3PV0A

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 86
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pv0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pv0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pv0A01
1IN8A 1D2MA 2B7CA 4FN5A 2NVTH 2O5IC 2CEAA 3QI2A 4AYWA 1D7QA 4OHZA 4BY1G 1YZKA 3IO5A 4DDWA 1NVVQ 2J7PD 3CWZA 1Z0DA 4A3CG 4B3DA 5DN6D 2QBYB 1Q1BA 1EX6A 2G1KA 3U6KA 1FX0A 2R7ZG 3UXMA 4G5SA 3GTPH 4PC6A 1HY3A 1SVOA 5FL3A 5FH9A 1VQBA 1AE3A 1Q3HA 2QP3A 4OXPA 3VTKA 4BFWA 5BW8A 2O8EB 2IYRA 3ZIAD 3TBKA 2WPDD 3CD6A 4X66Q 2C04A 2CMKA 3RANA 4UXJA 4FCWA 2UU9Q 3WDNA 2A8VA 1XD8A 3EIEA 4PC7A 4TTQA 1VQLA 1GNQA 4U00A 1KSGA 3K9HA 4LFCL 4PSKA 4B3ML 1IAQA 1FUUA 1M74A 1OV4A 2OBLA 3L0IB 4Q9HA 2CQOA 3AQ4A 1WBDA 1XTSA 2O8BB 1SN8A 4R2IA 2QMEA 1L0WA 1AIPA 3ZZTA 1CR1A 1T0HB 4NXNL 4PFSA 4DK0A 3BD9A 1US8A 2J0VA 4WZ6A 3MLEA 4D4MA 2ZJPA 4AG6A 2MFIA 1VQ5A 3DEFA 2AXPA 2X19A 4OJKA 1OPXA 3OEED 1DXMA 3U4VA 521PA 3WNBA 2KBEA 1N0UA 1E2KA 5EQTA 1GUOA 2A6ED 3H86A 4NONA 1O7LA 2OBMA 4TMKA 3AP3A 2BH2A 3UPUA 2FEMA 3CPEA 1UJ2A 2H57A 4CIDA 2WKQA 3AV0B 2PQAA 4HJAA 2QAJA 1W36B 4DIDA 3H4MA 1Z7TA 1E1QD 4P75A 1ETUA 1HH4A 1LNZA 2GCNA 2J45A 4NYJR 3R9IA 1W3SA 3B2EA 3AVXA 4B3TQ 3H15A 3C8UA 5EJEA 3VX3A 3S1QH 4GL2A 4M0LA 2FG5A 3BORA 4E22A 4G1UC 2VQSA 3CW2C 1A62A 2ZSFA 1CRPA 1YR6A 4AG5A 4LNQA 2A2ZA 3SU8A 4K8OA 3OIVA 3AB3A 4NCKA 2QUZA 1UKEA 3FDIA 4B48A 3IFTA 1LM0A 4LF4L 3GLIB 4DLUA 1G9XA 4OQLA 5G53C 3EWAA 3UE1A 2F3TA 4MRPA 4NL4H 2IS4A 3RN5A 3R20A 1X6VA 4OX9L 4KLNA 4A75A 1W2HA 4IOAA 2NG1A 1Q81C 4TWZA 1I6VC 2JXMB 1COWA 5IRCD 2IHEA 3BU2A 3T34A 3GTJH 4ZDJA 4B3XA 2CCJA 3SYLA 1WF3A 1IBRA 4LUOA 2NO9A 2Q0HA 4EJSC 4JI5L 4OO1G 1VQIA 2ZSDA 2DUDA 1GIAA 2UXBL 4B3SL 3S2DH 4BFXA 1E0SA 4EFNA 2YU9H 1OB2A 4PZLA 1DAHA 4JI0L 4Z1MA 1NTGA 2NZJA 2ZI5A 1N6NA 1Q20A 3PQCA 3R8CA 5FJ8G 3BB1A 2KBNA 1N6RA 4HUQB 2WKPA 4DV3L 3QBTA 1JQLB 4YMVA 4A3FH 1G19A 4FWIB 4JI4Q 2D0PA 1CU1A 1QF9A 1GITA 2O52A 1NN3A 3AEZA 1VYUA 5B2ZA 3UDXA 4IDPA 3JVUA 2GXAA 1RRCA 1Z2CA 5FUVA 1QZXA 5HR5A 4JLVA 3CPJB 3RLOA 4DVGA 1KSJA 1E79D 2B6HA 2OCYC 4G01B 1S3SA 5EXTA 2PJRA 1TQ6A 1FPMA 1XD9A 1OIVA 1N6PA 2HDNB 5DE3A 1JR3A 2E1RA 3RRNA 3ZVMA 1E32A 3TH5A 4DV4Q 5F3WB 5DHAA 2LXJA 5E7JA 1QVFA 2ZE8A 1QVGA 2FF7A 3CCMA 2CNWD 3OF5A 4YDSA 1G7TA 1C9OA 1A5TA 3OW7A 1CJKC 2JJ1D 4QOSA 5FBWB 5H68A 4JMPA 3U2QA 2SHKA 2NMVA 4OWWB 3EC1A 3VFDA 1UBGA 3QNUA 1XMOL 3L0OA 1U90A 2CXXA 1KY3A 2IWHA 4EPRA 4OQXA 1J6QA 2OAP1 4GRAA 4D25A 3H3VH 1EWRA 1A82A 2RGDA 2VTKA 4M9ZA 3B6EA 4KBGA 5LBIA 2K75A 4NCIA 3CC7A 2CDNA 1N8RC 1L1OA 2W6ID 3DMDA 5ANRB 3D6TB 1HA3A 4GOXA 3AVWA 1Z0JA 4Q1BA 3B1WA 2R6AA 4GI7A 4HLDA 1RPZA 1I5FA 3PXGA 2RGBA 3BXZA 3W9YA 1YRBA 1VF7A 1TQ4A 5LD2B 1DAKA 3K09C 3ZD6A 3AM1A 3A7AB 2IXEA 4QXAA 4DKXA 4MYTA 3U60B 1EFTA 2XB2A 3I5YA 1VQHA 2XTMA 4JG2A 4OHYA 4CDGA 1BIFA 1TQ2A 5CJ2A 4JT2A 4JCVE 3D8BA 2WWIA 2VUMH 2B63H 1G5TA 5JZVA 2O8FA 2OCEA 3T5DA 3MEFA 3KDFA 2GJKA 2Q3HA 4HATA 3WHLA 2ZJAA 2D7DA 5M5XH 1JALA 1QRAA 2KBFA 2A6HD 1B8AA 4JOIA 5LMUL 3Q7QA 5AR1A 4F4CA 4QGAA 2ASBA 4DUYQ 2Z0SA 1JXMA 3DO6A 3VAAA 3GLGB 3NBXX 5JJIA 1H9MA 5FOSA 2KCTA 4BBSG 4BEBA 1CKNA 4OK6A 4EIWA 3B5JA 4NZYA 5A0FA 1VQDA 4EFLA 1LTQA 5HPYB 2EWWA 3BH0A 2AHOB 3A36A 3L7ZC 2FPLA 2PEYA 1E3PA 2GBLC 3RSLA 2ZRGA 5IP7H 2WIBA 3B9PA 4DCUA 1HR0Q 1Q57A 2R6FA 3A74A 5TV2A 3F8TA 5KNCA 1NVUQ 2HHHL 1RYFA 1T5LA 1NY6A 1YRAA 3DM9B 4BLTA 4Z51A 1J70A 4LF5Q 5DHFA 2AFHE 1KK1A 3M4OH 5SZJA 1XTRA 4X8LA 5K8TA 1YJNA 4CGZA 1UAAA 1OYYA 2YC4C 3QKSB 1L7VC 1E2FA 4JI8Q 2VSFA 1BH2A 2FEOA 3QEJA 4U7DA 4LC1A 3H3VI 1S3GA 2NPIA 1QVCA 1WA5A 2NTYC 4JVSB 2K32A 1PVOA 4D82A 1XEXB 1CKOA 2JEOA 2F55A 3HOXG 2XXAA 1PFSA 1GSIA 3REFA 4AQYL 3X1ZA 1XZQA 2WSSD 3CR7A 1QBKC 1YHNA 2VEDA 4EQ6A 3AFQA 1UE1A 2GK7A 4TMTA 1M7GA 1VQFA 4RZ2A 3TSZA 4DRZA 3I61A 3VKGA 1KOFA 2EJMA 4PPNA 1KO7A 2Q2UA 1ZNYA 4RG1A 5D3QA 4JLOA 4DR2L 4JBKA 5FTMA 1YHBA 3HWSA 5D3MB 1EYGA 3F0TA 4HAXA 5DNYB 721PA 2RMKA 1ZCBA 1YZUA 1VKJA 3LBIA 4LBZA 5CDFE 2VL6A 1NJGA 3J7ZC 2CLDX 4JV5Q 3MWKA 4F4IA 2K52A 4GP6A 3LQQA 2E5LL 2BV3A 5EE9A 2XGTA 3T1HQ 2GEDA 5HY6A 1VYVA 4GPTA 3U44A 3K7AH 1D8TA 2KB0A 3A0JA 1XEWY 3QG1A 2ZRKA 4PTLA 1RC8A 2KENA 2ONKA 5CM9C 2JJ8A 3BOSA 3PG5A 1F3OA 4OHXA 3RS4A 4ZKDA 5IYCH 5GADC 3B85A 3LVRE 4PQYA 2JA7G 1JR3E 4Q4JB 5L3VA 2JEAI 4KVAA 2ZR9A 3CPWA 2PCFB 3O8DA 4BXXH 1KKMA 1R7RA 2F43B 1NBMA 4PQRA 4A3IH 1YVCA 2V1CC 3OTOQ 1XMJA 2QGNA 4DR3L 3IBGA 1OKKD 3FHWA 2LSSA 3ZZUA 3L2PA 1YJ9A 2NN6H 3WMEA 3PUXA 4QIWE 1MV5A 3KFVA 4I1UA 1ZP6A 2JAQA 3ZYCA 3DM3A 3SDZA 1KL9A 2P67A 2QSYA 2B29A 3A6PC 4OJQA 1EFUA 2IY5B 4IJMA 5FOXA 5HZKA 1JBKA 3RAPR 5C4JH 3NEMA 5FOTA 1JR6A 3J7A5 5E3HA 2DPXA 5BN5A 5FR2A 3RRZA 3RWMB 2KSQA 3Q8XB 1WBBA 4YY3L 2J7KA 1P2TA 4HZUA 4B2PA 2HXYA 1JPJA 3U6BA 4A3LH 2DY1A 5IP9G 3TRFA 1BYUA 1PJRA 5DI3B 2MSCB 3OAAA 1G5RA 3AVTA 3BG3A 1IXSB 1PH1A 4TMVA 3L82B 5JEAG 4NH0A 2CVHA 1LYLA 4UJ5A 3WP0A 1OYWA 1C9KA 4IDNA 1R0ZA 2HT1A 1VG1A 4TSFA 5C0XJ 1I94L 2R93G 1M1YE 1P5ZB 3FGNA 1CUKA 3RLNA 3LW7A 4Q5IA 2ANCA 3O47A 4DAMA 4L9SA 1TWCH 2D06A 3KFXA 