3PV0A

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 86
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pv0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pv0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pv0A01
4FD2A 2IS2A 5M3FG 1NF3A 3VAAA 3HOZH 2ZR9A 4WZAE 3F2CA 5F98A 5J47A 1OXTA 3K81C 3EARA 3S1MH 2B63G 3AFPA 3K70C 4DAMA 1A2KC 4ZI3A 4LF6Q 2GILA 1YRAA 2F9MA 3AM1A 2W6JA 4Q01A 3TRZA 3EA0A 3S16H 1ODFA 2V54A 3AKEA 1XDBA 3K0FA 4M9ZA 5KYKA 2YKGA 1OH8A 1BVSA 1VQJA 3ADBA 3FDIA 2BA0A 2JJ2D 2O5VA 2E74C 421PA 1HQYE 1VMAA 1SVMA 2C9OA 1XNRQ 1HZCA 1HURA 4H02A 3B6YA 3PEUA 4G5RA 4Q19A 4DSNA 5FLMH 5KHOC 1DGSA 3GLGA 3A58B 2YJTD 4ZDJA 4I4LA 1OIWA 2ORVA 5JEAG 5KU1A 5SZJA 3C5CA 5CM8B 2BIFA 2VO1A 2AHOB 4C0BA 5IE8A 2PL3A 4IPHA 3WP0A 5IWAL 4LFBQ 2ZRNA 1DAGA 1S1MA 3PFIA 2ZUBA 1UE7A 3UDFA 3PG5A 3L0IB 3OAAD 2BWJA 2KHJA 4TLEA 3T34A 3W5IA 1H9MA 1Y8NB 2ZRLA 2ZAOA 1IL2A 4Q1FA 3S1NH 1XEWY 2IWHA 1WXQA 1Z0AA 3AF0A 4MGKR 1VQ6A 1W49A 4JZKA 4MUAA 3GLIB 4M1MA 3KLRA 5DLQE 3ASYA 3TKLA 4O2LA 4B6FA 4AG6A 4GZYC 1V8QA 4YHHL 1J99A 1NP6A 2AUJD 2JA6G 4P0TA 1J6QA 2C9CA 4US0R 4W5WA 2JEOA 3LY5A 3GJ8A 1KD1C 1VECA 3L43A 5CJ2A 5DSZA 4WBSA 4E22A 5H68A 4C3HH 1D2NA 4DSOA 2WPDD 2IYSA 4LYJA 2ZU0C 2X2EA 5B57C 1YI2A 4GKJQ 4AYWA 4MTNA 1VQLA 4LHVA 4MNOA 1KK2A 4ZDIA 3M0EA 4DCUA 1LW7A 4MYHA 2GTPA 2Q3FA 4IVRA 1H8HD 1HQMC 1WCMH 4GN5A 4P71A 2Z6KA 1RIPA 2BM1A 2L5TA 2ZTDA 4IDHA 2O8CA 1UE1A 4JI8Q 1SXJD 2W0MA 3EZFA 1XMOQ 3NH6A 2NVQH 3RABA 5FR1A 2GXAA 3MWJA 2VQFQ 4LZZA 5DYIA 2K7VA 1SVOA 3FMIA 3VFDA 2GJ9A 5C0XG 1CP2A 1AK2A 2JA8G 3T5GA 4B3GA 2F52A 3BZCA 1E9DA 4RD1A 4ITRC 4KKSA 1HNXL 5BN4A 2FE4A 4C0KA 4KCGA 4XH9B 2P5TB 4QJ5A 1OF1A 2FSGA 2N42A 4PPQA 1YJNA 2QM7A 2ZRCA 4HB3A 3M4QA 1BMFA 1N6OA 1OH7A 5JSZB 1QVRA 3AVYA 2C04A 3KUDA 4B34A 4MDEA 2J87A 1FTNA 4DDTA 1MO3A 3VU9B 1X6VA 3CCMA 1E9BA 3R9WA 3U58A 2FNAA 3OIVA 3I56A 8OHMA 4HIMA 4QQBX 3H3VH 1KHTA 1XD2A 4C0JA 3GQBA 4PHHA 1HPCA 1N6HA 3KJGA 1IBMQ 2N49A 4TYPA 3DOFA 5K36H 5IYBG 1FW6A 1YNNC 1E4YA 2A68D 1AZSC 1U2RA 3KF8B 1K8MA 2F43B 4OKSA 5AUQA 3JVUA 4TL9A 4A93H 1IXRA 4IW3B 4HJ8A 4XJXA 2ZJOA 4DIEA 1SR3A 3EZ6A 1II0A 2Q21A 4H0LC 1NBMA 1HNZL 1H9SB 1NVVR 1JAHA 2HF9A 4IXNA 2JLWA 3PF4A 3RWOA 4A9AA 4PZYA 4JI5L 1FQKA 3VU9A 1GL7A 1Q8KA 5IYCG 1Y1WG 1AS0A 2FX3A 1VQ9A 1DAEA 4JYAL 1LS1A 2A6HD 4YCWA 4DDVA 2D74A 4OHXA 2KSQA 4HLQB 4IOKA 2R2AA 2VPPA 5E4FA 3TAUA 5JECA 3LWNA 4MRRA 3UMSA 5LMUL 4LBVA 1K9MC 1KJZA 1TAGA 1VYUA 2F3IA 2A68C 1C0AA 2NZ8A 2JLSA 4NYJQ 4A3EG 2Q3HA 2W58A 3EIEA 1MRSA 3IILA 3Q5DA 3H15A 3IIMA 3KXIA 5LD2C 1IBKQ 1K6MA 3FKSD 4GZLA 2X8AA 5LMNW 3S1RH 1WA5A 2OWOA 1ZRHA 3FHCB 3ZIAA 4JI6Q 3F2BA 4S2EA 3BFVA 3K9HA 1VF5C 3U4QA 1ZM3A 5C4XH 1JJVA 3F8TA 4TT3D 4OQXA 1YZKA 3A8TA 5DLQC 3CNLA 4X66Q 3T1OA 3R9XA 1LUZA 3ZJYC 2PQAB 2QGQA 3NELA 1BYIA 1M7GA 1W44A 1SVIA 2I5LX 1A4RA 2X1VA 2ZEJA 4RZ3A 5EP3A 3BZKA 4JBJA 2QP9X 4I7ZC 2BJWA 3B78A 3TS0A 1ZKOA 1Z6TA 1NIPA 1KO7A 4YXWA 4BA2I 1YR7A 3R7WA 1Z83A 4A1FA 4B75A 4JV5Q 2OEPA 3B9QA 4K0KL 3L82B 3MFYA 1FX0B 2WB1E 1G6OA 1QVCA 2JLQA 3HOUG 3HU2A 3HWSA 3KKMA 1NTGA 2BCGY 1B9NA 2YWEA 3IRBA 3B5JA 2E2JH 5FL3A 3ZJYA 2QM8A 2KHIA 1X8KA 4MRPA 2C78A 2W83A 1NKSA 5KNBA 3J81i 1FMLA 3IBYA 1HV8A 4LCBA 4PHFA 4TL8A 4Z51A 3FVQA 3Q9LA 2YTXA 3NIBA 1L2TA 1RL2A 2G6BA 2NO9A 1HYQA 1NN5A 3BIFA 2EXDA 1R10A 2WOOA 1F6BA 2H5EA 1VQKA 4A3BH 2REXB 2KCCA 1NL3A 1ZCAA 4O3MA 4MRNA 3KL4A 3TGPA 1R0YA 4Y0AA 5KSPA 2CHVA 4WIAA 2PMKA 1GM5A 4QBGB 3X1DA 4URZR 2QGNA 1QUQA 3KUCA 4Q7LA 4DV6L 3MSXA 5E95A 3BWDD 3B1WA 1R0XA 4DB2A 1Z07A 2FSFA 2HXSA 121PA 2Q8IB 2OAP1 1W5TA 3CZQA 1E1TA 3T1HL 4NXML 1DOAA 1LB1B 3SNHA 2JLZA 1FL0A 1OH6A 2UUAQ 1N34L 4LK1C 1ZMXA 1NLFA 4JYBA 5LBIA 1IXSB 2O8BA 3HYTA 4B6EA 1GUAA 2GNOA 5IT5A 1XFAA 4K81B 4JI1Q 3MGCA 1EESA 2H5XA 1G291 4GOXA 4JVMA 4A3DG 1HZAA 3F2DA 4DB4A 2JJQA 1E94E 2GJSA 2UXCQ 4NBSA 3OF5A 4OBEA 3V00A 3NH9A 3UIEA 2BBOA 4Q5IA 3WMGA 5M5YH 3LV8A 4B35A 3STBC 4M4SA 1SVSA 4DBLC 1PLKA 2V9PA 4GKKQ 2C2HA 2DBYA 1DVRA 2VSFA 4N0EA 2ZM5A 1EWQA 2QE7D 2UUBL 1S40A 4JMPA 1XNRL 2D06A 3JC66 3TEHB 1VDZA 4G7ZC 2A78A 1YZTA 3I1FA 1T3SA 3FYHA 2R6CA 4QNRA 2EJFC 5JI3E 2EFHB 3I4NG 1NNEA 4OQLA 1I94L 3B8HA 3ICQB 2EW1A 3GLHA 4OWXB 3OW2A 2FZ4A 4D4JA 2O52A 1ZW6A 3U4ZA 1EXMA 4HAZA 2GK7A 4R4OA 3CONA 3S17H 1Y3AA 2DNEA 2YWGA 3ETLA 5FI1B 3W8RA 4A0RA 1VQIA 4RD2A 2A2ZA 1YZ6A 2ZJQA 1JEDA 2WSMA 3SC3A 4A3CG 3T61A 1K8GA 2IF2A 4H44C 2ZJZA 4JI3Q 1KDOA 3DKPA 4AKHA 5DIFA 1P73A 2ES2A 4G5GA 1FOEB 4DHEA 4A3JG 5FUYA 4EPYA 1ZM4A 2W6JD 4C0AC 1AGRA 3VX3A 2QA5A 4F7WA 2KWIA 4A82A 5HZHA 1VQDA 3TK1A 1SMYC 4QGFA 3WHKA 4CGZA 3QG5A 5IK2D 3KFUA 4BXXG 2BE5C 2PZGA 1HNXQ 1E2DA 3SEAA 1OB5A 2VL7A 1SHKA 3S2DH 1QDEA 1HR0W 5D3QA 1NJIC 1YVCA 2A5JA 4Q02A 2ZS7A 3VHLB 1DCZA 1T5IA 1TUEA 4EPVA 1IBRA 3IIJA 4BE7B 4DCTA 5J4KA 1YU9A 4JI8L 1PUIA 4QKQA 3TSZA 4TMXA 1SQ5A 4QGAA 4UQOA 2EWWA 2IYVA 3OW7A 1P2TA 3CZPA 1M6NA 2EQBA 1SXJE 3VR1A 4DNRB 3FKSA 4OXPA 4H13C 1R0WA 1U8AA 3B1YA 2ZJPA 5GJVC 4B3DA 4TMTA 4CDGA 4A3MH 1P9NA 3LAWA 2IHEA 2PI2E 2C8VA 1E2VA 4LUOA 3I92A 1NE3A 1ZC3A 