1PV4A 1SXJA 2WSMA 4FINA 2ANBA 1OHHA 1E0JA 1RPZA 3KDFA 4LWZA 5FBQB 2PNHA 3CCEA 3B9PA 4JLJA 4X62Q 3U7HB 3CMAA 3C8UA 1A6XA 4CEHB 2UKDA 4UKDA 1T0HB 2GF9A 1M2OB 1CJTC 2IHEA 2ATVA 2L15A 1XD9A 1NSFA 2B21A 3SZRA 4FMBB 5L3SB 1UADA 2IS6A 4M4SA 4RD6A 1TWFH 2FOLA 3GDEA 5IYCG 3CH5A 3VFDA 4QNRA 5LMUQ 4QGFA 2UVQA 2J0UA 3AUYA 5GROA 2O8FB 5H1SE 521PA 3EA5A 3W5OA 3MWJA 3THXB 2HIVA 2R92G 2ZI7A 2ZRMA 4G7HC 1G41A 4B3RL 4R2IA 3PIOA 2C98A 2XB4A 4DJTA 4MTNA 1E2EA 4U02A 4PSKA 1PLLA 1N25A 1OFUX 4ZDWA 1KI2A 4M9QA 1M90C 2ATXA 4DV6L 3O47A 2DUDA 4YWLA 1CTQA 2WJVA 5H68A 5BXQC 5CDFA 5CITA 1OIVA 1YJNA 2VQFL 2ZTCA 2Q2UA 2D74A 3AKDA 5DHFA 1G8FA 3AVWA 1UE5A 4IPCA 4DR6L 4DV5L 3AVVA 1TQ6A 4TT3A 2UXDL 1CLUA 2DWOA 3ICEA 1HQMC 1R0WA 2GETA 3L8YA 3T1VA 1E2NA 4P0TA 2I5LX 1E2MA 4KXFB 2FFHA 1XP8A 4RZ3A 3PEVA 1XJVA 1DG1G 5EXSA 4A82A 2N46A 1D6JA 1HH4A 5AWFC 2ZJ2A 4MKFA 3OFNA 2I3BA 5KU1A 1YZ6A 1E4YA 2A6ED 3THWB 2R6FA 1D8LA 2V55B 3IBYA 1TWGH 2E2JH 2EDGA 2BJWA 3EC2A 4JI0Q 2CKZB 1VTKA 1D2MA 2JA5G 2A5GA 5JLJA 4HAYA 3SS8A 2J59A 4BGDA 3PCOB 3QKRB 3IO5A 3TAHA 3MD0A 2J7KA 4DV1L 2OCBA 4Q7MB 1N5JA 5IDVA 3VKWA 1ZCBA 1Z0IA 1NVVR 3U6BA 1LYLA 4AH6A 2Q2TA 1O87A 1WCV1 3LVRE 4TLDA 1A7JA 1RC8A 2D0OA 1DVRA 5BWMA 3J81k 4LZZA 1P16A 2BBSA 1QVFA 5IWAL 3GLIA 4YMTA 2OE2A 2XNSA 1LUZA 2HQLA 3ASYA 2VF8A 4V0LA 2JA1A 3A4MA 4JBWA 2ZETA 2RGDA 1JECA 3BZCA 4PV1C 4LJ6A 4BLTA 1E1QA 3BK7A 1ZBDA 5B64A 4B3MQ 2NN6I 1B70B 1LS6A 3KUCA 4C3JH 2F7SA 1JEEA 4MZ9A 4BFUA 3HOUH 2EQSA 2XTMA 2R7ZH 3EG5A 2YTVA 1XFAA 2GTPA 2PLRA 4LV8B 3G4SA 3NBFA 4YMUA 3SJZA 2K4KA 1E9RA 2QGZA 3E2IA 4A1FA 4D6PA 1UKEA 4QJ3A 4URXR 1I2MA 3LQRA 1Q90A 2CCGA 2REOA 2Y8EA 3B5JA 1YZUA 4P75A 4G5QA 3PEUA 2R6GA 1D7QA 3FGNA 4WXPA 4F4JA 2JEBI 3QPUA 3KQUA 3LGJA 3DDCA 3I8SA 4QNMA 3WMEA 5J4LA 2CNWD 2IBMA 1TEVA 3X1YA 3KKNA 2XXAA 3RHFA 3KUDA 3HOYG 2HYDA 1KDRA 1VYUA 4OHXA 2FJUA 3B82A 3GTOH 1T5IA 4CF7A 3TW8B 5FLMH 1KDOA 3QPWA 3FKIH 1Q1BA 3K80C 2OBLA 2Q3MA 3WHKA 2LXKA 3TUZC 4BLOA 3D4RA 4OHYA 3H0GH 1RJ9B 1U81A 1LNZA 4WJ3M 3Q8XB 2CE2X 3DZDA 4B44A 4C2MH 1Z9FA 1G16A 1XTQA 2O0HA 5SZIA 2N78A 4ZCLA 1I3QH 3U2QA 3PENA 2YU9H 2EVWX 3PO2G 2FSIA 1IN5A 4Q1AA 4E22A 1E2IA 1LF0A 2ZRKA 3LLMA 1W4BA 3B6YA 2F3IA 1GWNA 5C0XG 3THYB 3GEIA 1T5EA 2D06A 4JV5L 5J4KA 1UE6A 1Z08A 2J9RA 1YJ5A 3TW4A 2OFXA 3F1ZA 2PZEA 2ZE6A 1EFWA 1J2JA 1FL9A 2OCAA 4AYTA 2VHQA 4HUTA 5M3MH 3TR5A 3W3AA 3B60A 2DFTA 3C7KA 1BVSA 2D7DA 2MMCA 4KKTA 3FMIA 3T61A 3A1VA 1S9DA 4Q48A 4KN4C 4GKJQ 4B3TL 1X6OA 2Y0SE 3T1YL 1ZUIA 2F1JA 1CUKA 1Z2AA 2JDIA 3BERA 4TMXA 3EZ6A 3QF4A 5L3SA 1OH8A 2LKCA 4LWCA 1R9TH 3O8DA 4LJ8A 4P4UA 3TQCA 4JI6L 4S2EA 1CFMA 2CHVA 4UNNA 3E9IA 1QVAA 3DKVA 4IOJA 3PXGA 1JR3D 1GNQA 1VQEA 1VQDA 3CQZH 3K7UC 3RN5A 1HYQA 1OYWA 1OIWA 1S4QA 2QMHA 2RB4A 3MRSA 4K46A 4A0FA 3U3KA 3AF0A 4GNXB 2NVQH 3CRKC 1YJ9A 1U98A 2W00A 1QZGA 3CPWA 4EIWA 1S3OA 1PHJA 1TQDA 4BBRH 1YHQA 1ESNA 1N34L 4RSGA 1AS3A 3IGFA 3WWVA 4R4CA 1NY5A 1U9IC 2WZQA 3ER0A 4R71A 3U7FB 4DT1A 4I1UA 4TMVA 2EFHB 3B6EA 3BFXA 4HJ5A 3QBVA 3GTQH 4B3GA 4OYHA 1AE3A 2JEAI 4A4IA 1BS1A 4BXXG 1NLFA 2QQ0A 2QUZA 3A8JE 4GOPC 2IYXA 2YWEA 3K9LA 4LY6A 3LVQE 1H9SB 4X66L 4YY3L 3V4FA 1D2EA 2VLIA 2ZRJA 2E9SA 2NO9A 4OO1G 2ZJRA 4PQYA 1DAFA 3KJIA 1ZP6A 2FZ4A 2O5VA 2ZRHA 2K5HA 3GTMH 1ZUNB 2PMKA 4OI2A 3STBC 5TV2A 1ZKOA 4JT2A 4PHHA 4LHXA 3DO6A 1KHTA 1G7TA 4DDWA 2OO7A 3DMDA 3E70C 3FMFA 4GFDA 3REFA 3ADCA 3FKQA 1PH3A 4QL3A 2WICA 2B8GA 3A8KE 5CK5A 3MXUA 4IJLA 4YWKA 3K0CC 3NVAA 3PQCA 1DAGA 4POAA 1GKUB 2FPMA 4PXAA 4BASA 2VHCA 3BJUA 4MH0R 3SYLA 4KBGA 2LXJA 1WDTA 1ZM3A 2FGKA 4L5QA 1XEWY 3R20A 4DKAC 2A5DA 5C4JH 3BB1A 4FMCB 4B34A 1X8JA 1OYYA 3IIJA 2IS2A 4MUBA 3S1AB 2K5VA 2CMKA 4JKIA 5EJEA 4GZMA 2D62A 1HZBA 2GBLC 1HR0W 4O2LA 2D5DA 1SQ5A 4JLOA 5IYCH 1WMSA 4NH0A 1Q81C 1TEXA 4KFUA 1YVCA 3M4YA 2ZPTX 5C4XH 5C46F 3W34A 1GM5A 1U8YA 5CB8A 3HKZG 1ZD8A 2WWIA 1E24A 3A74A 4TYPA 1ASYA 2IX1A 2WTUA 1A62A 4ESHA 1JXOA 1N6IA 4LHYA 1AKEA 4TLCA 5LB2A 3DM3A 1RKBA 2CNWA 2QE7A 5HR5A 4DK6C 4B3FX 2O8BB 3KQNA 1E0AA 2E1RA 4IEIA 4D82A 2BEKA 4B2IA 3NH6A 2QTFA 2VIIA 4CYMA 