2R6GA 2E8GA 3B9QA 4A93H 3BB3A 4F91B 1RL2A 1W0JD 5G41A 1S72A 4TYYA 2HXSA 2JA6G 5LMNL 5JHHB 4PC1A 4A2WA 4N0DA 2BMDA 2IK8A 2J59A 5JS8A 1Y8NB 1Y1WG 2J0SA 3B6YA 1H8HA 2ATVA 3CRRA 4APVA 4BY7G 3QJYA 3SJCA 5GADl 1O3YA 4LFCQ 4B3MQ 2CL0X 3G82C 5J40A 1JEEA 2V6IA 3A37A 1QZHA 1I2DA 2QENA 3I8XA 1DGSA 2O8EA 5HCIA 2W58A 2L0XA 1XTJA 2K14A 4GNXC 3HDTA 4JVNA 2VP5A 1S0UA 4AIMA 4NXNQ 2LXKA 1RRGA 2VYFA 4JYAQ 2G9NA 1P6XA 1ZM9A 5J4VA 1TPZA 1AGRA 3I56A 1SRUA 3KDSE 1T3LA 2OBNA 4HIDA 3FMFA 4JI3L 4AYBE 1US8B 2OXRA 3CF0A 4UKDA 2NZ8A 3TNFA 5IK2A 3VKHA 2A5JA 3Q5DA 3G71A 1RVDA 3FWYA 2PMZE 4DCSA 2QM8A 4ZI2A 3MG9A 5M3MH 4H0LC 4LW1A 4A8JC 5ELNA 3PSIA 2R44A 1N32L 3RRYA 4LPSA 3MXUA 3OE7D 2JJQA 1SXJD 1Z5ZA 5FTKA 4LFAL 1W1WA 2PQAB 1G8PA 3NBZC 3NTUA 1LF5A 4FXPA 4NYIQ 2B8WA 3ERSX 3HU2A 1TQDA 2F1RA 2WWHA 1L4YA 1KI1A 1PH6A 1IM2A 1WCV1 3AVPA 2MMCA 3CX7A 3DL0A 5HCNA 3OEHD 1KYIA 4YDHB 5IYDG 4LF4Q 4TYPA 3HOWH 1VQ8A 1WRBA 4LYFA 1A2KC 3DZ8A 4QL5A 2A1AA 3GCGA 4MYCA 2FV8A 1II0A 2F9LA 2GVZC 4OX9Q 1DG1G 1W0KD 1Z83A 1J90A 5E7IA 1M6NA 2Z43A 4CF7A 3IUYA 1AKYA 3SEAA 1HJPA 3SFZA 2DGYA 4DCVA 3G48A 4P4UA 4DLWA 2ZTCA 2ZXUA 1Y3AA 1EIYB 2MSDB 3V9PA 1P8LA 3EAQA 1CKMA 2IUUA 1S1MA 3GLIA 4B43A 4FMCB 3K9NA 4JI5Q 4CRWB 3UE0A 2C99A 2UXBQ 3EZ6A 1W36D 2CVFA 2NO7A 1MRNA 1Q22A 4HAZA 1G41A 4I1VA 4QBIA 2AL7A 3SHFA 2YWHA 4JI0Q 2VHJA 4L5BA 1G3UA 3WMFA 2CL6X 4P73A 3KUCA 5JECA 5JJLA 1P7CA 2IYZA 5EZ5A 3K0EA 4DV3Q 1E22A 4JZKA 2FZ4A 4TTPA 3S24A 1TTTA 3DZDA 1D8LA 4HAYA 1Z63A 4AYBG 4JT4A 2EW1A 4V0OA 1NNEA 1UKYA 3U4ZA 1XBTA 3CP0A 4QM7A 4BY1H 4LZZA 2KWIA 2L15A 4A3CH 4KYUA 5M3FG 3BK7A 2PZFA 3CZQA 4DWJA 2LKCA 2HJGA 2J1LA 2KHIA 2P6NA 2R7ZH 1B70B 4HUQA 4PO9A 1KRTA 3GLFA 2ZJ8A 2ZTEA 1XNJA 2C95A 4FMBB 4URYR 4UNPA 1NBME 4JC0A 2EU8A 2GAOA 1AA9A 3IIMA 1ZUHA 5FPKA 3IGFA 2J0QA 4PANA 1KSFX 3AF1A 4JI7L 1UKZA 1YZ6A 4LF7L 3W5JA 1ESNA 3P27A 4GDFA 3J80i 1IL2A 3S1MH 1NG1A 3C41J 4D0NA 1E2MA 4V0KA 1SE8A 2Z6VA 5KSYA 1VQNA 821PA 2E75C 1TEXA 1HQYE 2BJVA 4BZXA 2DWPA 3GFTA 4Q19A 1B23P 1YKSA 4I1SA 3HKSA 1KI6A 3GJ0A 2VY3A 1XPUA 4KXFB 1WP9A 1TWGH 3RYTC 3L2OB 2IS2A 5GJBA 2VZAA 4JVLA 4A4IA 1HNWL 2NQ2C 2P2LA 3SZRA 4DLSA 4DSOA 4D0GA 1KRSA 5FOUA 3CKLA 1U0JA 3GEEA 3A8IE 4BZQA 4C2UA 2P0EA 2OZEA 3B13B 2FSFA 1C0AA 2A5FA 2C78A 4ALPA 3GFPA 5K36G 1K8AC 3LRPA 4ZV4A 3MGCA 3T06B 3KXLA 4D4KA 1Y69U 3CW2A 5EXPA 1L1OB 3LLUA 4GSYA 2R7DA 4QGHA 2GVBA 4BLPA 1A4RA 1G16A 2GNOA 3ULLA 2UZIR 1D9XA 3NENA 5BXQC 4J0QA 1O78A 4PQFA 4BFTA 3CMEA 3CCSA 2IX3A 1GTVA 4YC7A 4G0NA 1Q3TA 1A2BA 2YOHA 2VQEL 1RIPA 4F92B 1JNYA 4RD1A 4A3EG 1QVAA 1GAJA 2JLYA 3AYHB 2JLQA 3OYYA 1X3FA 5LMUQ 2UUBL 2VP0A 4MGZR 4EPYA 2I1QA 2ZETA 1OJLA 2PBRA 4EJSA 4TYNA 2BA0A 1KI3A 2IYYA 3ZS9A 3R8FA 2XGJA 2ZJZA 4WVFA 4A82A 1YNXA 2AWNA 2C77A 2HCJB 1PZNA 1UPTA 2FOLA 2NO1A 4JBYA 4KFSA 5JSZB 3HOUG 3SJZA 5EP3A 5IE8A 3KUDA 1E9CA 4FD2A 1IY0A 4PHGA 3KKNA 2O5JC 1NMGA 4IFDI 3ADKA 4M1MA 4OO1H 3EARA 1FZQA 3EBEA 3RNLA 1Y63A 3I73A 1P75A 1SQ5A 2P3SA 3ZVRA 4GZLA 3SFVA 1I4LD 1ZCAA 2HHHQ 2DNCA 4BWYA 2LMCB 5G40A 4K0KL 5TARA 5FJ8H 1F6BA 2AHOA 2FFHA 1C7YA 4NU0A 2ZM6L 4FIDA 3GTOH 5FTNA 4PPFA 2ZPTX 3MWLA 2WB1E 2EFHB 4HJ5A 1JAIA 4V0LA 3I7FA 5C2JB 4D26A 2DYKA 4M2LA 3LBHA 2IYVA 3LNNA 4IOLA 1Z2AA 2N1BA 2UVQA 4BFUA 4V0ME 2V7QD 3SBDA 3U3MA 4ZKEA 4HJ9A 1E2PA 1QUQA 1AZSC 1MRSA 1T8UA 1P72A 1Z0AA 4RJLA 2QAGC 5L3SB 2JJ2D 3S1NH 2REOA 4LSGA 2BEJA 4AQYQ 3VA7A 1IBLL 2X1VA 2RGAA 4LJ5A 3QKSA 4IDQA 1DCZA 1HZCA 1N5KA 1FOEB 1NMYA 4TLEA 2XXAB 2JIZA 2ZJRA 2QROA 4BLRA 1V43A 1NLFA 5FLXc 1ZM4A 4QRHA 3W5IA 3S2HH 4B71A 1B0UA 4P72A 3GLIE 2DHRA 4DR2Q 3AKEA 4EQ6B 3AKCA 2B8TA 2DR3A 3WBJA 5KDDA 1VQCA 2FPKA 3E5HA 4OQFA 1E1RD 2RHMA 1XTQA 4LBVA 2F9MA 4IEEA 3MCAA 4TMWA 1N36L 4A92A 1HNXL 4B2IA 1OFTA 1QHYA 4IFEA 3KQKA 3K09A 1I4DD 3BB4A 3AKYA 1FJGL 2RKOA 4A3KG 2E5LQ 3TUIC 1QHNA 1UBCA 4IVRA 4MRRA 2CHVA 3TW8B 2ZE6A 1O87A 3A1TA 5AJVB 2O8BA 1L8QA 5JRZA 3P20A 1C1YA 3CO5A 5CYPA 3STBD 2AD1A 4TQUS 1TEVA 2BMFA 2YC2C 2V3CC 3QOFA 4DEYA 3CCVA 4C0LA 1GUGA 4DHEA 3DXJC 2UUCL 3LX8A 3GLFE 2WJVA 1AKEA 1VIYA 3U44B 2XOKA 2XZPA 3OHMA 3QKRB 4KCGA 4XSGA 3U5ZB 1G4AE 2FA9A 1X8LA 3IQWA 4OO1I 1CJVC 1G64A 1GDDA 1XB2A 2WB1G 3R9WA 2FFQA 1NRJB 5EP1A 2E74C 4DR3Q 2NGRA 3OIYA 1NP6A 5IT9c 1IN4A 3IKJA 1XPOA 2OLJA 2VLIA 3VU9A 1Z47A 3EWSA 4PPGA 1IYJB 4DCTA 4LF8L 3C5CA 4RD3A 4Q4JA 4TQ9A 4URXR 3PCOB 3UANA 3BWDD 2GBLA 2F43A 3CRKC 4QJ3A 3QF4A 4QBHA 4NBSA 3WYAA 4BBSH 1KMQA 4KBFA 3KXKA 1AQUA 2BBSA 1CR4A 3FKQA 3U4QA 2XEXA 3K0FB 4O2LA 5C44G 2RHDA 2YOGA 4YY3Q 5EXSA 2FNAA 2B3GA 2GZHA 1XDBA 2D74A 2QAGB 1ZYRC 4RCZA 1S4QA 1P9WA 1LFDB 2JA8G 3AF3A 2Q9BA 3T1QA 1HT2E 1IN7A 2D5DA 1TMKA 4MKIA 5FL7D 4C9BA 2VQFL 4HZUB 2GN5A 1RJ9A 1Z8FA 2QTHA 3GJ6A 5AJXA 2WJYA 1CEEA 3UDFA 1LY1A 2HF9A 2QL6A 1PYBA 1RYHA 1H9JA 3DLLA 3EZ2A 3RS3A 4AURA 4MRSA 2Y0SE 3EZ9A 3ZQJA 2JQOA 1YE8A 5DH9A 1R4AA 4NDZA 5LMNQ 2X2FA 1OXVA 4R4TA 1E2EA 4NYMR 1YNJC 4RD4A 1CS4C 4DUGD 1VQ7A 2IYLD 4DAYB 2X8AA 3CIOA 3TIFA 1OB5A 1W44A 1PH9A 1K73C 1VQKA 2OXCA 1GHKA 4QNRA 3HOXH 3VX4A 3NH6A 2HQLA 1FR3A 4R4IA 5GAHC 4B3RL 1DEKA 2ZU6A 