1OJLA 1XXHA 2V55B 1F60A 1KNQA 4GOPB 3A8IE 2NPFA 1P2UA 4CW7A 4JVSB 4XWAA 4BBSG 4EPTA 5GADC 2ZRDA 2GZDA 5J3BA 4NB3A 4IO9A 1RZ3A 2ERXA 3ZS9A 1QHGA 1SROA 5TVKA 4C7OA 2ZRIA 3ZYCA 2ZIAA 4JBWA 3ICEA 2GJ8A 2V7QD 2QE7A 2JLRA 5KPJA 3NDPA 2R6AA 2H8KA 5SZKB 4IFDH 2VNUD 2IS4A 3LH5A 4OL0A 4RZXA 2QENA 1E2WA 1KTVA 4ILEA 1SMXA 3A5ZB 2ODBA 2W2VA 2WKQA 1W36C 2GEVA 4PC1A 2B8FA 4QHYA 5CJPA 5JI2E 3NBZC 4L8GA 5EE9A 3NG1A 4OO1H 3TNFA 5C4MA 5JJLA 3U7HB 1Q12A 1JECA 4DV0L 3ZZTA 2P65A 3RVBA 3E9HA 4LHZA 4KSCA 1FUUA 1TWAH 4QY7A 2JIZD 1NN1A 2FPLA 621PA 3K8YA 4LC1A 4EIWA 2ZR7A 4RKEA 4JCVE 1XCPA 3VR4A 4BY7H 4E5UA 1FNMA 1G5RA 3NBHB 3KJOA 1BKDR 1Q1BA 4BASA 2DCUA 1BH2A 1J70A 2I5HA 4LF6L 1G8HA 1R0ZA 1IBML 5GJCA 4BFYA 2IBMA 4A0GA 3R8CA 4BLOA 4C3JH 1NRJB 3FHWA 4UP7A 5EJEA 2QROA 4KODA 4LGMA 2R93H 3M3YH 1OKKD 4A92A 3AQ4A 1A62A 3KFXA 4LJ7A 3UDXA 4DV3L 3C14C 3MG9A 4M8NE 4Q4JA 4B48A 1X65A 3CCJA 1QVGA 3I8XA 3NTUA 1LM0A 4NKRA 4Q9HA 3BG3A 3KF6A 1JQLB 4URWR 1GRQA 1XMQL 3W5JA 2BMFA 5IYDG 5EE3A 1SZPA 2P3SA 2ZSEA 3CF6R 1JALA 4PXAA 4X62L 1IOZA 3PO3H 2IUSA 3CRQA 1S2MA 4DLSA 1IY2A 1WP9A 4DJTA 1GHJA 3AKCA 1QBKC 2HF8A 1Y1VG 1L8QA 4JI0Q 3RRZA 3E9IA 2IYLD 1LF5A 2K5NA 1U98A 2AFIE 2E87A 4LY6A 3ZS8A 2WFWA 3Q8XB 1E32A 3IHWA 2E75C 4HIOA 1EQQA 2BVNA 2CNWD 3WYFA 3OESA 1ANKA 3DEFA 3SE0A 1X55A 4GOPC 2ZR0A 1T5LA 2CJWB 4UNNA 4GNXC 3PGZA 3OHMA 4KBGA 4JBYA 2OT3B 2Q9CA 2VYFA 5AJWA 3WMEA 1W4RA 2AXPA 1NLYA 3TH5A 2VY3A 1RJ9B 1IAQA 4JL8A 5DO9A 5C3EH 1LVGA 1PUJA 4MRVA 4JVLA 2FDCA 1G41A 3RRYA 5JJKA 4FXPA 4DDWA 1ZNZA 4BLPA 3EA5A 2CMKA 2B6HA 3HFZB 2CHQA 3EWSA 5FBRB 1WBDA 5C1BA 1X8LA 4R4IA 2H1LA 1BYUA 1HT2E 1VQ8A 2OCBA 5GROA 2CJWA 1SXJA 4HDCA 3VQTA 3HOWG 2ONJA 2UZIR 5KNDA 1GKUB 1PH8A 1IJEA 1XEXB 1E2NA 3IKJA 4ZKEA 3MUFA 2QA4A 4C2TA 2LMCB 1XBTA 1F2UA 3Q8DA 1UE5A 2HUPA 2VUMH 2KI5A 3G0HA 2XTNA 1T6NA 1I50H 4AH6A 4Q48A 1X8JA 2RGEA 3SBEA 2BEKA 2YOFA 4TL6A 4Z8XA 3SHWA 4F93B 3KDFB 1TKWB 1II8A 2BMJA 4DV7L 4AC9A 5JZVA 3TUJC 3EQLC 1VIYA 2NG1A 4BECA 1RRPA 3FPPA 1TQ2A 2QGZA 4F4CA 2YYZA 1FVIA 2BC9A 1YNJC 1YBYA 3W1GA 2JA1A 2CKZB 1DG1G 4MKGA 4YMWA 4L5QA 5BN5A 1AQYA 2QTHA 2WWHA 3K0FB 2YTVA 2A3RA 1UBFA 3L2PA 2HLDD 4F38A 4OWWB 1KAOA 2JEAI 1O7IA 1MKYA 3CRW1 3WRYC 2Z6VA 2K4KA 4O0AA 1Q1ZA 3CPWA 4A8JC 3QEJA 2R92H 2FXQA 2L15A 1JBKA 2GVZC 3U3KA 2J7KA 3U3MA 2BMDA 5FOVA 4MITA 2XJ9A 3D4RA 1S1CA 2PEYA 3EZ7A 3AP3A 4OYHA 1C1YA 3GPLA 2IYQA 1Z0JA 2FFQA 3QOFA 4GLXA 4IFDI 1AS2A 1W0KA 2ONKA 4GI7A 1FGUA 1V1QA 2OLJA 3J81j 2R6GA 5M3FH 3PR1A 4JIMA 2DR3A 3QXJA 1BBWA 3CX6A 3L8YA 5FLMG 3HR8A 4BQSA 2F3TA 1E3PA 2J0VA 1KIMA 3OIUA 2E2HH 5TY0A 3TE6A 5E7JA 3FOZA 1DE0A 1VG8A 3QPWA 1S3SA 3I72A 1CSPA 4F4JA 2ANBA 4PQFA 2GVDC 5B58C 1EUJA 1OHHD 1YVDA 4Q4LA 3ADDA 3SS8A 1JJ7A 2Z4RA 5TB5A 2VQSA 4WXRA 1DAFA 4G3XA 2CCJA 1OXXK 4D81A 4PSAA 2RKOA 2B92A 1DO2A 1KKMA 2V8OA 1PHJA 3A1WA 5IP9H 4BPBA 4Q7MB 4L8JA 4QL5A 2FN4A 1Q57A 2JE6I 2JLVA 2PJZA 4GS3A 1HTWA 5IF9A 5DNYB 2RGXA 3MWKA 1A63A 2ZRKA 5JFGA 4D4LA 1IN7A 5JEAH 4DIDA 4NXNL 4IHQA 4KSBA 1XJVA 4P75A 2R92G 1W4CA 3A4MA 1ZD8A 2PX0A 2WJIA 2CLDX 2BJVA 3WBKA 1EWHA 4DLVA 3A1UA 4US1R 1Z6AA 5TARA 1G3MA 1NSTA 2PLRA 1FMJA 4OGQC 1Z0DA 1BO6A 1Q22A 4JLKA 4LHYA 1B8AA 1YZUA 4PV1C 4QFMA 3QKUA 3VR5A 4JLPA 4AWXA 3ZIAD 1Q46A 2Z83A 5EQTA 2WKPA 1E7ZA 4PPGA 1OE0A 5EXTA 5B2ZA 3RYTC 4D80A 3ULPA 4A3CH 2O0HA 2ZI6A 3OIYA 4NPHA 3GJ0A 3PIOA 3CCVA 4ZV4A 2HV8A 1UEBA 4LK2A 1OYYA 4BZXA 4CEJB 4I81A 2NIPA 4P4UA 3FHTA 4LUZA 4HAYA 4ABYA 1JJGA 1I4LD 1BDOA 4JYAQ 1VG9B 2QMEA 3FMOB 4I1OA 4J0QA 4NHOA 5ANRB 1EIFA 4MGIR 3S1AA 3EWAA 3OEED 4PC6A 2IHYA 5FLXc 5IHPA 1TX4B 4C0SA 4OI0A 2GK6A 3Q5EA 2ZYUX 1A8VA 1RYHA 4ZCMA 3DO6A 3KKQA 1HNZQ 4LDJA 4DDUA 2C99A 4XVRA 1E9AA 3H1TA 4RD3A 3AVUA 2ZYTX 4TWZA 1N3BA 4TSFA 1ZCBA 3A8JE 2OCEA 2BM0A 3E70C 4CEIA 4HLCA 2XZPA 3S15H 1P4SA 2NN6G 4XTRA 2QMUA 5DGXA 4B76A 1F2TA 2ZUCA 3GLHE 1AKEA 4POAA 1Z6XA 4N1AA 2WAYA 1MO5A 4JLOA 2I3BA 5AJVB 2GCOB 3CNOA 1R5OA 3KYHC 2BKEA 3H86A 4G5SA 2XB2A 2Q3MA 1AZTA 5GVRA 1WBBA 3W5OA 4I99A 4JYCA 2XJ4A 1WF3A 4LBZA 3S1AB 5TMPA 5HCNA 1XD9A 1L4UA 4IQZA 2CL6X 1CJVC 1CI3M 3A5UA 2DFTA 2OHFA 3I3SR 4Q1DA 4KHPL 2O5IC 2VQFL 4L5RC 2EVWX 4JI4L 1UKYA 2LCFA 3PQCA 4MQBA 1ONLA 5AUOB 5LB2A 2UUCQ 2PCJA 1GILA 4V0ME 4WAUA 1NJFA 1XMQQ 1KMHB 2KJQA 2V7QA 4ZDKA 4DNIA 5L3QA 2YZ2A 2ALYB 2WWYA 4OX9L 1BKBA 2K5HA 1T3LA 1O7LA 4KN4C 3D8BA 3H84A 4LHXA 1ESMA 4LOAA 4NCNA 1Z6YA 2HQLA 4DLUA 1MT0A 5IYCH 1TQ6A 1O87A 4DV3Q 1WE2A 4UXJA 4B71A 1EGAA 2CL7X 3DHWC 1NKTA 4LF4L 3FKQA 3T1VA 4EPXA 5F3WB 5EE1A 2VEDA 2O8FA 4KHPQ 1IW7C 2MO1A 4LF5L 4B43A 4NDZA 1TEXA 5IY0A 2B8WA 3IEUA 3RLNA 2W6IA 2A5FA 2XXAA 5JWHA 1S8FA 4H1VA 5FOTA 2VL6A 2J41A 3U3OA 4XOIA 3DM3A 2OBLA 1NBME 3Q3JB 4DCNA 2EDGA 1T9HA 1KO5A 3CO5A 3FFAA 1E2HA 3PENA 3QVUA 4URUR 3TR0A 4GBMA 4G01B 1ZUHA 2ZRGA 3K9NA 4FMCB 4JS0A 1IZ6A 4IPCA 3GEEA 4DR6L 4H1UA 1J5EL 1AS3A 3THXB 2F1MA 5L3VA 1LTLA 1AKYA 4ZPXA 1Z22A 2Q2TA 3UWKA 1TU2B 1G7RA 1N5JA 1VF7A 1UWVA 1GG2A 2QRZA 3CPJB 1Q3HA 3IIKA 4R9UC 2A6EC 4ASUD 3IO3A 1N32L 4YDSA 2OZEA 1DBSA 1TWFH 2XX3A 3BD9A 4KYIB 3UG7A 4V0LA 