3PV0A

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 86
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pv0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pv0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pv0A01
2WTUA 4DV5L 4PZ7A 2OG2A 4LV6A 1H65A 3I2ZA 2I1QA 2OAP1 2VLIA 2SHKA 1KI8A 1P3JA 2XSZA 5FUYA 3ZS8A 1DXMA 4GN3B 1D2MA 5KOYA 2XZPA 2ZXUA 1JALA 2C98A 2ZJAA 1RYHA 1GHKA 4Y52H 1CS4C 4KI0A 1JE5A 1E1RA 1W5TA 4HAZA 5FL3A 1E2WA 3FHWA 2ZAOA 1BH2A 1H8ED 3S1NH 5LMNW 1FTNA 4ZV4A 1WMSA 2ZIAA 3HDTA 4YDHB 4F4JA 1PH3A 3GJ5A 2LSSA 1Q1QA 1UKZA 4BFXA 2W6IA 2PQAA 2RCNA 2CE7A 3CRMA 1ZMXA 4IDHA 2R6GA 1WI5A 3TAUA 1KI7A 4MRPA 4AC9A 2WP8J 5CJ2A 5HPYB 1VHTA 1ZNXA 3K8YA 4A3GG 1PVOA 4JI0L 1CR0A 1JQJC 1D2NA 2GZHA 2R6AA 1FW6A 2J5XA 4LGMA 1XXHB 3NDPA 1E2EA 4NYMQ 2E2IH 4HZUA 4ZI2A 2PX3A 1DD2A 1QHNA 1TU3A 3CNNA 4MKHA 2B6HA 1B7YB 2DY1A 1EGAA 3P26A 3LBNA 1W0JD 2CMKA 2VTKA 3MD0A 4HAVA 3VU9B 3B60A 1P2TA 5FOUA 1G1MA 5JS8A 3WMEA 3RRNA 3THXB 4JOIC 2AUJD 5SZIA 4DSOA 3O8CA 2IYUA 3I8XA 3REFA 1RC8A 1KDTA 1NI3A 4DJTA 4X8OA 2KA7A 4A75A 2FU5C 2RAPA 2WWXA 4LF7L 2V55B 2JLVA 1CRQA 3AKDA 2A5GA 1S40A 1E1QA 3FMIA 1VQFA 2B8TA 2GNOA 4RD6A 2IHEA 1B70B 1NMGA 3JZMA 3TJZA 3RZDH 1CJKC 1Z3IX 4Q9KA 3HOZH 1G18A 4M1SA 5BXQC 1GNRA 4HLDA 6Q21A 4YLGA 2VQEL 2ZSFA 3A8IE 1N0WA 4LBVA 1JAHA 2IYTA 1EIYB 3SJZA 4ACBA 4AYBG 1KC8C 4DKAC 1BOFA 1JXMA 2F43A 2IUSA 3JZAA 3ADKA 5JRZA 4ZDJA 1RRPA 4DB4A 4DRZA 1PH2A 4UXHA 1YVDA 3KTAA 1CXZA 2BBTA 2O8CB 2I1VB 3FMOB 2B29A 3CCUA 1UEBA 3GTGH 3BFKA 4GI7A 1X6VA 4C0AC 3PV0A 4Q4JA 3VMFA 2P6RA 4OI4A 1G6HA 4L9SA 3CH4B 1P9NA 3RC3A 1KK3A 1Q57A 4OHZA 3K0EA 4F7WA 2AXPA 1EUJA 3F1ZA 2O5VA 2ZT9C 1H9MA 4IRUB 1A2BA 