3PV0A

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 86
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pv0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pv0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pv0A01
3M7NA 2GZHA 4JOIA 2Z5FA 3LH5A 1QZGA 2BDOA 2I5LX 1J5EQ 2IS6A 2DFTA 1XF9A 1TUEA 1Z6AA 4LHYA 4ZKEA 1XXHE 4POGA 2TMKA 4TTQA 3ZD6A 2CVHA 4EUNA 1DAGA 4MDFA 4Q7MB 4P31A 5IY0A 1T5LA 2V4ZA 3W3ZB 3N6RA 4EPWA 1C0AA 1EFRA 3MRSA 1QHSA 2O8DA 1Z2CA 5C3EH 5CITA 1ZIOA 5EE3A 1CRPA 2V55B 1TWAH 4KLNA 3TE6A 2QUZA 4MYUA 1S0UA 3NC0C 1K8MA 2BVNA 5EXXA 2D5DA 1S72A 3KB2A 1A1VA 2KBEA 3EQLC 4G7HC 2ZJPA 1L1OA 1OXXK 1IBMQ 1NJFA 3AEZA 2KCCA 2CCKA 4YXWA 1G5TA 4TMVA 5FTNA 3PO3G 2GXQA 1W48A 1H9SB 3M3YH 2PH1A 4AIIA 1UEIA 1OFUX 3B9QA 3S1MH 2PCFB 4HB4A 2LKCA 3ZQJA 4EFLA 1J90A 3KUDA 1E2LA 1PH6A 3CD6A 1T3HA 2DWOA 2V6JA 2CWPA 1XEWX 2VPPA 4LFBL 3NBXX 3U3RA 3K70C 4IJLA 3ZJYA 2E5LQ 3VHXA 1S3GA 2QQ0A 1W4AA 4LX0A 4V0KA 5FLMH 2WKQA 3BBPA 1GOTA 4PHGA 5HZHA 2CDNA 3LQRA 4BLRA 1VQGA 1M1YE 2I1VB 3MUFA 4FI3C 4LF5Q 5D3MB 1AE3A 5C4MA 1A5TA 1GRNA 2XJ9A 4CEJA 5IP9G 3U9SA 2RHMA 4XTRA 5JI3E 4LZZA 1U8AA 4X66L 3PO2H 2NOAA 3GEIA 4JBXA 5AJVB 1E0AA 1ZP6A 4NB3A 3DPUA 4R71A 4QBHA 1B9MA 4OX9Q 4RSGA 2DB3A 4ASUD 2KBFA 4DUYQ 1E2WA 1KI6B 4JI8L 1E98A 2C03A 2YOHA 3ECCA 4Z1MA 3U4ZA 3C5HA 5LMUL 3EC2A 2ZITA 3T1QA 5FBVB 1FJGQ 2JATA 1G18A 1RE0A 1JJVA 1Z0AA 1EWRA 2X2FA 5LMNL 4DAMA 3EIQA 5GAEC 2WB1G 1P2SA 2ZVQX 3LW8A 3Q72A 4NH0A 4DKAC 4Q4JB 5E95A 4LUVA 1AGPA 2KE5A 5HTKA 1XMJA 1E1RD 2IT1A 3SQWA 3F0TA 3ZQ6A 3T61A 4DKXA 2QTHA 3OFNA 2AKWB 4Q9JA 4GMXA 5SZJA 3AKCA 1KK3A 1IBLL 1KI9A 1XDBA 4IDHA 3TSWA 2O8FA 1L4YA 2BJWA 5H1SE 2F3TA 3QVUA 4WZBE 1E1QA 2ZRHA 3OAAD 3UDFA 4IVQA 5A0FA 4IHQA 4B3FX 1YJNA 4Q00A 1Z6XA 5E7JA 5JCPA 4JJKA 1B23P 2HV8A 2DR3A 1I4TD 2IF2A 1Z6GA 3B1YA 3WMEA 2CEAA 3AVTA 2F9LA 1FQJA 4NL4H 4A3EH 4JI3Q 5J4HA 2O5IC 3E1SA 2WFWA 1KMQA 2H18A 5EE1A 1N6KA 1HTPA 4AYWA 3NBFA 2WB1E 3DMNA 1U98A 4ZPXA 2FPLA 3KDFB 1U8YA 4LV5B 4F4IA 4POFA 1K0RA 2J59A 3ZS9A 4DJTA 4GOXA 2B8GA 4LF4Q 1Z28A 4DLXA 5L8VA 4JIMA 2PX0A 3KB1A 1GUOA 1PH8A 3DLLA 1O78A 5M3MH 1LB1B 2JA6G 1QVGA 2MO1A 5IWAL 3GJ8A 2QI9C 3RS7A 3VX3A 2DUDA 2JA8G 1NP6A 5JWRA 1S2MA 3I5XA 4HUQB 2AHOB 4HLCA 4RD2A 2RCNA 2MO0A 4CT5A 5DH9A 2QA5A 2O8CA 1HQYE 3CCQA 5CJPA 2GVAA 2KBNA 1M90C 4TQ9A 2Q6TA 4JKYA 1R8QA 2P5TB 2CWAA 1D2MA 5EXPA 1SR3A 3OPOA 4IW3B 2VP0A 3HOXH 1QG2A 4DVGA 1Y69U 3WYGA 3I8SA 4M0LA 1RRGA 3M1IA 3GJ5A 3HJNA 1VQ5A 2GBLC 4TQUS 5K36H 2IYVA 421PA 4A4DA 1NSTA 2HIXA 2D2FA 2YC2C 2QSYA 2P2LA 3UK6A 3WMGA 2YJTD 5LD2B 1F2UA 2BWJA 2PPBC 1RZ3A 1A6XA 2ZRNA 4JYBA 1VQ6A 3MGCA 4F92B 5FBWB 2XXAB 4JBMA 1TU2B 1FQKA 1XTRA 4M1TA 2XNSA 4HAUA 2KJQA 1NKTA 2ZETA 1JEEA 3PUWA 3HR8A 4AI6A 3GJ4A 3M6AA 4A6XA 1FL0A 2MNAA 1OT3A 1MRSA 4BLTA 4XSGA 5C2JB 4JLOA 4KCGA 4PG3A 4D82A 3EASA 3GLHB 1YR8A 3CCLA 3CWZA 1EUJA 4FINA 4BLPA 1OHHA 4BFXA 2QT1A 5TY0A 3VU9A 3SYKA 2RHQB 1L8QA 5B57C 3K7UC 1BBUA 1Z9FA 1IJEA 4JVLA 4Z8XA 4P73A 4KYIB 4C0LA 2OFOA 1XB2A 1L0WA 4NPSA 2ANCA 2GJSA 2QQEA 4NP6A 3BRWD 3FMIA 3U6BA 3W8NA 4GP6A 5AJZA 1E2NA 1DAIA 2BEKA 1IBKQ 4BY7H 3ZH9B 4L8JA 3CXCA 1KO5A 4BA1I 1D9ZA 4MDEA 2J0SA 4PZLA 3S14H 1F48A 2UUAL 2QAGC 1KHIA 1QHIA 1YZLA 4HJ8A 3NHBA 3KLWA 4POAA 5CYOA 1O7IA 1CUKA 1GZSA 5M3MG 2ALYB 4NCKA 3S1AA 4YLGA 1OB2A 2H92A 1UE1A 1XJ0A 1Z0FA 5SZHB 3KXKA 2XB4A 4GPTA 2NPFA 3SBEA 2XNDD 1MRNA 2F4VL 3QXJA 1QHNA 4MGKR 4M2LA 2GK6A 3U4QA 3VR6A 4LDJA 1PUIA 2CCZA 4JYAL 3FKSD 3REFA 2DYKA 1W36C 5E7NA 1B7YB 4OJKA 4E5UA 1MOZA 2OT3B 1X3GA 5JJKA 3RSLA 1P62B 4PAQA 2JA9A 4M9XA 5GJCA 4DEYA 5K36G 4RD0A 3CW2C 4OBEA 3LVRE 1I94Q 3THWB 3VNUA 4IDQA 5GQOA 1SVKA 4KKUA 4QRHA 8OHMA 1KQSA 2ZSEA 4C3JH 1QZHA 1GP2A 4US2R 3M85A 2NZHA 3EIHA 1W47A 4FCTA 4PC7A 2PEYA 3T35A 1XCPA 3K09C 3KYHC 1KAOA 1KSGA 4A3DH 5IYCH 4AH6A 3U4VA 3OTOL 4DK0A 4HIOA 4MUBA 1GILA 2C95A 1YJ9A 2BMEA 3VKWA 1G64A 2R6CA 4TYWA 3IKJA 3FHOA 1L2TA 5JCZA 3K0CA 4JVNA 1JR3E 1X1RA 3H84A 5JEAJ 5JWHA 3ERSX 4AKHA 1N36L 1UPTA 1SMYC 5AJYA 1JJ7A 4C0QC 3GTQH 4LRWA 1PLKA 3RANA 4DV1L 2IK8A 4ME3A 4EFNA 3EW9A 2CJWA 2AHOA 4HUQA 2Z0SA 4BY1H 1FX0B 2UXDQ 5JEEA 4F91B 4JT2A 1G8YA 1H9RA 1Q8KA 4X62Q 2CE2X 3MXUA 4ZIRB 5JECA 2W0MA 2X1VA 4LC0A 1DO0A 2YV5A 4URYR 4OQLA 5L3SA 2F3IA 4B3MQ 2N46A 4L5TA 2C9CA 1QZXA 4Q1AA 3CH4B 1CJTC 3EAQA 4PC3A 2ODEA 1KJWA 2YTVA 3KFXA 1K5GA 1G8HA 3LXRA 2EXDA 4WXRA 1W44A 1PH4A 1YR9A 2R92H 1VYVA 2KWIA 2DWQA 3I4NH 2I5MX 1K8RA 3CONA 4JKIA 2OQ0A 4KSCA 4G5GA 4H1VA 2EIFA 4MYHA 5FUXA 3VFDA 3HOWH 4IXMA 3K0FA 3RS5A 3WWVA 4LFAQ 1YNNC 2ZYUX 1XFAA 4NZYA 1B0UA 4OL0A 4MKFA 2ZIAA 3SJAA 2VP6A 4IEIA 1E32A 2WIBA 1NBWA 1AJEA 4A4IA 1QF9A 1OH6A 4JI5Q 3JZMA 1TMKA 1Z08A 3CWQA 4NYJR 2NIPA 2F9MA 2FEOA 3KKPA 4TMWA 2BA0A 4LBZA 3FHCB 4LJAA 3EPJA 1GAJA 3S1NH 1E9EA 5JHHB 1EOVA 4A3KG 4LCBA 4A0RA 3WNCA 2WICA 1GSIA 5FPHA 3FWYA 2OAP1 4BFZA 1XTJA 4J0QA 2UZIR 4W5HA 5F9FA 2RF4A 1RIFA 5IYCG 2BC9A 3TSOA 1ANKA 1XMOQ 1NBMD 2NPIA 1VQJA 1EX7A 4LF7Q 2GCNA 4F38A 4A93H 1N25A 4LF6L 4GSYA 3SYLA 4U7DA 1HT2E 3I3SR 2OFWA 1IHUA 4BBRG 2BBWA 