1AZSC 1L1OC 2OXCA 3P1JA 3FHCB 4IOKA 3TREA 3HP1A 4GNKA 3MUFA 4HZIA 4JI0L 4RVCA 4UP7A 4C7OB 3UMSA 1K83H 3TIFA 2VS1A 1BYUA 2HYIC 1EWIA 4JOIC 5LMNL 1BOFA 4O2DA 2ATWA 2GCNA 2IUSA 3NXSA 3SEAA 3SYKA 1GRRA 3S1NH 3M4OH 4DR5L 2HDNB 2WKQA 3KJEA 3HOXH 3SQWA 5LMUL 2A5JA 4RKEA 5HE9A 4Q1FA 2FFBA 2BA1A 3QKTA 3W6PA 4HJ7A 1XEXB 1Z6AA 4L15A 3WNCA 1EWQA 4L9SA 1A8VA 4Q01A 4A92A 4JKYA 5G41A 1CR1A 1BDOA 1Q12A 4M9XA 3P26A 2LSSA 3GCGA 2C2HA 2QAGC 3LBNA 1GRQA 3GJXC 2KSQA 3L0IB 5H70A 2IF2A 3JAMc 4BFVA 4CGZA 2IS4A 3NBYC 3H94A 3TRFA 3ZYCA 2BBOA 2VQFQ 3CLVA 4LX0A 2GRJA 2H92A 4DR6Q 1TUEA 3X1ZA 3GP8A 4G7ZC 2QN6A 5JWOA 5FPKA 2G83A 2PI2E 3M4QA 4R1JA 4A3MG 1UDWA 1IJEA 4K0KQ 2GXAA 2IA5A 3U4ZA 3TNFA 3KJPA 1H9KA 4PG3A 2CW0C 2RCNA 1ZRHA 2GK6A 3UXMA 4QM7A 2GEVA 3K0CA 3AB9A 4RD1A 4ON9A 4H1VA 3EZ9A 1N36L 2QAGB 3MAAC 2PNRC 2FZLA 2H16A 1LVGA 4HIKA 1Q3TA 2NO1A 4WIAA 2XZLA 4YY3Q 4EPWA 3U4VA 1HT2E 1Q0UA 1W46A 5E7MA 1I4LD 3EC1A 2RHSB 1TF5A 4LHWA 4Q02A 4QG7A 1G3UA 5JS7A 1CS4C 2GDJA 5HPYB 2KJQA 3DPUA 1AK2A 1H9MA 4B3BA 1XTKA 3G48A 1ZVQA 2IYZA 3B2EA 4I99A 3ZQJA 3TJZA 3DLLA 1CULC 2C04A 4DV1Q 3JVVA 2W6JA 2ODBA 4X65L 1A5TA 4ZIRB 2MO1A 3FHTA 2QMUA 3OIUA 4BBSH 4H02A 5M04A 2XZOA 2YYZA 2IY5B 2ZTSA 4AYXA 4Q1CA 1Y1WG 1UJ2A 3N2IA 4KYIB 1Q22A 1GFIA 4A3IG 4PANA 1MT0A 1OF1A 3WXMA 2AD1A 3HOZH 5F2EA 4P3YA 1I6HH 2JA7H 3KFVA 2QPAA 2J0QA 4LCBA 1IY0A 2Z0SA 2G88A 3F2CA 3ZZ0A 1HNWQ 2I1QA 5EZ5A 4QJFA 1DBSA 1VQ6A 4LFBQ 1JB1A 1TU2B 4DUZL 4KLZA 1K8OA 1XEFA 4GOXA 1UE7A 1Q8KA 2E5LL 2B92A 1B8AA 3A5UA 1XNRQ 1G3RA 221PA 2YWGA 4CDGA 5K8UA 4OONA 1FQJA 1W5TA 3RLOA 3TQFA 3F5FA 3LBHA 4X6AH 5TXGA 1Z6HA 3EPLA 2CWAA 3EAQA 1H9SA 5JMTA 1ZD9A 4XH9B 1GUSA 1A1VA 2O8DB 2WHXA 1W1WA 4DDVA 1Q46A 4NYJQ 3BH6A 2QBYB 1WA5A 5JRJA 2ZVPX 3UMFA 2WP8J 2ZRAA 4H13C 4LF9L 2LKDA 2RHMA 4O0MA 2EJGC 3LDAA 1SXJD 1P2VA 3NH9A 4JC0A 1Q1EA 4B3SQ 3V00A 5FTMA 4EJSA 2C96A 4FW9A 3MGCA 4O0AA 4MGKR 2UXCQ 3WYGA 2ASEA 5F9HA 2QGNA 3A6PC 4MKHA 1NMYA 4TMKA 2G1JA 2R7DA 5C4MA 1J70A 5EE3A 2IWRA 1I4DD 2ZYWX 4CVNA 1IAQA 2WV9A 5JZVA 2O8CA 5LMNW 4G5SA 1YU9A 4WXRA 1G20E 4JJZA 1OB2A 4NXML 1WBBA 3VU9A 1XNQL 3CRVA 3EX7C 5FJ8G 1P5ZB 1X1SA 4MGZR 1CP2A 3T06B 4PZ8A 5M3FG 1XCPA 3CPHA 3EASA 3H4MA 4DCUA 4UNPA 4QJ4A 1IOZA 3B1ZA 3LV8A 5KTYA 1X55A 4JV5Q 2C9OA 2QQEA 4Q4HB 1G1MA 2JLVA 4V03A 1L1OB 1RE0A 3TVTA 1KSHA 2ES2A 5AJYA 3GLHE 3B1YA 1G7RA 5EP2A 3CO5A 4B48A 1F6BA 4B6FA 4Z54A 4X8OA 2AR7A 2KCTA 3SDZA 1FNMA 4A3EH 3A36A 1V5WA 2NQ2C 4PR0A 5G3ZA 3IUYA 5HZHA 5KPDA 4DNTB 2FSFA 1KSGA 4B2LA 2JLZA 4TT3D 1CIPA 5F9FA 2ID0A 3IKJA 4MYUA 1IHUA 3X2SA 2V1XA 2GJSA 4A3FH 1KNXA 4IDQA 4OQFA 4QFMA 4A3KH 5EXXA 4LHZA 2OCYC 3AF4A 4C0LA 3P32A 1ZM7A 1N9WA 2BMEA 3BRWD 1IY2A 3WRYC 4ERNA 3CX7A 5DHAA 4LF4L 4M0LA 1SVLA 4DAYB 1G4UR 4FDBA 4DNIA 1HY3A 3VR1A 2HV8A 5JHGB 4IVRA 5HY6A 2FA9A 2JK8A 5KSPA 5BYJA 1DCZA 1GL6A 2NO0A 5AJWA 3T1HQ 1HQCA 1G8GA 4NCKA 1MO5A 5KNBA 1EUJA 1OFIA 4Q18A 4JLKA 3KJHA 4W5WA 1MO4A 1NN5A 2F9LA 3EARA 2C9CA 1T6NA 1EK0A 3RYTC 4GOJA 4X66Q 4QXAA 1G18A 4LF6Q 4WZ6A 1XZPA 4DUYL 2O52A 4FD2A 1BMFD 1FR3A 3S24A 1IM2A 4IFDJ 2AK3A 3K9NA 3PFIA 3M9BA 1E94E 4N1AA 3GFOA 5GAGC 2XTZA 4LYFA 4QHTA 3R7WA 3CIOA 4PHTA 4Z51A 4JL6A 4OK5A 1VQMA 1MRNA 4OBEA 2VSOA 4P72A 2WIBA 1FMJA 1UE1A 1KI7A 2ZI3A 3A1TA 3CCUA 4Q9IA 4NZYA 4IVQA 3CWZA 1GNPA 4LFBL 3EIHA 3OPOA 5CYOA 1JALA 1YRAA 2RGNA 5DYGA 4R98A 2OFOA 4URWR 2N3SA 5GJCA 3RSOA 1G64A 3BFKA 1AQYA 2ZSFA 4JYBA 5JFGA 4TQUS 2H5XA 1KOFA 4B3SL 1ZC4A 2Z6KC 1GITA 4TYQA 1P2TA 1AA9A 2R93G 1OSNA 2HLDD 2ZU6A 2O8EB 4MGYR 4D2IA 3FDIA 3AUXA 1G7SA 1E0SA 4XSGA 5DISB 3GPLA 1VF7A 1GILA 3T34A 2D2FA 4DC9A 1G5RA 4AYBG 2I5MX 1HR0L 2ZS7A 5IK2D 1MO3A 1KMHB 1CRPA 4K0KL 4LBYA 4JLNA 4WA7A 1YZGA 5ANRB 4OX9Q 4A3IH 1IYUA 4LF9Q 2GZAA 1BO6A 2A68D 4JI1L 3EXAA 2VY3A 2KBEA 3ZZUA 1KJYA 3AYHB 2GEUA 2A5FA 1TXYA 2GESA 4PHFA 3THWA 2IX3A 2IF0A 1NMGA 2G3YA 1HTPA 2ZI6A 2YHSA 4FCVA 5BN3A 2DWQA 3A8IE 1FNNA 1U9IA 2C78A 2VA8A 1U0LA 1QVRA 5FBVB 1U0JA 5FBWB 3FMCA 3AVOA 1FJGL 4LYHA 1J6QA 1E2JA 1KI9A 2MSDB 2RGXA 3D7MA 2BA0A 1LFDB 1SHZA 3HPQA 5BQ5A 3CPFA 3TR0A 