2GZDA 3QSYA 4OI1A 2QPTA 3AQ4A 2PT7A 4C9BA 3BJIC 3AB3A 1IW7C 2J9RA 2OBMA 2CW0C 1CU1A 2C03A 2BMEA 3EN2A 3PEVA 2C9YA 4BGDA 1Y8OB 3T1YL 5M3MH 2H7VA 3RNLA 3AH8A 3TGPA 1YITA 2FOLA 5M5WH 1Q46A 2RKOA 3W90A 3LNCA 3AVTA 1YZTA 1MH1A 2ONJA 3A7AB 1OXVA 1J8MF 4OK3A 4JI1L 3F0TA 4FCWA 3JAMc 3G82C 1Q1EA 3FKIH 3MJHA 4IOAA 4B3DA 3EPJA 2G9NA 1N6KA 2MMCA 5JZVA 1DO2A 3KTAB 1EFHA 2DWQA 1UADA 4I1UA 2XTIA 3TIFA 2DFNA 4X65L 1IBRA 3IIJA 2ZAMA 3DMDA 1Z0FA 1CLUA 2WKPA 1EWQA 1J5EQ 1FMJA 2O0KA 3UE1A 3S24A 1JEDA 3WYFA 1HNZQ 1QG4A 1J8YF 2BA0A 1KO5A 1XEFA 3L2PA 2JEOA 5FR1A 4TL7A 1ZM4A 2J0QA 4ZCIA 4QBGB 2Q2HA 2JA8H 3VKHA 3OTOQ 4OX9L 1JNYA 1IOZA 2AX4A 3UMRA 3FMFA 1V43A 3AVUA 3HU2A 3MGCA 4LF4Q 2ZTSA 4HAUA 4XTCS 5P21A 2C04A 1UE1A 2DBYA 2O5JC 3OTOL 4OX9Q 5EAYA 3PIRA 3I5XA 1HQMC 1F2UB 3AKEA 3W6NA 1XCPA 1VG1A 5GVSA 1E3PA 2W58A 4M9ZA 4KN7C 4IOCA 1XPUA 4L15A 3T1YQ 1RJ9A 2A68D 1PA6A 3F2BA 2F4VQ 4DR6Q 1G291 4JI5Q 2QBYB 4AYBE 2QAGC 2ZRKA 3VTKA 2JLZA 3QBTA 3ZIAD 821PA 1XFAA 1TNDA 2QE7D 5J4HA 4B3TL 1E2VA 4MKFA 3T34A 5ELXA 4I4LA 1ZUHA 2KWIA 3N70A 2ZRHA 1RZ3A 1IY1A 1HH4A 1ZAKA 2F3TA 2MO1A 1VQDA 1NE3A 1BKBA 2OXRA 4UXIA 1NKTA 3TEHB 3FKIG 4JOIA 1K0RA 1N32L 3FKQA 2KCTA 4RD0A 4S2EA 2PNRC 1VIAA 2BJWA 3PO2G 2QAGB 3EZ2A 3P32A 4TT3A 4A36A 1EX6A 2YKGA 3BIFA 3VNUA 3I73A 2TMKA 4IVPA 1UKEA 2JLRA 5CITA 4K8OA 2O8BA 4LJYA 1VQKA 2NZOA 1A82A 3D4RA 3K0SA 3BZCA 4RSGA 3D0FA 1N6LA 4JKIA 4C0JA 2A68C 2NO9A 2ZTDA 1P9WA 1IN5A 2ZVPX 4G01B 4LHXA 3H1TA 1DVRA 2JIZD 1G7CA 5CB8A 5F3WB 5FR2A 3E70C 3KFUA 4BLRA 3CPEA 4GOPA 4HIMA 3EQLC 3I3SR 1YJNA 1NJIC 2WSSA 3CRQA 5LDDC 2JGNA 1JBKA 4TL6A 5FOVA 3KJIA 1W4AA 1D8TA 4C3JH 2ZRMA 2O8EA 2HT6A 221PA 4BFSA 3GLFE 4DR3Q 3K0AB 5KYKA 