3A7AB 1GKHA 1JI0A 2BBTA 4HIDA 3PEWA 1VYTA 4JI7L 1TMKA 3CW2A 1SKYE 3EC1A 3OZXA 2IF0A 1RC8A 4Q4AB 4PAOA 4LF8L 4BLQA 3CNNA 2A19A 1O78A 2VQEQ 5JWOA 4XSHA 3BB1A 4TMZA 1SRUA 4UP8A 4LUVA 3LLMA 4TLAA 3J7ZC 4OHWA 5G3ZA 3GJ3A 2NO1A 1E2JA 1M7HA 3AGPA 4GP7A 4ON9A 3R9IA 4IOCA 3UMFA 1CULC 2GBLC 2IX0A 1PH7A 1VQ7A 2IL1A 1G5TA 4EJSB 4TQUS 2J7PA 4HJ5A 3W6OA 4U7DA 1OFUX 5HKKD 3PSIA 3QKTA 2XAUA 2FU5C 3P4XA 4NTZA 2KBEA 4B3TL 5H1SE 5EAYA 4A3BG 1GHKA 1JXOA 1UEIA 2BDTA 2CVHA 2R9VA 4HAVA 1QHHA 4LWZA 1JB7A 4W7SA 3T1HQ 2K52A 1Z06A 3IHLA 4D26A 4JI7Q 3G4SA 3EAQA 4EQ6A 4YQFA 4HATA 1JXMA 4D0LB 4L4UA 4IOJA 2O8BB 3AEZA 4P31A 3KJPA 1MJCA 3K09A 4DLYA 4HB2A 5CB8A 4R1JA 4HIKA 5L3QB 1YQTA 3CRMA 2E5LQ 5IDVA 4ME3A 5FTKA 3VNUA 5DHFA 2ZXUA 5AK0A 1YZLA 5JS8A 2UUAL 1FQJA 1UEJA 1Q81C 4QGGA 1VQAA 3R20A 4NCJA 2JA6H 2HJGA 1ZNXA 4F4IA 2JGNA 1PH1A 1CTQA 1XB2A 5FUXA 4RZ2A 3ZD7A 2MFIA 4DKAC 2OILA 4OQFA 2UXCL 2KB0A 4LF9Q 4DUGD 5KOYA 1G3RA 4M1TA 4D0GA 5JLJA 4C2UA 4DAYB 1K73C 3RZOH 2OCYC 3LQRA 4MUBA 521PA 4IPGA 3GD7A 3WRXC 1GNPA 4M2LA 1T3HA 1Q21A 1UKEA 4DV1Q 5A0FA 4EQ5A 4A15A 2ZSFA 2E5LL 1YR8A 4EPRA 3K70D 3PO3G 1IXZA 2N78A 4A3IH 1NN0A 4X8MA 4NPSA 2G1KA 5EP4A 3ADKA 5FBQB 5J4VA 1JR3A 1WCMG 2IYYA 2O0KA 2ZI9A 1P75A 3WYAA 5BQ5A 4D4KA 1B70B 2ASEA 2PT7A 4X66L 1N2CE 4IKEA 1QHNA 1TNDA 1J8YF 1XEWX 4IEEA 2NQ2C 1KSJA 1XMIA 2ZJ2A 4LPSA 4M9QA 2FA9A 3U4VA 4CRWB 1XTDA 2NTYC 3ASZA 3EW9A 4HUQB 3SYKA 2H17A 3M4OH 2HEIA 1XJ0A 4MA4A 1YIJA 1PH6A 3GLFE 3I5YA 1MR3F 6Q21A 5CDFE 1X56A 3AVXA 3NVAA 3AH8A 3QXCA 5G3YA 3H3VI 2JLUA 3A7LA 2GVBA 1E2KA 2ZI4A 1F3OA 3O8RA 4HJAA 3REFA 4QL3A 2OE2A 1KAWA 1AH9A 4G7OC 1KJWA 4GL2A 1JPNA 2W2TA 3RAPR 4AKGA 3GFPA 2FEOA 2A69C 4YWLA 3OFNA 4C0LA 3GLFB 3A1TA 4EX5A 1IW7D 2ASBA 1ZD9A 4KFSA 4N0DA 4BY1H 5DH9A 4Y52H 2GESA 5HE9A 1PFSA 4D6PA 3J80i 1KL9A 4C4PA 2DHRA 4URXR 4HUQA 3O8BA 5JWRA 2IYRA 3N70A 5FOSA 3U3RA 4OWTB 4D0NA 3GFOA 3GLHB 2KBNA 3STBD 3KLWA 3LFUA 4IPDA 3QQ5A 2ZU6A 4ARZB 3D0FA 4UNRA 3A8KE 4HR7B 1XRJA 2P2LA 4GZMA 1Z0KA 1ZU4A 4MZ9A 1CRQA 3P32A 5M3MG 1PH9A 2ID0A 1DO0A 2JATA 3QPUA 1Z29A 5CLQA 5DI3A 3WHLA 3X1YA 5HY6A 4MH0R 3BBPA 4PPNA 2HYDA 4AYXA 4JI5Q 1TTTA 2MMGA 1X54A 2WZQA 4OHZA 1KO4A 1N0VC 1HH2P 2OLKA 3SOPA 3CC7A 5C2JB 5CITA 1F5NA 2PPBC 4KMUC 3DPUA 4L5BA 1FPMA 3M4PA 1IXRC 3K1JA 4DWJA 1NVUQ 4NP6A 5BW8A 3LDAA 3ADCA 1PVOA 4QJ3A 1W3SA 2IUUA 4BZPA 3B1VA 4PAMA 4LFCL 3SJAA 4B32A 1B9MA 5ELOA 4B73A 1CIPA 1PH5A 2DFKB 3AF2A 1KI4A 1UBEA 3CPHA 5HCIA 1XMVA 1US8A 4AURA 4HLUC 2GVAA 1Q86C 2FFAA 2WJVA 3DM9B 3P4YA 4OJQA 4XVQA 1VIAA 2IHFA 4G5OA 1VQCA 2OBMA 2W0SA 2OUKA 3BOSA 4C3IH 3CH4B 4QHTA 4P32A 1JMCA 3GLGE 4FINA 4X6AH 1YJWA 4YLGA 3AB9A 1YITA 1UPTA 2ORIA 1LACA 3EASA 3I5XA 2ZUDA 2IYUA 3X1WA 4DR7L 1L1OA 1P3JA 2IXEA 4KFUA 4DZZA 4LFCQ 1XPUA 1L2FA 2OG2A 5M5XH 3TS2A 1HQCA 4HB4A 3CMEA 3EG5A 2ZM6L 1V43A 3PUVA 2ATVA 3ZZ0A 4L5SA 3U5ZB 4O25A 4APVA 1BMFD 1W4AA 2ZITA 3HDTA 1KQSA 4V0MA 3PUYA 3OEEA 1SFOH 5FPTA 1A2BA 2DNCA 1CUKA 1ASYA 2YOHA 1E0AA 2GA8A 4GPTA 4IXMA 1HZBA 4IOLA 3CWZA 2K14A 3D7MA 4PZ6A 3FFBA 1Z3IX 1K0RA 4P74A 1HNWL 4GOKA 1KJYA 4NCHA 5DISB 1KSFX 3HP1A 3UXMA 4MGZR 3Q72A 3ZLJA 1N6KA 4TMWA 1N0WA 1RIFA 2CLCX 4BGDA 4M22A 5FPHA 2OFWA 3TJZA 4DEYA 5P21A 3HOYH 3AUXA 4M1WA 4OONA 2DYKA 3L2OB 3SU8A 1AGPA 1IN4A 4ERNA 4RCYA 2A6HC 3UDIA 3CCRA 5J4YA 1DEKA 2QRNA 4MKFA 1U0HC 1NLZA 2NZHA 3KDSE 3QVVA 4DT1B 4W9MC 1Z08A 2GCOA 3BE4A 1Y1VH 1ZU5A 4B3RL 5CYOA 3RS0A 1A1VA 4TZ6A 4CYMA 2Q2UA 1S72A 2ZE5A 4GKKL 3BS4A 2R7DA 4E09A 3ZQJA 4B3SQ 3NXSA 2P6RA 3EPHA 3FKIH 1DS6A 1HH4A 4IDNA 1KZGB 4IEIA 2LKCA 4OI1A 3EPKA 4UP9A 2XB4A 4I1UA 2XNDA 2IXFA 3MLEA 3TMKA 4DK6C 4PG3A 1XD8A 2EU8A 3W90A 3KQNA 4M1SA 2I0QA 4TLCA 5HR5A 2A30A 4RMFA 1U94A 1UBGA 2LKDA 2QNRA 3AB3A 3H4MA 5CIQA 1M34E 3IGFA 1P61B 1OTCA 1ZNWA 4G1UC 4LFBL 5C44G 4EFLA 2FGKA 1WB9A 1ZAKA 1J8MF 2BEJA 1TWGH 1U90A 2XEXA 1N8RC 5K8IA 1YEZA 1OB2A 4TN1A 3KZ1E 5FOXA 3ECCA 1E2PA 2NZOA 1Y14B 3K09C 3KQUA 4EQ6B 2BDOA 3TQCA 3CCQA 4AK9A 2D2FA 5FUVA 1N6NA 4DV7Q 1EYGA 5C0XJ 1KY2A 2A5DA 2N1BA 4HYYA 2K32A 1RRGA 2J1LA 3CRKC 1G51A 1Z8FA 3THYB 4URYR 3S14H 2Z0MA 1W46A 4MKIA 2RGNA 3IPYA 4TMVA 3QKRA 2AUKA 1VCNA 2R8RA 1YR6A 2AKWB 4XWKA 4A6PA 1V9PA 2K5UA 5BXQC 1E2IA 4RSGA 1QUQB 3OE7D 4L5TA 4PTLA 2B8GA 1NMGA 3FMFA 4KO8A 5FI0B 3WNBA 2VHJA 5KO2A 5M3MH 1QVAA 4FW9A 3MXUA 2WAQG 4BLRA 1KIXA 2O0JA 3HOXH 3GMTA 4K46A 1QRAA 1M90C 2C77A 2ZYVX 1GJXA 1H8HA 2ZANA 3CKLA 5GAGC 1Y8OB 4DPGA 3I2ZA 2ZREA 3PCRB 4DV2Q 3AEVA 4M9SA 4AD8A 1JJ2A 1KYIA 2E1RA 2D5DA 4RG1A 1ASZA 1XU4A 2UZ3A 2BMEA 2PT5A 3VNVA 2GBLA 3CPFA 1N32Q 4KYUA 4W5HA 4RD6A 3TQFA 3V9PA 4FCTA 1Q90A 4DNTB 1N5KA 4FWIB 4JOIA 2D0OA 1TU4A 1X6OA 3U2QA 3QSYA 3PUWA 4NYIR 3EZ2A 2VA8A 4UXHA 3L0PA 1CKEA 2DUDA 5E3HA 1P7CA 2CXXA 5DN6A 4C3ZA 3J80c 2K50A 2P67A 3K80C 4DK3C 3A4NA 5GVSA 1S9HA 3G82C 3CCEA 2G77B 1U8ZA 2CCKA 4IVQA 1GFIA 4DR3Q 2F1JA 2ZJAA 4EUNA 1U81A 2QP3A 1CFMA 1MABB 2R6FA 4DV1L 1M1KC 1NI3A 2WIBA 3LX5A 3IO5A 4Z1MA 1EIYB 1W2BA 1MV5A 1SXJB 2VRWA 4Q1BA 3GTPH 4QBHA 4DCVA 1PV4A 2EWVA 2V3CC 1Q7YC 1XEXA 3NWJA 4MYTA 1JEEA 1KDRA 