1MO6A 3AH8A 3FMIA 4OK5A 2J7PA 4OONA 4GFDA 4RKEA 4X65Q 1TF5A 3O8BA 5DN6A 2QGQA 3NEJA 4JL8A 1DS6A 2VW9A 1N5IA 4MKGA 2QT1A 4L5TA 3W5OA 2F6RA 4BUJA 1E1TA 1W7AA 4C0SA 4DV7L 1T5IA 2GVDC 1UKVY 1M90C 2DWOA 1YZTA 2QY9A 5JLJA 1UE7A 5IYBG 1TU2B 2N46A 3TQCA 2D2CC 2ZJQA 3BC1A 4JI3Q 3TQFA 1E2IA 4R4OA 1X65A 1KI4A 1KI8A 3PO3G 1YITA 2KI5A 3GLGE 4POFA 2BE5C 1WDTA 4N0EA 1KK2A 4A4DA 3BH6A 1XJVA 3LNCA 2EJFC 4GT1A 1BBWA 1N32Q 4WAUA 2DFLA 1NKSA 3ZDQA 3I4NG 4IFDJ 2CHQA 4LFAQ 3AEVA 1W5TA 3P32A 3H94A 3A8TA 5TB5A 1WXQA 4DUZL 2F1HA 4M1OA 3EW9A 3O8CA 2V9PA 3U7HB 1XMSA 3FKSA 2QT0A 4ARZB 1K9MC 2ZRPA 4PC2A 2DB3A 1T3SA 1EESA 1OH6A 4AWXA 5CIWA 2YYZA 1G51A 4I7ZC 2JA7H 4LPKA 4YMTA 1NF3A 2Q2HA 5AUQA 1WI5A 3W6OA 2Y0SG 1G3QA 1G4UR 4OI1A 4TQAA 4WXRA 1KO4A 4DR6L 3IRBA 1KI2A 2W0SA 3V4FA 4BFSA 3J81k 1KKLA 4JSTA 3I3SR 4B47A 3TRZA 5GQOA 2QPAA 3IHLA 2ZE7A 2Q9CA 2O8CA 3QVVA 2IYQA 1K0RA 2IT1A 1NLZA 3ND8A 2QTVB 4ZI3A 2UXCL 3AFPA 2JA5G 2IXGA 4YWLA 3H0KA 3KJEA 4HDQB 5K8UA 4W9MC 4WIAA 1VS0A 2ZRBA 2KCMA 5C4GB 3W1BA 4DR4Q 4HLUC 2C2HA 1XD2B 1ZYUA 2EDGA 1OSNA 2Z4RA 2PH1A 4O2DA 4OGQC 5E4FA 1HH2P 3DKVA 2PPBC 1AH9A 4DK3C 2HT6A 1E2QA 2PMKA 5CB8A 4HZIA 4UY8C 4XOIA 4YXWD 1G8GA 5IP9H 1W4RA 2CL7X 4EFMA 4G3XA 5HTKA 4NHOA 2A7QA 2Z83A 2ZROA 3A1SA 5JEAH 3KF8B 2E87A 1LTLA 3ICQB 1X56A 2AKYA 2IXFA 2GZAA 4RZ3A 4E07A 1S8FA 3T1OA 2R93H 3ZQ6A 1DBSA 3HYRA 1U0HC 2ZVQX 5F2EA 5HKKA 1U5KA 5C46F 1MIUA 2OTJA 2V1UA 3SC3A 3BERA 4B3FX 3JAMi 1OFUX 2ODWA 2R6CA 3A8KE 3Q9LA 4MGKR 3P26A 3PUWA 3J80c 4ZCIA 3BFKA 2CLSA 4ACBA 4X64L 2JK8A 2JA6H 2VBCA 2CCKA 4AC9A 4LF7Q 5DI9A 4C0AC 4GNXA 4L8GA 1T6NA 3H1TA 1GRRA 3ADBA 4TL8A 3WNDA 1Y1WH 1P9NA 2VP4A 4OWTB 4BY7H 3PIOA 1JJGA 1COWD 2ZSEA 3I4LA 1IW7C 2D4HA 4IXMA 4LYJA 3RS2A 3SQWA 5FBLB 4O0MA 2NO6A 3HR8A 4A76A 1QHIA 5G3ZA 2LKDA 2XAUA 4FW9A 1OH5A 3W6NA 3E9HA 5SZHB 2NO0A 4TZ0A 3GTGH 3QKTA 4ABYA 2YJTD 3QENA 1HNWQ 4A8JA 2ZI9A 2AXNA 4Z1MD 2OO7A 2ZRLA 3QE0A 1D9ZA 3K8AA 3T5GA 3NH9A 2VL7A 1Z22A 1KAGA 1KI6B 4R2HA 2WOJA 2C98A 2F1MA 1G3IA 4PMWA 1BKBA 1FNNA 4TLBA 1TUEA 1Q46A 1HURA 3EQLC 2ID0A 2IF2A 4ACAA 2CCZA 4EPTA 2GK6A 4X62L 2MO0A 2OT3B 2G3YA 2HYDA 1R5OA 4M9XA 1EQRA 4G5QA 4UQOA 2RHSB 4Q7JB 4DDUA 4C7OA 3CNNA 1LACA 3N6RA 1Z6GA 4NPSA 1R10A 4HDCA 1NMFA 4P32A 2VF7A 4KU4A 1JR3D 3GTQH 3BDOA 3J81j 4LV5B 1GKUB 1FGUA 2ORWA 3ZD7A 2VQEQ 4TT3A 1VIAA 2ZS9A 1OXTA 4DK6C 2IUSA 1FVIA 1FP6A 4EPVA 3T1YL 3FHCB 5IYDH 4Q4HB 2UUBQ 1JJCB 1EGAA 1GKYA 4A0FA 3KF6A 4NYJQ 2XB4A 4WZBE 5HGQA 1QHSA 4B76A 2BA1A 1P16A 4HB4A 2ZTSA 3P4XA 4PZYA 3A5UA 4PV1C 1XTDA 4HDOB 1DAFA 3UG6A 4JLKA 2ZRIA 2W2TA 3PR1A 2BDTA 1IOZA 1RE0A 3B1ZA 3RC3A 4A3JG 4EJSB 2A69D 1KDRA 1M1KC 4K46A 3THWA 3CH5A 3PEVA 4Q02A 2WJHA 4QHSA 4DIEA 5JWHA 4RKFA 3K70C 2NZOA 1H95A 3PF5A 4TVAB 1BS1A 3CR8A 1G8FA 2R9VA 2AFIE 4K0KQ 3QXHA 4R98A 2EVBA 2K5NA 1KHIA 5JSZA 2I3BA 2VHUA 5E95A 3B7GA 1H9SB 3F1ZA 2ZM6Q 2W00A 4KAXA 3TUJC 4FWTA 1FYCA 3L8ZA 4NE2A 1KNQA 2BC9A 2QE7A 3GEIA 1O7IA 1RRFA 1Q86C 4IW3B 3M3YH 2QPOA 2R8RA 1NBWA 4LHYA 2C35B 4IPGA 1PH4A 1YZQA 4QJ5A 1TU4A 4KSBA 5M3FH 4RCNA 1NSFA 2ZYTX 4YWKA 3BH7A 3RS0A 3W8NA 4E03A 4YCWA 5ELXA 1OH8A 2MNAA 2PI2A 1JXOA 2ZUDA 4LHXA 4M9QA 4P4TA 4Q4LA 4DR1L 4WA7A 5DSZA 1IBLQ 2K5UA 4GKKL 2AMCB 2C9YA 1KC8C 2QEQA 4D81A 1NIJA 1TWFH 3PJRA 4DV5L 4KVGA 3IHWA 1QUQB 4DV1L 2OV2A 4A1FA 3LWUA 1NMZA 4C2TA 2LWIA 2VA8A 3CX8A 3WMGA 4DLVA 5AJ3Q 4LV8B 5L3SA 4QC2A 2WP8J 2MO1A 1MH1A 3QPUA 3BAFA 4KLKA 4JLAA 3U7EB 1VQ4A 1QDEA 4KFTA 2N78A 1EIFA 2P5SA 1TF2A 1CKEA 5JI2E 4LRWA 4DV6L 1N36Q 4TN1A 2ZUCA 1HNXQ 3QY0A 1BMFA 3PCRB 1N2CE 1P3JA 1P61B 2VS1A 1XTKA 2I4IA 2MMGA 3BZCA 2WZQA 4YQFA 2JLRA 3NDPA 1NVXQ 3N5CA 4M1SA 3TUZC 1IONA 1J5EQ 4IDOA 3U7GA 4DSNA 1AGPA 1QHHA 2HCBA 1VF5C 2F4VL 4U02A 4GNKA 5K36H 3TAUA 4JVMA 4DR5L 1Y14B 3L0SA 4D80A 4C3HH 2HF8A 2F1IA 4N1AA 4F93B 1CJUC 1X55A 2UUCQ 4H1VA 1JT8A 4IXNA 5FPYA 5FTJA 4M1YA 4PZZA 1OE0A 4GOPC 3QUSA 1M8PA 4Z54A 1E98A 3GLFB 1DD2A 3B1XA 3CXCA 3A1VA 4UJ3A 2EFGA 4LF9L 1W2GA 1ZC3A 4ON9A 2ZJBA 4P31A 3A7LA 2ZRMA 2NIPA 3J81i 3CPHA 3AB9A 3TEHB 4JI2L 1XP8A 4US2R 3THXA 1Q12A 1OHHA 4A3EH 2H7VA 1KIXA 3UIEA 4BRUA 3CC4A 2VHCA 3Q3JB 4JLPA 1CR0A 2V4ZA 5B57C 4LF8Q 4JBXA 4A0HA 4DLYA 4JBMA 3QKRA 4EPWA 3VR5A 3JC66 1KO8A 3EA5A 1A6XA 3F3YA 2IHFA 3K53A 1Y1VG 2MSEB 2VHQA 4LYHA 4IRUB 4PSAA 1ASYA 4UNQA 5E7MA 4HUTA 4JI6L 1GG2A 2FE4A 3VU9B 3BFVA 5BWMA 2C5LA 4DV0L 1VMAA 4BA2I 2JDIA 1XNRL 3BGWA 1SVLA 1ZUNB 5B64A 5L8VA 2H17A 1DG3A 1ZD9A 2F3RA 2XJ9A 1MJEA 3HOUH 4B6EA 3BZKA 4LJYA 5SZKB 3GLHA 4XVUA 2H5XA 1X3GA 3K7UC 1IJEA 3QF4B 3KJGA 3E9IA 1TNDA 4LUVA 4KKSA 4HIMA 3QQ5A 4IFBA 4B3BA 3U4QB 3IO3A 2A6EC 5JWRA 2VQFQ 2WWYA 1B9MA 4PAMA 4LOAA 3TSOA 2ODBA 2I5LX 3VHLB 1N5LA 3K0FA 1GKIA 2D7CA 2ZAMA 4KFRA 1Q90A 4QL3A 1JEDA 2F7SA 1JJ2A 2QAGA 2OM2A 3WHKA 2ZYVX 1AM4D 2BIFA 2OG2A 2WIAA 1RJ9B 3VR4A 4ZCMA 3KKPA 1PMRA 3SYNA 4Q01A 4YCVA 4XWOA 2PEZA 4M1WA 3I55A 4IQZA 1ZIPA 3IPYA 4LBWA 4AD8A 1KDPA 1NBMD 1E94E 1EOVA 1N6HA 1U94A 1WOCA 3IIJA 421PA 4PAOA 2VIIA 4URWR 5C1BA 1ZD8A 4QJFA 1P73A 1G291 2KCCA 1VDZA 2QMHA 4AKHA 3IPXA 1J99A 4LJ8A 