1Y14B 2G1KA 2JLXA 1II8A 4JI4L 1XEXA 2BV3A 3CW2A 2GXAA 2Z6KA 4NZYA 1G7SA 2D2FA 2GESA 1N36Q 1W47A 2ZJBA 2QU8A 4DK6C 1R5BA 4JL6A 1XJQA 3VA7A 4KYUA 1FNNA 2XTNA 3LY5A 1XJ0A 3PUYA 2VSFA 4A0HA 2NVYH 4DV0L 3AVQA 1Z22A 4JV5L 3G71A 2UVQA 4DB2A 3HYRA 4N0EA 5B57C 4LWCA 5DISB 2L5TA 2W83A 1IBLQ 1E2NA 1Q3TA 4YY3Q 3CCMA 2ZRGA 3DM5A 4P3YA 5F2EA 1WFQA 2OT3B 1DTSA 2QM8A 4JVMA 2N78A 1YRBA 3C5HA 3RN2A 5E7MA 2BOVA 2P6UA 5FFMA 3M85A 4KODA 3M4QA 1P4SA 3GMTA 2J41A 2FDCA 2H5XA 5C3EG 3RS2A 5L3VA 1QDEA 1LM0A 4H9GA 3M4YA 5DHAA 2FPMA 1UJ2A 2XEXA 4NONA 5TDHA 3AVPA 1KHIA 1A6XA 4IFEA 1Z8FA 2CKZB 4PHGA 2DCUA 1YR9A 5IP9G 4QM6A 5C0XI 4NCNA 1N3BA 2C9CA 2RGNA 4JVSB 1N6PA 5AJZA 4QJ5A 2BMDA 1E9AA 2FF7A 3TW4A 2ECKA 2P65A 1S2MA 3GLHA 3K09A 1Q7YC 1KSJA 5L3QA 2JLWA 1H95A 4TQAA 5H1YA 1DOAA 4B3XA 3QUSA 3A6PC 4TMZA 4JI0Q 2QRNA 2A9KA 4B74A 1J2JA 3NVAA 1KYIA 2IWRA 1XB2A 2NN6H 2QT1A 2ZJ5A 3FHCB 2EYQA 5C4XG 3EXAA 2ZSAA 5EJEA 3THYB 1P62B 3GJ0A 1X6OA 4NYMR 5LB2A 2GAAA 5IP9H 1E9FA 4HATA 4BBRG 2OFXA 2WMNB 1SXJE 5IYDH 3NBXX 3W5OA 3BXZA 4RZ2A 2X77A 3D3QA 1IONA 1E69A 4FMDB 2OUKA 3CP0A 4US1R 1YI2A 3T1VA 3ZYCA 4TMWA 5DO9A 1YNNC 3FKSA 4QBFA 4JBMA 3IEVA 3KUCA 3S1MH 4JBXA 4M1MA 4YHHQ 4A76A 4DDUA 4L5RC 3DXJC 1PYSB 4GNXC 2JIZA 2F3IA 1UBCA 3KFXA 1G5RA 4EUNA 2MO0A 1V5WA 5C44H 1G20E 2AR7A 4JLNA 1NRJB 3UATA 4A3MG 4A3KH 2WJYA 4RG1A 2CHVA 2F9MA 4XD7D 4E07A 2CHGA 1E9DA 2FPKA 4DUGA 4DLWA 4DR7Q 4WJ4A 1WDTA 2QZ4A 4QL5A 3AF0A 2XX3A 3C16C 1G9XA 1AA9A 2PX0A 4QBIA 3THOA 2R8RA 1K8AC 1Y8NB 3GJ7A 3Q5EA 2D5DA 4LRWA 2A2ZA 4DCSA 2DFTA 4H02A 2O8DB 3TZUA 2Z6VA 4IDOA 3RAPR 5C4JH 3KDFA 3CCJA 1T4GA 3KF8B 5JJLA 4G7OC 2BVNA 2GEDA 3GTPH 2H57A 4YY3L 2VBCA 3OIYA 2FFHA 2B8FA 1I6HH 