3H2YA 3B1XA 1I6HH 1CXZA 4LF9L 3PXGA 3BJUA 3TUIC 1Z2AA 1XXHE 1ZM7A 2NZJA 3CPEA 4US2R 1GTVA 2J5XA 1PYBA 3QEOA 4D2IA 3KOJA 3KDFA 1QHXA 2EVBA 4YWMA 1W0KD 2D3WA 2GCNA 2P6UA 3IQWA 1NY5A 3KKPA 1KDTA 4KI0A 3MJRA 4FCWA 4M1OA 2R65A 2IX3A 1VQBA 2O5JC 4BFVA 2NOAA 2ORWA 3SGIA 2DWOA 4JG2A 2XZLA 3I7FA 2ZRAA 5D3MB 4A4IA 1OH5A 2I1QA 4IFDJ 4GNXB 4NYJR 5CDFA 1E69A 4P33A 3NBFA 4I1VA 4LNQA 5FR2A 1JR6A 2GEDA 5M5WH 1G6PA 4Q9KA 3H0GG 3PCOB 4YMTA 5B64A 5IP7G 2JA7H 1MIUA 4POGA 2F1HA 2ODNA 4R2IA 4BFUA 3T06B 1CU1A 1YHNA 1CR0A 3SFZA 4JI2L 3CM0A 4LV5B 3K70B 2L0XA 3RHFA 3SR0A 2JQOA 1C9OA 4R98A 1ETUA 2WMNB 5KPDA 2ZTSA 3J7A5 5BYJA 2XTZA 1RVDA 3RR5A 2FSHA 1GP2A 1MKHA 4KFRA 2WB1G 4G7HC 4NL4H 3TVTA 2OSBA 3WY9A 1YHAA 3C16C 221PA 1OIXA 3AVWA 1CF4A 4CF7A 4KKUA 3KX2A 1KAGA 3ZH9B 2FWRA 3HOVH 2ZETA 2ZSBA 1TF5A 2IEZA 4OX9Q 1ZM2A 4U5XA 3CRRA 1XTKA 4GOPA 4B3SL 2XITA 4Y7NH 2EJGC 1P2VA 1QZHA 2G88A 1E22A 2XOKD 5DI9A 1AE2A 1TU3A 1ZJ6A 2WAQE 3PV0A 3U44A 1H95A 1QHSA 3SZRA 3RLOA 3IEVA 3I4LA 2G3YA 2CQOA 4TYYA 2F1RA 2WOJA 2E8GA 2HHHL 5FPSA 4V0OA 5FTMA 3NHAA 5IYDH 2HT6A 2R7FA 1F2TB 4JLMA 3EIVA 1Z2CA 2QZ4A 2NO7A 5JCZA 4PC2A 1UKVY 1G9XA 1LYLA 3LNNA 4A93G 2WIAA 3NC0C 1OKKA 2AN9A 1E2GA 4Z1MD 2REOA 4GN3B 3BGWA 4EJSA 2BOVA 2Q2HA 2JJ2A 3Q85A 3NHBA 3AVQA 1CR1A 3LGJA 2ZRJA 1XD2B 2I1VB 1AN0A 2KENA 1KY3A 2ZI3A 3CAMA 1IY0A 2A8VA 3REGA 3QXXA 1XJCA 1ZYRC 1JAIA 2DGYA 4GOJA 1F48A 1UM8A 2ATXA 4HJ9A 1EK0A 3LVQE 2UU9L 3PO2G 4K0KQ 4DUYQ 1YNXA 2GXSA 4TLBA 4TTRA 3LBNA 1E79A 1V5WA 2XTMA 4UY8C 2ZS9A 3Q7PA 1EFUA 2PH1A 4N3NA 4BFWA 1OYWA 3D6TB 4JLAA 4ESHA 1RRFA 1GITA 2C95A 3GCGA 3IUYA 4JLBA 4LJ4A 3RSLA 4ZCIA 2ZJBA 1HNWQ 4XTCS 1HTPA 1JT8A 2O8EB 4R4CA 4ACAA 2Q9AA 4IOAA 4Q1AA 4GFDA 3EBEA 1SKQA 3SQXA 4LJAA 1UDXA 3LD9A 4Q18A 5AJ3Q 5KDOA 5J40A 3RANA 1G3IA 1Q0UA 5HE8A 2IC5A 2QPTA 4PHGA 2XXAB 1CRPA 3GTJH 1J7KA 3ZD6A 1X9NA 5HZKA 2JLYA 4KKTA 4OJKA 1G7SA 4TYWA 1XMOL 1BS1A 5JHHB 2A69D 3RDPA 2REBA 3NDBB 1D8LA 1AQUA 2EFDB 3HJNA 4ZKDA 5KSZA 3LXRA 2N3SA 2D2EA 4DVGA 2GJAA 4ACBA 5LDDC 4KXFB 3K53A 4AIIA 4EDHA 2FSIA 4NMMA 4KHZA 1GUTA 1WJJA 2RHSB 3SQWA 3K0EA 2ECKA 4DLRA 4Y0VA 2OTLA 2XTIA 2C03A 4A3FG 1DAHA 2IXGA 4V02A 4GKJL 2H7VA 4NCKA 3MXNB 4KLZA 1G17A 4C0QC 2CW0C 2XZOA 1YZGA 1X3SA 1R2QA 3FPAA 1NBWA 4UNSA 5AJYA 4AKEA 4A36A 4P73A 2H18A 2JJ1A 2IYWA 3FE2A 1TQ4A 4DUZL 1TPZA 1G19A 4Q4AA 2LWIA 2HXYA 2AMCB 2ZQ5A 1YHQA 4YHHQ 5LD2B 1Y63A 4M0LA 5H8WA 4QJFA 3CUEF 4C30A 3TRFA 2VHUA 2XGJA 3GJ5A 3TW8B 4TKOB 1E0JA 3MCAA 2PI2A 1U5KA 1H9JA 1RJ9A 4GLAC 2F43A 1C7YA 1EOVA 3DXJC 4RCNA 1HR0L 2ZRHA 1R5BA 4Z8YA 4LFAL 3SN6A 3FWYA 2Z43A 4MKHA 3G71A 1KNXA 2FFHA 2PZEA 2WMOB 3A74A 2FH5B 5IWAQ 1N6PA 2MMCA 4YONB 1X1RA 2QTVB 3U7GA 1MH1A 1VKJA 4DR3L 1UE6A 1XZQA 3AF3A 1AJEA 1T5EA 1R8SA 4JI2Q 2GWHA 2QSZA 3ULJA 2V4ZA 4JT2A 4IDOA 4LV8B 1Q1EA 4LUCA 3U3JA 4BFXA 1YHBA 1XNQQ 3LVRE 1VQ5A 1TUIA 5IK2A 3ZZUA 3C5HA 5DYGA 3WWVA 1NSFA 2CNWA 2QPOA 1RE0A 2BE5D 4PO8A 3T15A 4L16A 2HT1A 5K8LA 3CCLA 4IFEA 1F2UB 3X1XA 1GVNB 3BH0A 4B3XA 3KF6B 2R6DA 4ESVA 2K5VA 3KTAB 3E1SA 4ZIRA 1T91A 4HB0A 3CMAA 1OPXA 3K0XA 2D7CA 4MDFA 4Q7KA 3CC4A 3CQZH 4A3MG 1XMJA 2FJUA 3KXKA 2GF9A 4MGYR 4EJSC 3N5CA 4C9BA 1BBUA 2ZJ8A 2ZI7A 1VQPA 2X19A 4B47A 4JKYA 3HOYG 1XPRA 1H9RA 4UPAA 4L9SA 5FL7A 5KSYA 2GDJA 1MABA 4NONA 3KQLA 2QAJA 3O8CA 2JAQA 2RHDA 2A1AA 3A0JA 2YWHA 3C7KA 4PPFA 4PSKA 4P4SA 1DAIA 2QTFA 3QE0A 1U0JA 4HZUB 4A4DA 3I4NH 1DAMA 3VKHA 2OQKA 5EUMA 4V0NA 3TSOA 1UFQA 1HR0Q 3FMCA 1SLJA 3B7GA 5EXPA 4QM6A 1IHUA 3F1ZA 1N5LA 4HDQB 1FX0A 3DZDA 4C0HA 1VQGA 1CJKC 1JR3D 1Q20A 2RCNA 3I4MG 2F55A 3CR7A 4TVAB 4IDQA 4Q9IA 1E0SA 2C98A 4AIMA 2HDNB 4RFSA 1OSNA 2V1XA 1XF9A 1UBCA 3WP1B 4Q1EA 3VMFA 1SGWA 3CW2C 1LY1A 1QHHB 2BCJQ 2FPMA 2KBFA 2ANCA 3W3ZB 2NVTH 1ZIOA 1R8QA 4JLDA 4DK0A 3HKSA 3CB4A 3RZDH 3I73A 1OFTA 4ALPA 1KI7A 4PAQA 3PF5A 1YZQA 2VSXA 2NPIA 5TV2A 2D0PA 3A36A 1G8PA 1EFRA 1DARA 4WZBE 2GN5A 2ZPTX 5JJIA 5DHAA 3HKZG 3TUZC 2EFGA 2QSYA 2GZHA 1I4DD 3WMFA 3CF2A 1S0UA 5IRCD 3QBTA 2ZAMA 4TZ0A 1E98A 2RF4A 4DV0Q 4A0FA 5J4HA 1L0WA 3PIRA 1Z63A 3I62A 2VBCA 2Q6TA 3U50C 4OQNA 4A3GG 1IN8A 2WJYA 1P9RA 3H94A 2C35B 1KI9A 1LNZA 1RFLA 1VG0B 3GTGH 2EQSA 3S1QH 1Z6GA 3RC8A 2LXKA 2AX4A 2WM9B 3QY0A 4R7ZA 1U0LA 1U99A 2CLSA 3BERA 3UK6A 4AY2A 3GLIA 3RS7A 4NCIA 1N34Q 3NE5B 5FTLA 4DK1A 2VHTA 3FMPB 2JK8A 2XSZA 4JLVA 1OXUA 2B8TA 5FOWA 2QBYA 2J0QA 2NGRA 4DR5Q 2JEBI 2P6NA 2ERYA 3KKNA 4OI4A 2VHCA 1QVFA 3HYRA 4KN7C 3RC3A 4DXAA 1I5FA 4KITB 4AKIA 1ZM9A 3HOXG 1XNQL 2AWNA 4YCUA 5JEDA 2C9YA 3MWLA 3UANA 2VIIA 4QHSA 3GTMH 3ZGXA 3ZVNA 5JEEA 2PJRA 2FPKA 1R4AA 3IQXA 4JI6L 2UXDQ 1CLUA 1Y69U 1K83H 4X65L 2E9SA 2YOGA 2ZS8A 1H9KA 3EXAA 2ZM6Q 5LB4A 1YZNA 4QJ4A 1XTIA 2H57A 4QGUA 2CE7A 4HUTA 1KI3A 2QT1A 2PNHA 2VP6A 2B63H 4OK5A 4RD0A 1E2EA 2PMDA 1Z47A 4KJZA 4TQAA 2JCSA 1LF0A 3V4FA 3VA7A 1S9DA 3QNUA 1EG7A 5LMUQ 1SVLA 2A7QA 1KHIA 1G1MA 4LBYA 5GJWC 3ND8A 2F1IA 5C4XG 3B9PA 2NN6I 1WQ1R 5FBWB 1N36L 1W5SA 4CT5A 2FGJA 2QY9A 1KOFA 1MO4A 4LF5Q 4RVCA 5GAHC 1EX7A 3W9YA 1G21E 4OO1G 2C5LA 4X62Q 4D82A 2D7DA 4CEIB 1J5EQ 1KK1A 1HE1C 2QN6A 5F9FA 