4KSBA 1E9DA 4YWKA 2A30A 2ONKA 1KSFX 1XNQL 4BFSA 4DR3L 4LSGA 4V03A 2EWVA 3BC1A 4Q4LA 3VDYA 2QEXA 1DAKA 1G21E 3CCUA 5C0XJ 4QC2A 3QEOA 2VSOA 4DUGD 3DOEA 4M4SA 2W2XA 4M1KA 4ASUA 5DGXA 4DSTA 4DV7L 1LS6A 3I56A 2CHVA 3I32A 5EE9A 2Q3FA 4DV0L 1AKEA 1EFCA 2CL6X 2VY3A 3DEFA 2P6RA 3RRZA 4IRUB 1CULC 4G5OA 2F1IA 2EJGC 1KXLA 2HHHL 3AQQA 1KY3A 1Z0IA 1W0JD 1I6HH 1E1RA 3PFIA 4DDUA 5GROA 2R7ZG 2F6RA 3Q3JB 2FU5C 1UKVY 4FMCF 4URVR 1NTGA 2VLIA 2V4DA 3FDIA 1IXRC 4LV6A 3UMRA 4JI6Q 3AVOA 1KD1C 1PH5A 3N2IA 3PQCA 2L15A 1GM5A 1R0ZA 4GP7A 3AGQA 2HXYA 3R9IA 2JLWA 3GLHE 2DWPA 5F2EA 3MWKA 3OHMA 3QENA 2VQSA 3K9HA 2V1CC 2CVFA 3NBHB 4B3SQ 2CCGA 1T3LA 2OLJA 3EZ2A 3QXSA 5KO2A 1N6LA 2E74C 1K8OA 1IL2A 1DADA 1NMYA 3B1ZA 3KDSE 3QXCA 4MITA 3SBDA 4GL2A 4LFCQ 2CLDX 4TLBA 4AYBG 5G3ZA 4EPYA 1XCMA 3CKLA 3DZ8A 3M0EA 3W90A 4JSTA 1JNYA 1GRRA 2J87A 4EJSB 1XMSA 1Y1WG 4A36A 2OQKA 2RGNA 2IYSA 4RKEA 1IQPA 3QG1A 1N0UA 3THOA 2R6GA 1DAMA 2E9SA 6Q21A 4A2QA 1DS6A 1G7SA 1KO8A 3QBTA 4XVUA 1ZD1A 3EXAA 3A7LA 4Q21A 3A4LA 5DO9A 3SR0A 1SROA 4X65Q 2Q8IB 3A8JE 1JXMA 2R6AA 4IOLA 2HXSA 2XX3A 4P4SB 4V0LA 3CQZH 4NYMR 5IYDH 1ZCBA 1N6RA 4Q9LA 1PV4A 1K83H 3GTPH 1G7RA 1GG2A 1I50H 4JV5L 5KNBA 2O0HA 3GPLA 1LM0A 1VCNA 1DGSA 1QHHA 1E79D 5KPDA 2F7SA 1KMHB 3PENA 4UXIA 1E9BA 2IXEA 3CR8A 4IVRA 4M1WA 4AYBE 2UUBQ 1G20E 5JSZB 4IFDJ 3CX8A 2BH8A 3CNOA 5HGQA 1YZUA 3AF1A 4AD8A 3GMTA 4NDZA 4DR7L 1ZMXA 3P32A 3T1VA 2VL7A 2R2AA 1P4SA 4DIEA 3GTOH 4NPHA 2GEVA 4RVCA 2JXMB 3K81C 3B82A 3GCGA 2IXFA 2OBLA 1GKUB 4R4OA 1DE0A 1LVGA 2VQEL 3C4JA 4PR0A 1UE7A 3MJHA 5CK4A 3TUJC 1HR0Q 5BN4A 3SC3A 5IHPA 2WWHA 3SDZA 1KY2A 1K6MA 2IX0A 2NVQH 1C4OA 1TQDA 3THXB 4JL6A 2BHRA 2NZ8A 3VX4A 2O8BA 5TARA 2P67A 4A3JG 4TN1A 3VHLB 3D6TB 4K0KQ 2ZYVX 4HAYA 2AFHE 3C16C 1S4QA 2GJAA 1YJWA 4IPGA 4KV9A 2CLSA 4P74A 4HLUC 2EYUA 1K73C 3NKVA 1PUJA 2VS1A 2ZJZA 1Y8NB 1U99A 3CPJB 1ZUHA 4Q4HB 4DV6Q 1WA5A 1G3RA 4O0MA 4RD1A 1FFHA 5FLXc 3S1QH 4YCWA 4XD7D 4JLNA 1GFIA 1TWHH 2ZUDA 4P33A 1Z5ZA 2H1LA 2OBNA 2O5JC 1IM2A 4XWOA 2ZR0A 4P75A 3PUZA 1E1OA 1PLJA 1XTIA 4AIMA 2Z0MA 4PHFA 4ESHA 3WDNA 2AKAB 1Y3AA 1NMZA 5JEAG 2PQAA 1WI5A 1XXHB 2PL3A 2XNDA 3CF0A 3QKSA 4HDCA 4WOPA 4Q19A 5JMTA 5K8LA 4MRPA 2GZAA 4GBMA 2NN6I 1XNRQ 3FKSA 1N5LA 1HNZL 5FI1B 4A3MG 4LHVA 1IY1A 2FDCA 3TAHA 3H15A 2FEMA 5FJ8H 2YWHA 3TUIC 1T8TA 4K8OA 3EPLA 3MWJA 1QRAA 1NJGA 5E7IA 5E7MA 1BYUA 4D4LA 4BGDA 3QF4A 3HOYH 3NHAA 2IHFA 1CKNA 1K8GA 3CZQA 4LHXA 1NL3A 4JI0Q 4GNKA 4NYIQ 5J5CA 4GOPB 1YZNA 3MD0A 1M7GA 5AK0A 2V54A 3CIOA 1M7BA 4NCHA 1BMFD 4PFSA 2ZTCA 4HB2A 1WDTA 3VR5A 4DT1A 2Z4RA 2ODWA 4OXPA 2A19A 2QNRA 4G1UC 3RS4A 1G17A 3U44A 4PV1C 1WJJA 4UP9A 2HDNB 2P6UA 2XEXA 2ZSAA 4URUR 1J70A 2RGBA 3U3JA 4D0LB 3EIEA 4OK3A 5FOUA 1WFQA 3CF5A 4WXPA 1JECA 2VO1A 3TMKA 4JI4L 4A0GA 4BLQA 2B29A 2R7DA 5IYBG 3A37A 3RABA 1KGDA 1KTVA 1QG4A 1RYFA 5FOVA 2PMKA 2VH5R 2K75A 1W46A 2ZREA 1CTQA 3M4YA 4OO1G 4FWTA 2HCBA 4LNQA 2AL7A 1E9RA 4EX5A 3O8CA 3CMEA 2VQFL 3SOPA 1WB9A 1OXTA 4DCUA 1JBKA 4HAWA 4HDQB 1QVRA 4GKKL 2O8EA 4B3TQ 4OI4A 1XP8A 1Z6TA 3ZVRA 3TIFA 2QGNA 4JLJA 3BORA 4G7ZC 1ZVQA 3AF3A 3X1YA 1W1WA 4M1YA 3J7ZC 4DR1Q 2E2HH 4OHYA 3UE0A 3TGPA 2GXAA 1L2FA 1QVFA 2J9RA 3NDBB 5JSZA 5FPKA 2ZI9A 4LC1A 3I72A 5GJVC 1Y1VG 4WIAA 2C04A 2X8AA 3K70B 621PA 1HT1E 3TLXA 4JSYA 4GNXC 2BBTA 3AVPA 4KJZA 5HKKD 3J81c 2O8DB 1RVDA 1Q0UA 4NE2A 1SXJC 2Q21A 3D31A 1R4AA 3IQXA 4A3GG 3I55A 3GTLH 3J81j 1DELA 1DEKA 5LB2A 1YZGA 1L1OB 3K9GA 3X1ZA 2RKOA 2QTFA 3WP1B 1IY0A 4QNMA 4DV3L 2C96A 4IDNA 2QEQA 1SE8A 2NO7A 3FMCA 3BS4A 3HU3A 5EZ5A 3WRYC 4KITB 3NELA 4DCTA 3THXA 3BH7A 2XOKD 4JBJA 2PCLA 3WRXC 1HZ9A 3IRBA 2GRJA 5A35A 4LHZA 4PC6A 3RYTC 3CCSA 3WHKA 4Z51A 3NENA 1EFWA 5CYPA 4C2TA 4YONB 1EFUA 2G3YA 3BWDD 1HEIA 1T5IA 3EZ7A 1NBMA 1TWCH 2JDID 3UMFA 3W8RA 1X86B 4BFVA 1N32Q 2NVXH 2AXNA 3KJEA 2ORIA 4OHWA 4TMZA 4DEXA 5A4JA 4D25A 4Q01A 4LBWA 5JJIA 2Y8EA 2NTYC 3PUXA 1K5DA 1GVPA 3KUCA 1ESMA 4C3IH 4Z8YA 4URZR 1XRJA 2AFIE 1G6PA 2J7PD 4CEJB 1WF3A 1OSNA 3C7KA 1ZM3A 3FFBA 3H2YA 3FTQA 4DNIA 4JG2A 2QRZA 1UBFA 1HNWQ 1RIPA 1XWIA 4X8HA 4XSHA 3D3QA 4DUGA 3CLVA 1JAIA 1GVNB 5TB5A 3LXXA 4U02A 5IF9A 3GLGA 4P4UA 2B8FA 4TQAA 1SULA 3C14C 4R2IA 2VNUD 2RGGA 1Q1QA 4JBYA 2QM7A 1Z6YA 1VF5C 2UXBQ 3U4QB 4L15A 3QVVA 5KU1A 5AJ3Q 4TL9A 2BH2A 3PO3H 1GUSA 1W0JA 3B7GA 4A8JA 1NY4A 4JL8A 3KQKA 2ZJRA 4G5RA 2GF9A 3H1TA 3G48A 1P9RA 2BKEA 1XJQA 4DLRA 4H0LC 3OOCA 4O2RA 3GTJH 3TRZA 1D9XA 1SVOA 3RR5A 5P21A 4I7ZC 3AKDA 4LF8L 1JJGA 1E2JA 1E2IA 1LW7A 1NF3A 2JJ2D 4MYCA 2DFNA 1VQPA 1N5JA 2O8FB 1G51A 4D4KA 3GLFA 3A4MA 2KENA 4IEEA 3TH5A 2CHGA 2EFHB 2WV9A 1XMQQ 2G77B 4IDPA 5BN5A 1Q12A 1UF9A 4UY8C 4Q4AA 3VAAA 4IFDG 1VQ7A 1I5FA 3K0XA 1NBME 2HYDA 2J3EA 5IP9H 2NG1A 5AJXA 1NG1A 4A3BG 2YYZA 2BM0A 2JEAI 1M8PA 4QJ5A 2G0TA 2ZTEA 3JC66 4XWAA 2IYWA 3A5UA 4GLXA 4V02A 2IYRA 2ZEJA 1X1SA 2GWHA 4RZ2A 4TLEA 4OHXA 1GHKA 4DDVA 3ADBA 3T34A 4HDOB 3RNUA 4CF7A 3SFZA 1E2DA 5FUVA 5JWOA 3NEYA 5DLQE 4GMDA 1E0KA 4FDBA 2XITA 3ZDQA 2MQHA 1NN0A 3LBIA 3FFAA 5DI9A 2J0VA 3G82C 3PITA 2DPXA 1IAQA 4C0BA 2A7QA 2QE7D 3PEWA 1J6QA 2BBOA 5CLQA 