1QG2A 1W44A 5D3QA 5FBQB 3DVLA 5CB6A 2XGTA 3HR7A 1OH8A 3R9XA 4C0QC 4ON9A 1JJ7A 1JMCA 1RW4A 1HV8A 3RZOH 4BECA 2OQKA 4OQFA 5D3MA 2R44A 2CE2X 2CFMA 4LF8L 2GVDC 5B58C 1YHBA 1BIFA 1TADA 1UPTA 4U5XA 4BRUA 2BE5C 3QPVA 5F9FA 1Q44A 3RLOA 4O3MA 2C5LA 2RB4A 2IYRA 1P61B 1B23P 2R65A 1XWIA 2H18A 1B9NA 1I50H 4ZO4A 2NO0A 2QGQA 1ZD9A 5CIWA 4TLCA 2ZRAA 1UDXA 4R9UC 1WB9A 3QG1A 4AYTA 4YXWA 2DPXA 2QT0A 1US8A 3NH6A 4POFA 2Q3HA 1N8RC 4D0NA 1TF2A 1WA5A 4P73A 4IFDJ 1QHHA 3L2OB 4EX5A 3GO5A 1CSPA 2IY5B 3J81c 4X65Q 3EZ6A 2K5NA 3W5IA 4CEJA 3X1DA 2F7SA 1K6MA 2BCGY 2EU8A 1W48A 4EQ5A 3CIOA 2EVWX 4DIEA 3T1QA 1M1KC 3PEUA 3TH5A 1SVOA 2YJTD 3CR8A 4LK1C 4DNIA 2Z83A 3A1VA 3ZZ0A 1ETUA 3SFVA 2BBSA 3D7MA 3QQ5A 4DLXA 2JLUA 1N5KA 3PEYA 1EESA 2E87A 4XSGA 2BKUA 4P75A 4BY7H 1E98A 5A5GA 1V8QA 2ZE5A 2NO7A 2V3CC 1W0KA 1XCMA 1HEIA 4CF7A 3U7FB 1K8OA 3OPOA 4BFYA 1KJWA 2FMXA 2AMCB 2WWFA 4Q47A 3DPUA 1Z6YA 2ZJYA 1VF7A 2Q8IB 3NBYC 1VCMA 3LWUA 4AIMA 1U9IA 2Z4RA 4MGYR 4EJSA 3SHWA 2QSYA 1WBBA 3U58A 3DZDA 1VQ7A 1A2KC 2QM7A 3LVRE 3X1YA 3ADBA 1Z2CA 3HKZG 1KMHA 3NELA 1WF3A 2QP9X 3U5ZB 3QY0A 1VQEA 2VQFL 2ZI9A 1XU4A 3CM0A 4WIAA 3ZGXA 3DKVA 2OCPA 4HB2A 3X1WA 2HYIC 4DV6Q 3X1XA 3B85A 1TQ4A 4ZDIA 2AHOB 2GA8A 4BBRH 4UQOA 3CNLA 4LJ4A 1W36B 2JJ8A 3B1VA 2ODBA 3HU3A 4P4UA 2WSMA 1FZQA 3E2IA 3L0IB 1XPOA 2GBLA 4DT1A 3J81k 3MG9A 1T91A 1BMFD 4DV4L 1HNXQ 1VG9B 4TL9A 3DKPA 1VS0A 3W34A 5FOTA 3ZQJA 1HURA 3PUVA 2WJIA 2IHBA 4MITA 2XZOA 1K8MA 1RKBA 4LJ6A 1PH6A 2Z0SA 5KDOA 1GNQA 1BYUA 2CQOA 4DV7Q 1X55A 3VR2A 3E9IA 3CCLA 3SQWA 2O8BB 3CZQA 1KTVA 4IFDH 4TZ0A 3R20A 5H8WA 1ZVQA 2OBLA 1GSIA 1OXXK 4XIGS 3I56A 4OGQC 1CR4A 1KMHB 2QROA 2RGCA 1XNJA 1WCMG 2NVXH 2XNDA 5JJKA 1Q3HA 2IEZA 