2QL6A 2SHKA 2AD1A 2WWIA 1E0KA 1S96A 4XD7A 5AJXA 1J90A 1B7YB 3CF0A 2J0SA 4X64Q 4PSVA 3CRVA 3KXLA 4P3YA 5LPNA 3CF5A 2ZYWX 2OBNA 4WXPA 5KSOA 3ND9A 2HHHQ 4ARZA 5HTKA 4BWYA 3F5FA 5C4GB 2VF7A 5ELNA 1VQOA 1LFDB 3LBIA 4IRUB 3SI7A 1A5TA 1EWIA 4YCVA 5DI3B 1U8YA 4BEBA 4M9XA 1HEIA 4Q9LA 3QIAA 1JJCB 4JC0A 1L4YA 1P5ZB 2BV3A 3TW4A 2VZAA 3CR8A 3C4JA 1COWD 4LC0A 3CX7A 3BORA 3WBJA 1E4VA 2B21A 2QQEA 2YVUA 3KJEA 5G53C 4EAQA 2ZTCA 2B7CA 3MMPA 4BLSA 1GD7A 4TSFD 3OFND 1KMQA 2Y0SE 3SYLA 3CIOA 1VQNA 5AUPB 1DTSA 4PMWA 1CJTC 3H0KA 3K0AA 2D4HA 2FFBA 4X64L 3NC1C 2O8DA 4JBKA 1P2SA 1YR9A 2OO7A 2ZT9C 2J0UA 2PBRA 1GRRA 2RHQB 3RNUA 3LLUA 2OFOA 2RGCA 2UXBQ 2FMXA 4YY3Q 3KB1A 2OV2A 4JJKA 4A2PA 1QF9A 1KO8A 4FMDF 3AUYA 1N6IA 2G83A 1VHLA 1XTRA 3JZMA 2AK2A 4LI0A 5EZ6B 4CZ2A 1RPZA 2VSOA 3RSOA 1EWRA 1VCIA 3FKIG 3GJ7A 2J7PD 3EPLA 4FDBA 4KLKA 5E7NA 4CEHB 5C46F 1R6BX 4LJ5A 3LQQA 3QXSA 3WNCA 1G5PA 3DVLA 1W0JD 3QKSB 2K75A 1JPJA 4A3DH 1D9XA 1LV7A 2VF8A 1W1WA 1IY1A 2JA8H 1DXMA 1L1OB 5L8VA 1VQ4A 2P5SA 5SZHB 3K7UC 4PZLA 2F9LA 3BDOA 3ZVRA 5F9HA 1TEVA 3K0AB 4HSEA 1FJGL 2IYZA 3EX7C 3G48A 4JLNA 3TIFA 1KXLA 4DRZA 3DOEA 3OEHD 4M53A 1SVWA 2MSDB 4GMDA 3OOCA 4IDPA 3BXZA 1EQRA 4Q4HB 3ONWA 4D4MA 5KTYA 1ZVQA 2EIFA 2ZTEA 3A37A 1VHTA 3LNCA 1UDWA 2TMKA 4WVFA 2IW3A 3LXXA 1KI2A 4OHVA 3R7WB 2N46A 3TZUA 1I2DA 3HKZE 4DSUA 4NXNQ 3AVOA 4LX0A 5CLLA 1IN6A 4A2WA 4A2QA 4KV9A 4Q66C 2HJVA 4LYHA 4MRSA 2J59A 5L3SA 2CHGA 3I61A 2FG5A 1D8TA 1I3QH 2VUMG 5EUQB 2WICA 4TT3A 3LX8A 4B3MQ 4RFVA 4EPWA 1UKZA 3T1YQ 2E2IH 2AKYA 3M1IA 4OK6A 1B0UA 1E2LA 1KC8C 2J46A 4RJLA 4M21A 1OW3B 4A3FH 1M7BA 3C15C 4DV2L 1Z7TA 2UKDA 2OFXA 2OQ0A 2OCPA 4RKFA 3MWYW 1KI8A 2CFMA 5EE5B 4X8HA 1RRCA 1NY4A 1G8FA 3BH7A 5EXXA 3NBYC 1E99A 1FZQA 2IX1A 1I4TD 2FF7A 2QU8A 3LRPA 2RH5A 4L9WA 2YTYA 3AVTA 2ZJYA 4U02A 4I1SA 2VLIA 4JLJA 2PMZE 2ZRMA 4JV5L 2IA5A 1CKNB 2VP9A 3THXA 1HUQA 4AG5A 4A76A 4AQYL 1CS4C 1PH3A 1P62B 1W47A 1ZP6A 2IY5B 2WJHA 1TF2A 2KA7A 1GKYA 1SVKA 3U6KA 3PJRA 4UNQA 2O8EA 1TQDA 2EJMA 1GVPA 1CR2A 3CP0A 3TQYA 4DR1Q 1E9SA 1L7VC 2MSCB 4LW1A 3GEIA 3UMRA 1NBMD 4IFDG 3O8DA 2RAPA 2XOKA 4QG7A 2IWRA 5GAEC 2AD5A 2CCZA 2BBWA 4MYUA 3HU1A 4XVUA 1UAAA 4PC3A 3KKOA 2ODWA 1D6JA 1ZNYA 2GXQA 3QKRB 2ZE8A 2AFHE 3K0SA 1UADA 4LV6A 4ZIRB 2IUTA 3QF4A 1ELOA 4BEJA 2CDNA 1GO3E 4L15A 2Y8EA 4DLXA 3SFVA 4A0HA 4DV4L 3T35A 4GN4B 1DD2A 3WYGA 4YC7A 5BR8L 1NMFA 5BR8Q 2AKAB 5FBVB 1ZD1A 1S3GA 1KDPA 1YJ5A 4A8JA 2Z0SA 4TQ9A 4PR0A 3BAFA 3U7EB 1Z28A 1M8PA 1EFTA 1A7JA 2QUZA 3ERSX 3AVVA 1XCGB 2IYXA 4QNMA 2IS6A 1IONA 1E24A 5DE3A 1E1QD 5K8TA 5TDHA 3VR6A 4P4SB 5BYKA 1E2ZA 3AV0B 2I5MX 3MD0A 3VR2A 4GSYA 1IJFA 1K8AC 1N33Q 1G6HA 2VP2A 4YMVA 5JCPA 1KSGA 3IBGA 1SE8A 2YINC 2IK8A 2GKSA 3QF4B 4XWOA 1K8OA 4V0KA 1T0HB 3I55A 1NG1A 2IS1A 1D5CA 1P9WA 3VDYA 1WCV1 1M2OB 1ZBDA 3EIQA 2WJGA 3GJ6A 4LF7L 4ZCLA 3IFTA 3FP9A 4YMUA 3HOWH 4WW0A 2GJKA 2GXUA 2H92A 5TXGA 1EX6A 2OXRA 4LF4Q 4TL7A 1WDTA 4LJYA 3RS4A 4S35A 3I4OA 2OM2A 4B74A 2LSSA 2JXMB 1U9IC 2PCFB 4OO1I 4HLUA 3A6PC 4DR7Q 2CCGA 2CK3D 4C2MH 1HT1E 3FB4A 3OE7A 3QI2A 2QAGA 1QJOA 2R7ZG 4JK1C 2F4VL 4JI4Q 3HOVG 1JQJC 2H16A 3QPVA 1LTQA 1FYCA 1KO1A 3W3AA 4A3KH 3T1QA 1RYFA 1GL9B 3HR7A 4B3CA 1NY6A 2ZJRA 3QXHA 4DR2L 3JAMc 2W2XA 4LJ6A 1NMYA 4QM7A 1U9IA 1CKOA 3AGQA 4WZ6A 3C41J 2JJ1D 3HGBA 5C3EG 1E9EA 1XJQA 3P27A 4UXIA 3ZDQA 3D31A 1W36D 4HLDA 4DR6Q 2DFNA 5D3MA 4XSGA 1DG3A 1E2MA 4GNXA 4IFBA 1YKSA 5L3RA 3L0OA 4OHYA 1VQFA 1IM2A 3W6NA 5FPYA 3NEMA 4OK3A 3BJIC 2QBYB 2GF0A 1VYVA 4B3ML 2QMOA 2I4IA 2V6IA 1D2MA 4QGHA 1X86B 4KVGA 3X1ZA 2WAXA 5LMNQ 2RGNC 1GNQA 1D9ZA 1Z0IA 2GEUA 4B3RQ 3PVSA 5J5CA 1FP7A 1G8YA 3GLFA 1X3FA 4LFAQ 5FBLB 5FH9A 2FV8A 2IEYA 1TWCH 4BFTA 4WA7A 4W5JA 2ZE6A 5JEAJ 1JR3E 3Q7QA 1H8ED 4KBFA 2DN8A 2R62A 3M6AA 4NH0A 3RRMA 4PZ8A 2QI9C 1QHIA 3I32A 3WNDA 4FMDB 3KB2A 2J0UB 2KE5A 2JA5H 2QPAA 3OIWA 1LABA 1E1QA 4Q1CA 4YDHB 1VQMA 1ZUNB 3U7FB 1Z6HA 1A0IA 2HIXA 3UWOA 2VW9A 4PZ7A 5FJ8H 4DV5Q 1IBLL 2OXCA 2WSSA 3O47A 3QENA 3W34A 2XNDD 2DWQA 4LBWA 3W1BA 1EFHA 1OHHA 3U44B 1XTQA 1HCZA 2V1UA 2NVYH 1IYJB 5AJ3L 1G7CA 2GCPA 1E1RD 3RWMB 4BFSA 2AXNA 4PANA 4CEHA 4PQRA 1SHZA 2PX3A 2E76C 1KI6A 3S24A 2QT0A 2YC2C 4HI0E 2Q9BA 3GTLH 4HAWA 2J9RA 1Z0FA 2QAGC 2ZVQX 1J2JA 3T12A 4Z54A 3U6BA 4YMSA 1E3MA 3NKVA 3CRLC 1E9CA 4DT1A 3TREA 2EYQA 3TAHA 2Q0HA 5KNCA 4YY3L 1FTSA 4Q7JB 5K36G 5IYBH 1N5IA 2O8CB 1E9FA 1VG1A 821PA 3VHXA 5HPYB 4DR2Q 1G3QA 1QG4A 2HLDA 1XXHB 2X2FA 3PO2H 1IQPA 2OTJA 3EC2A 1OT3A 1NIJA 1G64A 3GDEA 1OXVA 2NVXH 3AFQA 1GWNA 4LYAA 4GNKA 1XZPA 4GP6A 4HEJA 4F92B 3RN5A 4BZQA 4NYMR 4C7OB 4GDFA 4E07A 1QZGA 3GP8A 2YV5A 3T1TA 1JNYA 2R7ZH 4LRWA 2HIVA 3J81c 4BBSH 4DUYL 3HPRA 1O3YA 4GRAA 4DKXA 4RCZA 1XEFA 5L3SB 3CBQA 3IPXA 3K7AH 2UUCL 3VR3A 3U4QB 2CVFA 2CWPA 3OPOA 3P20A 5LMNL 1KK3A 3AVPA 3MRSA 1I2MA 4G5QA 5GADl 3DDCA 3RLFA 4TTQA 4U00A 5CM9C 5C0XI 4RY2A 4NU0A 1M1YE 3IDQA 1DELA 2PLFA 1Q3TA 2ZVPX 5FTJA 1Y8PB 3QF7A 1YE8A 3LO5A 2NN6H 4R4QA 1FP6A 1NVXQ 2V4DA 1FUKA 1G7TA 1RKBA 1XWIA 1W2GA 2ZJ5A 5AWFC 4LWCA 1QZXA 1OLOA 2FEMA 1PLLA 2LXJA 2IHBA 2QP4A 3WDNA 4G0NA 4HAXA 