5FLMG 4B3RQ 1K5DA 2EFCB 1WYDA 1G3RA 4Q9KA 3CCUA 2NVXH 1UADA 3AQQA 1KQSA 2Q21A 4HB3A 2G6BA 4OHWA 1LVGA 3IILA 4RY2A 4YLGA 4XJXA 5FOWA 5C4MA 5C0XG 4B44A 4DDVA 5K8IA 3S15H 2N3SA 3BFXA 3A1WA 2PCLA 2V4DA 1CSPA 4DV7Q 1DARA 2REXB 3F2CA 5HE8A 4A6XA 4Z8YA 3M0EA 4Y0VA 5IF9A 5KPDA 2AR7A 3H0GG 4LBYA 4IPCA 4CT5A 4POGA 2PT7A 3TGPA 2VP6A 3RZDH 2DN8A 1JJ7A 1SGWA 2V8OA 1X86B 3FMOB 3OAAD 4DJTA 2P6RA 1S1CA 2CW0C 4LWCA 3WWVA 1RZ3A 2YINC 2ZU0C 3K1JA 3W6PA 1Q1EA 1K8GA 5BYKA 4R1JA 4TSFD 5IWAL 4A3KH 4ZDKA 2C9CA 2HLDA 3AP2A 1KJYA 1TKWB 3QKUA 4TLAA 4C4PA 4GLAC 1UWVA 5FFMA 1FFHA 1MKHA 4W5JA 4P3YA 2EQBA 4DUZQ 4MKFA 1UFQA 4MZ9A 2RAPA 2QN6A 5CJPA 2JASA 1E2ZA 4LUCA 4H9GA 3K70B 5M04A 1VQ9A 2GJAA 1H8HD 1JI0A 1R0YA 1SVSA 5GROA 1XF9A 4CZ2A 2WAXA 3CNLA 5JEEA 2ZM5A 2G77B 3NC1C 4DR6Q 2IC5A 1NY4A 4DNTB 5CK4A 2NN6I 3CAMA 1E6CA 1G3MA 3LGJA 5EE1A 2ATXA 1EFWA 4ARZA 3CCQA 3S1RH 2WV9A 1Z06A 1TUIA 1Z6AA 4TL6A 4DB4A 2UXCQ 4GLXA 1HR0W 1P2VA 4LWZA 1AS2A 4HAUA 4JIMA 2ONJA 2HV8A 1TX4B 1ZD1A 5GVRA 2FX3A 5K8LA 3LV8A 5AUPB 2O8CB 1R2QA 5KNDA 5C3EG 2I1VB 3EPHA 4QY7A 1EFHA 2JE6I 5IY0A 2ZRDA 1S9DA 1SHKA 4MGIR 1GVPA 3ECCA 1XXHA 4X8MA 4C30A 2K7VA 4A3MG 5IK2D 3D3QA 1SR3A 2QMOA 4F7WA 2CE2X 5C44H 1L2TA 3UK6A 2ORIA 4Q1CA 4O0AA 3NIBA 1YBYA 4DLTA 1W0KA 1GHJA 3SI7A 4KO8A 2AUJD 1XD2A 3CCJA 2JA8H 2QSZA 1D2NA 2W6JA 3REGA 2A5GA 2K33A 3MJRA 3CRW1 4P74A 2GJ9A 3MXNB 2OCPA 1NVWQ 2IEZA 3ULPA 2BKUA 4B3SQ 3QF7A 3M4YA 4OQMA 5FPTA 3FKIG 3RNUA 3HOYG 2VF8A 3CLVA 1UDWA 5M5YH 3EASA 2WVJA 5BN4A 4X64Q 1X1RA 4YMUA 1VHLA 3T1TA 4Y52H 4DLRA 5HE9A 3M4QA 221PA 3TQYA 2C8VA 4BFZA 2FN4A 1K8OA 3NG1A 2UKDA 2VO1A 2QNRA 3T53B 1VG8A 3W3ZB 3OW2A 4GNXB 3GEHA 2A6HC 4PO1A 2HJVA 2Z5FA 5BYJA 4PZ7A 3T1VA 4A3BG 1G18A 4TTRA 1OFIA 1YR9A 3NEYA 3ZJYC 2VNUD 1NSTA 3CCLA 2OFXA 2ZAOA 3GLHE 5UKDA 2WKRA 1X8KA 2B8GA 4L9WA 3U58A 1B9NA 1A0IA 5IYBH 2ZJ2A 3N2IA 4UNNA 2KHJA 1ZUIA 4UXIA 3SS8A 3THOA 4B2LA 1DTSA 4MITA 3A5ZB 4A3DG 3PO3H 1ZM3A 4A8JB 3T15A 3M1IA 3U3JA 2IYSA 1MO4A 1W47A 4KHZA 1ZM7A 1KHTA 3A4NA 5KYKA 4X62Q 4TMXA 2G83A 2GJSA 1XMQL 1W46A 3GJ4A 5AJYA 3ZS8A 4CEIB 121PA 3SJAA 1XMOQ 2RHQB 2ZI7A 1HV8A 3CONA 3LFUA 3I4NH 3A4LA 4NXML 4TKOB 3C5HA 4Q66C 3TS2A 1I3QH 2ECKA 3W90A 1DOAA 2WICA 3PO2G 2VPPA 1GUTA 5L3RA 4UNRA 4UP8A 3TW4A 4GKJL 4MUAA 4AKEA 2JGNA 4C7OB 4HSEA 3KX2A 4YONB 3T1YQ 5ELOA 1CTQA 1DO2A 3MD0A 1HUQA 3RLFA 2XNSA 4WXPA 3PUVA 1KTVA 1CFMA 2QRNA 4QNMA 2GZDA 4HLUA 2CWAA 4QFMA 1CJTC 1XTIA 3TS0A 3GD7A 2VH5R 4GP7A 3ZVNA 1EFRA 1MOZA 1EX7A 3KF6B 1ZC4A 3CX6A 2JA5H 3T56B 1E2DA 1FL9A 1H9RA 4FDBA 4Q4HA 1DO0A 3JZMA 4WJ3M 1FQJA 2RGNC 2E2HH 2UXDL 1EG7A 3Q72A 4JYCA 5FR1A 4NCHA 3A1UA 3OZXA 2F52A 1CLUA 1ONBA 1ELOA 4Z8XA 4QBGB 2ZSAA 1XNQL 3LH5A 4WZAE 4L8JA 1N6LA 1TWHH 3GDEA 3JZAA 4XTRA 1MJCA 2Q9AA 3SOPA 4ASUA 3THWB 4PC3A 3FHTA 4MDEA 4ZPXA 1Q82C 3ZH9B 5EXXA 2J0UB 3K80C 2QI9C 3JVVA 4L4UA 3TJZA 2R2AA 3GJ3A 1E1OA 3GPLA 1NN5A 4AI6A 3LX5A 2YV5A 1VQPA 1E0KA 3CPFA 1N0VC 2GAAA 4M22A 1HTWA 4RFSA 1KGDA 3EIHA 1U0LA 2C9OA 4LF6L 2JA1A 4UPAA 4OYHA 5JMTA 5GAEC 5H8WA 3RWOA 2HEIA 1H9SA 4HB0A 3NBHB 4KKUA 4Q9LA 2O8DA 1MO5A 1XCMA 2IS1A 3L8YA 4GKKQ 1X3EA 3M6AA 3EXAA 4HAVA 4DV5Q 1F5NA 1G6HA 4DV1Q 3LWNA 3S14H 4HIOA 1PLLA 1VG9B 1JB1A 2XSZA 3KL4A 5DYIA 5B30A 2KE5A 1VCIA 4LI0A 3CF5A 1CTMA 1DAGA 4CEJA 4F4JA 1IQPA 3VR6A 1YHAA 1UDXA 3AGQA 1KK3A 4RSGA 5CIQA 4A2PA 4FCTA 4RFVA 5TMPA 3QEOA 4KLZA 4KMUC 3NBYC 2AKAB 5EZ6B 2AX4A 4RZUA 3I92A 3TR0A 2YZ2A 5J4KA 5CITA 5CK5A 1ZVQA 3UMRA 1BDOA 3QXXA 1PV4A 4XWAA 3PIRA 3X1DA 1L4UA 2ZR0A 2IYXA 1U81A 2XX3A 5J4HA 3BIFA 1IBML 2IBMA 3TSWA 2IX0A 1GL9B 1G6PA 1ZNXA 4K81B 1FNMA 3GP8A 2FZLA 2F4VQ 4DV2L 1N6IA 2GILA 3TKLA 4X8HA 1Z6HA 4KKTA 2ZIAA 4DR5Q 2ZRHA 4Q7LA 2H5EA 2YWGA 2C03A 1CSQA 3PGZA 5JI3E 1P9RA 1SMYC 3B60A 4DB2A 1MABA 1AS0A 4ZDIA 2IX1A 3UKDA 4EAQA 1QHHB 4KITB 4FMDF 1IXZA 2XITA 4MRVA 2NZHA 2YVUA 4PR0A 3WP1B 4LF9Q 4CYMA 4DBLC 4GZYC 4I99A 4JI2Q 2EYQA 4Q1FA 4PSVA 4Y7NH 1HNZL 1NVVR 3CRMA 2JIZD 1G1MA 1YR7A 4BRWA 2HYIC 1Q1ZA 2AUKA 3HGBA 3HOZG 1YZGA 3THXB 4RD2A 4RD6A 3EC2A 4XD7A 4JI6Q 2CK3D 2ZEJA 2O0JA 1R8SA 1GUSA 2GXSA 1T9HA 1JE5A 4DV0Q 1HYQA 1H8ED 1XNRQ 4H13C 1E4YA 2GJ8A 2OHFA 1LB1B 4A3JH 2XNDA 2JCSA 5CLLA 4FI3C 3OFND 2RB4A 5KPJA 3VNVA 4RCYA 3WNCA 3X1XA 3AF2A 3TE6A 1NN1A 3TLXA 3MFYA 2CJWA 2IUTA 3GLHB 4KJZA 4B32A 1F2TB 3RC8A 3IEVA 5J4YA 3DDCA 4H1UA 3ASZA 1T3HA 2UUAL 1CRQA 3D4RA 1SHZA 4YWMA 2EVWX 4NMMA 3NDBB 2AN9A 2ZS7A 4OI2A 2XOKD 3QXSA 3VR2A 2ZYWX 4A36A 1SXJC 2EIFA 4ESHA 5EAYA 2GEUA 5CB6A 3EZ7A 5KDLA 3BBPA 1R5NA 3MRSA 1SVKA 4Q9IA 5AUNB 1HZBA 2NPFA 2Z4SA 4GN5A 1ZBDA 4HEJA 3CCEA 1ZNWA 1X3SA 3SQXA 3H2YA 1TL7C 2EYUA 3BRWD 4PHTA 3RHFA 2ERYA 1WB9A 1I94Q 3CWQA 3KJPA 1E9SA 1XJ0A 2XJ4A 2IL1A 4LY6A 1E96A 4GZMA 1GOTA 2IA5A 2J41A 2ANBA 4L5SA 2PT5A 2R65A 4D4JA 1II9A 3RZOH 1VPLA 4R9UC 1NG9A 1UBEA 2AK2A 2OAQ1 4B34A 4BLOA 1R0WA 5IT5A 5JHGB 1HEIA 2O8FB 4B3GA 4B35A 1M7BA 3Q85A 4NB3A 2YWEA 3LY5A 2JLXA 2BHRA 3CB4A 4N3NA 2JLVA 4DUGA 4M53A 1Z07A 1GWNA 1U8AA 1W36C 3UG7A 2R62A 2P6UA 4KFUA 3LXXA 1WCMG 1GL6A 4IOJA 1D2EA 5IHPA 5IWAQ 5C4XG 2Y8EA 