1YNXA 4LF5L 4GSYA 4QY7A 1LS1A 4HLQB 1SKYE 4II7A 5JSZB 2MSEB 4JYAL 3AQQA 1QUQB 4QJFA 4A3FH 3S16H 2ANCA 4A8JC 2LKCA 2ZRBA 4NKRA 5BW8A 4AG6A 1OV4A 2FGJA 2DB3A 4NHOA 4NYJR 4BEJA 5J4LA 2EFEB 4Q4AA 1PH8A 4QGAA 3GLGE 2R7ZH 2JATA 1BVSA 4G1UC 4MYHA 2EFCB 1VCIA 1ZC3A 1F3OA 2KSQA 3UXMA 2Y0SG 3B6YA 3CCRA 3CWZA 3VX3A 1OH7A 5DLQE 4AKHA 2QPAA 2HJGA 2I5LX 4ZCMA 4BZQA 4DV3L 3J7A5 1N0VC 5EE3A 2FFQA 3HOWG 2NO1A 3BK7A 4GL2A 4ZDKA 3NBFA 5JEDA 4DT1B 2B8WA 1LF0A 1GG2A 1SXJA 3U4ZA 2V7QD 1MO4A 3GJ4A 2FN4A 3MFYA 2BKEA 4ACAA 3ZVRA 5C2JB 4YMUA 2ATVA 3U2QA 1H8EA 2AUKA 3HOVG 2PEYA 4C2TA 2HV8A 2WAXA 4CT5A 1M8PA 4GT1A 1LF5A 3K70C 1GDDA 4A1FA 5AUOB 3NENA 4Q19A 2WJJA 2N42A 3CX6A 1BKDR 3I4NG 2WSSD 3LQRA 4AURA 3HPQA 2HJVA 2GEUA 1NSTA 3BORA 5IWAQ 1P75A 4CEHB 4A3LH 4ARZB 1FGUA 5DE3A 421PA 3EA5A 5FUVA 5FBVB 2FX3A 3BFVA 4GP7A 1G4AE 4UJ5A 2DYKA 1GP2A 2QTHA 2VHUA 4WZAE 2UUBQ 2IHFA 2DN8A 2BEJA 4IJMA 4A6PA 2UZ3A 4F38A 1AQUA 4QNRA 2FA9A 1SRUA 1PHJA 5EE9A 5CYPA 5KSOA 1QVCA 1V1QA 1S72A 1M90C 3I4MG 2OCEA 2EIFA 1LFDB 1B0UA 4MDFA 4Q1CA 3EZFA 4GMDA 2J45A 1QZGA 3WMGA 1DG3A 1GL7A 3BS4A 1DAEA 5CLQA 3BAFA 1U99A 2D3WA 1Z08A 3HOUH 3U6BA 4EKDA 3IFTA 3CMAA 2F1HA 4LW1A 1FJGQ 4LPSA 2PMDA 3CC7A 4R2HA 1NLYA 2K75A 1IM2A 2XJ4A 4HZUB 4LYFA 3VAAA 4DLSA 2BBWA 3SFZA 3ULPA 1N32Q 2HXYA 1RIPA 4DUZL 3EZ7A 1HQYE 1NMXA 4DNRB 3KZ1E 3IQXA 3VFDA 4F91B 5LMNQ 1VPLA 2EQBA 3KB1A 4A2WA 1GITA 1VQHA 2NZJA 4MKIA 1QHIA 1VDZA 3IILA 1P5ZB 1MJCA 1A1VA 5SZJA 2XZLA 4JLOA 3TRZA 1PJRA 1E1RD 2IBMA 4LJ5A 4Q1FA 1S0UA 1YZNA 1UBFA 2AFHE 4IJLA 4F92B 1J5EL 2FZ4A 2V6IA 2YOGA 4KHPL 3FPPA 4V0NA 4Q9HA 2ID0A 4Q1AA 1CTQA 4NXML 5EP2A 3RANA 1EQQA 4A0RA 3UK6A 4CT4B 4NXNL 1E9SA 2BM1A 1W46A 4B3SL 