3PEYA 4NXMQ 4HJ5A 4W7SA 2ATVA 3QF7A 3M4QA 5TXGA 1VF7A 2O8CB 5DHAA 3U3KA 1Q3TA 2JE6I 1ZM9A 2PMDA 3OYYA 4OX9L 2KCMA 3AKEA 1TWFH 4DUYL 2N1BA 1E79A 2XZLA 3A1WA 4QGAA 1FTSA 3WBKA 4A2WA 1KNQA 4OQFA 1XNJA 4CZ2A 2XB2A 1S8FA 4PXAA 4KMUC 2OLKA 1Z7TA 2VEDA 4JI7Q 2HUPA 3D8BA 2V7QD 4L5SA 1VQEA 1XTDA 2A6EC 3I4OA 1JB7A 1H8ED 2CXXA 2DFLA 4M8NE 4M1SA 4P0TA 4Q47A 1F2UB 2BV3A 3DOFA 5EE0A 2GAAA 3NEJA 4LPKA 3CPWA 2A5DA 4IFEA 3F2DA 2VBCA 2HJGA 1G7TA 4MNOA 1CRQA 3QXHA 3GLFE 1XMIA 2IS1A 3U50C 2VHUA 1PH1A 1UKYA 3QG5A 4DBLC 1GO3E 2CK3D 5F9HA 2W6JD 2J1LA 3QOFA 1Q1EA 3RN5A 3I4LA 1E99A 4APVA 3GO5A 5EP3A 3RLNA 4WJ4A 1VCOA 4PO1A 2ZM6Q 1U0JA 2ATWA 2GKSA 2WBLC 4DDWA 4JI3L 3PGZA 2JA6H 1OW3B 4XJXA 4DR2Q 3KTAA 4DB4A 3ZVNA 3FGNA 3VU9B 2JA8H 3R7WA 1E96A 1R7RA 2J45A 4JOIC 4DLUA 3I2ZA 4JC0A 1G8PA 2AN9A 1AH9A 2ZJBA 3KJGA 1NE3A 1R8SA 2ODBA 2G9NA 2XTZA 1KIXA 2JASA 2CE7A 4OYHA 1JALA 2V3CC 1NG9A 1IN8A 1IY2A 4GKJL 2BIFA 3B85A 4JI2Q 4HIKA 4XD7A 1YBYA 3CC4A 3MXNB 2ZJAA 3MMPA 4N0EA 2C8VA 3OF5A 3U61B 4CGZA 3W5JA 4D6PA 5IK2D 1PH2A 1S40A 1EFTA 2ZI3A 3NH6A 3T12A 3S1AB 3BH6A 1W3SA 1R6BX 2D4HA 4II7A 5J4KA 1J2JA 1EX6A 3OIUA 3A1VA 3NWJA 3LX8A 2D0OA 1G6OA 1KL9A 1KC8C 2ZPTX 4M22A 4Q5IA 821PA 5FTLA 2FN4A 2MMGA 5F98A 2EQSA 1IONA 1DCZA 4A6PA 4MKGA 2FH5B 1CLUA 4X8MA 4KN7C 3UMSA 1R0XA 2VRWA 1VQNA 1Z06A 3TKLA 3O47A 1HH2P 2G1KA 3RSOA 3T15A 4RMFA 3HU1A 3EBEA 4KVAA 1SMXA 4R9UC 3WY9A 4BRWA 2MSCB 2VSFA 1XD2A 1ZUIA 4P32A 4QG7A 3TUZC 2GETA 2IX1A 3R8CA 3GFOA 5DN6D 4LWCA 4DR6L 2VTKA 4F4CA 1KI4A 1Z3IX 3DO6A 1GKIA 3CF6R 4R4QA 3ZJYC 2HLDD 1N9WA 1LF5A 4GN3B 1G6HA 4AWXA 3UG6A 1XPRA 3SJCA 2NO9A 4BLOA 4D80A 2N78A 1SHKA 5FH9A 2OCBA 2V8OA 3UG7A 4CW7A 2EJFC 1D2EA 1ETUA 4HJAA 2WTUA 4DWJA 2KCTA 1AZSC 2R44A 4DV5Q 2JLXA 1RRCA 5G3YA 4A3IG 4QOSA 4F4JA 1MIUA 1G4UR 2AUJD 1KO7A 1VIYA 1ZBDA 5IE8A 5B30A 2YTYA 1SVIA 2VHQA 2ZM5A 4FXPA 1H8HD 4LFBQ 3EC1A 3R9XA 1BBWA 5CDFA 1GITA 3LLMA 3IBYA 3TRFA 2IYUA 3VMFA 2CJWB 3JVUA 5UKDA 3AYHB 3MEFA 2QN6A 4L9WA 1G41A 4W5JA 4QM7A 1W7AA 2ORVA 3CR7A 1VQCA 2GILA 2GXUA 4KI0A 5L3SB 1E7ZA 4AKEA 3GLIA 2A8VA 1FZQA 2H5XA 3HOVG 2ZE5A 3AUXA 1WBDA 1YITA 3KXIA 2N3SA 3HOUG 3GTKH 1D2NA 2LXJA 4X66Q 1VQLA 4MQBA 3UANA 5TV2A 4ZCLA 2GCOA 4BPBA 2OESA 1VHLA 4MRRA 1E9FA 4DCSA 1ZAKA 5DYGA 5HKKA 1M34E 3BE4A 4P4TA 4MH0R 1R0WA 3QE0A 4LF9L 4V0NA 4JI8Q 1ZRHA 3L0OA 5LMUQ 3EN2A 1E2PA 2OE2A 1KI8A 2R6DA 4FN5A 2QSZA 3K0FB 2OSBA 3W1GA 5LMNQ 4KFSA 2GN5A 4OJQA 2QAGA 1JJ2A 4IOMA 3E70C 1II8A 3HYTA 5FR1A 3REGA 1I94L 2J46A 4TZ0A 3VR4A 1NVVQ 2PCJA 4QFMA 4JYCA 1E2HA 1GUGA 5EAYA 2AWNA 2VIIA 3EA5A 4LYFA 4Q02A 4Q1FA 1DARA 2XOKA 3F2BA 2OFXA 1VECA 4RZUA 2QG6A 3UWOA 5FOXA 5FUYA 1U81A 5GAGC 1K9MC 2EU8A 2A6HD 5K8TA 3W6NA 3NE5B 1W2BA 3IGFA 2Z43A 5JS8A 2ZJQA 1DD2A 2VSXA 4C7OA 2FGJA 2JDIA 3PXGA 4B47A 3SGIA 4YMUA 1N5KA 4ZV4A 1PFSA 2CNWD 4RFSA 2UXCL 2HT6A 1XTQA 4L5RC 3HGBA 3QQ5A 5G53C 2P0EA 1Z8FA 4A1FA 2Q3HA 2QORA 3CW2A 4DNRB 1JAHA 1DAHA 1YEZA 3AP2A 5CDFE 3WXMA 2J7PA 3ICEA 2QZ4A 4HAZA 3ZS8A 2Z6KC 2VA8A 1CSQA 4C2UA 3NG1A 1TADA 4MKHA 2EJMA 4FMCB 4X62L 1WQ1R 1X6OA 2Z6VA 4QJ4A 3GLIE 4LUZA 4GT1A 4ACAA 4A76A 1M6NA 2GEUA 3KLRA 3LD9A 1YI2A 3Q9LA 4LK2A 4XWKA 5M04A 5DHFA 3G4SA 1VQOA 5IWAQ 3QEJA 4QHYA 3RNLA 1SLJA 3L8YA 1FVIA 2YWEA 3V4RA 3UKDA 5EUMA 1QVAA 2FX3A 5AJWA 1UBEA 4JL5A 1FUKA 1ZUNB 3D7MA 1ASZA 1G19A 1I2DA 1N0WA 4I81A 3ZGXA 2OXCA 4M9ZA 1XD8A 1W4CA 4DCNA 3CH5A 2B8WA 4AYTA 3BXZA 4A3KH 2REBA 1XZPA 4QJFA 2GXSA 3U7GA 4NCIA 3QNUA 1I6VC 4LFAL 1EQRA 4M9SA 2JJ2A 2ZE8A 4TSFD 5B64A 3GJ6A 1NNEA 3EIVA 3IBGA 3OE7D 1ZCAA 2QBYA 2K4KA 1GKHA 2KHJA 3ASZA 4UNQA 3K9NA 2GNOA 1P75A 4I4LA 2AXPA 3HDTA 4WZ6A 5EXSA 2F1HA 5KUTA 1NN3A 2RAPA 4LUOA 1H9KA 1HTWA 4BBRH 5FPSA 3FMOB 3K9LA 4D0NA 3ZD7A 2IWHA 3L2PA 3PIRA 1OLOA 1E4YA 2ERXA 4D4MA 3U6KA 1KSJA 3IIMA 4PSKA 1VQ8A 4DLWA 2WJIA 3QJYA 1XMOL 1LYLA 1SXJD 1V43A 2QU8A 5M3FG 1WRBA 3MSXA 1SRUA 2YINC 2XTIA 4D2IA 1KI3A 1IXSB 4DR5L 3KOJA 1CF4A 4CEIB 2EYQA 3RS3A 2RMKA 4GZLA 1XPUA 2QL6A 2ZRGA 2ZS9A 2NO1A 4B73A 4DSUA 4RKFA 2QP3A 3W6PA 1NVXQ 2E76C 4H13C 3AFQA 1XTSA 3S24A 1XZQA 1FOEB 2YWFA 3S2DH 3BFVA 3NTUA 4KU4A 4LI0A 3N5CA 2P65A 2JIZD 3HWSA 2R7ZH 5EXTA 4OWTB 1LS1A 5C18A 4NKRA 1PJRA 4YQFA 4HZIA 2EFEB 2CFMA 2VL6A 2OCAA 2O0JA 4B6EA 1QHHB 1U9IC 2PBRA 1GDDA 2PX3A 3NXSA 1N33L 2A5YB 3L0SA 2V7QA 5CB6A 1H8EA 2ZAMA 2Q2TA 5IP7G 1MT0A 2H17A 2FSFA 2OWOA 2F4VQ 2IYQA 2P6NA 3CRVA 3FYHA 4RD3A 1I4LD 3LWUA 2GA8A 4D81A 4AQYL 2Q2UA 2GJKA 2GVZC 2XTNA 2CK3A 1TQ2A 3K0CC 1IW7C 4TMXA 2W6JA 2D74A 5FTJA 3Q8DA 4UP8A 2F3RA 2ZRDA 2D0PA 1Y1WH 1I2MA 1XD9A 4JVSB 2ZI5A 1UE5A 4EQ6A 4UNNA 3MG9A 2WJHA 5JRJA 2F55A 3EPHA 2IYTA 2FF7A 1B70B 2I3BA 5LPNA 3JZAA 2JLZA 3AVVA 1T4GA 4UQOA 1NN1A 4N0DA 3VR1A 4LFCL 3B78A 3IHLA 4IFBA 4QGUA 2R93G 2O8BB 1W0KD 3OTOQ 1KO1A 4RZXA 3EZ9A 4Q9IA 3NIBA 3AGPA 1S1MA 3U7EB 1XTKA 4A3FG 4B3RL 1N6HA 3MLEA 5J4YA 1NJIC 2V9PA 1VQIA 1ZD9A 2W00A 1G1MA 4TKOB 3L8ZA 4DC9A 2CMKA 1VYUA 2XTMA 2IA5A 2W2VA 3B6EA 3F3YA 4PX9A 1N36Q 3RC3A 1SKQA 4NYJQ 5JEDA 4HJ9A 2IW3A 5IK2A 3RLFA 3DM3A 4DV1Q 5LD2C 3CMAA 1LY1A 1RFLA 1VMAA 