4Q03A 5CK5A 1T8TA 1NG9A 2B7BA 2WWGA 3M9BA 3M7NA 2UXDL 3W8NA 2PZFA 4Q47A 3THWB 4A3KG 1G4UR 2BH8A 4AYBG 3SJZA 3CC2A 1H9SA 4DUGA 1R5NA 1OFHA 3GLIE 1WFQA 2JA9A 4A3EH 2GRJA 2J3EA 2QEQA 2XSZD 1E9RA 1XTSA 5JRZA 5IP9G 3K8AA 3B1ZA 1Q82C 4POFA 4B3FX 4Q4HA 4TLDA 3R8FA 2V6JA 4PFSA 4BFZA 4JVNA 1YJ9A 2DPXA 3DKVA 1CJMA 3K0CC 4KFTA 4KLNA 4OI2A 4EFMA 5E7MA 4OQMA 1I94Q 5SZIA 3UDGA 1N6LA 3N2IA 4O2RA 2CK3A 2KCMA 5KDDA 3U60B 1OIVA 3CD6A 4JBMA 5IP7H 3RN2A 2A6ED 2JA7G 3T53B 2EYUA 2JIZA 3AF4A 4NZYA 4TTPA 2WVJA 4LF7Q 4JSYA 5FTNA 4RFSB 1COWA 3G6EA 4WOPA 4Q9JA 4DR1L 3CXCA 3DMDA 3VKWA 4A8JB 1GZSA 4UKDA 4R71A 3L7ZC 3NENA 3UE0A 1DADA 4M1YA 1PH4A 3H0GH 3BC1A 4ZI2A 4A75A 3AYHB 2BH2A 2W6ID 1G8GA 2ZE7A 1GUGA 3BFXA 3B85A 4B3BA 1K8RA 4DV6Q 3FGNA 3NEYA 4CVNA 1E96A 4V03A 1GIAA 3VKGA 4QRHA 3B6EA 4QBIA 2MSEB 3HOUH 3JAMi 4PC7A 2F3RA 2JA5G 1EFCA 1JB1A 2YWFA 2DFLA 1A82A 3M4YA 4QIWE 2AL7A 1PZNA 1HE8B 1HY3A 3N2EA 5FJ8G 2B29A 1Z9FA 5JHGB 4A6XA 3F0TA 1MO6A 4M1KA 2JDID 3M85A 5DN6D 3LA6A 3AKDA 4LPKA 3SJBA 3BH6A 2JLXA 1VQEA 3DMNA 1HA3A 2ODEA 3CCUA 4WJ4A 3BU2A 2AWOA 3T1YL 2R93G 1R7RA 3B2EA 4LHWA 3GTOH 1XMSA 4BBRG 1D2EA 4WJ3M 3BB4A 3B60A 2VP5A 3EPJA 4BRWA 4A3LG 1TWHH 3AF1A 3L8ZA 3NEJA 5B30A 2MNAA 3PIPA 1N0UA 5FUWA 2OESA 2N8NA 4UJ3A 4AYTA 3C8UA 4X65Q 3BFKA 2HCBA 1Q44A 1PLJA 4RD4A 3G5UA 1NMZA 2FOLA 2ATWA 1FL9A 2GAAA 4HJ7A 1PA6A 1D7QA 4NYIQ 1XNJA 2RGBA 5EXSA 4ZDWA 3RRNA 3VTKA 3UPUA 4LJ9A 1S3OA 1I6VC 2MO0A 4O2DA 3E0EA 2UVQA 3JVVA 4X8OA 4DLWA 2VTKA 1II8B 2YC4C 3CLVA 2AHOA 1W0JA 1LS6A 4DR5L 1WMSA 2GETA 5GQOA 3PITA 3KJHA 3MJHA 4AYBE 1QG2A 1SULA 4BUJA 5FOUA 2QEXA 1N33L 1A6XA 1AA9A 2VHQA 5JRJA 3T56B 1E2QA 3K9LA 3GTQH 3AKYA 3LWUA 4A3JH 3DLLA 4JL6A 2X77A 1DPFA 4JL5A 1P60A 4NE2A 5EE0A 3TVDA 1TXYA 1KK0A 1CTMA 4LJ8A 5FL7D 2CE2X 4DR4L 4IJHA 1G18A 1C9KA 1N25A 3HPQA 4PO1A 2VQEL 2D2CC 1KSHA 1CKMA 4UJ5A 3BB3A 3QG1A 1WOCA 2CWAA 3TSWA 1FFHA 1W2HA 3PEVA 3QUSA 2ZRBA 2WTUA 1E1OA 2OCAA 1KGDA 3AP1A 4DLZA 4BLTA 3PEYA 1GUNA 4HAUA 1XTJA 1K5GA 3THOA 1KRTA 2UXBL 4PZZA 4Q21A 4FMCF 3ZQ6A 1E6CA 1B23P 2QORA 4A3LH 1DAKA 5AR1A 2NMVA 1KZ7B 4JI1L 1XP8A 3OEHA 3SBDA 4DV5L 1IBLQ 1T4GA 2WWWA 3SJCA 3OTOQ 4QBFA 4CEJA 1PH2A 1T8UA 3X2SA 5C18A 5HGQA 1K5DA 2DB3A 4A3IG 2AR7A 1CBUA 2K33A 1US8B 5H1YA 2EFEB 3SYNA 1W7AA 2WV9A 3KQHA 5FFMA 4JT4A 2WP8J 2WKRA 3MEFA 1JE5A 2QF7A 3QJYA 2YU9H 1RW4A 5KDLA 5K8UA 1NVVQ 1Y1WH 1KRSA 3UKDA 2VP0A 3P26A 4B3TQ 3GLGB 1L1OC 3VX4A 5F2EA 1EFRD 4FCVA 3W6PA 1FJGQ 4II7A 2JJ8A 1VCOA 4IVPA 1N9WA 1ZIPA 2WHXA 4AQYQ 4EKDA 1KI6B 2P0EA 3E5HA 3BRWD 2KCTA 1KKLA 3PUXA 4GLVB 3FTQA 4BRUA 5GJBA 5H70A 1II9A 1E2FA 4BXXH 3NBXX 2DY1A 3P1JA 2O8DB 1TF7A 2C96A 4B33A 2Z5FA 1ESNA 2MQHA 1S4QA 5EZ5A 1P6XA 4LF8Q 1XPOA 1WRBA 3L0SA 4CIDA 1SN8A 2XNSA 5CK4A 2GZAA 2HYIC 2FZLA 4NYMQ 3I8SA 4JBXA 4QXAA 5G40A 4URVR 1BOFA 5ELXA 3LW7A 4XIGS 3ULLA 4EFNA 2IT1A 1W4BA 3KFVA 1GDDA 3OYYA 3E2IA 3T5DA 1IN5A 1NN3A 1G16A 1ZUIA 5A35A 2QG6A 2RB4A 2WWXA 5CYPA 3QKSA 1PMRA 1TADA 5J4LA 1W48A 3RS2A 2PNRC 3CCSA 4DR4Q 1H8EA 2GHIA 721PA 1XCMA 1Z5ZA 2ZI5A 1VCMA 4R2HA 3V4RA 1CEEA 3JZAA 2O8FB 4B2LA 2UU9Q 5A5GA 1GL6A 5CB6A 1R9TH 1GOTA 2CL0X 3F3YA 5EP1A 5C44H 2Q2IA 1NVWQ 1UF9A 3TR5A 4JI3L 2YNMA 5JBQA 1WI5A 5JS7A 4TYNA 1GUSA 1NMXA 1ZINA 4YWKA 1N6RA 4BY7G 2A9KA 4BBRH 1IBKL 2VP4A 4PO9A 2VH5R 2GAOA 3GJXC 3KJIA 4FIDA 2ZROA 1UJ2A 2RMKA 1G3UA 2OAQ1 3T51B 3WXMA 2Y0SG 4FMBB 5BN3A 3CH5A 2F7SA 3GO5A 4PX9A 3THWA 1GKIA 1OFIA 2RGDA 2IYTA 1G4AE 5JMTA 1IYUA 3EN2A 1MJEA 3GJ4A 5JSZA 4PQYA 4DUZQ 4BY1G 1MRNA 2ZRFA 2G0TA 2ZRPA 4XD7D 2ZSAA 4DEXA 2A5GA 1IYVA 1P8LA 2BKUA 3DM5A 4DC9A 5A4JA 2NO6A 1AIPA 5IT9c 4JSTA 2WWFA 1EFWA 4KVAA 5KUTA 1SXJC 4FI3C 2G1JA 4KU4A 4B2IA 4BA1I 2WPDA 3B13B 5E7IA 1QHYA 4HZIA 4P4TA 4Q00A 4K8OA 2Z6KC 1MOZA 3FHOA 1HJPA 1FNNA 2EFCB 2G0NA 4CT4B 1ZC4A 4YXWD 1KMHA 4O0MA 4TYQA 5AUNB 2VS1A 1X1SA 4H9GA 4X8LA 3DL0A 3UATA 1X3GA 2JDIA 5C4JH 5G41A 4JKIA 4FWTA 3K9GA 3ER0A 4FN5A 3AQQA 4DSTA 3GTKH 1XX6A 3EZ9A 4NXMQ 3GEHA 4IJMA 4LJZC 4KAXA 1FR3A 2R44A 2D62A 2QMHA 3MAAC 4QOSA 3QBVA 1K3RA 3AP2A 1AE3A 4DV4Q 1NJGA 3A4LA 4IOMA 2BBSA 3B82A 4LSGA 1TL7C 2BHRA 4HZUA 4Q4JB 1BIFA 2HCJB 3A1SA 3BK7A 3OTOL 1GNRA 2RHMA 3I4MH 4D25A 4A3GH 1CSQA 1HZ9A 4RZUA 4GMXA 1C4OA 1G20E 4TMKA 3EIHA 5HKKA 3LW8A 3RS3A 4PHTA 1T0JB 1GSIA 4LYFA 3RNLA 4E03A 2G9NA 2UUBQ 2PCLA 3A1VA 4JJZA 3PUZA 1E1RA 2ZSDA 3K0CA 2A5YB 1AM4D 1KI1A 2V1CC 2CBZA 4UNPA 1CR4A 1N36Q 3HOZG 1VS0A 3CWQA 3OAAA 4P72A 4DCSA 1W36B 2WBLC 5AJZA 2W00A 5UKDA 3J81k 3S2HH 1GAJA 2PQAA 2YHSA 3THYA 3TLXA 2CEAA 3ZVLA 3DZ8A 4JI0L 4B44A 4ZO4A 2F6RA 3ZVMA 2B3GA 2AK3A 1CJUC 3GFTA 3HU3A 3LBHA 4F91B 3KTAA 3N6RA 1YRBA 2J45A 3SHFA 1Q1QA 1CKNA 1E79D 1ZYUA 1VTKA 2RGGA 1OXSC 3RS5A 2QQ0A 3UE1A 1X3EA 4GT1A 4J15A 5M04A 1H65A 2Z4SA 3D3QA 5CIWA 4JOIC 3UG6A 4R4TA 2RGAA 2F4VQ 2DWPA 4DLTA 3SDZA 2BA1A 1VQHA 2PEZA 2WSSD 4ASUA 1SKYB 4AI6A 1PYSB 2JASA 4HDOB 2NO0A 3U61B 1OV4A 5EP2A 5C0XH 1VPLA 1M74A 1P72A 2XGTA 2WJJA 1WYDA 4QC2A 4B2PA 4IJLA 3KQKA 1GUOA 1PJRA 3U9SA 3CX8A 4MYCA 1ONBA 1P16A 2QAGB 5FPKA 1GRNA 3TBKA 5BWMA