1OXUA 2K50A 5L8VA 3O8RA 4XSHA 4C4PA 2V8OA 4GP6A 3OEED 5DI9A 3W8RA 4TZ0A 1SVIA 1II8B 2QM8A 3HJNA 2D2CC 4DPGA 3C16C 2EFEB 4G3XA 3EW9A 4JS0A 3E9HA 3NWJA 4MRNA 3EBEA 8OHMA 1KI6A 4EPXA 2PCFB 1HNZQ 4KVGA 2BEJA 3RR5A 2BE5C 1XMOL 2WWGA 4O25A 3QNUA 4PAQA 4DLXA 4WBSA 4TKOB 4UXHA 1GG2A 4EJSB 1MV5A 2V6IA 4Q4AA 3KLWA 1I4TD 5ELXA 1K8AC 1HURA 1P6XA 5J47A 3H1TA 1CRQA 1X1RA 4L8JA 2OCEA 3P4YA 2EJFC 2WSSA 2YVUA 1KKLA 2WJYA 3KX2A 4CEJA 5KSYA 1VYVA 1AS2A 3TH5A 5EXPA 2P5TB 1GL9B 5IE8A 4LYAA 1P2SA 3DHWC 4RCYA 1Z47A 4PC6A 1E2KA 2GKSA 3OEHD 4DZZA 3VU9B 3IBGA 3S17H 4GMDA 2OM2A 4RD2A 3KFUA 1Q20A 1H9JA 2FEMA 2WJJA 2SHKA 4JI3Q 3F0TA 4G1UC 5TARA 3MSXA 4FCWA 1VQFA 5BR8L 1M7HA 4YMWA 3ND9A 2DPXA 4RG1A 3ZH9B 1FQKA 3L2OB 1VG0B 1XJ0A 1YR7A 2V4ZA 4MRPA 3A7LA 2F9MA 3BWDD 5EE0A 4P71A 1GVNB 5JJLA 3HKSA 5DO9A 4DCSA 1E9SA 1N32Q 2XJ9A 1GSIA 4KLNA 3UDIA 2ZT9C 1IZ6A 4OWTB 3VR5A 4OGQC 3CC2A 2L5TA 1NY6A 1QHSA 1UM8A 1XEWX 2BMJA 3AFQA 1WP9A 1SVWA 2FSGA 2WIAA 5DIFA 4BQSA 4C0SA 4ESVA 1T8UA 3KKPA 4QOSA 1E9EA 3VHXA 4X65Q 1MIUA 3MJHA 1VQ9A 3G71A 1M7BA 3CD6A 1VQCA 3W6NA 2ZR7A 4Q4JB 3A5ZB 1KDTA 4HAZA 3TS2A 1K6MA 1VCMA 1Z6YA 2QEXA 2Z6KA 5FTNA 1JPJA 4EAQA 4EFLA 3U5ZB 4OI0A 3UMRA 2AXPA 5EAYA 2TMKA 4NXMQ 4UY8C 3E0EA 3SFVA 4TMTA 5AR1A 1XCMA 5E95A 3RRZA 5KO2A 3JC66 3PF4A 3THYA 5IP7G 4A3BG 2D2EA 5KNCA 4URYR 2RGGA 2AX4A 3RNUA 4CEIA 1JAHA 1JE5A 1XMQQ 3B13B 1X54A 2Z0MA 1QHIA 1NN3A 2IUTA 1F2TA 2D0PA 1R5BA 1T4GA 1A82A 821PA 5KSZA 1R0XA 1DE0A 3I32A 4AYBE 4DK3C 5M3MG 2WOOA 3I62A 2ZJ8A 2R6AA 1WYDA 4YDSA 2CCJA 3CB4A 3GLFE 3KKOA 4DBLC 4AK9A 2JQOA 1AN0A 5A0FA 1X3FA 1OT3A 3KTAB 1GKIA 2WB1G 3J81c 4HLQB 5KDLA 3QPVA 1R6BX 1GOTA 2CJWB 2DWPA 3AVUA 4CZ2A 2KA7A 3OW2A 2B63G 1ZU5A 4AD8A 1OXTA 2K7VA 2F4VQ 3K0EA 4BUJA 4DK0A 4UJ3A 2CBZA 4AWXA 1EQQA 3PCRB 1DELA 2GNOA 2ZSEA 4DCVA 1X3SA 4BEJA 3I61A 3GQBA 4A3LH 1N6PA 2Q8IB 3K0SA 5C3EG 3I4NG 1HE1C 1OPXA 3BU2A 2Q9CA 4GI7A 3R9WA 2ZRFA 2WWWA 4EKDA 3BFVA 4DR3Q 1EGAA 4EPYA 4B3DA 4EFNA 1NBME 3GLHA 3KF8B 1HNZL 5D3MB 2XSZA 3HU3A 1IBLL 1L2FA 3SHWA 2LCFA 2JA7G 1IN4A 2JXMB 2R2AA 3RABA 2DNEA 3CCJA 1QVGA 1CKNB 1L8QA 1EFRD 3M1IA 3K1JA 3AKEA 1PH7A 2A78A 1S40A 3H2YA 1QG4A 4M22A 3AP2A 1GUGA 1NLZA 1TKWB 3ERSX 1QHGA 2CXXA 3CMEA 3LNNA 1N6OA 2NG1A 2EWWA 1KMHA 2QSYA 2ZAOA 2ZE5A 3SFZA 4R9UC 4PZZA 4TL7A 4PZYA 1HZAA 1IQPA 4QGGA 3S2DH 3IO3A 1G7CA 2IEZA 3CX8A 4XVUA 1E7ZA 5E7NA 3TGPA 3J80c 1KIMA 1IXRA 4L4UA 1C7YA 3ONWA 5LD2C 3RWMB 4M1OA 5DNYB 2IYQA 4BEBA 4JI3L 1SKQA 3FMOB 2ZR0A 3EQLC 1SVSA 2YWFA 4NL4H 2ASBA 1SZPA 4LOAA 4DUGD 1JAIA 2JJ8A 3KOJA 1MOZA 4YC7A 3K8AA 1IW7C 1NVUQ 3SBDA 2WKRA 4TYNA 5FPYA 3E5HA 2VYFA 2VW9A 1FFHA 3LQQA 1E69A 2R44A 3UWOA 5GQOA 4NCIA 3SNHA 4AY2A 2Q2HA 2NZ8A 2RHDA 1RRPA 3DEFA 2PH1A 4JLDA 3VHLB 5K8IA 3AV0B 4KHPQ 1IBRA 3NEYA 2EYQA 4KVAA 2AKYA 3HOVH 1W4CA 1NBMD 5FBLB 4Q9KA 1KI6B 3PUVA 3GJ8A 1E9AA 1KO5A 4GBMA 4LC1A 2ZM5A 1QZHA 1AS0A 2GF0A 2NO7A 2V1UA 1PUIA 1VS0A 3MFYA 3L8ZA 2KBNA 5JJIA 2YOGA 2WKPA 1WCMG 2QP9X 3NBXX 5AJXA 5UKDA 3RS3A 4AKIA 2KWIA 3U7EB 5G53C 1FW6A 1EXMA 3TS0A 3K0AB 3IEUA 1G8PA 2G77B 5DSZA 4A36A 1IBML 2A9KA 1ZM9A 1VQLA 3CWQA 4B3ML 2A8VA 5LDDC 1E3PA 1S3GA 3TRZA 3ICQB 4FCTA 1F2UB 2ZJZA 4GP7A 2UZIR 2OXRA 4KSBA 5LBIA 5KSOA 1PFSA 4A0HA 3S14H 3B8HA 5JHHB 4LUCA 2KCCA 1FMLA 2QEQA 1OLOA 2Q0HA 2ERYA 4MNOA 3WBKA 4WVFA 4LK1C 1WRBA 1H9RA 4B71A 1AIPA 4AC9A 1UEIA 1ZINA 2C35B 2GA8A 2HUPA 1FX0A 2DNCA 2X19A 4WZAE 2IYWA 1O7LA 1TQ2A 2F4VL 2NOAA 3BDOA 5EE1A 5IF9A 2JLSA 2WBLC 4A3BH 4KKSA 2ZIAA 2ZRCA 4Q19A 1E2VA 1FL0A 1X3EA 3CXCA 2CLCX 2WAXA 3CF0A 3K09C 1DOAA 4NTZA 4AIIA 4A8JA 2QF7A 3A0JA 1ZIOA 3LWNA 2KBFA 3U9SA 1FUUA 4H44C 3QXCA 3JZAA 1PH1A 3EZFA 4AI6A 4KI0A 3PUYA 4RD3A 2E2HH 4JMPA 2N8NA 4M9ZA 2ZVQX 4JBMA 1KK1A 4C3IH 3QG1A 4X8MA 4KKUA 1HR0Q 2AWNA 4LJ4A 5JBQA 2MSCB 1R0YA 4IDNA 4C2UA 3L7ZC 2B63H 4GKKL 1EX7A 4B3XA 1W0JA 2Q3HA 4HLUA 3VAAA 3W90A 2GEDA 3UDGA 3LA6A 1N5KA 4KFTA 4JYAL 3BORA 5FR2A 3ADBA 4LGMA 1GUNA 3T5DA 3M7NA 2EXDA 1FOEB 3PIRA 2O8FA 4Q1EA 4RKFA 2VP0A 3AVTA 1PLJA 1DARA 3CAMA 3ASZA 1SN8A 1NVWQ 1EFRA 2A6HD 2OG2A 3T5GA 