3AUXA 4OKSA 3VR3A 5FI1B 1K3RA 1ZAKA 4OBEA 3SGIA 4FCVA 4E5UA 2A68D 4GOPA 2NVQH 2ERXA 3ZVLA 1J8MF 4M1KA 3X1WA 1W48A 1EFCA 1PLJA 1LF0A 2HUPA 4W5HA 1WQ1R 1NKTA 1SVWA 4LJZC 3T51B 2Z6KC 4JLBA 1E3MA 3ZIAA 4G7OC 2QZ4A 2WPDA 4AY2A 3D0FA 1OLOA 2ZRNA 3ICEA 1KXLA 1XZPA 2WOOA 2FJUA 4CEHA 3QIAA 1YVDA 4DKAC 4A3GG 2QQEA 2ES2A 3MAAC 2BDOA 1K8MA 3PVSA 3PITA 2WMOB 4GLVB 1BKDR 4WJ4A 1VG0B 2V54A 4LJ7A 2OCAA 3LLMA 3KJHA 4C0BA 2BMEA 4TYQA 1QHXA 4URUR 2BBOA 3RABA 4BGDA 4IFDG 2QMUA 2BKEA 1D6JA 1Z0IA 2VP9A 2WAYA 1BBUA 1IYVA 4NP6A 3TREA 2H1LA 4DT1A 1Y1VH 4UP9A 3OOCA 2ZE5A 3OEEA 2E76C 3DPUA 3G0HA 1SXJB 4TMZA 1GNPA 1BOFA 1NIPA 1YU9A 1YZNA 2EWVA 4PO8A 1LS6A 3K0CC 1OXUA 3GQBA 3KJOA 1NJIC 1ZMXA 3C14C 1T91A 3WY9A 3NVAA 5TY0A 4P4SA 4QQBX 1E1QA 1E2WA 1XCGB 3HOVG 3Q5EA 1XXHB 2GDJA 4Q00A 2QA5A 4NCJA 5DLQC 3GTLH 2GXQA 4IVPA 4LV6A 2GF9A 1WJJA 4O3MA 4JYAL 4MDFA 2YKGA 2GCOA 2DNEA 1JPNA 1SKYE 3FKSD 4ILEA 3KQHA 1SKQA 2ODEA 2EJGC 1FP7A 3N2EA 4KN4C 3RN2A 1VQEA 2RGGA 5TDHA 2PX3A 2JLZA 1QG4A 2D2FA 3B1VA 4RD0A 3K0SA 4TLCA 4BBRG 4C0KA 5FBQB 3DOEA 2W2VA 4LC0A 5GVSA 4DC9A 4JI1L 1N3BA 5DO9A 3EG5A 3FFBA 4JJKA 4YXWA 3KLWA 1PA6A 1F2UA 4PZ8A 1UEIA 2PMDA 3IQXA 3PFIA 3MJHA 2BH8A 4DSTA 4BEJA 4JS0A 5FLMH 1N5JA 4X8OA 1N34L 4GMXA 2IS6A 1HQMC 2A30A 3KQLA 4Q47A 4ZIRA 4OWXB 2OFWA 1HE1C 3KB2A 2XTZA 5C0XH 4IOCA 1EK0A 5KDOA 3QPWA 2WTUA 1Z6XA 5JWOA 4NYMQ 2Q2IA 2J9RA 1A7JA 3UATA 4JI7Q 4JKYA 3HKZE 1K8RA 1S40A 3AVYA 3H0GH 1ONLA 1IBKL 1IXRC 2K5VA 4HI0E 4DZZA 4DLXA 1AS3A 5LD2C 3TVTA 2BBTA 2E2JH 2GESA 2RGEA 4M21A 1XMQQ 5KSPA 1GD7A 4Q03A 4YMWA 2FDCA 2NVYH 4YCUA 1GL7A 2ZI6A 1Q7YC 1FW6A 4Q4AA 1IN5A 3ADCA 1GZSA 5HKKD 4NXMQ 1E79A 4MH0R 3TVDA 3AF4A 2K5HA 2KA7A 2R92G 3G6EA 1U98A 2UZ3A 2ZRFA 5LDDC 1P2SA 1OIXA 3Q7PA 4Q1DA 3R7WB 3VDYA 5F9HA 5CDFA 1VQOA 4GKJQ 1LABA 2RGCA 5EUQB 4CEIA 1U9IC 3K9GA 1YI2A 4DXAA 3S1AA 4LK1C 2CNWA 2Q3FA 3LBNA 1SLJA 4IEIA 5DISB 4B6FA 1JAHA 2JJ1A 4MGYR 1N33L 5CM8B 2FSIA 2J5XA 4QGUA 3IEUA 4P0TA 1J8YF 2VHTA 2ASEA 1YR8A 1PH7A 3I5XA 1JQJC 3OPOA 1Z3IX 5LB2A 4IPDA 1GKHA 2WJGA 1OH7A 3B78A 2QA4A 2UXDQ 1E9DA 1TAGA 3P4YA 4DNRB 3CUEF 3L0PA 5C3EH 2WWFA 2W6IA 3FVQA 4HLQB 5G3YA 4NPHA 1W4BA 4BPBA 2IEYA 1XNQQ 1QG2A 5BQ5A 3KQNA 1GUNA 3MWYW 4JLNA 1VQAA 5LMNW 4A3MH 2TMKA 4XSHA 1PH3A 3RVBA 3PF4A 1G7RA 3KTAB 4LJ9A 3DHWC 3CQZH 1VQ6A 2PLFA 1SMXA 4PPQA 5JCZA 1PYSB 3HKZG 1G21E 1G7SA 3IIKA 1G8HA 2R7FA 3RS5A 3QXJA 2JA9A 3PEWA 3DM5A 2Q2TA 4S2EA 3HR7A 4KYIB 5C0XI 3STBC 1XX6A 1QZGA 4QJ4A 2RGXA 4LF6Q 3OIWA 3DVLA 4BQSA 5JFGA 4TT3D 2QORA 3UDIA 4IKEA 3FKIH 3HOYH 2GWHA 2J0UA 4HLCA 2FH5B 3GJ7A 2D0OA 2ZRAA 3LA6A 3V00A 1JB7A 1OXSC 4NTZA 4RFSB 2PZGA 1KSHA 1KJWA 1VECA 1GUAA 3I4MG 2H92A 3SYKA 4O25A 2YHSA 3E0EA 1PHJA 1FUKA 3M7NA 2DCUA 4JSYA 1E4VA 3X1YA 3TAHA 3S17H 1OXXK 4DR7L 3ZJYA 1Y8OB 1NJFA 1A1VA 1N6KA 5LB4A 1R6BX 1X8JA 2XZOA 2FGKA 2B21A 3CNOA 1E2NA 4MA4A 5A4JA 2DBYA 2W0MA 5EP2A 3AGPA 4A3BH 1FMJA 5AK0A 1CP2A 1PUIA 3H84A 4GOJA 3NXSA 4BECA 4CEJB 3I72A 1IYUA 1XJQA 5CLQA 1GP2A 1V5WA 1VCMA 2G0NA 2WAQE 3N70A 2FFBA 4A0GA 2GF0A 3UWOA 5JRJA 1VTKA 2BWJA 3LVQE 4ITRC 1IBMQ 3CRLC 1IN6A 3K0AA 2OE2A 2LCFA 4A3DH 1DE0A 4DV2Q 4KODA 1E2LA 4F38A 1TXYA 2IYWA 1VHTA 3EPLA 4J15A 4OQNA 2QTFA 4DPGA 3ETLA 2QE7D 5KHOC 4XVRA 3FOZA 4HAWA 1EWHA 2YNMA 5FUWA 3WRYC 4ERNA 4RMFA 4C3JH 4I1OA 4AYXA 4LK2A 2O0KA 3NHAA 4IPHA 1GILA 3CC2A 1QHGA 1RFLA 2ORVA 1BO6A 4A15A 1M2OB 1P2UA 2X77A 4EDHA 5LPNA 3U9SA 1MABB 2QP4A 1ZU4A 3PO2H 1FJGQ 3O8RA 2GKSA 3PUYA 1S2MA 1SKYB 2WSSA 1NL3A 1LS1A 3G4SA 1HNZQ 3UMSA 1NY5A 4IDHA 5B58C 4OL0A 2WWGA 4GOKA 5FOVA 1H9KA 3HU1A 4L5RC 3X2SA 4YHHL 3SHWA 2RGNA 3PENA 1F48A 1GO3E 1HT1E 2BCGY 3LXRA 2HIVA 2CWPA 1JECA 4R4CA 3CMAA 1WMSA 2ZYUX 4LYAA 5JEDA 2H18A 1CR2A 4PG3A 2A68C 3FE2A 4M9SA 4DLZA 5AJWA 2ZI4A 1BMFD 2EXDA 1PLKA 2OSBA 2R6DA 1KO5A 3I1FA 8OHMA 5JJKA 3MSXA 3U3RA 2OILA 2N8NA 1F60A 1ZNZA 4AKGA 1GJXA 2DFNA 4CVNA 4MQBA 1K6MA 1UE6A 1WE2A 2W83A 5M5WH 3CF6R 3GO5A 1E99A 1KAOA 1MO3A 1ZM2A 1NMXA 1ZIOA 2WBLC 2PNRC 1CXZA 1JJVA 4H44C 2CKZB 2WAQG 1EWIA 1U8YA 2UUAQ 1DAEA 2Z0MA 4IOKA 5DIFA 4PHHA 2CJWB 4AIIA 1X9NA 4Q21A 2PNHA 2DFKB 1E7ZA 1E9FA 4GS3A 3AUYA 2L5TA 1ZRHA 3LQRA 4L16A 3DMNA 1YEZA 4II7A 4R7ZA 5FTLA 3UDGA 1F2TA 2VRWA 1KAWA 3HPQA 1AK2A 3BJUA 1PH5A 4Q7KA 1OKKA 5C18A 5JS7A 4L15A 1KMHA 2GA8A 2QP9X 1OHHD 3W34A 3P1JA 4JBJA 1II8A 1E9AA 1KD1C 3D31A 1SVMA 2MQHA 2W2XA 4LUZA 4JKIA 3WYGA 2J87A 5KOYA 3AVUA 1KZ7B 5BN3A 3PEYA 5GAGC 1ZJ6A 4Q9JA 2CFMA 3NBFA 4MTNA 4NYIR 2RF4A 3I4OA 2A78A 2OLKA 3HP1A 1YHQA 2V1XA 3IDQA 3GTKH 1ZKOA 2GEVA 2JDID 5L3QA 3KLRA 1D5CA 4M1TA 2CE7A 2WWXA 1B7YB 2N42A 2BVNA 4D2IA 1DVRA 5A5GA 4V0NA 2ZTDA 4X6AH 2WSMA 3ND9A 1TADA 2HIXA 3AF0A 3T61A 3RRMA 1SULA 2Q3MA 2WM9B 1G8YA 1LW7A 5AWFC 4PXAA 1MT0A 5H70A 2G1JA 3F5FA 3NWJA 1KY2A 1NLYA 2O0HA 1Z28A 3FMCA 4TZ6A 1KO1A 2ZJOA 4E09A 4UP7A 2VP2A 1G6OA 3GJ8A 3TZUA 1EUJA 2H16A 3FPAA 4V03A 1VQGA 3UMFA 1W0JA 1T5EA 2P65A 4QM6A 1YJ5A 1EQQA 1HE8B 3F2DA 4GOPB 3IBYA 1XEFA 2WHXA 3OESA 1I4TD 4KHPL 3U3KA 5JEAJ 1X1SA 5KNBA 3M9BA 2QG6A 2B8FA 1Q0UA 2IW3A 3EIQA 4BE7B 5BR8L 4ESVA 