4JI7L 3LFUA 3N2EA 4XWAA 4B47A 4HAWA 4B2PA 2BMFA 1KZGB 1E2HA 1YZKA 4JZKA 3QKRB 4P0TA 2XOKA 4O0MA 1M7HA 3GLFA 2IWHA 3ZIAA 3H94A 1JR3A 2QE7A 4JC0A 2ORVA 1E0SA 4C0BA 3WRYC 3GJ3A 2NN6G 3KX2A 4V0LA 1R0ZA 5FTMA 1DG1G 4DCUA 2QGNA 3S1QH 3K0FA 2GZAA 3U44B 5FPSA 1ZIOA 1SE8A 5D3MB 4W9MC 1IJFA 3K7AH 1K83H 2JCSA 3KFVA 3LLMA 2BC9A 3MAAC 4R7ZA 5TARA 3HR8A 3SHFA 2Q3FA 1NVVQ 1P8LA 4G5GA 4KSCA 4Q4JB 3SEAA 3W3AA 3VR6A 5AJYA 1SROA 1VQCA 2ZTCA 3M7NA 2JA7G 3BFXA 5DHFA 4M9XA 5HE8A 4KKUA 3PEWA 2WIBA 4OWWB 3NH9A 2LCFA 1XMIA 4MYTA 1KY3A 3U6KA 4W5HA 5KSYA 3REGA 2RHDA 2QL6A 2WJHA 3QPUA 3FOZA 4C2UA 1OTCA 1J6QA 1KAOA 1W4CA 3R7WB 3T5DA 3PXGA 4FCVA 1KK2A 3DL0A 3UIEA 2IYQA 2GAOA 4UNNA 2HEIA 4KFRA 5JS7A 2E5LQ 2C9OA 2WWGA 4LBWA 4TLEA 1IYJB 5IWAL 3BH0A 4DDVA 5JI2E 4ASUA 1HUQA 1AIPA 4G7HC 1XEWY 1KNXA 4GPTA 3SDZA 2K5HA 4DR5Q 2PCJA 1PLKA 2I5HA 1U94A 3IQWA 3PUWA 4OL0A 4RJLA 1G19A 2OM2A 3WNDA 5IYBG 3U4QB 3AVXA 2MSDB 4A3DH 4GKKL 1VCNA 2P6NA 1UKVY 4BY7G 4HB4A 4NCIA 4RD1A 1AN0A 1RYFA 2ZUCA 4DR7L 3GPLA 4YXWD 2QF7A 4FWTA 2PI2A 4JCVE 3FYHA 3H3VH 1XNQQ 2K5UA 3NEYA 2F55A 1NBMA 3AKYA 3DOFA 1L1OB 4GLAC 5AUQA 3EPHA 1H9SB 2B8GA 2H5EA 1ESNA 2GJ8A 3LAWA 3Q7PA 4BRWA 4LFBQ 2GKSA 2QY9A 1VQ4A 3AF1A 4LJ9A 3STBD 1KJZA 1X3GA 3S17H 1EWRA 1SXJC 2IL1A 1MT0A 3C15C 1W3SA 2F9LA 4LFAL 2WWWA 2XAUA 3UMSA 3QVUA 1VQBA 1UAAA 3KKPA 2E74C 1YEZA 2A6HC 4A0GA 1ELOA 1DAMA 1DAIA 1ZNYA 1T9HA 3UE0A 1F2UA 1R0YA 1YZGA 4I1OA 2G0NA 4IEIA 1UBEA 3QVVA 2ZI3A 1W0KD 3GJ8A 4KAXA 3S1AB 2MMGA 2XOKD 1D2EA 3GTJH 4TT3D 1GL9B 2J1LA 3F8TA 4PPQA 2GVBA 1E24A 3K09C 5DIFA 1K3RA 5EZ5A 1TX4B 4DR5L 2CCJA 1KSHA 3I92A 4OBEA 2IYWA 4DBLC 2GCNA 4QXAA 1OFUX 3QF4B 4A82A 3BB4A 3GTLH 4DIDA 1JB1A 1FX0B 