3DM9B 1YHNA 3LXRA 4BPBA 1K3RA 2VF7A 4FWIB 3K81C 2WMOB 3CRMA 4IDHA 1J5EL 4B3TQ 4GKJL 1ZJ6A 4B73A 3KTAA 1X86B 2PPBC 3KDSE 1XJCA 2B8FA 4PTLA 4TTPA 5FFMA 5HCIA 5C18A 5L3QB 1VCIA 4DR1L 2WSSD 4LI0A 1RRFA 4A3EG 4PZ6A 2C03A 2OFWA 4HZUA 5KYKA 2UUBQ 4AQYL 2ONJA 2GILA 1GKYA 2ZJYA 2AMCB 2XZPA 4NCNA 2JLUA 4O3MA 4CEJB 3AVYA 1AE2A 4JBKA 1IN6A 4IFDI 5CIQA 3FFBA 2WWYA 4HLUC 1KKMA 1OB5A 3QJYA 2CVFA 2XITA 4LSGA 2E74C 3W1GA 4PO9A 3ADKA 1T0JB 5D3QA 4NYIR 1IYVA 1H65A 4BLRA 1CR4A 2C99A 3X1XA 3ZJYA 3WHLA 3BZKA 3OEEA 4L16A 4HAUA 2J46A 2DGYA 2EIFA 1GKHA 4JI4L 1KHIA 4NONA 4RZUA 4UXIA 4KAXA 5JEDA 4NKRA 1Q57A 2XXAB 3QENA 5FOXA 5IP9G 4WW0A 2Z83A 3NENA 3QQ5A 2IX0A 4AKEA 2Q21A 2E2IH 2VP6A 4HUQB 3RLNA 5JWHA 1LTLA 2R92H 3LWUA 1NKSA 4D4KA 1NY4A 2GXQA 3S15H 4E5UA 4V0KA 2KHIA 1N6RA 1VQ7A 2RGBA 5BR8Q 1NJGA 1IW7D 2ZJQA 1XTRA 2WWXA 2ERXA 4OQLA 4DLYA 5JSZA 1IL2A 1H8HA 4M1TA 1XJQA 1LM0A 1KIXA 3M6AA 4XWAA 3W9YA 4M9SA 4EX5A 2X1VA 1BH2A 3U4QA 3KQKA 4HB0A 1YKSA 2N49A 4II7A 4LUZA 3AKCA 1DADA 1OH5A 4GRAA 1R10A 2QG6A 3HDTA 3LFUA 4IOMA 4P4SA 4URVR 4DWJA 4IDOA 5J4HA 1XTIA 2FGJA 1XXHE 4C2TA 2HLDA 3BE4A 1ZC3A 1MKHA 5E7IA 5C2JB 4OO1I 5IYDH 3I72A 3EN2A 2J0VA 3CR7A 3QKSA 4UP8A 1NVXQ 1DO2A 3KJGA 5FUXA 1X6VA 3CBQA 3AF2A 3CNNA 5IYBH 1K8RA 4I81A 1S9HA 2IXEA 2ZRLA 1TL7C 3AEVA 2R7ZG 1VQKA 2X2EA 1T9HA 1VQ8A 2PMDA 4AURA 3UG7A 3U50C 2WB1E 4EFMA 1O3YA 3B78A 4ASUD 2JLWA 1N0WA 5JEAJ 3UATA 4QHSA 1RFLA 4Q4HA 3PF5A 1FP6A 1R7RA 4HJ8A 2ZUDA 4OI4A 2N42A 5K36H 3OEHA 3WNDA 2IL1A 3K0FB 1HUQA 4M1WA 3MWKA 4FMDB 1IN8A 2VH5R 5AK0A 4QGUA 3QXXA 3TLXA 3FWYA 1QHXA 3A1SA 4YCWA 2BM0A 4OK3A 4AG5A 2MO0A 5JI2E 3T35A 2QE7D 4DR2Q 3HGBA 1L0WA 2R7FA 2PBRA 5DN6A 1J5EQ 1BKDR 1RVDA 2DR3A 2ZYUX 1YQTA 4Z1MD 2ZAMA 1NJFA 3S1QH 2P67A 2PT7A 1P4SA 4DV2L 2HT1A 4IKEA 1JJGA 2GVZC 4C0KA 3RC3A 2NVYH 2NZJA 2FX3A 4QGAA 5TB5A 3CX6A 3Q85A 4JYAQ 1NIJA 3AVPA 2RGNC 4NYMR 2PCJA 2BDOA 3GTPH 1M1YE 5FUVA 4ZDJA 4D0NA 1JBKA 2VP5A 2YWHA 2ZRGA 1KJWA 1IBLQ 1VDZA 2JJQA 3W3ZB 3N6RA 3IPXA 3EIVA 2V4DA 1AM4D 1NN0A 1P9WA 4ZCMA 4MDEA 1YR9A 3O8BA 4I7ZC 1AKYA 2FV8A 4LBWA 1W2HA 3UE0A 3BC1A 5JCPA 2QA4A 5B58C 5KHOC 4KFRA 1Y3AA 1Z07A 3DXJC 5IY0A 2ZREA 1QVCA 2VZAA 3RSLA 2UUBL 1MABA 2IC5A 2WPDD 4DV7Q 1UFQA 2BC9A 1YR8A 4AYWA 1E1OA 3PUXA 1GZSA 4KMUC 4X62L 4PMWA 2ZI5A 1G21E 4IXNA 4TWZA 3R7WB 2REXB 1CEEA 3IPYA 3T1OA 1AGRA 2HHHQ 1KI1A 2IWHA 4HJAA 1RIFA 3KKQA 1L4YA 4OKSA 2OAP1 1N6LA 4BFZA 1O7IA 2F6RA 4IJMA 4PAMA 4A0GA 5AJ3Q 3PUWA 4LF5L 2BIFA 5GJVC 2VL6A 1G5PA 5JECA 4BXXH 4TMWA 1SXJC 3ULPA 3W1BA 2BOVA 1Y14B 4A3JH 3UWKA 4OHZA 4PPGA 4DT1B 1C4OA 1E1QD 1VQOA 3QE0A 2UU9L 4JVNA 4M2LA 2W2XA 2AXNA 1NLYA 2X2FA 5C4GB 3GJ6A 1KAWA 4LV5B 4NCJA 1BYIA 3ZIAA 3Q72A 1HEIA 2AHOA 1Z0AA 2D4HA 2P6NA 3TUJC 1I6VC 4YMSA 4NPSA 4APVA 1E4VA 4Q21A 4A3CG 2H18A 4C0BA 4A75A 3GD7A 1PH8A 3U58A 1US8A 1XF9A 3LH5A 3D8BA 4KO8A 4H0LC 3CW2C 4HSEA 2ALYB 3MEFA 1M1KC 2CL6X 4EPTA 1P72A 1WJJA 2GJ9A 4UNSA 1DTSA 3K7AH 2IXFA 2W2VA 4D80A 2NN6H 1P61B 1XD2A 4MKIA 2BMDA 3ZVMA 3FHWA 1PA6A 4NCHA 1Z7TA 2GJKA 4Q4LA 1I5FA 2IEYA 3SC3A 1IXZA 3TBKA 3MXNB 1KZ7B 1GO3E 3TSZA 1G51A 1XRJA 1ZM4A 2BKUA 2Q6TA 4NHOA 2FN4A 1R8QA 2UXBL 1RZ3A 1W44A 2EJMA 4DR1Q 1E2GA 1S1MA 1YZNA 1T8TA 2OV2A 3SJCA 1I50H 2RMKA 4ZKEA 1GJXA 2AUKA 5JSZB 3HU2A 2V3CC 2V6JA 1GAJA 2OILA 4DHEA 2QORA 3HWSA 1P75A 4Q66C 1YRBA 1XMSA 1H8ED 1Z83A 2HF8A 2WJIA 3MWYW 1K73C 1VQJA 2J3EA 1J8MF 2WJHA 2Z43A 4BRWA 3GLFB 1XB2A 1DGSA 5JEAG 2VL7A 4P4SB 1XMJA 4XD7A 2D3WA 2A68C 4WAUA 2BMFA 2DYKA 5J4YA 5JCZA 4MYHA 4FMCF 3CCRA 1U2RA 2VUMG 1COWA 2CCKA 4LJ7A 3Q9LA 2AUJD 2PL3A 3B85A 4QY7A 1H8EA 3K0XA 2JJ2D 3LX8A 5FPSA 2G9NA 4A3JG 2EYUA 4X64Q 3CCSA 4JL5A 2KHJA 1P62B 1JJCB 2ZE8A 3SHFA 3I56A 1T91A 1CKOA 1XPRA 3HOWH 1RJ9A 1EFTA 1Z28A 2VSXA 1I94L 3Q7QA 5EQTA 4DNRB 3T12A 2CDNA 1CKEA 2VPPA 4US2R 2PX0A 3IDQA 1A0IA 2Q9AA 1TU3A 5DLQC 4GDFA 1NI3A 4YXWA 1JJVA 4B47A 3NHAA 1O78A 4FMDF 1QHNA 4P31A 3IQWA 1OTCA 4GMXA 3TE6A 3PO3H 3NE5B 2NN6G 4Z8YA 2F3RA 5A4JA 1K9MC 3R8FA 1P2UA 3LAWA 4PX9A 1TWCH 3U3RA 4DXAA 4EQ6B 2XB2A 4JI5L 1XPOA 4NE2A 2A69C 3CCVA 