2G88A 3K0AA 4Q48A 4LWZA 4LYHA 3TZUA 4BEBA 1Y8OB 1Q81C 5KSPA 2PQAB 4RY2A 3RRYA 1A2BA 1JT8A 2FPKA 3QKSB 5B58C 2NZOA 5LDDC 3A1UA 3IPXA 1NMGA 3IEVA 2QF7A 1TEXA 5AUQA 3I61A 4DPGA 5J3BA 4HAXA 3T1HQ 4BASA 3TS0A 2KI5A 4ACBA 4Z54A 721PA 3FHTA 4QBFA 2QMEA 3P27A 1Z0DA 2BE5C 1LV7A 4KHPQ 2WHXA 4L5BA 5FFMA 3J80c 1YR6A 5DN6A 3WMFA 1CKEA 3OAAA 1AQUA 1CU1A 3QF4B 3T1TA 2HLDA 3DM5A 1CKNB 2XZPA 4DLZA 1NI3A 1YZTA 3HR7A 4QGFA 1NMFA 4KBGA 2E1RA 3J7A5 1T91A 3FKQA 4A3JH 3ZIAD 4D0GA 5KSYA 1DG3A 2OG2A 4WAUA 4DT1B 4DZZA 1EWIA 1OJLA 2RHSB 1G291 3W6OA 1FR3A 4M1OA 3U44B 3LDAA 521PA 3TK1A 5KDOA 1QUQA 1S3SA 4HB0A 3A74A 2EFGA 2ZJOA 4Y0VA 5FTMA 1DVRA 2K50A 1MJCA 3CRRA 5EP1A 1TL7C 1TUIA 2A6ED 1UDWA 4CEIA 3PCOB 1G8FA 2UUCL 3NVAA 1H8HA 3GEHA 4KHZA 4K0KL 3EPKA 3A58B 2GVBA 2OCEA 4KYUA 4QKQA 2VP4A 1YHQA 1J99A 1IYJB 5JEAH 1NIJA 2D7CA 4DV4L 2IWRA 3QPWA 1OKKD 2BMJA 4TLDA 4EAQA 2MFIA 4DV6L 4R4IA 4JLVA 4B76A 4UXJA 2WJJA 2DCUA 4A3MH 1P9WA 3ZZTA 1M1KC 1F2TB 4D4JA 4DCVA 5GADC 2VUMG 1Z29A 2ZSBA 4JLPA 4BE7B 2YOGA 4DLYA 4OQXA 4DR3Q 2LWIA 5AUPB 3K0SA 3B1WA 4MRSA 3GFTA 4G01B 3A0JA 3J80i 2R9VA 2XJ4A 3OIVA 4NCJA 1AN0A 3T51B 4YHHL 3T1OA 2KB0A 1MJEA 3GTGH 2A5JA 4A82A 4O3MA 4F7WA 4CEHB 5FOSA 1S3OA 4DV7Q 4S35A 5KTYA 5A5GA 2DGYA 3A4NA 4NXNQ 4A0FA 4DV0Q 5J4LA 1N6OA 2MSDB 3CUEF 4L8GA 2QAJA 4IPCA 1KO4A 2WMOB 3RZOH 4XVRA 5KNCA 2KSQA 1KSHA 5L3QB 4A3LH 3I1FA 2JA1A 3CPHA 5GADl 1D7QA 2WJYA 1GL6A 1GWNA 2JA7G 1SVLA 2C77A 2J0UA 4HATA 3BZCA 2G1JA 4IKEA 4TMKA 4UJ3A 4YCVA 3DKVA 3I5YA 3SU8A 5IYBH 3HU2A 4KFTA 5DNYB 3PJRA 2ODNA 4PC2A 5CIQA 1AZTA 4IDOA 3J81k 1KK1A 2PZEA 1QDEA 4OO1H 1ZC4A 3KKQA 4E09A 1P2TA 2P5SA 2CNWA 5C4GB 4EKDA 3THYA 4Y0AA 1DAEA 1KDTA 1Q20A 3TEHB 1GNQA 1VDZA 2ZRCA 2BCGY 3QIAA 2Q9BA 1HZAA 2ECKA 1DPFA 3IEUA 1MABB 3CPEA 4LYAA 5FPYA 5K8UA 1T9HA 4LJ8A 3LGJA 4PZ7A 2WWWA 4HIDA 4QHTA 3IO3A 1AQYA 4ZDKA 1F5NA 3HKZG 4DLVA 4JT4A 4B3BA 2QMHA 4LK1C 2DNCA 4ARZB 1T5EA 4DR4Q 3N2EA 5HE9A 5JJLA 1Y1VH 1GJXA 1N34Q 2NO0A 3SQXA 3O8RA 1ZKOA 4A15A 4YWLA 4OONA 3CNNA 5EUQB 4B3GA 1GD7A 1XEXA 2BMFA 4E03A 1G9XA 2GJ9A 1EG7A 3GLGB 5EQTA 1T6NA 1FL9A 2JAQA 1SVMA 4OGQC 3CCVA 1OXSC 1NRJB 2YZ2A 3CP0A 2JLRA 4A3GH 221PA 3ASYA 1WYDA 2BKUA 2QP4A 4NTZA 1CTMA 4C30A 5CLLA 4NYIR 3WNDA 4A8JB 4ABYA 3BB1A 1HCZA 1X56A 4JV5Q 1BH2A 4AKIA 1R10A 4ZDIA 1MH1A 4TSFA 4CVNA 2C5LA 2H57A 4BZXA 3FVQA 1ZM4A 1CI3M 3HKZE 4GRAA 2WWGA 2W0SA 3BJIC 3KJIA 1ONLA 1GUTA 5FBLB 4AG5A 1QHXA 2GHIA 3P4XA 2BA1A 4QY7A 4BXXG 1CR4A 2FG5A 3NDPA 1QVCA 3GLFB 4IVPA 2B92A 3PUVA 4YY3L 3PSIA 2JA5G 4A3LG 3ND9A 1U8ZA 1GIAA 3G5UA 4HEJA 4EPVA 5TMPA 2PJRA 3BDOA 3CCMA 2ZTDA 1KYIA 4LV8B 4Q4AB 4ALPA 1MR3F 1J8MF 3EZ6A 4GNXA 5BR8L 2VQEQ 1A82A 2WSSD 3IIJA 3LRPA 3KL4A 4P72A 3IQWA 2IUTA 2OCPA 2QM8A 4Q7JB 1TF5A 5LB4A 3TVTA 2B63G 3I8XA 1PZNA 4OK6A 1CS4C 2VHJA 3RLOA 3T5GA 4HI0E 3EWAA 2LXKA 2V1UA 1IN5A 4FMDB 5C44G 2QTVB 4L16A 1IN7A 1F2TA 3B5JA 2AK2A 5CM8B 2D2CC 3ADCA 1ZU5A 2ZRPA 2CW0C 3NBYC 1AS0A 1WE2A 4PZYA 3AF2A 4PTLA 4KKTA 1E3PA 1G5RA 4KLZA 2RGAA 2QPTA 3F5FA 4OK5A 2XZOA 1TKWB 2CLCX 1ZYRC 1FW6A 2ORWA 1GTVA 3Q7QA 4TL7A 2O5VA 3L0PA 4UNSA 3ZVLA 1XX6A 1E22A 3KFUA 4MGZR 4CEHA 3CRLC 2IYYA 4Y7NH 3E9IA 3S2HH 5BN3A 4GZMA 4DNTB 2PNHA 4JLAA 1E9CA 3DM9B 4LOAA 4C0AC 1YVCA 2I4IA 4JI1L 3RWOA 5C0XG 3R20A 3KJOA 4Q9HA 4EQ5A 2FWRA 4PAOA 2ONJA 4C0KA 2E8GA 3W1BA 5L3QA 4DB2A 1AIPA 2A2ZA 2OV2A 4G5QA 1HNZQ 2VZAA 1FMLA 4IFDH 5C4JH 1E0SA 3SFVA 5KDDA 1LABA 4EJSC 4JBWA 2CKZB 1V5WA 2ZVPX 3ZZ0A 4BLSA 3IFTA 4A3BH 3ZLJA 4KFRA 1X3FA 1UAAA 3F8TA 1Z63A 2ZAOA 2GESA 3BFKA 2UU9L 1CR0A 1L4UA 4KN4C 1W36D 1ZNZA 1MABA 4AY2A 3SEAA 2CL0X 5FBRB 3RC8A 5J40A 3T1YL 1HNXQ 1G3QA 2WM9B 1S9HA 4B74A 4P3YA 1VHTA 3CF2A 5IDVA 1PA6A 1YVDA 3U5ZB 3I62A 4BECA 5CM9C 3KTAB 3LBNA 1NN5A 3GDEA 3TNFA 3R7WB 1KZ7B 3B2EA 4I1VA 3Q5DA 3FB4A 4ARZA 4BFUA 3TW4A 3QSYA 4GZYC 5HCNA 4I1SA 4W9MC 1A62A 2ZYTX 3SHWA 1D8LA 5FL3A 3CPFA 4TLAA 2D62A 2REXB 1DBSA 1P7CA 3TJZA 1CR1A 4JI4Q 1J5EL 1KOFA 1SQ5A 1SVSA 2ZJ2A 4IJHA 3J81i 3I4MG 3JAMc 1JR3D 2ZRFA 4Q1EA 2BCJQ 1SKYB 2VP5A 3O8DA 3M4PA 1KNXA 2IHEA 4IO9A 4R7ZA 5H8WA 3MCAA 1S96A 2REOA 3Q7PA 1YRAA 2XGTA 1N2CE 1HE1C 1KI1A 2VQFQ 4H44C 1YR7A 2A3RA 4LJZC 2FPMA 4V0OA 4DIDA 3E9HA 2CQOA 2K32A 1OFIA 4OI0A 1EYGA 5F3WB 4O2DA 3PF5A 3N70A 5FL7D 4EDHA 1M2OB 1P2UA 1R5NA 1EIYB 3AB3A 4IOKA 4LJ6A 1KIMA 2OEPA 1X54A 3KXLA 3RZDH 2QGZA 3EX7C 3HPQA 3ICQB 5IT9c 3CRW1 1MO6A 3PEUA 4DRZA 3CC7A 4JI7L 1E2FA 4QIWE 3ULPA 2AMCB 4IPHA 5M5YH 1IBML 1WP9A 4TT3D 4B35A 4TYYA 1TWGH 2WAQG 3DZDA 1XD2B 1VQBA 1WMSA 2QRNA 2Z4SA 2WJGA 5C46F 1RW4A 5GVSA 1E3MA 5JS7A 1HQMC 1UE6A 1HUQA 3I92A 1EK0A 3LA6A 3ZIAA 4B43A 1AA9A 1VG1A 3KQUA 4QQBX 5G41A 2N8NA 4AK9A 1VS0A 1US8A 3OIYA 4DV3Q 2E5LL 1WOCA 3KX2A 4GN4B 1Z6HA 4TVAB 4URXR 5KYKA 2ZRMA 5DLQC 4A2PA 4O2LA 1WCMG 4YC7A 4DR2L 4XIGS 4FW9A 3ONWA 3JAMi 2ZRLA 4B3CA 4L9SA 1A0IA 3FKIG 4LF5L 2O52A 2ZJ5A 4H1UA 4ITRC 1VPLA 1RRFA 1G16A 1Q90A 1A63A 5CJ2A 1E9SA 5E4FA 4OKSA 2QROA 4C0JA 2IXGA 1OKKA 3ULJA 2K5UA 2ZUBA 2BM1A 2WAQE 5CK5A 4AG6A 2KHIA 3IDQA 2E87A 4US0R 2W58A 2Z83A 3GLGE 1IW7D 3S15H 4PQYA 