chains in the Genus database with same CATH superfamily
1SBNE 4GC9A 5M3FG 1NF3A 4BNMA 2MYNA 2Z2XA 1G20A 5I3CA 3SE7A 4WZAE 4DMRA 5AVOA 3F2CA 5F98A 4BQOA 1OXTA 4YQEA 3MBOA 4ABTA 5CR9A 3NVKI 4M6WA 3T13A 1ZBQA 4FHGA 2GILA 4I5GA 4HGYA 5FD8A 4RVOA 3J80L 4AXBA 2W6JA 3ONVA 3AM1A 1XRMA 2Q3JA 4Q01A 1RRVA 4MP8A 3TRZA 2WY2D 6YASA 3S16H 1ODFA 2V54A 4XW2A 3WGIA 3TIIA 5JARA 3AEUA 1OH8A 1BVSA 1LI7A 1WXXA 2II6A 3ZGZA 3RJMA 1HQYE 3CE6A 5EPJA 1XNRQ 1T8PA 4G5RA 4H02A 4Q19A 2NSDA 1NR2A 2YHBA 2HUNA 3O92A 4F06A 4S1TA 2KYRA 1E3SA 1JDBC 2WU4A 4BVJA 3GLGA 2YJTD 3I58A 4Z2YA 5B12A 5JEAG 1NW8A 4EGSA 2AHOB 3FX2A 3ENZA 2EKBA 3QA3E 4FKBA 3M7GA 4FE3A 5IWAL 2RG1A 1S2GA 1UMBB 2XE4A 3PFIA 3PNOA 1UE7A 2C5EA 1KQPA 2IKQA 2WU3A 5CVEA 3IJRA 1H9MA 3PCXA 4L0DA 1N2CB 5CNKA 1QAQA 1U7XA 1Y1PA 2WINI 4NMLA 4Q1FA 4ZD6A 1Z0AA 3AF0A 4RTLA 3PGLA 4OYLA 3H5LA 5ALPA 2IE0A 3EZLA 4DMCA 1E0DA 1KIAA 4CETA 2YBEA 1JAYA 1YASA 2Y1WA 4AG6A 4XYLA 1V8QA 5DNEA 4US0R 4ME6A 5E6SB 1PR5A 1UMCB 2FZGA 1KEVA 4UHKA 3N75A 4BX3A 4GM4A 1SVNA 1A15A 1W34A 4RPHA 3E03A 4NZZA 4A3SA 5KNDD 2EKZA 4LOJA 4LYJA 5BN4B 5EIEA 5D65A 1L5NA 2FWNA 3KZMA 1E1KA 1YI2A 1NVTA 2ZSUA 4OG2A 1DQRA 4UDXX 2ZSIA 3USCS 4BBSB 4LXUA 1PHRA 3F6SA 3H3FA 4UEQA 3U4AA 3WO1A 1T8YA 4KJXA 2GTPA 3FJOA 2R48A 4BNGA 5D14A 1N3IA 3UB3A 1ZH6A 2E4WA 1WCMH 1XUOA 2BM1A 3BTUA 2Y0BA 1NNXA 3DDWA 1MEJA 2DLNA 3JZFA 4JVOA 1F8XA 1SUBA 3AOEC 2ZTDA 3OJFA 4UPEA 3ADPA 1T9GS 1J0EA 1UE1A 1IG0A 2HMSA 4YJGA 4FDUA 5EQFA 2B2WA 1E3EA 2NVQH 1V6CA 1Z33A 3NH6A 4JUCA 3CF4G 4LZZA 4A5SA 2K7VA 3U48A 3UKJA 5JO0A 2QAIA 2XXJA 1GZVA 4MINA 4WZAB 3IEXA 3RSFA 4B3TB 5C0XG 1POXA 5JBIA 3FWZA 3W5AA 1H1DA 2LS01 2PMEA 2AUNA 1E9DA 3IVRA 3OZAA 4ITRC 4R9WA 3V2GA 4F2GA 4HRYA 1HKHA 4C0KA 2GUGA 4KCGA 4MWEA 3V9AA 4N8FA 3D8SA 4F38A 4BP9A 4HB3A 1ISPA 2JRLA 1CWUA 1YK0A 3D0KA 1N6OA 1JHRA 3PHCA 5I8ZA 5LKRA 1OH7A 1K7SN 4XJTA 3UH0A 2FPRA 2F0EA 2GBPA 5BUSA 2WK1A 3KUDA 4HDKB 4C4ZA 1Y9AA 3BJMA 3JQAD 1BDMA 3EXG2 4GXNA 4RVUA 3RVSA 3S2ZA 3IMGA 5EHQA 1XOIA 1ZUNA 2QR5A 4RK6A 4D3XA 3OIVA 3R9WA 1EIGA 1GUYA 4NBLA 4MV4A 3RIYA 1XD2A 5GOZA 2F9FA 1UZAA 2GZRA 1HPCA 3RZOB 2JJYA 4GGOA 3KJGA 1V6SA 3DF7A 4Q3AA 3TLAA 4CKEB 3QEKA 1E0BA 2BI8A 3DOFA 4J0JA 2AZTA 3STVA 5T8KA 1AZSC 1U2RA 5AUQA 5JSYA 1DKLA 3OZUA 2Z56A 4J91A 2R7KA 1QPGA 1UUFA 4TL9A 3RVQA 4A93H 1IXRA 1DWPA 1CZNA 2H4JA 2P9ZA 4G9EA 3COPA 4IW3B 4RV4A 3IDZA 4HJ8A 1RQNA 1I2BA 3TM5A 2HQOA 2ZJOA 4OLJA 5EIWA 3VNRA 2H63A 4FB5A 3U5TA 1Z4OA 1KJNA 2O8EA 3AI1A 1JAHA 5JYEA 1FVHA 3QKWA 3JAML 4HWRA 4PU0A 1CK4A 4PZYA 1L5RA 4OQYA 4ZAFA 3PFBA 3ML1A 4YAUA 2JLAA 3RD4A 1D0SA 2FWJA 1ET9A 2P4HX 2W22A 3FFXA 1LS1A 5EJFA 4X7RA 1TVXA 3DE7X 2KSQA 2ATCA 4LDQA 2R2AA 4Z9YA 3LKZA 3VUEA 5C9ZA 5JSFA 5GONB 5JECA 5LMUL 1BXKA 2FW8A 1KJZA 1WXHA 3R3ZA 4FE7A 2F3IA 1ZONA 1K68A 3ESAA 4NYJQ 1ND6A 4EKNB 3FOEC 2GARA 4H31A 3IALA 4ZODA 4D9CA 2Q3HA 4LRXA 3EIEA 1MRSA 2Y68A 3IILA 1SEVA 3DWQA 3AUJB 1M67A 1Z4MA 2PKWA 3FKSD 5F2DA 5HEKA 5CLJA 1ZZEA 5EPKA 3S1RH 2OWOA 2DQKA 3AEKB 3AL3A 3NUCA 4JI6Q 1K2VN 1C3LA 4PFJA 5SY4A 3URKA 1ULAA 3K9HA 2PO7A 3SEFA 3U7JA 5BURA 2I67A 4RH1A 2PSEA 1NJ5A 4M76B 4MO9A 4OQXA 4TMYA 1LDMA 2PANA 4TT3D 5DLQC 2WWVD 2BE7A 3D8NA 4WLFA 7REQB 3M6WA 1LUZA 3ZJYC 5KUTA 2QGQA 1KP9A 1TLTA 1SVIA 2I5LX 4F97A 4KQ6A 3QM1A 5J1TB 1QQ7A 3HZXA 2R1VA 5JY6A 1C2TA 4X95A 5ADWA 3ZI0A 3ZWCA 3R7WA 4A1FA 4WTOA 4JI5B 5B4VA 4GYKA 5LZ2A 1UCFA 5L7YA 4JV5Q 1QUFA 2OEPA 2PRKA 3CKKA 1IQRA 3B9QA 3L82B 1OX6A 3PA8A 4HYTA 3SLRA 4H0FA 2P9HA 2JLQA 3HU2A 3HWSA 3DOOA 4NK5A 3ZV4A 4OMUA 1XDDA 4IQ4A 2B8JA 3B5JA 3HP7A 4N12A 4Q6BA 4Z3KA 5L4SA 2M6KA 2QM8A 2SNIE 2QE6A 2W8BA 4M55A 4F3NA 4PHFA 1FMLA 1HV8A 3UJ6A 5EAIA 3VH3A 3TS1A 1EY7A 1Z9BA 3B1KA 3KR2A 1KFJB 2G36A 1HF3A 1HYQA 1NN5A 3QLTA 3SF0A 3THRA 3V33A 4DMGA 1PIWA 4H7FA 2REXB 4UMFA 5H4HA 4BFLA 1ZHOA 3B5EA 3OF3A 1H66A 4W1SA 5JCXA 2IPLA 4URZR 1ZSYA 4I4NA 4O2BA 4Q05A 1VI6A 3DTYA 5EHIA 5EMLA 1V1RA 3UAZA 5EJ2A 5GIOE 4XQ0A 2PLAA 2FSFA 2HXSA 1N9ZA 5J2UB 2Q8IB 2V98A 2XMGA 4Y2VA 1N36B 3U37A 1KABA 5K2MA 4NXML 2VBIA 2GD0A 1VSBA 3A2NA 3HLKA 3SNHA 3GA0A 4BWVA 3CLTC 1JQEA 1Y6ZA 3X44A 3K5OA 4R81A 1CB7A 4LK1C 3NWEA 1NLFA 4RNCA 5CPBA 3WFIA 1V2HE 1JG6A 3KZVA 5A2GA 5LYJA 2O8BA 1PU2A 4P3PA 2H5JA 5DCWA 1L9XA 4JI1Q 5LL6X 2D1QA 1RWQA 3WL6A 4GOXA 1G291 1ULSA 4ER3A 4A3DG 2PT9A 3V7YA 4DB4A 1V4VA 2JJQA 3KDPA 4NABA 8ADHA 3OF5A 3HCWA 2PY6A 1NP3A 4K87A 2I6QA 3LV8A 4DIKA 3P9CA 4L50A 1VDMA 2V5VA 4N5HX 4XWGA 1SVSA 4E14A 3U17A 4WORA 1RLJA 3KKKA 1VKHA 2DR2A 1KYTA 1XG5A 2X42A 4Q3LA 5KNCH 4Q37A 2CLOB 3UBTA 1EWQA 1MHPA 4AF7A 1P0MA 1EOTA 1RCTE 3PRJA 4G7ZC 2VUIB 5JAIA 1T3SA 4C7JA 5JI3E 3CTPA 1KEEA 3UNXA 3DDSA 3DDZX 3B8HA 3TYXA 4YCNA 1N2GA 3I5UA 3NTVA 2FZ4A 4D4JA 1GU0A 1AHIA 5CT6A 1DKNA 1SNMA 1M2JA 3PTAA 1FLDA 4ISBA 2GK7A 3LL7A 3CONA 2RHTA 2YWGA 4G8CA 4XARA 3DFFA 2CNKA 2NPOA 4LRUA 1XX8A 1LBSA 3KT6A 4MW4A 2GGSA 3NVMB 4A3CG 2R1TB 1XL1A 2A0YA 2XNCA 2Z08A 2C5FA 3DWIA 5DTMA 4BU1A 2XE7A 1X1QA 2EAUA 3BX1A 4XUCA 3LZDA 2PKEA 2ZUFA 1EJ2A 1P73A 1RVV1 3AR7A 4TXHA 1O96B 5JD5A 4EGCB 4UVDA 2H1OA 1JYFA 2XCTB 1ZM4A 3EWNA 3NHLA 