3QIAA 5FH9A 1IYJB 2J0SA 2GJ8A 3VKHA 2R65A 4A3GH 2NGRA 1ZYUA 1BKBA 3DVLA 3WP0A 4CEHA 3NC1C 4DR7L 3T56B 5SZHB 3KF6A 2R8RA 2GVDC 1ONBA 1W2GA 4RD4A 2XGJA 1UF9A 1OE0A 1SFOH 5CJ2A 5HE8A 1UEJA 5GVRA 1GUAA 2QAGA 4LFCL 3J7A5 4KITB 5ELOA 1UDXA 1VG1A 5IHPA 4K8OA 1LACA 1NNEA 3OE7A 3B1WA 4RJLA 4MRVA 4XWOA 2R62A 1YI2A 3RVBA 4A93H 2CK3A 3A8TA 4JJKA 5JS8A 3LY5A 3TVDA 2X77A 3S2HH 1DPFA 4LHVA 4DLZA 4BE7B 1LW7A 4DCNA 3RZOH 3ZQ6A 5EUQB 3O8CA 1VG9B 3LW7A 3QF7A 3OFND 4BA2I 2G6BA 3AB3A 4BWYA 3DM5A 4LF6L 2CJWA 1QUQA 1V1QA 1PH4A 3FPPA 2W6ID 4I1SA 2HXYA 4OQMA 3L0SA 2GHIA 1UEBA 2MMGA 1XCGB 4ZI2A 5GAEC 1HA3A 4A3KG 1OFHA 2JJ2A 4GN4B 2ZYTX 2WPDA 4WZBE 2CHGA 4BZXA 3PVSA 1NG9A 4IPDA 3GFTA 2WJGA 1BBUA 3RS2A 3BJIC 4K81B 3ETLA 1EWHA 1SROA 5AJVB 3VR6A 4C9BA 2JA9A 4HIMA 2QP3A 4X8HA 1OV4A 5J40A 1E2DA 4DEYA 1ZMXA 2CEAA 4CT4B 4DDUA 2YZ2A 2Z4RA 4ZCIA 2JASA 1NL3A 4JT4A 1OFTA 1XMIA 1XZQA 2A5YB 2RAPA 3AKYA 1CU1A 4OO1H 1PH5A 4PSAA 3W8NA 2VRWA 1GL7A 3KQLA 1OXSC 4MYCA 3IRBA 3A4NA 4URUR 4RZXA 2BCGY 4ACAA 2ZYVX 1R2QA 2UXDQ 1N34Q 1NG1A 2FE4A 3S1AA 1W36C 1NTGA 3KKMA 1UPTA 2UXBQ 2C77A 4DIEA 4HAWA 3C4JA 4JVLA 4C0QC 2ORIA 3AP3A 2AHOB 4HB2A 4Z1MA 3RS7A 1KMQA 3U3JA 5JWRA 4JI6Q 2XEXA 1P8LA 2PX3A 3F2BA 1FGUA 4Q1DA 3KB1A 4GZLA 4IXMA 5BN4A 3GTKH 3ULLA 1U94A 3OF5A 1UBEA 4FN5A 3NBHB 1UBFA 3TAUA 3I5YA 5FOSA 4NB3A 2EQBA 4WOPA 4AIMA 1I94Q 2H8KA 3SJAA 2G1KA 4BFYA 4H9GA 4IVPA 4DB4A 3QSYA 5GVSA 2ODWA 1YVDA 1SMXA 1YJWA 3NDBB 1HZ9A 3FPAA 3IEVA 3L0OA 1JMCA 1FJGQ 1G6OA 2FH5B 4TL8A 3EA0A 1PZNA 2AWOA 2E87A 3QXJA 4W7SA 5AJ3L 4DV0Q 1VQNA 1KAOA 1KDPA 1OHHD 4LNQA 3MJRA 3ZIAD 5CK4A 3CRQA 3QG5A 2ZSAA 2KI5A 1YE8A 1B9NA 4E09A 5DI3A 4C7OA 5C44G 4HYYA 2ZSBA 3C15C 2BCJQ 1RRGA 1ZU4A 1VYTA 3M4PA 1U5KA 4JI5Q 1Y1VG 1IONA 1VIAA 3NIBA 4JSYA 5CJPA 5P21A 1GRNA 2JCSA 4RCNA 1G19A 1TQ4A 4Q5IA 2V7QA 4JK1C 3GLFA 4DR7Q 5FL7D 2JA8H 4L5TA 4A9AA 2LWIA 3JVUA 2PQAB 1XMVA 2J1LA 4MA4A 1E6CA 4UP9A 1KO7A 3GEHA 2H7VA 3LX5A 1UWVA 3CRLC 3HR7A 2HEIA 4DV4L 1DAHA 3FYHA 1SVMA 3WP1B 1XX6A 1ZAKA 4GSYA 1N33Q 2JA6H 3EPKA 4BY1H 1FYCA 1RYHA 3PR1A 4E07A 1VCNA 1YZLA 2JDID 3WDNA 4KU4A 4NU0A 5AUQA 1NN1A 3CP0A 2NVXH 2VSFA 2GXUA 3KDFB 3IHWA 5TVKA 1ZCAA 3VX3A 1EESA 1E0KA 4JL8A 2ZI9A 3H0GG 1SVOA 1GNRA 4L8GA 1KL9A 3ULJA 4HJ9A 1S3SA 2UUCL 1DEKA 4Q00A 4V0OA 2F52A 4ZPXA 3PSIA 3I4MG 5B57C 2WWFA 3M0EA 3KXLA 2WAQG 621PA 2B7BA 3THOA 4QQBX 3L0PA 2NPIA 2OBNA 2I0QA 2O5JC 6Q21A 2VTKA 4IOCA 4XVRA 4LFCQ 3AM1A 3OIVA 4TQ9A 3SR0A 2GZDA 3MMPA 2VQEL 2QZ4A 3H15A 1KI8A 5IP9H 1R5NA 1N32L 1NP6A 2OUKA 2JLRA 1G9XA 1YIJA 2AD5A 2ORVA 2W0MA 4FXPA 1JJ7A 1Q7YC 1L4UA 3AH8A 3EWAA 4OJKA 4PPFA 3FVQA 4B35A 1CBUA 5H1YA 421PA 1OJLA 4LRWA 2GAOA 4EPRA 4YCUA 1DAKA 3AEZA 4V02A 4A76A 1WXQA 2CLDX 4NDZA 4QKQA 3ZVLA 2OLKA 3IIMA 1SKYB 3KF6B 4CRWB 5LMNQ 3N70A 2YV5A 4OXPA 4D0GA 4G01B 4ZIRA 2PEYA 1VQBA 3GTLH 4OQXA 3U61B 1WE2A 5JEAH 1W4RA 5J3BA 2ZS8A 5KOYA 3T51B 1NF3A 4HEJA 5K8LA 4TL6A 4Q7LA 1K8GA 2BKEA 1R5OA 4KJZA 4XVQA 4Y0VA 1HH2P 4LJYA 2YTYA 1G4AE 5SZKB 4A6XA 4TYWA 4DEXA 3KZ1E 1QHHA 4Q1BA 2V1CC 5CLLA 3CR8A 4XTRA 5C3EH 2ZRBA 2JIZA 4O2RA 1KJZA 5GADC 3G6EA 1R4AA 1N36Q 4UXJA 5FL7A 4BFTA 2OEPA 1CTMA 1SRUA 2GN5A 1E99A 1E2QA 1ONLA 1MO6A 2C95A 2REBA 2RH5A 2V7QD 1N6KA 4ASUA 2ZITA 1A2BA 2H17A 3OZXA 5L3QA 3VNVA 4BLSA 4LJAA 4MQBA 1T5LA 3HKZE 3BIFA 1S2MA 3I7FA 2W83A 3PV0A 2ZRIA 1G291 1ETUA 2ZRPA 1L7VC 4HZUB 1W0KD 2IYSA 3DOEA 1II0A 2QPTA 3I4NH 4XWKA 3VX4A 1P3JA 4XJXA 2IUUA 4GT1A 4D4MA 1KQSA 4Y52H 1JR3A 1A2KC 2FU5C 1E1TA 2PI2A 5C0XJ 2OBMA 3CNLA 1LTQA 4DR5Q 2QBYA 1SXJE 3AGQA 5E7JA 4JLPA 5FL3A 5FLMG 3FTQA 2CFMA 1E9BA 4LF8L 3BBPA 4LFAQ 3HFZB 5FOVA 3I4MH 3RANA 3GLIB 2JATA 2ZQ5A 4ILEA 5A5GA 2N1BA 2FFQA 4MUAA 1VQPA 4TSFD 4IPGA 2R9VA 3M3YH 1YEZA 5C4XG 1I2DA 2JEOA 3NKVA 5JJKA 4NYJR 5CYPA 1OW3B 1EIFA 4DV4Q 3ZGXA 4DLWA 1PH6A 2FF7A 1N33L 2QI9C 4FIDA 1NVVQ 4PSVA 1N0VC 1W49A 3BB3A 4B74A 4BECA 5B30A 3I5XA 4WJ4A 3CF5A 1KTVA 3KL4A 1N0UA 2QRNA 3ADDA 5FI0B 3L82B 1FZQA 2JE6I 3NG1A 3ECCA 2DB3A 2P3SA 4QBIA 1NRJB 3SQXA 4Q03A 4GOPB 3EZ2A 1DAIA 3U3MA 4RMFA 4US1R 3IFTA 