4X64Q 1NIPA 2C78A 4B71A 1NLFA 4K81B 4KXFB 2IX3A 1Z22A 2CHQA 3GP8A 4RJLA 3GLIB 3G71A 3LNNA 3SE0A 1X8LA 4FMBB 4QL3A 4C9BA 3AF4A 1FJGL 4HIMA 4IJMA 1IN4A 2HEIA 2LMCB 4KKSA 4MTNA 4DUZQ 3NC1C 4MRNA 4PPFA 2IF0A 1H9JA 2WWXA 4FMDF 4GOPC 5HR5A 2GCOB 4LBYA 1CSPA 2OHFA 4A9AA 2K5HA 2A68C 1R0YA 2GEDA 2VF7A 3AF0A 4DDTA 4ON9A 3RS2A 4EFMA 3SS8A 3CRMA 1SFOH 1W4RA 1CFMA 2IY5B 4B33A 1P3JA 1Q82C 4CYMA 5ELXA 2QAGB 4URWR 4YMSA 1V9PA 1II8B 3FP9A 4HUTA 3MWYW 5KPJA 4A3IH 1K3RA 1KZGB 4PO9A 2YTXA 5FI0B 1CKMA 3L2OB 2WIAA 5DYIA 1YZQA 1JMCA 4XH9B 1IXZA 1NSFA 2C98A 1BVSA 4LF8Q 1KK2A 4OHVA 3GJ7A 3UATA 2FFQA 1DG1G 1E69A 2EW1A 4C7OB 4DV5L 2IYZA 1W36B 3BFXA 3AUYA 3TAUA 4RFSB 3V4FA 1VQMA 4HYYA 1YNXA 1VKJA 4H9GA 3HKSA 4DV2Q 1W2HA 2HF8A 4NBSA 2BE5D 4I1OA 2AKYA 4LF4L 4D26A 1F3OA 1UBCA 3HOVH 1UKEA 3HOUH 1HV8A 5H1YA 2YU9H 5KHOC 1VCIA 2IHBA 4FD2A 4BEJA 3U7HB 1KI7A 4Q1BA 5HCIA 3RHFA 1BYIA 3S1RH 4RG1A 2WPDD 5C1BA 1TAGA 2HCJB 4FWIB 3PF4A 2E2JH 4PZ8A 1T0HB 3IO5A 1N8RC 1RJ9A 3KKNA 1G7CA 3X2SA 4B32A 1L1OC 4LJ7A 5BYJA 3B1VA 4G7OC 5KSZA 2K52A 5G40A 3TBKA 4EPXA 1DAFA 1M74A 2FOLA 1E2ZA 3KJPA 2R65A 4BBSG 4WJ3M 3O8BA 4XTCS 2XGJA 1IJFA 2YC4C 2IUUA 4CT4B 2W6ID 5KSOA 5CIWA 3RRNA 2ZRIA 5FOWA 3L0IB 3WNBA 3X1WA 2NN6G 5DE3A 3WP0A 1X6VA 5TVKA 2WP8J 2A9KA 3OZXA 3CCJA 1OF1A 4AYXA 4GN5A 3VA7A 2ZU0C 1E4VA 2ZR7A 3FPAA 3P26A 1ZNYA 1BMFA 1UKZA 2ZE7A 4LHWA 4NCNA 2EFCB 2JGNA 3U58A 1I3QH 3ER0A 2PI2A 1BIFA 2QBYB 3QI2A 4C3ZA 3PEVA 3T5DA 3V00A 3IILA 1E24A 4A75A 3SYNA 1II9A 3GD7A 2GBLA 3KKOA 3R9WA 1HYQA 5C3EG 2EWWA 5ELNA 1JJCB 3W5IA 2WSSA 4DK6C 2GVDC 1Z0JA 1X8JA 2QENA 4LGMA 2JJQA 2YKGA 3AVUA 2QY9A 3A7AB 3ETLA 2YOFA 1II0A 3U2QA 4AURA 3AP1A 5GJBA 5KOYA 1LTLA 1P72A 2JCSA 1OTCA 4C3HH 2G6BA 4DSOA 1A8VA 3LX5A 4KVGA 1SKYE 1LACA 1IBKL 2RGCA 4PQFA 1S1CA 4L4UA 4PHHA 2SHKA 2WMNB 1VIAA 2L0XA 4GOKA 4GOJA 4EIWA 3DHWC 3OEHD 1NMXA 4DK3C 4R98A 3WYFA 1JB1A 1GHJA 1O87A 1PMRA 4ZCMA 2QMUA 1QBKC 2ATXA 1P6XA 1Q22A 1U5KA 2F1RA 4BFWA 3VKGA 4DK1A 3CAMA 5FLMG 1KDPA 1ODFA 3VNVA 4GKJQ 4EPRA 3PVSA 2ZSFA 1O3YA 2VHCA 1WCV1 1TF7A 4IOCA 2ZI6A 4LY6A 3UWKA 1OH5A 1NVVR 4MKIA 4UJ5A 4Q9KA 4QL5A 3CM0A 1VQFA 1W5TA 3B9PA 3PG5A 2IS2A 2BJVA 4M1MA 3PO2G 1EQQA 2LCFA 3CRQA 2Z6KA 3SI7A 4C0HA 4XOIA 4MGIR 1GNRA 2FE4A 2P3SA 1OIXA 2PI2E 4J15A 2OTJA 1NVWQ 4LPSA 4CIDA 1QHGA 4WBSA 2QA4A 4GFDA 3SHFA 1ZYUA 3NH9A 3DDCA 2FXQA 2HT1A 3M4OH 2D7DA 2QPAA 2WZQA 1IBLQ 5M3FH 1H9SA 1ZC3A 2BBSA 3BJUA 4DR6Q 4H02A 1GL9B 4EQ6B 2J0QA 4BQSA 2J5XA 1LF0A 3GJ3A 3LY5A 4JCVE 3CC2A 1A4RA 1CJVC 2QPOA 2RGXA 2WWFA 4A0HA 1G3IA 4TTRA 5FUWA 3ULLA 3HP1A 2YHSA 5L3RA 1F6BA 2A69C 1TQ6A 2B6HA 4PC1A 4Y52H 4X8OA 5HPYB 3F1ZA 3BD9A 4PSAA 2NQ2C 4TLCA 2UXDL 3K09A 1AGRA 3GJ0A 2ES2A 1OYWA 2G0NA 5JFGA 3KF6B 1ZM7A 1E94E 3TVDA 1BO6A 1BOFA 4C0SA 1HR0W 1DOAA 1FTNA 1JR3A 1J8YF 3IIKA 4FIDA 5AR1A 4B3ML 4PZZA 4PANA 5D3MA 4DHEA 4ERNA 5H68A 4A3EG 4GDFA 1L7VC 1ZW6A 2QP9X 3M9BA 2WSMA 3CNLA 3K0AB 3DXJC 5IP7H 1OH7A 2IYXA 2W83A 3CZPA 3MAAC 2I0QA 4YDSA 3CCRA 5FL7A 3TR0A 1YZ6A 3GEEA 1KRTA 4NHOA 3AVQA 4US1R 3A5ZB 1NKSA 4GLVB 1KI6A 4E07A 4MZ9A 1G3UA 5J47A 4GLAC 1U0LA 2Q2HA 1YKSA 3UXMA 1W49A 3PV0A 2DY1A 2V6IA 1PH3A 5AUOB 5JI2E 5FR2A 4TT3A 4UNPA 4F93B 4B2IA 1WXQA 4Q4JA 1X55A 3K80C 2GTPA 4BFTA 2AUKA 2GCPA 2KA7A 4B48A 5DIFA 1W2GA 1MKHA 2FV8A 4JI5L 4FCVA 1EIFA 2ERYA 4IOJA 3IPYA 4UXHA 1J7KA 1Q1BA 2NZJA 1XMVA 3S17H 4LF9Q 2ZANA 1YIJA 3H0GH 2R93H 3HOXG 2ASEA 3KJHA 2FZLA 3A1TA 1PLLA 1OIWA 1T3SA 3W5OA 4B44A 5JBQA 2AD5A 1UEBA 4A3FH 1MV5A 1Y63A 1RC8A 2DBYA 3BZKA 1CJUC 1VG9B 1U9IA 3OIWA 4QNRA 2NVTH 4DLSA 2FNAA 2QMOA 4LF7L 2WAYA 3C8UA 1QUQB 4Q1DA 3VQTA 3BGWA 4QXAA 3VR2A 1E2QA 5JHGB 1NLZA 4HR7B 1QHYA 3DKPA 4JLMA 3STBC 1GKYA 5C4XH 1FNMA 1TXYA 1SVWA 3ZYCA 1MO4A 2GZDA 3AB9A 4OO1I 3D0FA 1ZIPA 1E9AA 1NY5A 1ASYA 1E2MA 1OFHA 2H7VA 3KDFA 2QE7A 2WJVA 2O0KA 4XVQA 2UXCQ 1YU9A 2Y0SG 3EZFA 1QJOA 3LNCA 2WWYA 2H5EA 4PMWA 2EVWX 1N5IA 2UVQA 1PYBA 1C1YA 1X8KA 3QKRB 3E0EA 2NO6A 3H86A 3KFVA 4GI7A 4JBKA 1A7JA 1D6JA 2J41A 3A36A 4JLKA 4LBVA 2UUAQ 5FTKA 4B2PA 4LJ9A 4KFUA 5TDHA 1P5ZB 3QPVA 4TYPA 2ZSDA 1PYSB 2ZI4A 4QHSA 1E6CA 3L7ZC 1YE8A 4GS3A 3B6YA 1ZD8A 2ZS8A 3CCEA 2AWOA 1OYYA 4EPTA 1HZCA 1U94A 1EWHA 1Z83A 4BFYA 3AM1A 4BY7G 3T1HL 3C41J 1XEWY 4AKGA 1B8AA 1XJCA 3OEED 4JYAQ 3VKHA 1O7LA 1H65A 5BQ5A 5C0XI 2RGEA 4KHPL 4JI6L 2DHRA 1IN6A 4BZPA 3H4MA 4PO8A 3LO5A 2Y0SE 2RGDA 3CX6A 2PMZE 2D06A 3F2CA 2J0UB 1KHTA 1RRPA 1Z07A 1Z2AA 4B3SL 2XXAA 1TPZA 2AR7A 2H16A 2OZEA 4JMPA 2FMXA 1IZ6A 3LLUA 3PUYA 4C4PA 3RVBA 3H0GG 2DFKB 121PA 2R62A 3BU2A 2A5GA 5D3QA 2CBZA 3THYB 3QKTA 1N6IA 3K7AH 1IXRA 3GLHA 3X1DA 1YJ5A 1IYVA 4PZ6A 3KF6A 2FSIA 1SGWA 2VF8A 4W5WA 2PLFA 3LBHA 1E2KA 3TR5A 2VUMH 2IEYA 2J7KA 5DISB 4X65L 4A3DG 1V8QA 5KNDA 4R4TA 3SJBA 3GJXC 3B60A 5C4XG 4PSVA 2WPDA 4WW0A 2VW9A 3JVVA 3RRMA 4A92A 2K33A 1ZU4A 4E22A 1BKBA 5ELOA 1N0VC 2AD1A 2JJ1D 2RHDA 3T06B 2I1QA 3U3MA 4DR5Q 1HE8B 1XEXB 4R2HA 3H3VI 1COWD 3HYRA 1YQTA 3P4YA 4OI1A 1KJYA 2ZUCA 2JLVA 1M7HA 3BERA 2K14A 1U90A 4RZ3A 2UUBL 1FMJA 2PT5A 2W6IA 3V9PA 3QBVA 1KAGA 1VG8A 2B21A 2VP2A 2ZYWX 