2ZT9C 1QVRA 1Z6TA 3WRXC 4MYUA 4CEHB 3THYA 4KSCA 3BJIC 3HPRA 1UBFA 4LFBL 2GTPA 5GJCA 4B3CA 1IJFA 3I62A 1UM8A 2J3EA 5EE0A 3EPKA 1MR3F 1RRPA 2YOFA 3HOZH 2B7BA 1QJOA 1CJMA 1RW4A 4EUNA 1E2HA 4M4SA 2PI2E 4HIKA 1W2BA 1FX0B 4FMCF 2I0QA 3HU3A 4GN4B 1GRQA 4A3FG 3K0XA 4IHQA 3K8YA 5J47A 3A8JE 2QBYA 1OTCA 4XIGS 1LUZA 3B1YA 3SBEA 1E9EA 1YJWA 4JLMA 1Z9FA 1UEBA 2BMJA 1U2RA 2BCJQ 2GHIA 1ZU5A 2HLDD 4V02A 3CF2A 3OE7A 2CBZA 4X65L 1R9TH 4C0HA 3AVQA 1SXJA 1EWQA 2JLUA 1FL0A 2F1JA 4D6PA 2OWOA 2FFAA 1KDOA 3SR0A 4P4SB 1Z0FA 3LW8A 2CLCX 1V9PA 3CBQA 1TF7A 3U50C 4X66L 4XH9B 2WJJA 1SVIA 1Z6YA 1PUJA 3SE0A 2OQ0A 1N6OA 1WFQA 3OEHA 5H1YA 2UU9L 2EQSA 4XWKA 4PAQA 4PHFA 3RSOA 2V6JA 3GFOA 2GCOB 4JLJA 1CULC 5EE3A 3EIVA 2E2IH 1N0WA 2FMXA 4LDJA 4JI1Q 3FFAA 5JCPA 3C7KA 5F98A 3TR5A 5KU1A 3EA0A 1OT3A 3U61B 1OFHA 3I2ZA 1M34E 3FHOA 4HJ7A 1DELA 2REBA 4KI0A 3JAMc 1N34Q 1C4OA 4D4LA 4WBSA 2ZREA 3KZ1E 4B73A 1I2MA 4DT1B 2ZI3A 4W7SA 4PX9A 1F2UB 3FMPB 1E9RA 1K83H 1X6OA 1OW3B 4US0R 1Z0KA 1GNRA 2I5HA 2GVAA 4JL6A 4V0MA 5JBQA 1KZGB 2A19A 1A8VA 4C3IH 4FINA 3RDPA 2AKWB 3HYTA 4G7ZC 4G7HC 4LX0A 2ZR7A 1L2FA 4QGFA 4ZIRB 2A69C 2FU5C 5FI0B 1VCNA 1Z29A 1IBKQ 3G5UA 2ZRJA 4B33A 4LHWA 1L1OC 2W6JD 1XFAA 4B3TL 3FYHA 5FUXA 4TL7A 4I81A 1WCMH 2Z6KA 1BYIA 1E69A 4Q1AA 2N49A 3LO5A 1HTPA 3ZZ0A 2PX0A 5C4XH 1LV7A 2VUMG 2E9SA 1DPFA 2IHBA 2B63G 1P4SA 4DDTA 2XTIA 2BEKA 1E0AA 4DR4L 3U3OA 4HYYA 4JBWA 2X2EA 1GRNA 2DWQA 2C96A 4UNSA 3UWKA 4BFVA 1XWIA 4Q4AB 1E2GA 3VR1A 2OESA 4MNOA 1Q44A 2AD5A 1P62B 3R9XA 1HQCA 3U7FB 4POAA 3W1GA 1IZ6A 2QQ0A 4HR7B 1IY1A 4A3GH 1PH8A 4BFYA 1CF4A 2QPTA 1NN0A 1N33Q 2B92A 2WWWA 4UXHA 3NKVA 2IWRA 4G5OA 2IYTA 3C15C 3C4JA 3R7WA 1KK0A 3D7MA 5A35A 4DSUA 3LDAA 4JOIC 5J3BA 1XEWX 3S1AB 2OUKA 4URVR 4JK1C 1AE2A 4HJ8A 1FMLA 3AVVA 3ZLJA 1XRJA 2BE5D 3BS4A 3K0CA 1AJEA 4ZDWA 5IP7G 2JLWA 4IFDH 3LAWA 2GXUA 4ME3A 1IY2A 4QG7A 1P60A 2JEBI 4DK1A 1NI3A 3PUZA 1HZAA 4JI4L 1U99A 4MRNA 4GBMA 5CYOA 5EE5B 1HCZA 3HJNA 2ALYB 1SZPA 2OTLA 2O5VA 2A5YB 4WW0A 2IHYA 2YTXA 3HOVH 4YMSA 1I50H 4JJZA 3B82A 4GMDA 3CH4B 5GJVC 1SFOH 4LHZA 4IJLA 3T12A 3SN6A 3VHXA 1E9BA 2KJQA 2PLRA 3NELA 3T35A 4URZR 1OF1A 3CRVA 4RVCA 1FTSA 3TMKA 5TXGA 5KSOA 2K4KA 3KOJA 4DV4L 1YIJA 2EFDB 3KTAA 1KDTA 621PA 4WOPA 4XTCS 3A58B 3NE5B 3EZFA 2I5MX 1Z08A 3KYHC 4W5WA 4M8NE 1EXMA 1V1QA 2RH5A 1JMCA 1G5PA 3VQTA 2RCNA 2QRZA 4QKQA 1VYTA 3FPPA 1AN0A 3E2IA 4BBRH 2AWOA 1UF9A 3A4MA 2YTYA 4DCNA 2ZSBA 1ASZA 4QGGA 4DR7Q 1TU3A 4O2RA 1T0JB 3QG5A 2CCGA 4NCNA 2G88A 1EFRD 4Y0AA 1T8TA 3KQUA 2OQKA 4US1R 4BLQA 1DAMA 3GTMH 4IOMA 3AVOA 3F2BA 1VCOA 2V55B 4ZCLA 2PJZA 4C3ZA 1KIMA 3ASYA 1IXRA 1U8ZA 3L43A 3EN2A 4Q48A 3TK1A 4A0RA 1N25A 4IVQA 3C16C 2A5DA 4BLSA 4DR1Q 2VSXA 4TLDA 4BASA 2YWFA 1H65A 1N9WA 1E0JA 2ZVPX 2ZQ5A 2ZRCA 1XU4A 5TVKA 2ATWA 3DOFA 3I32A 1Q1QA 4G5GA 5KTYA 2FPMA 1W5SA 2GETA 3KKOA 4ASUD 3RR5A 4R4QA 3E1SA 4BA1I 1AZTA 3ER0A 3CCRA 1W4AA 3PIPA 4Q18A 1XPRA 3KDFB 1ZINA 2GRJA 1SXJE 5DYGA 3VNUA 1KI9A 4Q1EA 2FGJA 5IYCG 4I4LA 3K81C 4OI4A 1M7HA 1DADA 3E70C 2ODNA 2FXQA 2AK3A 2PZEA 4RZXA 4OI0A 3K0AB 4AKIA 1HPCA 4BXXG 1U9IA 5KUTA 1YZLA 5H1SE 4A3IG 4CT4B 4H02A 2V7QA 4MUBA 1W4CA 4DV6Q 3KJIA 1RIFA 1XXHE 3PEUA 2O8DB 1CKNB 2R92H 2D62A 2NN6G 1FTNA 2JJ2A 5IDVA 1IW7D 1Y8PB 3NHBA 4P33A 4EPXA 3GLGA 1AQYA 1CI3M 4LHVA 5KO2A 4KV9A 1UEJA 4OK3A 3MMPA 2ZS8A 3CZPA 3LD9A 2XSZD 2A3RA 2BM0A 2WMNB 4DUYL 2QU8A 1RKBA 3CRQA 3K9LA 3AP1A 4GN3B 1CBUA 4YHHQ 3CM0A 4LJ4A 5EUMA 5J4LA 2OFOA 2BBWA 4XVQA 3MUFA 2G0TA 1S3OA 3KKQA 3QPVA 1R8QA 1ANKA 4EKDA 4JYBA 5FPSA 1E2JA 3MWJA 1E1RA 4AH6A 4A3LG 1XMVA 3J81c 1UE5A 2P5TB 5FBVB 1GVNB 2F3IA 3FP9A 1R0XA 5EP4A 2GCPA 1HR0L 3I8SA 1SROA 1TWAH 3ZGXA 2K50A 1E24A 2IYUA 4D0LB 1GFIA 2J46A 4S35A 2FSHA 4CW7A 4LF5L 4AK9A 1HZ9A 2ZANA 2ZITA 4TYWA 2ZUBA 4HB2A 4OHVA 4A9AA 1G20E 3PV0A 3M85A 4IJHA 4A93G 1Q8KA 3EPJA 5AJ3L 1XEXA 2CK3A 4JI8L 5FBRB 4EX5A 3V4RA 1YQTA 1H8EA 2IF0A 3GMTA 3WXMA 2ZJ5A 2H8KA 1A63A 2FSGA 2NOAA 1OIWA 5F9FA 3OFNA 2OCBA 4LCBA 1NE3A 1G7CA 2WJIA 1PH2A 1XJCA 3QSYA 3W8RA 4JL5A 2DFTA 5P21A 3Q8DA 1J5EL 1S96A 1R5BA 1W49A 2XTNA 2OEPA 4JLDA 5D3MA 3W3AA 5SZIA 3VMFA 4QBFA 4LGMA 2QM7A 2BJWA 3AKDA 2QEXA 3I4MH 1I6HH 1CIPA 3SJBA 3DKPA 1KMHB 4XD7D 2QF7A 2BM1A 4MYHA 2CHGA 4A6PA 2ZJYA 4G5RA 3WYFA 3K70D 2QGZA 4IO9A 1II8B 3FTQA 5AJZA 4A2QA 4P71A 4C0JA 1BVSA 3BE4A 3HFZB 1FQKA 2PCJA 2XNDD 5M3MG 1S9HA 4QHTA 4JV5L 1T4GA 1VQJA 3M4PA 5DLQE 2A9KA 4Q7MB 5L3QB 3QVUA 3ULJA 3FB4A 4C2MH 4U5XA 1Q21A 3T1HL 1V8QA 4EQ5A 1KNXA 2D3WA 3GJXC 5FL7A 3ADDA 1E2VA 1GM5A 3KKMA 1XMIA 2FWRA 2JATA 1IHUA 1ODFA 3QBVA 1K5GA 4FMDB 4BZPA 1XCPA 4TL9A 5GJWC 5J5CA 1YNNC 3KFUA 1VQMA 4ZO4A 5E7NA 1G17A 2Q6TA 3EX7C 1X54A 5FUYA 3HOWG 1MKYA 3B8HA 3RS7A 4B74A 3ONWA 2XZLA 1KJZA 4B75A 3WBKA 3S16H 3OTOL 1J7KA 4KHPQ 3QXCA 2VSOA 4DNIA 5DGXA 4C0QC 3VKWA 3KXIA 1DAIA 6Q21A 5BR8Q 1J2JA 2BOVA 4AYTA 4PZ6A 4DEXA 3OIUA 3GJ5A 2EFEB 5KSZA 4MKHA 2WFWA 4LFBQ 1KI7A 4R71A 4LJAA 1ESMA 5HZHA 4LJ6A 5DI3A 2YTVA 4QHYA 2D2EA 2PL3A 3SNHA 4KN7C 5AUOB 3NC0C 1ZW6A 3THYB 2JLSA 2Q8IB 3KB1A 4NKRA 4L5QA 5FPHA