3T15A 5FJ8H 2Z6VA 5KUTA 4LF7L 4BA1I 1XBTA 2R6CA 1LABA 3S1RH 3Q8DA 1EFUA 1Z6XA 4TYYA 3AGPA 5F98A 4BFXA 2WAYA 1X9NA 2GWHA 3H0KA 4L5RC 1E2ZA 3OIYA 1HE8B 3HYRA 4TLAA 1B7YB 4IOAA 3CPJB 1G17A 3T1QA 2B6HA 1AJEA 4EPVA 721PA 4DV3Q 3GTGH 3K70B 1CSPA 2F3TA 4POGA 2ORWA 1PLKA 2DFLA 1SHKA 1RW4A 2ZXUA 3FOZA 1WB9A 1PUJA 2W6IA 4LPKA 4JZKA 1NBMA 2JJ1D 4OHWA 2VHTA 2BH8A 2GAAA 1X65A 3PEWA 1W36D 3VKGA 3B9QA 4UQOA 3DOFA 1Y1WH 2C8VA 2QGQA 3BH7A 3GO5A 4DUYQ 1W2BA 5K36G 1QG2A 2HF9A 4PZ7A 2ZANA 3B7GA 2YC4C 3NC0C 4M53A 3RWOA 4RD0A 5FOTA 3DZ8A 1XNQQ 2ODNA 3UE1A 3VR4A 4QGHA 3SOPA 4BZPA 4UPAA 3OE7D 5B2ZA 1GVPA 2JA6G 1FUKA 2A2ZA 1KXLA 1N2CE 1JEDA 1HV8A 2P0EA 3KFXA 2NZOA 1F5NA 2B8WA 3QUSA 1W0JD 1DXMA 3BD9A 3KYHC 2RKOA 4QBGB 2MSEB 5CB6A 2AL7A 2MQHA 4B3RQ 3K8YA 2E5LQ 3DL0A 4JYCA 1P73A 3CRW1 2WMNB 4DV0L 4DCTA 2A3RA 4KN7C 2CVHA 3R8CA 5M5WH 3WRXC 5LPNA 1YITA 4UNRA 3TSWA 1PH9A 1UBGA 3CONA 1Z6TA 2ZROA 4HIDA 1HNXQ 2EVBA 1CJMA 3QKUA 4P33A 2CQOA 1F3OA 1Q3HA 2GJAA 2YJTD 4HAXA 1HNWL 3ZS8A 4RFVA 4LDJA 3LXXA 3X1WA 4ZDIA 3GLGA 2FDCA 4GNXC 4DUZQ 3ZZTA 1D8TA 3AP1A 4CT5A 1SULA 2CL7X 2W2TA 4D26A 1F2TB 4GLAC 1Q21A 2K52A 4Z8XA 4BBSG 1GHJA 2R6DA 2IYYA 1QJOA 2RHQB 4B3CA 5L3RA 4YXWD 3U44B 3RC8A 5IYBG 3R9XA 2RF4A 4LF8Q 1MH1A 4JSTA 4LYJA 3P20A 4TVAB 4NP6A 4KODA 4G5OA 4P73A 4DSTA 1GD7A 1J7KA 4W5JA 1ZNYA 2VP2A 2GBLA 3GFPA 2XX3A 4A93G 3Q7PA 4GN3B 4EQ6A 5BN5A 4B32A 1W7AA 4GKKQ 2AFHE 3T53B 3J81i 2DHRA 1ZNXA 2XOKD 4MRRA 1QDEA 5FOWA 4GS3A 1YZQA 1Z0FA 1U8AA 2UUCQ 2VUMH 2QL6A 4GN5A 1VMAA 1COWD 1HZCA 2QTVB 3AQ4A 4LV6A 2IHBA 4TLEA 5KDOA 4JLBA 4YCVA 4G0NA 2YC2C 1TTTA 2QAJA 4UJ5A 2UXCL 4AKHA 4Q47A 1CJKC 4XD7D 4OL0A 3M85A 1QHYA 2K5UA 4QBFA 1VQGA 1RRCA 4DDTA 3WYAA 1ANKA 1KO1A 1GDDA 3B1VA 3CZQA 1E2HA 4LF7Q 2NPFA 3T1TA 3DMNA 2A30A 5IT5A 1D2NA 4DIDA 4TTQA 3B1XA 3HR8A 5LB4A 4U00A 4AQYQ 4A15A 4JLVA 1CJUC 2FFAA 3G82C 4IEEA 5E4FA 4JVSB 3FE2A 3BG3A 2OQ0A 1G3MA 2FPLA 3CC4A 2VO1A 2FWRA 5EE9A 4JCVE 1KC8C 4YDHB 2O8DA 3EPJA 1YR6A 2KB0A 4IHQA 2K32A 4M8NE 5DN6D 4KLKA 3CF6R 1LV7A 1US8B 1DAEA 1SE8A
chains in the Genus database with same CATH superfamily
1QWOA 1C9KA 1QZXA 2OHXA 2VBFA 4KYUA 4C6TA 4CF5A 3I4LA 1HC7A 1NIPA 1VFPA 1ZIPA 1CZHA 1M66A 3BDIA 4JY7A 4LGYA 3AF5A 1CIVA 2XZDA 3GVXA 1VPDA 1P8AA 2OTLA 3CJTA 3CPEA 1D7AA 3M4ZA 4O4HB 4YALA 4ATNA 3EHEA 3E22A 4AM8A 1BNZA 1QYXA 2EFCB 3PNOA 1A04A 4TXNA 4RTKA 2MYUA 4IDCA 5C9ZA 2YNMD 5GADl 1JZSA 1HYEA 2VNUD 3OX4A 4DB2A 2JGEA 3KWLA 3ZGOA 3AETB 4DSNA 3A1UA 1EQRA 1BCSB 2BJVA 2BI8A 2QA5A 5B55A 4C6HA 1AC5A 4ZCTA 5K05A 5JQWA 1J0DA 2RDHA 2AA3A 2E8GA 2YIDA 3ETNA 1J0CA 3PJDA 1F12A 4IQ0A 4JP3A 4KDFA 2D3TA 3ZHBA 2UXDB 3QX9A 5C4HA 3I83A 4HEQA 1J25A 1W88B 1WDLA 5J2UA 1S8FA 2QN2A 4YRPA 4MQ5A 3UGQA 4E1BA 1L1OA 1KQNA 1HNXL 3L6RA 3TD2A 1JF8A 5FWYA 3RN2A 4URHA 3NRCA 3OTOL 1D4FA 1HE5A 3I1FA 2P9HA 1OXXK 2VTDA 5E4WC 4HAVA 1X1DA 3VC1A 4RJTA 1PRTD 1HQDA 1M7GA 3LL7A 2O0MA 3PHIA 2QTZA 4HH4A 4MQUA 4ZPJA 5FCDA 1CEEA 3IDFA 1QIKA 3DBRB 5HTKA 4HNAB 2ZM6L 1NM5C 1TU4A 4RHXA 5DX0A 4F4UA 1NF2A 3SXHA 1ITZA 1M6EX 2XUOA 2ZE7A 3TKLA 5F78A 2BTEA 2W6MA 3JAML 4MS1A 4EG0A 1WJGA 5KYUA 3TN2A 2FW1A 4GBGA 1M6NA 1VA5A 2W8BB 2Q6LA 3NOXA 1YNOA 2QPOA 2QM7A 2WM9B 3PIO3 5DSXA 3O4VA 4JIMA 1XMOQ 3QEBZ 1FNSA 1C1XB 1Q0HA 1P4RA 4JI8L 1SAYA 2C4KA 2XV1A 3DSRA 4WNIA 5IH7A 5ECYA 4DV4B 2UZ3A 3S28A 3OTOB 3HJGA 2JGRA 3SP1A 2HA0A 3LU1A 2IYUA 3NP8A 3R7LA 3PO3G 2WW8A 1XX8A 3R93A 1EP3B 3QVVA 1PKEA 2DP4E 3D1LA 3D6VA 4LDQA 1D2BA 5ALDA 3OW7A 5LQKA 1TLTA 1MRSA 1MF7A 1WXDA 2A57A 2D5AA 3HYTA 4PAOA 3SIRA 4IXWA 4LE1A 2E55A 3WIVA 2IVZA 3WKBA 1U0NA 3PFNA 3TFQA 1EPUA 3DW3X 1I01A 2Z1MA 3JQRA 1D6MA 4KVZA 3W2EA 1DBPA 3I53A 2YHIA 3I39X 1RPTA 3HUTA 3U6KA 1QBKC 2A73B 1GIAA 1QCZA 3CJRA 4P86A 4QOIA 4LF4Q 1T2UA 3D31A 2E4YA 1FNVA 1FRQA 2PS1A 2ZU0C 4LZNA 5FR1A 5C1OA 5AW1A 4R4JA 5I51A 2P78A 1DG9A 1W6UA 3DLAA 3ZHXA 4I8DA 2ANCA 2NADA 2Q5LA 3EIQA 5KO2A 3IEKA 2DERA 5HKKD 1K0RA 4KXNA 1JSXA 3BSSA 3VTKA 3HOVG 1T2NA 1V8DA 4LE2A 4S0ZA 4D4IA 5EP4A 1V26A 1T9CA 2XCTB 1ACLA 1CXZA 1J07A 4ZC1A 4PZLA 3RUPA 4NYIQ 2XQKA 