2JLSA 3U7FB 4BY1G 4YMWA 4K46A 2JA7H 5AUNB 2FGKA 2ZQ5A 5JZVA 3QXXA 1AKYA 4BZQA 2OAQ1 3TQCA 4N3NA 2K5NA 4NXNL 3K8AA 4QGHA 4TMTA 4WVFA 4PPGA 4BWYA 3LWNA 5GAHC 3FE2A 1VCMA 2YVUA 4BUJA 1N33Q 2JLQA 3KQHA 2HJVA 1HR0L 3T53B 3EA0A 3AKYA 5EJEA 3THWA 4OWXB 1FGUA 1CJKC 2BOVA 1Q57A 2C9YA 1AM4D 2HYIC 3DL0A 2R92G 3LQQA 2B7CA 1Q3HA 2FZ4A 3C5CA 4MYTA 4ZO4A 4IFDI 3I4NG 4IOAA 1UADA 2Q0HA 3FMPB 2ZT9C 4R1JA 4AQYQ 1MO3A 1UEJA 1HH4A 1X3SA 4LJ4A 5DI3B 4OHZA 4GNXB 3CX7A 1AS2A 3HOWG 5FPTA 1CR2A 4R4CA 2ZJ8A 1CKOA 2C9OA 4HLDA 2A68D 1LTQA 1TX4B 2X77A 2YWGA 3EG5A 4WA7A 1SXJB 3A8IE 1U0HC 5AWFC 4B3XA 4JVMA 3QKUA 4B75A 1LFDB 1A2KC 4A3CH 2Q9AA 5BW8A 4CDGA 1YHNA 4JK1C 3ADDA 3QKRA 4LF6Q 3R8FA 1HURA 5HZKA 3ZVMA 3OEHA 4HSEA 4JS0A 3CO5A 4NMMA 1EGAA 3AFPA 3AQ4A 4UKDA 3ZZUA 5CB8A 2IS4A 1ZNWA 4DR4L 4X6AH 4TL6A 1N34L 4B3RQ 2C35B 1NVUQ 1XBTA 3LV8A 1FX0A 4G5SA 1XNQQ 2H8KA 4M21A 4ZIRA 1R2QA 3T56B 4YWMA 2UKDA 1JXOA 2PNRC 2XSZD 4N1AA 3WYAA 2K7VA 4Q66C 1XNRL 3I7FA 1P16A 4A93G 4S2EA 3SJZA 3U60B 4M9QA 4U5XA 2MSEB 4HLUA 4BA2I 3HFZB 5HY6A 4P71A 1SZPA 1U2RA 4O25A 5M5WH 3GQBA 4BXXH 2OO7A 5IT5A 1YRBA 3Q85A 4QBGB 4UPAA 3K70D 1JEDA 2JA5H 1UJ2A 4OQNA 3K1JA 2HHHQ 5EE5B 1G4AE 1Q1ZA 2GF0A 2B7BA 1EFRD 5KDLA 4ZI2A 2JQOA 4NYMQ 3K0EA 2VYFA 2OUKA 4JI0L 3OW2A 2EDGA 1UBGA 4PPQA 2B8TA 1XEFA 4Q7KA 4ESVA 4YMVA 2FFBA 4HAVA 2RGNC 1OPXA 1R9TH 3G6EA 4PHTA 5JRZA 2EFDB 2YNMA 3B1XA 2B63H 4X8LA 1JQLB 1ZM2A 2AX4A 2EQBA 4KO8A 2IL1A 4YXWD 1EFHA 1TF2A 1Z0KA 1D8TA 2E2IH 3P1JA 4LJYA 4B6FA 1DXMA 5C44H 2DNEA 2FFHA 4HB3A 1DO2A 2F43B 3A1SA 1E2VA 2CL7X 2FJUA 3QY0A 5EP2A 1UM8A 2FSGA 3H0KA 3B13B 2OTLA 3EARA 4PAMA 3ND8A 2RH5A 3A6PC 4QGGA 3KF8B 2ZS7A 1OH8A 1HY3A 3MWLA 4IQZA 3W3AA 1G8GA 2MMCA 2PEZA 3MJRA 4KLKA 2PT7A 4Q1CA 1OV4A 1GRQA 3LVQE 2RB4A 1PH7A 5BXQC 1JR6A 1KAWA 5J4VA 5IRCD 4B3TL 1I4DD 2UZ3A 4ZI3A 1X9NA 4A3CG 1P60A 4LUCA 2UUCQ 3AVYA 4V0MA 1E2EA 1LNZA 2R6FA 4DR1L 4TYQA 1X65A 2ID0A 3BK7A 4AC9A 5C0XH 1PVOA 1B9NA 1G5PA 1ONBA 3X1XA 4DV4Q 1PH9A 2ZRAA 1R5OA 2OXRA 3GFPA 1CP2A 2AK3A 1YNJC 1GL7A 1VQKA 1RYHA 2OBMA 1FP6A 1W4BA 1PHJA 3RN2A 2C2HA 2JJ8A 4RD4A 5SZKB 5E3HA 4ZDJA 2BMDA 3NBZC 4Z1MD 1GUNA 5ANRB 3TQFA 3FHWA 1KI2A 3OESA 4TYNA 2C99A 2IHYA 3OE7A 2O8EB 5IYDG 2A6HC 4YHHQ 1HZBA 3B8HA 5EP4A 5FBQB 1VQAA 4DR7Q 3AVWA 2JLYA 3IHWA 1IOZA 4BRUA 3TQYA 3W34A 3FOZA 1OFTA 4HZUB 2QGQA 2B3GA 1GUAA 4B2LA 5DI3A 3TREA 3OFND 1MKYA 2EVBA 1OIVA 2JEOA 1N6NA 3L82B 5BWMA 2PLRA 1EWQA 3BAFA 1IBRA 2PZGA 2DN8A 2K5VA 4M53A 3TSZA 2LSSA 4YCUA 1D5CA 1US8B 1SXJA 4NU0A 2Q2IA 1HA3A 1N32L 1XJVA 3CB4A 4CRWB 1OE0A 3UE1A 1CIPA 1E1QD 1HPCA 1X3EA 2NVYH 1HNXL 2FFAA 2W2TA 2ZROA 1VYTA 4JJZA 4RCZA 3I4MH 2F52A 2I5HA 3RDPA 4TZ6A 1VG0B 2FSHA 1Q7YC 5GJWC 3H3VH 1UWVA 1E2GA 5LBIA 2GK7A 2GDJA 2Q3MA 4WZAE 4O0AA 2ZTSA 3EWSA 4EJSA 3AH8A 3KQLA 3PIOA 5B2ZA 4RCNA 3BIFA 1AK2A 1HNWL 1SN8A 1KKLA 4IXNA 4QM6A 4V0ME 2JIZA 3H94A 5FOTA 2HQLA 1G3MA 2WVJA 3UDGA 4MGYR 1AE2A 1XPOA 1T8UA 1OB5A 3SNHA 1VTKA 2VHTA 2WKPA 1TU3A 1UDXA 2BDTA 2A5FA 2ZI7A 1HJPA 4UP7A 2ANBA 2QT0A 1FPMA 4P4SA 4PPNA 2IC5A 1RL2A 5HE8A 2G83A 5DSZA 2UXBL 3HOZH 2A1AA 3S16H 3DVLA 3QUSA 1CEEA 2BEJA 5AJ3L 3QPUA 3WBJA 1AS3A 2X2EA 1Y14B 3E5HA 2E75C 1JI0A 3UDIA 4DXAA 3UPUA 2NMVA 1YHAA 2A69D 4G3XA 1OXVA 3BOSA 3UDXA 3OEEA 4I99A 1P73A 1OXUA 1KMHA 3IUYA 4IPDA 1IYUA 4LYJA 3CRKC 3L43A 3KZ1E 3LFUA 3BG3A 2WOJA 1NLYA 1C9KA 1T0JB 1FP7A 3PR1A 4RD6A 1KRSA 1EXMA 4HLQB 1P2VA 3FPPA 1V1QA 4JZKA 1KDOA 2LKDA 1XMQL 1WCMH 2X19A 1ESNA 2WAXA 2L5TA 1TNDA 2F43A 3FKIH 2N42A 1N6PA 1NY6A 1SXJE 1W0KA 4HJ7A 1FNNA 1GNPA 4UNRA 5FJ8G 1KDRA 3AP3A 2GAOA 2WWIA 3SN6A 3LW7A 3RS0A 1P61B 3UIEA 2FA9A 1VQHA 4PQRA 4YY3Q 1XU4A 2ZU6A 5LMNW 3HOYG 2D2EA 2IEZA 3NEMA 4ZDWA 1WBBA 5M5XH 3WHLA 1ZJ6A 2PJZA 2ZXUA 1ELOA 4B3DA 5BR8Q 1K8AC 1Q86C 1DTSA 3FMFA 4DLTA 1OHHD 4YMTA 3G0HA 4TTPA 1E1TA 1P9NA 4MA4A 2F1MA 3VR3A 3U3OA 1VQ9A 2JJ1A 4LJ5A 2OILA 4NXML 1R5BA 4OI2A 4Q4HA 3TS2A 4X64L 4TWZA 1Q44A 2D3WA 4OQMA 4YDHB 3W9YA 1LUZA 4GKKQ 1TQ4A 3KKMA 1HQCA 1Q46A 1CBUA 1RJ9B 1COWA 3C15C 3P20A 2HIVA 1E0JA 2IBMA 2R8RA 4ZKDA 4RFVA 1BKDR 3PCRB 1EESA 2JLUA 2XAUA 4KODA 4I1UA 4DUZL 2OCYC 4OWWB 1XXHA 2OM2A 2IYLD 2IUSA 4QJ3A 3STBD 3CBQA 3OW7A 4ZCIA 3HOZG 1Z47A 4C2MH 1FYCA 2PZFA 5K8IA 3KQNA 1MO5A 4MRVA 1VQDA 3GTMH 1ZINA 4Q18A 1VQ4A 1TU4A 5JLJA 4LW1A 4QBIA 1RPZA 3AEVA 1YZKA 3AVXA 2JK8A 4L5QA 2VP9A 2R7FA 1CXZA 3A8KE 3LAWA 1Y8PB 2V1XA 3ADKA 4G0NA 2ZE6A 3Q5EA 4TL8A 3E2IA 3Q8XB 4JI1Q 1KJZA 2HF9A 1S9DA 3BB3A 4ILEA 4KAXA 4DSNA 1KKMA 5L3VA 1TTTA 1ZNXA 3D4RA 3A8TA 1BDOA 3MFYA 1XCGB 4FCWA 1FUUA 4HZUA 5SZIA 1H9MA 2ZRBA 4GOPA 1C9OA 3I73A 2ZM6L 3BH0A 3RAPR 1SHZA 3RWMB 2ASBA 2F1JA 2NGRA 3TW8B 1JE5A 3K8YA 4B34A 3PIPA 4KBFA 4NONA 4Q7LA 1JPNA 2UU9Q 4Q03A 1F60A 4DAYB 1Q21A 1JPJA 2ZR9A 5H70A 1JQJC 4DV2L 1KK0A 3DMDA 5GVRA 5BYKA 3K53A 3BB4A 3T1YQ 3SZRA 3HPRA 1P8LA 2ZJYA 1BS1A 1W5SA 4JI2L 1C7YA 2ZRKA 4MUAA 4JLDA 3AV0B 5EZ6B 1YHBA 1TEVA 4A8JC 2JEBI 4BBSH 1N3BA 4U00A 2N49A 2CCJA 1H95A 2GJ8A 2WOOA 1UFQA 4JLBA 1RKBA 2WKRA 2Q9CA 2ZRJA 2A78A 4RCYA 3VTKA 2XSZA 1CJMA 2NN6H