chains in the Genus database with same CATH superfamily
1R8YA 2NVTH 3GNLA 2W70A 1NX6A 3VZQA 1EWCA 4B7AA 4BY1G 3IO5A 1Z0DA 3ZDDA 4EL5A 4AJ9A 1XRRA 1AE3A 3MLBA 1WD0A 2FX5A 2C04A 3J80A 4W6QA 1ORVA 1RQPA 5DNEA 1M74A 1BVYF 1OA0A 4R2IA 3MYRA 1US8A 3ANTA 3OI7A 4XIJA 3WNBA 1DXMA 4CDFC 4JUCA 1N0UA 3TG2A 2ZUWA 2FQXA 3O4RA 4DLNA 4HRXA 1HFNA 1UJ2A 3RVLA 1LNZA 4YUYA 4R83A 3S1QH 3BORA 4E22A 1L4KA 3NKLA 4A8TA 1IEVA 2I3ZA 4AG5A 5H4GA 2F0FA 1LM0A 3EWAA 2IZ6A 2F3TA 4DLLA 1X42A 4IOAA 3L41A 5AK6A 1PXUA 4P6VF 4QDUA 4B3XA 5LZ4A 3IVGA 2F48A 5C7LO 2YU9H 1ZHFA 1OTXA 4O5AA 2ZI5A 1WM1A 5CVTA 3CIFA 2AG0A 3RVJA 3W4JA 4PG7A 2AUNA 5AP9A 1Z2CA 4C14A 2B6HA 1W75A 1TQ6A 1OIVA 1T9GS 1U28A 3FHLA 3GZNB 1W1IA 1Z4JA 5BOSA 1B3QA 4CM8B 4OQEA 1QB7A 1A5TA 4J0GA 3TN7A 1DJOA 2CXXA 1GEGA 1KFEB 1AQJA 4TUYF 2QTBA 4RCOA 1Q7RA 1HA3A 4OOEA 4GOXA 4TMFA 1U8XX 4IJUA 5BUQA 2E2HB 4KJXA 3ZW9A 3P9NA 4JT2A 2H1VA 1PTOF 3J80E 1G5TA 4UHHA 2QG4A 2WU0A 3HJAA 2W71A 3I5MA 2H2DA 1U5CA 4BQRA 5FOSA 3TDMA 1ACMA 2RSLA 3AKZA 1FMFA 2PEYA 1QLJA 2VQDA 4JW0A 2VPZA 3E9RA 1LDYA 4H18A 1E2FA 1ZGBA 1MEEA 5FP0A 2FPGA 2X15A 1SBNE 3T38A 4HWOA 2QILA 2EJMA 1KO7A 1QCYA 3BVZA 4RG1A 5D3QA 2VJCA 4NU6A 1LI5A 3AW9A 3ORHA 1Q92A 5K51A 3J7ZC 4JV5Q 3E61A 3KLPX 4FE7A 1OFGA 3T1HQ 4IZHA 4MXDA 2PLAA 3QG1A 4NOMA 2QR5A 2F64A 4YJGA 1PIWA 2VAXA 2FDXA 4J91A 4KWCA 3ZYCA 4AMBA 3NEAA 2B29A 2IY5B 5HZKA 4Z9XA 2CF6A 2D8AA 4H1TA 5KNBH 3RRZA 2KSQA 3PPXA 5AW8A 3OAAA 1A5AB 4TMVA 1LYLA 3LY8A 4UJ5A 2ORED 2HT1A 4ENUA 1SCNE 2AJTA 2ANCA 3L8CA 1HDRA 4IIEA 1W0JD 5IH3A 3K2BA 3VVLA 2QRHA 4N0DA 2J0SA 3A6FA 1XDSA 2CL0X 2V6IA 3WDSA 5KMGB 1S0UA 3NBIA 3AI1A 2KLBA 3A9RA 3HG7A 2OBNA 3M5DA 3ZZ1A 3HTXA 5JMWA 3GH3A 3FWYA 1EIHA 3K5WA 4IQFA 4H7DA 1Z8HA 4LPSA 4YRAA 1Z5ZA 3GP5A 3TP5A 1KI1A 2QV7A 1Z82A 2XWJI 5KYIA 3EXFB 4YDHB 4JT8A 1VQ8A 4LYFA 3A1DA 2OQRA 3GTLB 2NYUA 3RSQA 4MTCA 2N3ZA 4MV8A 3EAQA 1CKMA 4P4GA 4JI5Q 1AHPA 2NO7A 3A6ZA 2V3WA 1VSBA 1G3UA 5JVG3 2JGMA 3HHPA 4JZKA 4HAOA 1FDSA 1TTTA 3DZDA 2D2XA 3I45A 4LDAA 2PKRA 4HUJA 5CVUA 1UKYA 1FYVA 4BY1H 1MHWC 1XWEA 1Z62A 2VPIA 3H0GB 3OU7A 3IIMA 1SMKA 5TJ9A 5YASA 1SAYA 4AZ3A 5K0TA 2QNBA 2HAEA 1VE5A 4JBNA 3FYDA 3VSEA 4ZGBA 3EMBA 4OP3A 1TWGH 5AI4A 1RHQA 4NFHA 2P2LA 1Y42X 4REQB 3L7KA 1PWEA 2OZEA 1I5EA 3EK2A 2LY7A 3A4IA 1U2DC 4H7HA 1UKAA 3D2LA 2AJ8A 3CW2A 3CCSA 1P1KA 3ROKA 4PF1A 3KYIB 3BL5A 1JS1X 3UT5B 4MGZR 4F3KA 4FQ5A 2CD9A 2A0UA 3M6FA 5BV1A 2WIKA 3ITPA 3AW8A 2V6MA 1PZNA 2AE2A 3S28A 2O5JC 4OLAA 3RNLA 3ZVRA 5K1ZA 5T3UA 4ND1A 4A0QA 3I1YA 4M2LA 4MB2A 2I8AA 3QA9A 1IULA 5K3EA 1LTKA 3JQ9A 5T1GA 2WVGA 4N03A 3L93A 1TZ2A 2I22A 2ZW9A 2E6KA 2YXBA 2RKOA 4KYVA 3TUIC 3TW8B 5JRZA 5FWXA 2DERA 4W82A 4Z0PA 3O95A 5HX7A 1GOZA 1P8JA 3V8PA 1A72A 4URFA 3IT3A 4X6YA 5M5WB 1TZMA 2YBEA 2GRUA 1U8CB 3WV4A 1Y9AA 4X7BA 4PSDA 3MTGA 5EXSA 2D74A 1S4QA 1I10A 1IQUA 4C9BA 2QTHA 3GJ6A 3KYJB 1LTHR 1LY1A 1DX4A 1RYHA 4NYMR 5B4UA 3CZCA 3EVBA 3CIOA 4J0DA 1VQKA 2XDQB 1FR3A 1BVHA 4A1OA 1N5IA 2C5FA 5TPZA 1YZTA 4DM3A 1RQ7A 3KEQA 2GARA 3T94A 1EX9A 5C5DA 3KE9A 1SCBA 3DJYA 1D5WA 4WAUA 3WWDA 4IFDJ 3A8TA 3DKIA 4NOJA 4M1OA 1T34A 3EW9A 2DB3A 1T3SA 1BCPB 1JLLA 1XLWA 1V5EA 4M0FA 3I42A 3I3SR 2CJXA 3KJEA 1VS0A 5T4BA 1NQOA 3ZQ4A 1B42A 1Z0ZA 3UOWA 4EUSA 4M0PA 4K6FA 4F12A 4UY8C 4BCDA 4NHOA 3RVDA 3EDMA 3HV0A 3LGAA 2P2SA 5AKKA 2R6CA 5H02A 5IZCA 3RHTA 1V7ZA 2D4HA 3RS2A 3V3TA 1XQ9A 3VYSB 4FW9A 3W6NA 2C97A 2FRVA 1U2TA 4BNDB 5GMOA 4TLBA 1X1CA 1RWQA 3VTZA 2WSIA 1LACA 2N55A 1IVNA 4P32A 3J81j 1VIAA 3KPYA 3WL6A 2HBYA 1JI3A 3IMCA 4W8GA 5BUCA 4YQZA 2BA1A 2W2OA 1KDRA 2Y1FA 4Q02A 4BBRB 5AOCA 1TO2E 4OQDA 2YMQA 5HEKA 3E82A 1MCZA 3U09A 1W4LA 2AEFA 4QAJA 4F96A 5CAEA 3DLBA 2F4VB 2QE7A 3O90A 4KUEA 2PAAA 1C0PA 2I2CA 1NSFA 3C39A 5DSZA 4O2AF 4KVGA 4PN7A 4RYLA 3BL6A 3EGXA 4F4UA 1MW9X 3TBHA 3L8HA 4OXKA 2X0DA 1YOVA 3QY0A 2I4IA 4YB8A 3BZCA 3TPZA 4B82A 3OQJA 1GTL1 4DSNA 2NU9A 1KBQA 3FN4A 3BXEA 1M5TA 1CJUC 2FSVA 3H1FA 3TWOA 5K0JA 4TKMA 4HCJA 3GLTA 3PQ3A 2WP0A 3THXA 5AKLA 4D3SA 3CC4A 4OIFA 2E3JA 5A6VA 1KO8A 3HCPA 4WK6A 4IRUB 4HUTA 3LUJA 4RPLA 2JDIA 5A2QA 1TLLA 3CO0S 4UTZA 4DFAA 2GK3A 1TMGE 4A91A 3IO3A 4XYBA 4QXRA 2HGSA 2LD4A 3TSOA 3HUDA 1YU6A 1VMEA 1JJ2A 5D1NA 1RJ9B 2PEZA 4ZARA 4IQZA 4X3OA 4R9RA 5SYNA 1T8RA 2BGNA 4HGNA 4EG0A 1KQOA 4WCFA 3T5TA 4G8BA 2Q6VA 4DAYA 4EZEA 5TMBA 5A0VA 2AR7A 1VPDA 1Y1SA 3RTDA 2HK8A 4BJ5A 2O23A 1VMKA 1FFGA 2H0AA 5FULA 5IWAL 4KH1A 2C9CA 3ADPA 3KQSA 3X0DA 2FJ2A 4KQ1A 2NVTB 1T1JA 4YH1A 1HL3A 2PGXA 3TNDA 4Y2QA 2G77B 1NY4A 4A27A 5I6DA 1Q19A 5FKAC 5J2UF 3E6AA 2J4FA 4LWZA 4HAUA 2WAQB 4I55F 2ONJA 3GRVA 1XPJA 1WTRA 4B6QA 4RTQA 1D07A 2CE2X 4PYIA 4AY6A 4M0EA 1SOVA 1C7ZA 3W77A 5FPTA 4NMXB 5DBOA 1X7HA 2NAFA 3JZIA 4XX1A 1T5TA 1BU5A 5LP6C 3I3OA 3C5EA 4HQLA 2AOTA 5HOEA 4GW3A 2NVOA 3D8NA 3WLHA 5JDIA 5KJ1A 1NDQA 2R97A 1B9NA 3UHJA 3ILVA 2HSWA 1SB9A 3G59A 5IUKC 1W9HA 3FVTA 2YY7A 1LUAA 2YU9B 5KS2A 3TS2A 2ECKA 3W90A 4UP8A 1PW7A 2PRZA 3A11A 4UASA 1PR6A 5C1DA 2JGKA 2P5YA 1ZC4A 3CX6A 2CYAA 4JP1A 2G9ZA 3T56B 4B4DA 4Q4HA 3QFFA 2XQGA 4AUMA 1ONBA 3MF4A 4K1LA 3JRWA 2PUCA 2IZ7A 3B3QA 3VPXA 