4WSOA 2VUTA 5LZ9A 1OGYA 2YNMA 4YUVA 1Y1LA 2FUCA 4MIUA 3IAYA 4FHGA 4OQYA 2WILA 2XRSD 3M9LA 2GK3A 5HA5A 1Q0LA 2J5RA 2JGKA 3HJCA 3K1YA 4OEMB 2ZRDA 1D1IA 4BMNA 4QM6A 2ZIXA 3QKRA 3NYWA 4K6OA 3NM6B 4R8MA 2QTVA 2FLVA 3HRKA 2VZ9A 1F3LA 3NTRA 2UVPA 4LDNA 1MCZA 2XNDA 4JR1A 3PDHA 3CY6A 2JCBA 3JCZA 3GFSA 3T4XA 1Z4IA 4JT9A 8LDHA 2R751 4BLPA 4DVGA 1EK1A 4KRGA 5EMMA 4BMYA 3KETA 1QRTA 1M5RA 1XF1A 4Z3KA 5HRUA 1P17A 2OB1A 2RH9B 5H82A 1P19A 4RFSB 3TZ6A 2PJUA 2ZJBA 3GRPA 3DFKA 2C7QA 1QOPB 5HCNA 3R2IA 4YVFA 5JMPA 1Z7BA 3LUGA 3BDVA 3H11B 4L5IA 4TVKA 1TD9A 2J5XA 4Y67A 2QW7A 3OTOQ 3F2IA 4M37A 3VJKA 3K2EA 1RIPA 1JC7A 3JZDA 4UDNA 2XUJA 4KIFA 3W5SA 2VJOA 3ZVRA 1NR7A 1E20A 3ADOA 2NU6A 1MAUA 5KGUA 3VUEA 4F0JA 5J2UF 2NP6A 4KQMA 3G5UA 5SZJA 3MFGA 2QT1A 3LYLA 5FOBB 2ZKLA 1XXGA 1Y8OB 3RYIB 1NXTA 4B33A 2PE5A 2IYTA 4LW1A 1GLNA 2KJXA 5K0BA 2WTEA 3ONEA 2GBCA 2PVSA 4TUYF 2BEUA 3DZBA 4OXQA 1F9AA 1G6PA 1H1LB 4IIJB 1DQYA 2K75A 4OB8A 4QEDA 5DPMA 3VR4H 3WMGA 2BAGA 4IHJB 1IY1A 2BHTA 3LLSA 2IIVA 2ZYRA 4M0CA 5IM4F 1IJFA 1J8VA 3HPRA 3Q9NA 4RHFA 2V03A 2ZTEA 4B82A 2XD4A 4HDKB 3OIGA 5LL6X 4JOIA 1DOLA 1NUAA 2FMXA 4Y6GB 3RFUA 5I7WA 4EB8A 4IH1A 1R8SA 1VMDA 2VPWA 1FX1A 3A9CA 1DZIA 3ZLUA 2RB5A 4GMKA 2GCEA 4EG4A 3NAZA 3TLEA 5J1SB 1PZMA 5CW1A 1XCJA 2IW1A 4FBGA 4H6XA 3RVPA 1BVHA 3E2PA 1P9RA 4R7ZA 5DXAA 1QK4A 4EHBA 3NEPX 3OJWA 3CCLA 3RS0A 1KRSA 1RYYA 1YMVA 5ULLA 4I50F 2OZEA 2XGOA 2JS7A 4QBTA 1HLPA 1FLAA 3OP4A 5EGNA 1K06A 3G2IA 4F2GA 3U16A 3GP5A 1DI0A 3OQIA 4WV3A 2PUEA 1V4BA 1PG2A 5KTOA 1G4HA 5FLXc 4F06A 1TTHA 1XA4A 2VRCA 2A6EC 1N9ZA 2VVTA 3V8BA 4ILKA 2BV3A 2QAIA 3ISJA 4WKBA 4GVXA 1DS6A 3TLMA 3LO5A 1JPVA 2RC6A 3MRVA 1JAYA 3BK2A 3E5NA 4NNPA 3SU8A 4D81A 2G7ZA 5KBYA 3LE8A 3CF2A 1UBOS 5DH9A 1V8PA 2H0AA 1A3TA 1USVA 3EYWA 1EE9A 4G5HA 4AZVA 4ETNA 2RBEA 1WCXA 2CUKA 4CM9D 4KR3A 3WLPA 1N8RC 1BF4A 5CFOA 4JLAA 2PJZA 3EH1A 2G4VA 1OGJA 4MB0A 1LS1A 5F4BA 3MTDA 3L1IA 4IRUB 4M1SA 4D98A 2RD2A 1AG9A 1UWKA 3Q24A 1T13A 2J9ZB 4HATA 4WERA 4PGGA 5CGZA 1I13A 1FLNA 4CM4B 2F0KA 2GPSA 3OT5A 4AUMA 1Z2CA 1ZBQA 1PGOA 3EEQA 1XZDA 1N5LA 1YBYA 2CQAA 2HJGA 5AESA 1PYOA 3IDOA 4CEIB 3K7EA 1V6AA 4HO1X 4MVJI 4XLLA 2N9UA 2NTVA 4R6XA 3UIEA 2P27A 2HT6A 2X6GA 2Z8ZA 1L6RA 4MVJP 1SNCA 2ZIZA 2B2WC 1FTSA 2RK6A 2AMFA 3MCTA 3R3UA 4R2HA 3WLNA 3CN9A 2H2GA 1AMUA 1ZVJA 2X9QA 3A7AB 2G0AA 3PE4A 4N9WA 1O03A 5JIBA 1DUSA 4KE7A 2Z57A 2JAOA 4FQ8A 2VEDA 4DFAA 3DFZA 1TUIA 4U39A 3M4JA 3EZYA 2ZM6Q 4XOIA 4YMGA 3LZDA 1Y3FE 3UFBA 2A69D 1T3SA 3UK6A 3I3SR 1RQNA 1U1GA 2BR4A 3H3JA 3SK5A 5ENZA 4XJVA 1OVMA 1QIJA 1V35A 4O4JB 4BMDA 1JSZA 4G8DA 4OGGA 1J06A 3BCUA 1V4NA 3SSAA 1PH2A 4B76A 3MZ5A 4GZ5A 2PA3A 2O5IC 5C4XB 3PFWO 1SY7A 3N0TA 4MTLA 2PW5A 1GZDA 4MCHA 4AMUA 4EY5A 3DV0B 1NNUA 3E7DA 3KKZA 1VQ1A 4E12A 1KQFA 3ROPA 1V8QA 1U2SA 2NU8B 2HMWA 3N5CA 1A9XB 4B4WA 2BH2A 2C9YA 5D3MA 3P2JA 1J1UA 1YVPA 3OPNA 4PRKA 5BW8A 3KZMA 2CBXA 1E1RD 2R8OA 1B1AA 5IRCD 2ZJ3A 4DEVA 1SBIA 3B2NA 1DOKA 1N6NA 2YL2A 4N5HX 1D1KA 5MDHA 4DV6Q 1R3DA 2R7LA 2YIJA 4QSHA 1E5TA 5JZ9A 5ALUA 2FDCA 4IIEA 4P74A 2G9ZA 4IICA 4K2LA 3SF8B 1Y69U 4YCDA 4OIMA 1GXSB 1GYPA 4V0QA 5HBRA 5CB4A 5HRAA 4N18A 4DIFA 4IURA 1X3GA 3WV5A 4JI7L 1BBWA 4CGYA 2NU7A 1E1YA 2Q3FA 1A3CA 3J7AV 2BWJA 4I1OA 3M82A 3LVBA 4QDTA 3M4OB 4R84A 4DUGA 4PYMA 3K09A 1NW8A 4FLMA 1YC2A 4DE5A 1VF5C 2JKYA 2IXTA 3WY9A 1GDTA 2JFXA 4KK4A 1SC1A 4DR3L 3N74A 1LT5D 3LTEA 1X3PA 3I6MA 3OAAD 1LY1A 3WMFA 4KPGA 2RHBA 3PEEA 1HFGA 2MNAA 2VOJA 5JY6A 1GOZA 1W0KA 3AERB 3KVRA 4UVHA 4OYYA 1V41E 2WC1A 4AJKA 3ZQ4A 5BV2P 4RWSC 2O8BA 1Y8RB 3MXOA 4MWSA 1JQ5A 5ALGA 5FLXL 4EHLA 1Z0JA 4N0EA 1R9JA 5GAHC 1U7UA 3CKLA 3GRYA 1Y5IA 3GLKA 5FDFA 5CA1A 1TVCA 2FKAA 3KXDA 4KXWA 2XQJA 3I55A 3FFWA 3EZ7A 3GJRA 3GT7A 4GXRA 4GRIA 3IOEA 4IQ8A 4OXRA 1SN7A 3PG5A 4HXGA 5AKIA 1HLDA 2XW6A 2Z8YA 1BHSA 3SXUB 2OQKA 1Y0BA 2XNCA 4IFDH 3X1KA 1S0UA 4Q7KA 4G1VA 2EZ8A 4A6PA 4KPYA 2Q41A 1JJFA 4R1LA 3JAMi 2RSOA 1H9AA 1UXJA 3TAXA 3WOVA 4AG6A 4ZDKA 3E18A 3K5LA 1KFBB 1KNQA 3AFOA 2PT9A 3PE3A 1J49A 5M9OA 1B0PA 3DC2A 1RJGA 1QGZA 3I04A 3MJCA 1BE1A 4IQGA 