chains in the Genus database with same CATH superfamily
2BDOA 2ESRA 4IG4A 4POGA 1DAGA 4P31A 4J7CA 1KTIA 2PYDA 3PL1A 5E6SA 1TWAH 3RYFA 3PC7A 2H1VA 1M5TA 2UYYA 4RGYA 1H9SB 1X15A 4YJDA 2FXIA 1QG7A 2DWUA 1PQPA 1M1YE 2EJUA 1O5OA 5GIPE 2BSQA 2Z58A 3OPQA 1QTRA 4X66L 1E0AA 2ZBPA 5AJVB 5LMUL 3GRUA 5FBVB 4Q4JB 4G9BA 3FZQA 2H51A 2XA1A 4TV8F 2I55A 1T1RA 5EG5A 3AKCA 1B3QA 3MGGA 3ESAA 4JNKA 1L4YA 3QVUA 1YJNA 1NW3A 9ABPA 5JCPA 3KU1A 1SCKA 1LT6D 4OGKA 2O5IC 4AYWA 3H9JA 3KAPA 4LV5B 2J59A 1Z28A 4DLXA 1AGYA 3DOHA 3GJ8A 2ATIA 1PZID 5EBDA 4HNRA 1D2MA 2ON6A 4L22A 3M1IA 5DDIP 4Q39A 4K8JA 3KL2A 421PA 4ND6A 2HIXA 1RQRA 1PL0A 3BRSA 3PXBA 5AD1A 2W6CX 1FQKA 3INYA 1T24A 3HR8A 1O7ZA 1OILA 1TY0A 3M89A 4QXQA 4PG3A 3PF9A 1YBAA 3CCLA 1EUJA 4BLPA 1OHHA 5D85A 3WBFA 3UOAB 2WVAA 3BMQA 4Y2HA 3W8NA 4MDEA 4RS4A 4BA1I 3SQOA 4PZLA 4ISBA 4POAA 2VF5X 2X3FA 1PQUA 3BJZA 5U9CA 5B1HA 2WF7A 3TNYA 3UNXA 5BNZA 1GUYA 4PZCA 5DTEA 1PTKA 1QC5B 2DUUA 2ZGVA 2ET6A 3S4YA 3KYHC 2WU0A 2ZDHA 1GILA 3I9KA 1RNLA 1L2TA 3QK7A 3KYJB 4G67A 1IJBA 3V46A 3PPIA 5JAMA 3WGIA 1S2GA 2UXDQ 1K3BC 2IDKA 1A3VA 5AW3A 4GE3A 1P0MA 3GV0A 3H1PA 3O83A 1W44A 4GLJA 2E2WA 4JFRA 5FUXA 2H1CA 3RS5A 1YMVA 4AS2A 1B0UA 3ZE0B 3SJAA 3OJOA 2VP6A 1AJEA 2BFAA 3VVLA 3S1NH 3I9OA 3ZHXA 1EOVA 5AKGA 2O2SA 5BRAA 3J81A 1N5OX 1IJKA 1B8NA 1XNQL 4DR3L 4LSGA 5GGXA 1G21E 5LQSA 4A3SA 3AR7A 3EEBA 2WM2A 2CL6X 1GZ4A 3VC1A 2ID8A 4DR1B 2CHEA 2JFYA 1WUYA 2EF0A 2R7ZG 3Q3JB 1QO9A 4ODGA 4YI5A 1SXIA 4ND8B 1KQFA 3Q15C 2L15A 3CUUA 2DWPA 4H3KB 2X4IA 4KNWA 2EC5A 4HNUA 5G3ZA 4EPYA 3W90A 3L41A 4GL4A 2ZYIA 1DS6A 3KEQA 3D6VA 1SH7A 4P4SB 3ZYZA 5DSTA 2YTZA 1K83H 4GRIA 4PYOA 1XK6A 1I7DA 2O0HA 3GPLA 5HW0A 5KAPA 1VCNA 2UUBQ 3HOYB 1PK9A 3JYNA 5CCXA 2ZYDA 4IG9A 2BPOA 4W5QA 1M6EX 1JFLA 1X3LA 4HMOA 1LVGA 3C4JA 1Q91A 1FYXA 4PR0A 1QVVA 4XQJA 2Y9PB 4M46A 1NU6A 5FEMA 1DRWA 1CY7A 1QO0A 3VX4A 1UZNA 2YXLA 4Q93A 4A3JG 2ZYVX 2BI4A 1P74A 4IPGA 2PMFA 4O0MA 4RD1A 1QO7A 2ZCUA 2V3WA 2ZUDA 2Z0MA 1Y3AA 5L3ZA 4GBMA 2PZJA 5IBCA 3LQ4A 1HUNA 5C4JB 2WYIA 3O1LA 5E7IA 2BLNA 1UIMA 2UYOA 1MG5A 4GNKA 2PQ2A 4Q7EA 2Z4RA 1KBQA 1ZITA 1SCIA 3U3JA 3AF5A 4OK3A 4NJMA 2PMKA 1CTQA 2AL7A 4CU2A 3RUFA 3KAKA 3O8CA 3FTEA 4YB8A 1L4KA 5BVGB 1UOQA 4NP5A 3J7ZC 3W8EA 1QVFA 3EAFA 5KVCA 4JYZA 2WKCA 5E6SB 3ENNA 3GGSA 3RYFB 5B3KA 3IQXA 1OY1A 1U8EA 3EXEA 2E18A 3WRYC 1GL3A 1T5SA 1JLKA 2GRJA 5I9SA 3R6LA 1C80A 2J3IA 3OOWA 4UOQA 1KVSA 4D6YA 5TMBA 2WLTA 4KV7A 2XYRA 5EJWA 2QZZA 4FOTA 1CZRA 1TVMA 1A9ZA 3B6ZA 4P22A 5G0WA 2Q5JA 4NPAA 1JHAA 3WLQA 1D09A 1SFOB 5K01A 5I01A 1SHJA 1UQUA 1J07A 5AP9A 3RR5A 4X00A 2JJ2D 2H2GA 1ZSYA 2UVPA 1WM1A 4TRMA 1GRVA 3W0LB 1CDOA 3UJ3X 1NBME 2NG1A 4A3BG 1QNLA 5BSEA 3IAXA 1OI2A 1ODKA 4EJ0A 2ZEJA 2RH9B 2GWHA 4MUKA 3QU9A 3KHUA 1YNND 1CZLA 5I6WA 4JEHA 1ZHHA 4RIHA 1TU0A 1VF7A 2F3VA 5DF1A 2JE6I 3OYYA 4EABA 1EVQA 1R0RE 1S8FA 1Z7TA 2V7QD 2EYOA 2YIJA 4ARVA 1EAMA 3SHVA 2X5JO 3Q9NA 1TGVA 3BE8A 3TZEA 1Q1EA 3NMUF 3GO5A 1I30A 4F2HA 4D9JA 2EWMA 1PJ8A 2JA8H 3ZWKA 4ILWA 1XU7A 2MHCA 5GV7A 4I9FA 3BMQB 1NE3A 2XTZA 2NT4A 4JI2Q 2QD4A 3RFCA 3ZNNA 3NH6A 2GHTA 4K9OA 4C1NI 3AMVA 2AF4C 1M2OA 1G5IA 1KL9A 3CF4G 2EQSA 3QVLA 4MKGA 3RSOA 3MJFA 2F0PA 3GFOA 2PPLA 2VTKA 3PPVA 3OWEB 1JZSA 1PK7A 5F1PA 5M5BA 1KH3A 1JIUA 2FUG6 1O77A 1Z9BA 1MXFA 4F4JA 1VJ0A 2VHQA 2NV6A 4H3HB 4LF7B 5AXBA 2XCUA 3ND6A 3AYHB 2QN6A 5GONA 2GXUA 1FFXB 2H5XA 1UMCB 3HOUG 4D0RA 2KLBA 4PBTA 4BPBA 5E8JA 3GZTB 2AG8A 1GR1A 5KZMB 3KOYA 5AKIA 3ANTA 3FYTA 3SK0A 5CDSA 2QAGA 1YFKA 3E70C 3H2HA 4RC9A 5TPZA 1E7QA 4J16C 3IP3A 5K5PA 9GPBA 3RTBA 2AN5A 5JS8A 1G8AA 1DD2A 5KU7A 1CB0A 5KWJA 4JJAA 1DAHA 3S2GA 3KLOA 3FUUA 4O8ZA 1DWOA 1C3LA 3A28A 4PRYA 1QQ6A 4HQKA 1QVAA 3OZDA 3QWAA 4ZK2A 1YB6A 4D9NA 1Z5OA 2N55A 4LFAL 2WUEA 1NOKA 4NXNB 4DV0B 1PWZA 1NUUA 5EXSA 3LOUA 5KUTA 1EFKA 5TEWA 3L2PA 2V74B 1E4YA 3OWOA 3L4EA 1XMOL 4KO4S 3NQTA 1SXJD 1EP1B 4LAAA 3OQIA 4L57A 3RS3A 4OJMX 1ENAA 2ZS9A 4FEYA 3O13A 3CHYA 3IAS6 4ZAFA 5J2UF 2XDWA 5KTTA 2OCAA 3GEPA 1YTLA 2Q2TA 3NCHA 5EIFA 3VYRA 2OWOA 1J7JA 3ZDZB 4FHEA 3V8QA 4OUDB 1TW3A 4UP8A 1KPIA 2H1RA 2YZNA 2EPBA 1HLPA 1I5OA 4RESA 3ONAB 5CVJA 3DZKA 4MTLA 2B8EA 4FQ8A 4MUNA 5DHUA 3I9V6 4BEBA 1Y8OB 5KSPA 1OROA 3FWPA 4LCJA 5JCJD 4BJ5A 3OP4A 1J9EA 5K8JB 1PHRA 9MHTA 2MYPA 1Q5PA 2QZJA 3V7WA 2PT9A 4EO9A 4DG5A 5HKAA 1GA4A 5K20A 4NE9A 4NJMB 1NZDA 4CEIA 4FBMA 3GEHA 2F8SA 5E9JA 3HNRA 4B4VA 1RBZA 2EP7A 1B43A 2BGGA 4IIHA 3A0JA 2R9VA 4KWIA 4M60A 1RJDA 3LC2O 4CTKA 1A98A 1Z7BA 2YR0A 3NW9A 3DGEC 5HF6A 2QAJA 3A2NA 4EHAA 1VI2A 4B0OA 4QTZA 2HA7A 3DBHA 3HO1A 1Y9DA 3EXEB 3L79A 1ENCA 4C4TA 1B93A 4LYAA 3LGJA 1D6SA 2NWGA 3FH0A 4INZA 5C4ZA 3KNZA 3BXEA 3N2EA 4PYQA 3V2GA 2GQ0A 4YWLA 3HFGA 3VH3A 3EYAA 5CYUA 2X7XA 4LGYA 5IXSA 2WUVA 4NOMA 4LJRA 2FB9A 4PO3X 3GD5A 4XRRA 3WNDA 1Z6PA 3MOGA 1OI7A 2ETVA 2X8WA 2FHPA 4ZDIA 2C5LA 4AY4A 2OCKA 3IQHX 2AQ8A 4PYIA 5JG7A 4I7EA 2UVPB 3G5UA 1ZRSA 3BDOA 2ZTDA 3G6KA 1MR3F 4R51A 3EZ6A 1PWXA 3LRPA 4IFTA 1T8WA 4O1IA 3IQWA 5GIOE 3WLPA 2WINB 2Q5IA 3FCXA 3LUHA 3GG2A 2YVKA 4PTLA 1TTPB 2A5HA 4YAFA 3AUFA 3RZDB 3AW9A 4IVNA 4KQIA 1P5HA 1XRRA 