5FLXA 1I3LA 4DV2B 3FBTA 4GQIA 3MB5A 1E2UA 1DX9A 1CNMA 3U26A 1ORRA 1JB1A 1NJ6A 4KY6A 1VCIA 4C5BA 1WHTA 3QEOA 4PNHA 1J2YA 2VHWA 2SKEA 3JASA 1U81A 3FUVA 1LK0A 1FNMA 4EB6B 2JL1A 2WKDA 4Q7LA 3PXAA 3E15A 1SMYC 4FLEA 5GPBA 3LPDA 4LF9Q 2FJ0A 4I99A 5KWJA 4H15A 4Q1FA 5AW3A 2HYIC 4PVDA 3BXXA 3WO1A 1Y6JA 5IASA 5I7UA 2GXSA 1T9HA 4PIVA 1YR1A 2B7LA 1A9XB 1PFNA 3WNCA 3PFGA 2BI7A 3MFYA 4KJZA 1N2OA 3IJEB 4YUWA 1Q84A 1SUIA 2JGEA 3HC7A 4NMMA 4J3NA 3EZ7A 4BNMA 4OA8A 5IVIA 4EG3A 1N5DA 1WB9A 1QVVA 2YHIA 3CVWA 3EUWA 4FW8A 4D4HA 5IT5A 2J3HA 2VPQA 2V96A 4KN9S 3L6CA 3D6FA 4INAA 3HXKA 4KFUA 2PT6A 2XQJA 3LL7A 3JATB 2IP2A 1R5JA 4AKTA 4GZ6A 4AY2A 4WI1A 1P31A 2HRBA 1KXLA 3DMPA 2C3MA 2JEYA 4FLMA 2WD7A 4DKAC 3KLNA 1W8DA 4CR7A 1I5OA 4EWLA 3KJHA 3BGIA 2QMUA 3NWTA 4JUAA 1D6JA 5FHRA 3EVNA 3OZCA 4GPAA 4PO8A 1LX7A 4CMKA 1NXXA 4PTYA 2CZQA 3MJSA 4XWGA 2OENG 1SKQA 4FJ1A 1FP7A 1TZBA 2FWNA 4C89A 1BJRE 1AO3A 4B3JA 4U7JA 3H7AA 3IQXA 2B1IA 5BR7A 4JS0A 3LC2O 3DVAB 1EK0A 5FIUA 4JH0A 4R0NA 4UPVA 2O20A 4L2IA 4WSOA 1Q7YC 1ODKA 2N47A 3K6RA 3IAEA 3TVDA 3GPDG 5JC1A 1RTNA 1U2GC 3VDYA 4UDNA 4Y6PA 4HAIA 4IX9A 3K9GA 1L1FA 2OHJA 4HQFA 3F98A 1M54A 2DECA 4BY1B 4D9BA 5CCDA 1PH7A 3OPOA 5LB2A 2EJCA 2R6R1 1CCWA 4CWAA 3IMFA 3B5EA 2ZIUB 3E53A 2IEYA 4O4LF 5CLJA 3JD0A 2ZIGA 3DL4A 2QK4A 3V32A 2CJPA 1G7SA 1QIJA 4UM9D 4JOBA 4BBZA 4TT3D 2QORA 4HY3A 4KUGA 3AY3A 4HLCA 3GJ7A 3N8NA 1TOAA 3QVTA 1NU8A 1TJ4A 1RM5A 1NBOA 1A71A 1ZX1A 2RGWA 2ZUVA 4LOKA 3O8LA 4L0DA 3ET5A 4G8DA 5IYZA 1VCMA 2FFBA 3V9AA 2OE2A 2LCFA 2YYSA 4XVRA 4X5OA 3QVGA 3WRYC 1YWGO 1BO6A 3R0QA 3JY6A 3KVOA 3OCZA 1M67A 3X3MA 3UWSA 4I8XA 3AUJB 1F9QA 3A9VA 3A1CA 1E7WA 3R5JA 2AOVA 1H4SA 3DMGA 3DDNA 1RBMA 3ULKA 2ZI4A 1A04A 1TVKB 4FKMA 2OILA 2DETA 3PGKA 2IPAB 1WE2A 2PNRC 3UMYA 2UUAQ 3T7KA 5AVTA 2JHAA 1FFAA 1GGFA 3WA7A 4GS3A 1AGXA 2Y1OA 2QLLA 2VRWA 3CURA 2QLJA 1KMHA 3P5BA 2REQA 4AL4A 1MQAA 1AKTA 3HLTA 1VHJA 1GL3A 3GL9A 4P81A 3A9CA 4MPTA 2HA2A 1KLUD 5GAGC 2FLKA 3MMSA 1E7QA 2GEVA 5EKIA 1U4MA 3P2IA 4FOLA 3NWJA 2O0HA 4NV1A 1KO1A 2VP2A 2XHZA 3TZUA 4XWWA 2P79A 4GOPB 3IBYA 1OMOA 2ZSJA 1RYYA 5T6BA 2J9ZB 2B39A 3WLFA 2GHQA 2GM4A 1HZZC 3NV9A 4M37A 3EPKA 1LGYA 2FJPA 5E6SB 3UMCA 3HU3A 5WRFA 3OIFA 1RF2D 1OTCA 3CLRD 2VT6A 2JFQA 4ZVTA 3SR0A 4LN1A 1U0GA 2GDZA 3ZHCA 1V9PA 1ZHOA 2OMEA 2O8BA 1EINA 2K7ZA 2GPSA 2I3GA 2R7KA 5EE3A 1N0WA 4Z2AA 4JI1Q 2IYPA 3C7KA 5IARA 3A26A 3BCUA 4S3MA 4QEZA 1V39A 1UBJS 1PJ4A 5EIHA 3U1TA 3LWEA 4BQEA 2EKPA 1W6UA 3DT9A 3PFWO 3GJYA 4LHWA 2PX4A 3PQFA 1H4VB 4KGZA 4TL7A 4L3OA 1STYA 4TMYA 2CNNA 2X2EA 1GRNA 3LUDA 2DWQA 1ZD4A 4L85A 3SNKA 4LQDA 1P62B 1RYMA 4FB5A 3OIQA 2V4UA 2BTOA 2GN1A 2IQ5A 4JBHA 3HS3A 4A3SA 4UHBA 3ZLJA 5GOTA 3S9WA 3KALA 3PKZA 4I6JA 1A9TA 4QG7A 1UJMA 2QN8A 4DK1A 2Q5LA 4IGAA 4EGCB 1A98A 2GCIA 4GBMA 2WJPA 5TVGA 1PZEA 1NVTA 1SFOH 3CH6A 3OD1A 1H1TA 2IPKD 2KJQA 1L3BA 3TMKA 2XVMA 1FTSA 2CVRA 1WSBA 4R05A 4WOPA 3W1VA 4PHCA 4JKOA 2RG1A 2R7NA 1TC1A 1TIKA 4P3NA 4PG8A 3F2BA 4C3ZA 4U4AA 1N25A 5C8ZA 1NLMA 2BKVA 2PPVA 3UUGA 1ZH0A 3KKOA 4CMIA 4BA1I 2X23A 3MC0B 5I8PA 4YQYA 4HADA 4RZXA 1QK4A 2PZEA 4OI0A 1VHWA 4BXXG 4A3IG 4CT4B 5M5XB 1KYVA 2D62A 1CZGA 4EPXA 3CJRA 5KO2A 1UDRA 4DUYL 1XLTA 2G0TA 1X1EA 4EKGA 4WT7A 1NI5A 1HR0L 3BEDA 1V1RA 2O7SA 3M6WA 1STEA 2ACWA 3L05A 2H4OA 1G7CA 4LKOA 4MHEA 1RRKA 4O29A 4JLDA 1CIPA 2QF7A 5B55A 3WOHA 2ZBRA 3PA8A 4N7MA 2CV0A 1IB0A 1IHYA 3ULJA 4XGIA 3JQFC 3IT1A 3RH0A 3QBVA 2VNIA 1OTYA 1X54A 3B8HA 1DCMA 3AHGA 2IJ0A 4G67A 1BCPF 1GR1A 2YQ4A 1EUDB 3R3YA 4FBLA 1QQTA 4PZ6A 2CXUA 1QKJA 4TV8A 4QOJA 1KORA 3AL0C 1IN8A 1D2MA 1EL0A 2Z4TA 4PIMA 1ODJA 1OVMA 3W5CA 4PC6A 5TPZD 1BNZA 4FFPA 4L8YA 3RANA 4JGGA 1XD8A 2BEWA 2K7FA 1OBCA 3QFCA 4IF4A 3L0IB 3SF8B 5CW1A 3U7IA 4K8IA 4KAJA 4DY4A 5T6MA 1CR1A 3WV5A 1KJNA 1N2JA 2OBMA 3UPUA 2UZ1A 3TSSA 1DHTA 4DT1A 4AZ0A 4DV3B 3G6JB 1O8CA 4GSKA 2NTJA 1PWZA 4MWBA 2QVCA 3T4AC 5F1YA 1NW6A 2JG3A 1V4NA 1NUHA 3PC6A 1G9XA 5FNZA 1IRXA 1WETA 4OX9L 4WEOA 4ZDJA 4WNIA 2AQHA 2PSEA 3T0FA 3GGDA 4MAMA 3O4GA 3PD7A 2WKPA 3T54A 4UMEA 1GPWB 1RRCA 3BHMA 1T36A 4FHGA 2PW5A 4AP5A 2Q3EA 3QX8A 2O50A 1N8KA 2ZE8A 3VSCA 3STXA 4K14A 1MDFA 4JMPA 3VVMA 3ZDFA 1XF1A 3C98A 4GRAA 1QU2A 3QPBA 1RHJA 2CDNA 3QELB 1L1OA 1Z37A 1Z0JA 5DJ5A 1OI7A 4NBWA 2JHPA 4QXAA 1EFTA 1RWOA 9GPBA 2WIJA 5MN4A 4Y67A 1MIOB 1P7YA 3EJ6A 3E3XA 2H0RA 1JALA 2H8GA 2Y76A 3D02A 3RAJA 3ZXIA 4D5GA 3GCZA 1YTLA 5BR1A 4EIWA 5JJIA 3OZSA 4WNCA 3BFJA 2RD2A 1QNKA 3TQHA 2BMWA 4D74A 3L7ZC 1E3PA 3N75A 3L79A 4MJ7A 3A74A 2HHHL 3WFZA 1NY6A 1J70A 3V96A 4X8LA 3MELA 3S70A 5LL6S 4U7DA 1F7VA 2OEOA 3M6LA 5HS4A 2JEOA 2W6ZA 2JIPA 2ZTHA 2PUVA 4NKLA 3ENKA 1B0ZA 4EQZA 4DR3B 3WI7A 1GFZA 2Z2YA 3VKGA 5HQJA 1U11A 4MUHA 1ECFA 3E8SA 3KT3A 5JFTA 3MWKA 2K52A 5ALEA 1VYVA 1V35A 4A16A 1EA5A 2NVUB 1Z7YA 4D3DA 4BXXH 4A3IH 1PZJD 3NWPA 1GPKA 3D6JA 4RTRA 3NYQA 4GQAA 5JAMA 4D9JA 4B6OA 4FUTA 1CQFA 3O9VA 1ND5A 2D00A 2BF7A 5HRCA 2D5LA 3VNRA 1I94L 4TVSA 2HW8A 4DAMA 5EJ4A 3IBFA 4O5OA 4JC5A 3NJ8A 4WZBB 4PC1A 3SX2A 5EL0A 3EPRA 3EVGA 3MXTA 1YOBA 2C0QA 4G63A 1XTJA 4NXNQ 5DHQA 1RJGA 3GFVA