4GVLA 2YXLA 3RT9A 3WKCA 2IHJA 2DBRA 4KCGA 3HKZB 4DSOA 1CDDA 4KV9A 2Y0DA 3DE0X 2FEWB 2JA5H 4AJLA 3H13A 2GKOA 4DR4L 3RT7A 3ASVA 3LZCA 3UKDA 1SUBA 4M8KA 1UCFA 3NGLA 3GJ3A 2CYAA 4RY2A 4AO6A 3IP5A 1NFFA 1SKAA 1NMZA 4WXEA 1JFVA 1KNAA 1C1YA 2Q6KA 3JATA 1KY3A 2NVTH 4GMGA 4QBGB 3UV3A 1E32A 1TZ2A 2P3OA 3FRHA 1XJ5A 4PQFA 4QBHA 5A9TA 3CUVA 3VKUA 1EA7A 2YWJA 4P58A 1C8LA 2EP7A 3IAS1 3CKKA 1KZHA 3V2IA 2PPLA 4XYLA 3D3RA 4B8YA 2UYQA 2DJGC 4R4QA 3VR3A 4J6FA 3RS4A 4XYMA 1GNVA 4QUCA 5E3IA 3VH1A 5BYKA 1U9RA 4ER0A 5JBNA 3BH0A 2J0UB 3U4CA 4R4IA 1TK9A 2XNAC 8ADHA 3B6JA 2BZ1A 2D0PB 4EQ5A 2CL5A 4H1UA 1RJFA 3C5HA 1FP7A 3GEPA 4A23A 4A8JB 3UPUA 3THXA 3MERA 1A8QA 5BY2A 2X8WA 1SUEA 1QP8A 1GYRA 1QFSA 1TM4E 3FP9A 2C0CA 2IIQA 4FHZA 1Y7LA 2K33A 3I2GA 4N0QA 1SBQA 3LA8A 5MFZA 3TTUA 1POWA 5F52A 2O57A 2FCAA 2ZRNA 5JJ5A 1MABB 2JLQA 5HIMA 4R4TA 1Z5OA 3L6BA 1VRVA 1NFQA 5FBHA 4DR2L 1OIXA 5F9MA 3H0GB 4A26A 4DLSA 2VQEQ 1ZMBA 2AOUA 4HJXA 5AW5A 1L5HB 3BD8A 3LBIA 5KYWA 2EOAA 2HH9A 4KQHA 5J9FA 3F2UA 2DWUA 2XTIA 5DGDA 2C8JA 5AI5A 1WQ4A 1A4RA 1Z45A 1VOTA 2WD8A 2Y27A 3ORFA 2WF5A 1DEOA 4AF8A 5L4SA 5J5CA 4JUIA 3O1IC 1M34E 1ESEA 4PWYA 3PVCA 5D51S 4JI1Q 4GLXA 2VR1A 3L07A 4FI3C 5JI3E 3D81A 1E6WA 1E96A 3MPUA 1FDUA 5CD9A 4PQRA 1ZI6A 4V2UA 1MJHA 1QWSA 1L1RA 3C6KA 1AHNA 3DZHA 3DXZA 1TEZA 3T4EA 3HOYH 3L18A 3CB2A 1CKNA 1I3MA 2XADA 2SBTA 1OH6A 2QG9A 3F9IA 3RS5A 1G8HA 1SA0B 1R8JA 1SD1A 1NSNS 2FMIA 4LI3X 1C0LA 2V3VA 2GXSA 4KZKA 4TM7A 2Z8YM 4GKVA 1UOQA 1C50A 4F5DA 4MPTA 4HIOA 1E8MA 2EFGA 4RK0A 4EATA 1K97A 2R61A 2DFKB 3OIWA 4K9QA 4KW7A 1ZGZA 5E3HA 5KCZA 4L5BA 4FKBA 2BFDB 2RAVA 3Q5GA 3OYYA 5DULA 4BLWA 2GQ0A 4A0RA 1U6IA 1ZYRC 2ISQA 2JB9A 1X15A 3IE2A 1X7WA 2ZJFA 1PYSB 3LLUA 3LK6A 3NBQA 3OLXA 3PGXA 2ZR9A 2ZJ6A 3AWDA 1VECA 1Y8QB 3F5DA 3IT2A 4AUEA 2XTNA 1C9OA 2HXSA 1CT1D 3BTOA 4IFEA 1N1EA 3W4JA 2AOTA 1DLJA 3A58B 3HKDB 1UPXA 1XG5A 2F1HA 4MDYA 5IJWA 4LF5Q 1EWKA 2AUNA 1TZBA 2FPSA 2O23A 2YWCA 4MTKA 4Q3CA 4JI5B 4B75A 2ZTUA 4RGTA 5CVDA 3NOVA 3ZH2A 3UB2A 1SRRA 4BQEA 5FTKA 1UBCA 4RORA 4N3AA 2FMFA 1QILA 2NAPA 2CV1A 4UZEA 2A9OA 5L6MB 3PQ4A 3RBXA 4B83A 2EHDA 1AKVA 2QJOA 4EUNA 1YDMA 5KMGB 4D25A 2ZBFA 5DEOA 5MN5A 2R1UA 3K9GA 2QJFA 1EWVA 3N2EA 2H3EA 3J80i 1YIAA 4MEBA 2IQ5A 4QXOA 4B45A 4C6SA 2OK7A 2E6UX 4TTAA 4FC6A 3C5CA 4YLYA 5KNDA 2NYAA 2PUWA 4DLUA 3DCIA 4FGJA 5IJXA 4B81A 4JQZA 2BEVA 3OY7A 4DSUA 4O5OA 1VPLA 3GROA 1FVOA 1G8YA 1NYLA 1YDFA 4M7PA 5F2NA 4YNBA 3PGMA 3GLGE 1WI5A 2WFMA 2O4CA 1Z38A 2G0NA 1ZD2P 4ROTA 5ELLA 3R9IA 4J0CA 5LVAA 1U7OA 3UDFA 3GJ4A 1VMIA 4JXZA 2OBXA 4JG2A 1N8NA 1KA9H 4CW7A 2H7YA 1Z35A 2R93H 4KO1S 3WGQA 3QOFA 1U3WA 4FUTA 4ZU6X 3WGKA 1VE7A 4MS4B 1TVMA 4QRDA 4YYEA 1MGOA 1ULZA 3TQSA 5E8JA 3ZW9A 4ZXPA 5K09A 3UYKA 4H7HA 2O0KA 5FWYB 3SR3A 4MCIA 2O2EA 3WDMA 5DT9A 2XQGA 3FX2A 3P8ZA 1PV4A 2WSMA 5D84A 4FINA 4PM4A 3WWEA 2E0IA 2JFVA 1RPZA 1W87A 4FHEA 5LOVB 1JDJA 4LWZA 1L4FA 1EG2A 3B9PA 4X62Q 4NHEA 3C7CB 3M6LA 4X41A 3FDFA 5FRDA 2UKDA 3TG8A 5HMMA 3DF7A 3QLVA 1M2OB 1IPHA 1JQEA 4IX9A 4WBNF 4EUSA 2IHEA 4JDPA 4DHWA 5JASA 3B9BA 3BG5A 3E0XA 5BOSB 4M4SA 4WTOA 4YPOA 2ZBQA 4GUDA 1AGXA 1E9VA 4KPUB 4MI1A 4N8FA 3CH5A 1W6RA 5J4VA 3CV3A 4QNRA 5LMUQ 4PYRA 5K3SA 1UJCA 2GEFA 5ENVA 4B6RA 2O8FB 4OQMA 3W7VA 4WORA 1YJAA 1Q11A 3FNRA 3ZLTA 1M8FA 1QGED 5CBKA 2ZI7A 1G41A 1SZDA 1XZBA 4YGYA 3NIFB 2EOTA 2C98A 1NJ5A 2DU8A 4ZDWA 1YZYA 1N25A 4OOEA 2QRKA 2V98A 1KI2A 4M9QA 5TGTA 1M90C 5H68A 2DUDA 1KXJA 4J7CA 2AQHA 2EJCA 2YBDA 5EN4A 5EIHA 1OIVA 1YJNA 3R4VA 4KOAA 4LHWA 5EUBA 5DHFA 3AKDA 4I65A 1K7XB 3N28A 3ORSA 2AQ2B 2LCIA 3HV2A 4DV5L 1ISMA 2BFFB 4KIWA 3DTNA 1LO5D 5L7WA 2UXDL 2F0DA 3IUBA 3REQB 3P2MA 1R0WA 1R18A 1XYGA 8MHTA 1DJRD 1SUPA 2GETA 2E4WA 4INPA 5CFPA 4IILA 4P0TA 3JQAD 4M76B 2FFHA 4MI9A 1FFGA 3RC1A 3IJ5A 2P2GA 5F33A 1DG1G 4CL0A 1XQ1A 2A9RA 4A82A 1G9SA 3ENWA 1T5BA 5HS6A 4Z4CA 5ABPA 5H3HA 5LP6A 1HH4A 1FXWF 5AWFC 3W1VA 1ZOPA 3CH6A 3MS2A 4GX2A 4MKFA 3UV7A 5EMKA 1XMOB 3IL8A 2L82A 4XARA 3TBIB 1E4YA 2AN3A 2A6ED 3WIDA 1TJNA 3IBYA 5JVDA 3DPIA 2E2JH 2A9FA 3EC2A 4JI0Q 1QKIA 3WDKA 4E5UA