3G7NA 3R3SA 3H65A 4IXDA 4OP3A 1AGRA 1JQYD 1DJQA 5BNIA 1DIAA 3L4JA 4YY3B 1VQDA 3WHKA 1TT2A 2B30A 1Z39A 3L3BA 4PRZA 4HS4A 2WU1A 4QGFA 4PSCA 1C81A 5ERGB 3OUTA 4EGAA 5FWNA 1HNXQ 3B6IA 1E2DA 1CUUA 3SEAA 3ZQKA 5IKPA 2VL7A 1FLAA 4IJWA 4QUCA 3LOQA 5BSUA 1IBSA 1HR0W 5D3QA 1IXYA 1XZDA 3FOAA 3PHJA 3GGOA 2K01A 4Q02A 4YB8A 2ZS7A 4R8NA 1CJBA 1BA2A 1TUEA 3SZMA 1UXIA 1MOQA 3B6JA 1ILWA 3EF1A 3H2JA 3JV7A 4QATA 4QIHA 4AKSA 4BE7B 4JI8L 1WUKS 1T15A 5JU6A 1HZJA 3H19A 4TMXA 4U2BA 4IUUA 4HPJB 3TSZA 1RXEA 4I55A 1BQ3A 2P68A 2BUAA 5F1PA 3LQFA 3NXKA 1WQ3A 4RL6A 3VJMA 1R9NA 4DAEA 1U5CA 1T3TA 3SVMA 1M6NA 2FKAA 4H13C 3B1YA 2J0EA 1BRMA 2ZJPA 3NHPA 5GJVC 1MB9A 2FZKA 4LF4B 2ZVDA 1ZCZA 2LE0A 2XWQA 1QNKA 4RORA 5ULLA 3VYVA 1B3QA 2X58A 2OM6A 2YBDA 1F60A 1VJTA 4GOPB 3A8IE 2NPFA 5JVG3 1P2UA 4PG4A 3UW3A 4ZK2A 4IIEA 1THZA 5GADC 2AR0A 3JAKA 2PGAA 1LTKA 1XPJA 5J3BA 3OJLA 4MR8B 1QP0A 3QHQA 5LNK6 1RZ3A 1QHGA 1UZNA 2O4CA 3L07A 3N8KA 4QECA 5IVDA 3TINA 1BHJA 3ICEA 3FLBA 4RPKA 3NHFA 2Y4OA 3UANA 1WD5A 2R6AA 5SZKB 1JE1A 2IS4A 1FNUA 2IP4A 4ZGGA 5EC8A 1K4MA 2VQFB 4KO4S 2QENA 3VTAA 2D00A 1QNFA 1SMXA 3KQSA 2ODBA 1TS4A 1X19A 1ZXBA 2W2VA 5T4FA 3UUGA 4C04A 2MUYA 3U9OA 1TY2A 2B8FA 2DWCA 5CJPA 4X93A 5JI2E 2MR6A 3NBZC 4WNYA 2FLWA 1O97C 2I3GA 1L4HA 4QQKA 5EE9A 3TNFA 4OO1H 3C87A 1Z73A 3CNHA 4DNXA 5JJLA 2OYSA 5LQJA 5EMNA 2CNNA 3CY6A 3W78A 3GD5A 2XECA 4P7FA 2CC2A 4P58A 2ZGVA 3CR3C 5BYAA 4QY7A 3CU7A 5CGKA 1KZ6A 1NN1A 2I5PO 2FPLA 2JIZD 5F4ZA 3RSQA 3ZY5A 4EIWA 5IDWA 2ZIVB 4DREA 5EYPB 3C1EA 3VR4A 1LX6A 3HACA 4XIIA 4E5UA 4Z0NA 1FNMA 5KAMA 3F2UA 1BKDR 3B3GA 5HYVA 3E9ZA 2ZUWA 1AHNA 2P27A 3WSTA 1R0ZA 2HAEA 1IBML 2KMLA 2VUTA 1SYDA 2ZTUA 4IJ6A 3L6BA 2YFHA 2AG1A 3BHIA 4ZVOA 4B7UA 1OO9B 2W2LD 1FBNA 4BLOA 1T2VA 4ML3A 2DQ4A 1FDSA 3WVNA 4KODA 4LGMA 2R93H 3MGBA 5EY5B 1RTOA 2PZLA 5TR9A 2VDJA 3QLJA 5EOVA 4QUIA 3V3KA 1CFZA 3EXEA 4FP9A 4KPUA 4K1XA 5ALGA 3UDXA 1I1OA 3C14C 4M8NE 1FSZA 5EEHA 1JAZA 3HCDA 3A4TA 1QVGA 3NTUA 1LM0A 1XZKA 3DMTC 3AUAA 4GI5A 1RI5A 3CC8A 3W5BA 1ETHA 2R11A 2AH5A 2BMFA 4QPNA 3WB0A 3GRPA 1JALA 4DLSA 4X62L 1IOZA 1RHQA 1TVEA 1S2MA 2P2ZA 2QRPA 3IR6A 3S99A 4HNUA 1MDBA 1R0LA 1JEJA 1C9DB 1Y1VG 2WFZA 3BWEA 3RRZA 2ZJ4A 3O9MA 1LF5A 2AFIE 2XVMA 1A3VA 4BP8A 2P79A 4L8LA 4ZT7A 4H4DA 1I9GA 1E32A 2YFQA 2E75C 4HIOA 1BHQ1 1GTJ1 2BVNA 1N8KA 2CNWD 2ZPUA 3DW1X 3NEAA 1T34A 4FONA 4L5YA 2LCQA 3WYFA 4GOPC 1GDTA 2JG3A 1XU9A 2CJWB 2G25A 4RV9A 1E3IA 2ZYRA 2BFEB 2Q9CA 4E88A 1Z13A 1BCPF 3JX9A 1IK4A 5HG0A 3PQ2A 3R5SA 4C78A 1E92A 4CDRA 4EJMA 2X5OA 5JH7F 3TH5A 2H51A 3ADOA 4X71A 4DA9A 4JL8A 1XVLA 1IZ0A 4GKJB 3Q3VA 1RXVA 1DKRA 3RU7A 5LMZA 4JJEA 5AVQA 1G41A 2OQIA 4FXPA 2LRHA 2VWHA 3UMBA 2H08A 3ROKA 5LU9A 4XM1A 4E7PA 2FRDC 4J1TC 1E1CA 3K7EA 4OIMA 4ZOAA 1A04A 3PQ8A 4WBNA 1NE2A 1HFKA 2R5NA 3EWSA 3ONAB 2OBFA 5T6BA 1WBDA 1X8LA 5DP1A 1ESDA 3O0TA 3U44B 2H1LA 1HT2E 5AK3A 4A8HA 1YOBA 3VQTA 4HWKA 2BFEA 3PLRA 4ZKEA 1WKCA 4CLXA 2I65A 1SBHA 2H48A 2WINB 2Y0SB 5KNDH 1VLZA 2VUMH 2KI5A 3RUEA 4DJ5X 1X92A 4AH6A 2P5YA 1H23A 1K7YA 2GN8A 2YOFA 4F93B 1J2RA 4Z8XA 5CM2Z 1TKWB 1II8A 4X94A 5IXSA 1WD0A 5FFNA 4G4JA 5E2AA 1OBHA 3IQIX 3M9XA 1BUVT 3DAPA 3EQLC 3CLHA 4N7BA 4N5LA 4U7FA 3VGPA 1U4RA 1QIFA 2IVFA 1LPOA 3DFMA 1RRPA 4FD3A 4R9RA 5A4KA 3ZW8A 1CD5A 5EWJB 3HM9A 1YJBA 1SU8A 4L5QA 5BN5A 3E9MA 3I3CA 2YTVA 4YRLA 4EZIA 2OCGA 4G5YA 4WI1A 2DERA 1KAOA 4J0CA 3K2EA 3CRW1 1H42A 2Z6VA 3WL8A 4AJNA 2VPTA 1KYQA 1Q1ZA 3CPWA 3A4VA 4Y7CA 1EX9A 2DQZA 2L15A 3U3KA 1IH8A 5IH7A 3FPLA 2V0GA 1LD3A 4K7JA 4UD6A 1Y1KE 4L85A 1S1CA 2PEYA 4OY3A 3NT5A 4ZYXA 1J4AA 3A7EA 4RSMA 1Z0JA 4DG5A 3QOFA 5I7SA 3JQAA 4ZWNA 4IFDI 2ONKA 4GI7A 2IFTA 4XDZA 4U2KA 3J81j 2R6GA 1H1LB 3IMKA 1T0IA 4OHKA 4ETNA 1FP4A 1UPFA 1N77A 1H5UA 2X9QA 2J31A 3LOUA 4ES6A 1BBWA 4KR0A 4DE5A 4YAFA 3GGPA 4YRTA 1EVKA 4OH7A 3ZXYA 5EUCA 1Q8IA 1I1NA 1HGXA 3DE0X 3HR8A 4EB6A 3RJZA 5CG2A 4RFLA 5LYJF 1MSGA 5TY0A 3TE6A 2E2HH 3FOZA 3CINA 5E7JA 3AHFA 1L4FA 1L5HA 3QPWA 3AJ9A 3UICA 4NCBA 1K4YA 1GZ7A 2ANBA 2GVDC 3HUUA 3NNSA 4HSGA 1IK6A 3SS8A 4OD0A 1XNRB 4OHCA 3S55A 1U9RA 4YJHB 1W30A 1G20B 3EQ8A 3MTQA 2Q7OE 1GLVA 1R50A 3T0GA 2PJDA 1J97A 1FLNA 1KKMA 1UJ5A 2H52A 1U0OC 2A9PA 3A1WA 1SAPA 2EGUA 3FRHA 1QANA 1ZWKA 5EIOA 2FN4A 3UV3A 4AO7A 1ZJWA 2RGXA 5JFGA 2QW8A 2FPIA 1F1JA 3TLEA 5I48A 3LUDA 4XI9A 1CHPD 2GKGA 5IC6A 4HCSA 1SZJG 2R92G 3AINA 3DVRX 3MSCA 4HGPA 4LNAA 1ZD8A 1JR0D 3JASB 4KB5A 2QGFA 4XAQA 3WK5A 1UBMS 4CM1A 1VFPA 2CLDX 4F7DA 1TKRA 1ZGBA 2ATEA 2FJ2A 1RLUA 2H4HA 2SKDA 2K1BA 1NSTA 5JMOA 3RTDA 5KVCA 4JY7A 3NWSA 5AFSA 5AJHA 4JLKA 1YZUA 4PV1C 3QKUA 3N3BC 1Z74A 4EHDA 2E55A 1E4EA 3KEMA 1ZN8A 3KR1A 4PPGA 1M73E 1RBQA 2ZBVA 4KO1S 4D80A 5ICGA 2O0HA 1DBQA 3OIYA 4R3NA 1SFRA 4CEJB 2XDYA 3KT0A 2XNAC 1C80A 2NIPA 2WYOA 1FFWA 1YDHA 4HAYA 4OO3A 1JJGA 5DYNA 1ORTA 3FMOB 4MARA 4QUEA 3OX1A 4DJFC 4IUVA 1CNFA 2IHYA 1TX4B 2IPNA 3PJDA 1W5AA 1VPVA 1XCLA 2A6PA 2R5FA 3A2MA 3VYUA 1CQXA 3Q5EA 4JUAA 3KKQA 4KXXA 2NT4A 5EIBC 4DQ0A 1X1CA 5HZMA 1H6DA 4DDUA 2C99A 1FUYB 2CF6A 3BGVA 1VKNA 1N3BA 4MRAA 3VYTA 3A8JE 1GR0A 1FYWA 1OD6A 1LPBB