5BQFA 4RGQA 3FOAA 3KYDA 2F4IA 1NQWA 4PAOA 3AR8A 1AIPA 4Y1GA 4IFDH 4R1TA 3HBMA 4KFRA 2B2NA 3U3DA 3KZNA 4NCXA 5K0ZA 2BKXA 3NK9A 1W36D 1HQKA 4AY2A 2CL0X 3B5IA 5J40A 4C6RA 2EY6A 3EMVA 3B2EA 2HJRA 2I3DA 3FB4A 4N9TA 3QSYA 4X3CA 1J1ZA 4KAJA 2OAGA 4ZN6A 4QAJA 3L18A 1NWHA 5E2IA 2K32A 1UDAA 3WK5A 1VKOA 1M2OB 4IOKA 1Z0ZA 3P52A 1MO6A 3IJRA 4QIWE 3LHIA 4TT3D 1EWTA 2VNKA 1YDGA 3I92A 4CMKA 1FDVA 3UFXB 3OZRA 1VS0A 5JSHA 2KS6A 1FGBD 4ZQEA 3S1RB 4ZREA 3FKIG 4LF5L 4C0JA 3NKFA 2ECQA 2ZUBA 3SY8A 3BXXA 2KHIA 4TXMA 1FFDA 2W58A 2F3SA 1VBKA 3PO2B 5GONB 1RFGE 3G71A 3FW1A 4MTNA 2MP1A 1V8DA 2I3GA 4YPOA 5A4DA 4YAUA 4FMDF 1R88A 3MVVA 3PYLA 4FPXA 4B33A 4CYMA 2QAGB 3IPCA 4A3IH 1CKMA 2JEYA 3A1CA 3RUDA 4OHVA 4GLLA 3OU6A 5FLYA 3AUYA 1C9DB 1XHFA 3ENWA 1GPWB 2PSJA 4FHFA 1UKEA 1V4NA 4GKBA 4PFJA 1UXKA 3DZBA 5EGTA 1XUOA 5C81A 4G7OC 1DAFA 1WHSA 2FOLA 1E2ZA 5DB4A 4RQUA 2YC4C 2RHTA 2W6ID 2UUAB 4G0WA 3A9VA 3L0DA 5DTMA 4UTPA 3IE1A 3FKJA 2NT3A 4KDFA 4L95C 4H7KA 3N2LA 1E24A 5K6RA 5C3EG 1H23A 3NTIA 4FF4A 1TDJA 1GG9A 1D5XC 5CFNA 5CVCA 3JD3A 2UDPA 5K0NA 3OCVA 1R3UA 2YOFA 4S04A 2HMSA 4UUNA 1FUIA 1K6XA 4PQFA 1NV9A 4P3KA 1NMXA 1GHJA 2ZIWB 5CP8A 1KEEA 3UGJA 2P2YA 4U2GA 5F23A 2VHCA 3EFBA 5G1PA 3BQNB 3C74A 4C7BA 3VYRB 3HP7A 4FLEA 3TZBA 3SVMA 2D7DA 1BDJA 5EZYB 1FSGA 3BJUA 1GL9B 2OLEA 3EEIA 2ZYAA 5HIJA 4LZOA 1UDRA 3VVMA 3ZJUA 3HCFA 1N3YA 3DVAA 1NNI1 4A3EG 1ZW6A 3N6VA 2WSMA 3Q22A 3DXJC 4YDSA 5FL7A 5JRDS 3TR0A 5JD6A 3AB8A 1W49A 2AW3A 1PH3A 3IVAA 5NULA 1AKWA 4UBKA 4YPFA 1V1PA 2IOYA 1SPBS 1F20A 2OYCA 2ZZMA 4TZTA 4LE2A 3RKRA 2IHKA 4CMIA 1DKUA 4BFCA 2RHBA 1UFRA 2QE7A 3ENVA 2Y0SG 4K05A 1C1YA 3GRVA 2RFLA 4EGVA 5IU6A 3NXWA 2B37A 4HGZA 1PYSB 3PFKA 2BRUA 4K2KA 1OYYA 1WPRA 4DWVA 4AKGA 1YRYE 4YMGA 1ZGHA 1DMRA 3Q1LA 2DH5A 4RS3A 3R7SA 3DBHB 4MB0A 3E0JA 1ZD4A 1AXGA 1IZ6A 1NYQA 4OQZA 1I7LA 1FFEA 1IXRA 1WMEA 2VQEB 2MYTA 2FLKA 4C3JG 4O59O 4J9VA 4ZPJA 3L4BA 2FF5A 3NJRA 4BP1A 4N8DA 4DCPA 1NUCA 3ANMA 3VOAA 4BGIA 2B21A 1ZXBA 2VP2A 4B7CA 5C8VA 4H0CA 3GR6A 4YACA 2K5NA 1P9LA 2YVUA 1J4AA 3BXGA 3EA0A 4MROA 1V41E 1X1QA 1XROA 2WUWE 1FGUA 2HYIC 4P93A 4WKCA 4KJOA 4KPUB 3OCYA 2C00A 3A04A 4IRXA 1EE2A 3NSWA 4JK1C 4O3FA 4XEHA 2XI4A 4N3CA 1N34L 4AJEA 3GDHA 5BR8B 1I8TA 1JKMA 1MFZA 2Z95A 1J8QA 2J5BA 5DT2A 4FEAA 3M3PA 4L0DA 1EUCB 3BWCA 1EU1A 2HV9A 1XEFA 1XWEA 1SB9A 2FFBA 2VYQA 4MW6A 3CVOA 1YUMA 1NULA 2WQ7A 3EMKA 2EOAA 5C44H 1UM8A 5SYMA 2RHOA 1X3PA 4Q1CA 4BXOA 5FYDA 3HOZB 2IOHA 4TYQA 1C3XA 2W70A 1IYZA 3E3AA 1KRWA 3BREA 1UKCA 1YGYA 1OPRA 3KBXA 5HKBA 2MJLA 3PEEA 4YHHQ 3LPLA 4UAIA 3VYTA 4LXIA 5EIOA 1MKYA 4Z86A 4BAUA 4J1TA 2XQIA 1TB4A 3LC1O 3ZDYB 2FSHA 2CVOA 1ECGA 1LI7A 3EWSA 3AH8A 5EFZA 3G8YA 4J03A 1OB5A 4YRCA 5DWVA 2BFPA 1PZGA 4NESA 5ETJA 3WBJA 3HJHA 3HSKA 3UCFA 2F0KA 5HJ7A 2MR5A 1I7NA 1SUDA 4J43A 3K2BA 3BG3A 4DUYB 3HYCA 1PD1A 3V1NA 2Q1TA 3TJRA 4OY3A 2Y1WA 1PV1A 4CM1A 4XB2A 2F43A 1U2DC 3H2ZA 3CU5A 1J0CA 5BRJA 4BTEA 1BX3A 1NU8A 3ZQ4A 2E4AA 3K57A 4JCCA 2I29A 4PMBA 3NEMA 1UK8A 5DWDA 2PRIA 1FTYA 5K3CA 1CDZA 4OLHA 5JROA 3GRRA 1IUPA 4K8RB 3AEKA 1JHMA 5JLAA 1CBUA 1COWA 4AZ0A 1E0JA 3TQRA 3AESB 1P5JA 1WHSB 2OM2A 4G5FA 2CDCA 1DDIA 4YIJA 4LW1A 3E2IA 4D4IA 4ZA2A 3ECSA 4KAXA 4KQGA 3IDAA 2PKWA 2Y27A 4YDQA 5JASA 4HXFB 4WGFA 4AZSA 4MVXA 4ZCQA 5GVRA 2H63A 1TIID 3QYJA 1P8LA 1U8FO 2PO7A 3T5CA 4FFMA 2JEBI 2MPMA 4P84A 1KEEB 4UUAA 4EW3A 4MHOA 1WXGA 2I5LX 2I1WA 3RROA 2DFTA 2BSXA 3F46A 2DQYA 1AUPA 2YDXA 2YYSA 1RYZA 3G9TA 3ZHYA 4DMRA 4AJKA 1TMYA 3HCWA 3Q2KA 1CCWA 4NKLA 1ZAYA 1UEIA 4RV4A 1ZA2A 1RI4A 1I7PA 5FLMH 1TM5E 3BBPA 3KOUA 3DVAB 4AUNA 2XJ9A 2RHMA 4IALA 4XQ0A 2NOAA 3PX2A 1GHTA 2PX8A 2DY8A 2D2XA 1YS6A 4DSAA 5E95A 3KOOA 4OQYA 4X71A 3GGOA 5FBHA 3QW2A 1IHYA 3A10A 2PX5A 1V1PB 2AKWB 1LBQA 3TW8A 2OQRA 1Z26A 1KK3A 5H1SE 1ACJA 4NENB 4CMIB 1RI2A 4ZT7A 1PE0A 4UBJA 2GRAA 1R0CA 4P7FA 4A73A 4DJTA 3KB1A 5JWRA 2QI9C 4Y6PA 4FHZA 2JBHA 4QVIA 2C7QA 1UQTA 2Q3CA 3M5CA 2VJMB 3KQWA 2D2FA 1EVIA 4G63A 2WU4A 4ESEA 1A6XA 3NBAA 3NDIA 3N0TA 2DERA 1ZGAA 1C8LA 1Z18A 3E03A 2RHQB 4F3KA 5WRFA 1IQ0A 1L8QA 3A6FA 1GGKA 4JVLA 1C50A 4FGSA 5E1DA 4AB1A 3F6BX 3PQ5A 1RQ2A 4NCKA 3NGLA 4V0SA 5D3ZA 5BV7A 4GPTA 2EAUA 2NSLA 3TM4A 4JUBA 2CCZA 2KHSA 1W36C 5DM0A 2R8XA 4W7IA 3CW2C 1X9HA 2B36A 4QRHA 1KQSA 1ECJA 4CMHA 4KQWA 1Y3CE 3WGJA 1WTCA 1NR4A 4FHDA 1ABEA 5TNXA 4BKRA 3E5SA 3OJCA 4JVNA 4NI5A 4J2OA 1YS4A 4E30A 3P75A 1U4SA 4HUQA 2VQDA 1AQ6A 1G8YA 4EENA 3VZDA 2X1VA 2GZ2A 3D8SA 3ODPA 4CL2A 2N46A 3GRKA 1M1NA 1OTXA 1HDZA 2C9CA 3M70A 5EGNA 4EUHA 2I99A 3RBAA 1K5GA 1G8SA 3OE4A 2WDZA 2QVZX 4RK1A 4N40A 3HOWH 3Q1KA 2QL9A 3GFBA 1E32A 4DMGA 1HEYA 3GLUA 3HI4A 3L7AA 3FHCB 4F86A 5CB4F 1CUHA 5IYCG 4TKMA 1U3UA 4BXOB 2HFKA 4EA6A 1N25A 3CLRD 2GZMA 5CVVA 1Q2UA 2EWVA 3VDYA 1UZLA 4CMGA 1L0XB 4IPTA 1EOTA 3IDSA 2KM1A 1DI0A 3KKLA 1WCYA 1U2SA 1G20A 1I6HH 2XVAA 1NTGA 1KD1C 1M76A 2NVQB 1L3BA 1ULUA 3OHSX 1O57A 1NVAA 3F4LA 5C8YB 2QVYX 4W99A 1PIWA 1VKRA 1Q8IA 3WWCA 2CLDX 2HW8A 2W22A 1JNYA 2QRVA 1XMSA 2IYSA 1K2WA 4KLCA 2AFHA 4XVUA 4E2ZA 5GY7A 1OAOC 3CQZH 3A1DA 3O2SB 4BNGA 4AQDA 2NUTA