2E5LL 3HWSA 2BH2A 1ZM3A 3LV8A 4P33A 1OE0A 3SJBA 4BUJA 4KLKA 4ABYA 4EQ6B 1DAFA 4FI3C 2ZR7A 1JJGA 3WXMA 1DO0A 1X9NA 1M6NA 3EIVA 3A0JA 2VF7A 2IA5A 1P2VA 3W9YA 4LF4L 1G3IA 2YNMA 3DOEA 2RGAA 4B33A 4BQSA 1HPCA 4ITRC 4LI0A 2J3EA 2VL7A 1L7VC 4LHYA 4WW0A 2RHMA 2BMJA 4GS3A 2ZI7A 3CWQA 4MKGA 2B63H 2AD1A 4AK9A 3B8HA 2AXNA 4MYCA 2K5VA 3T1TA 4LV8B 2PLFA 1NVXQ 4QGHA 1W36C 4RFSB 1JJ2A 2VP6A 1P72A 4PQRA 3LQQA 1BMFA 4FD2A 4POGA 1VQGA 2GVZC 3O8DA 2V6JA 4IKEA 1XNRQ 4DV0Q 1LS6A 4B3MQ 5FL7D 5BR8L 2VW9A 2Q9BA 4A3JH 2ATXA 2FWRA 4B6FA 3Q9LA 3R9WA 2XGJA 3C4JA 4TMVA 5HCIA 2A30A 4I1SA 1PFSA 3CRLC 4Y0VA 1AK2A 2RHSB 4HLUA 1IN4A 5FOWA 3B6EA 2GCPA 3MJRA 1X1SA 3S14H 2V9PA 4KU4A 1U0LA 2NOAA 4KN4C 2VQEQ 3GLGA 4H44C 1E22A 3X1ZA 2QAJA 4NXNQ 3DM3A 3QE0A 5TXGA 3QKSA 1CTMA 1KO7A 4FINA 3OEED 1G64A 3OW2A 2YWEA 1Z07A 5M5XH 2QNRA 3S1AA 4JBYA 1O87A 2IX0A 3HYTA 4OJKA 2QORA 4Q7KA 4Z8YA 2RH5A 4IJHA 3BGWA 3FFAA 4CEHA 1E2KA 2J7PD 3IUYA 1C7YA 1NLFA 1Q1ZA 4DV1Q 3IBGA 4LSGA 3ER0A 4URWR 5JWOA 2FG5A 1W36D 2O5IC 1S8FA 1VTKA 2Z5FA 1IYVA 2HDNB 3CF6R 4P4SB 3CQZH 2IT1A 1X3EA 1FX0A 1IN8A 2PZGA 5C1BA 5K36G 3SOPA 2A1AA 2X1VA 4M2LA 2Q2IA 1PH5A 1QBKC 3ZZUA 3KQLA 2QSZA 2W0SA 3WHKA 1N34L 5HZKA 4JYCA 1Y1VG 1WCV1 1FYCA 2NZ8A 4LJZC 3T06B 3RS4A 3THWA 2PCLA 3EX7C 2W2VA 3CF0A 4OHWA 4JBKA 1A5TA 4AG5A 1I94L 2UXBQ 8OHMA 2EVBA 2QP4A 2JK8A 3WYAA 3CAMA 4A9AA 3OAAD 1EK0A 3U7GA 4GNXA 1IN7A 1E1OA 1PUIA 5FPHA 3PUXA 3HGBA 2FJUA 1ZM9A 1EQRA 3NBHB 4X66Q 1E2MA 2QGZA 2IXEA 2V1UA 4OHXA 3I1FA 1AJEA 2QQEA 4KYIB 2J59A 4PC2A 3AF2A 1T8TA 5E7IA 1A63A 1GJXA 3AYHB 4PHHA 3HU1A 1N6IA 1XZQA 2F6RA 3P4XA 2CL0X 4JLJA 4PZZA 2O8FA 2E8GA 4MA4A 4AKEA 3BG3A 4X8HA 4CEIA 3AP1A 1Y3AA 1XTRA 1JXOA 4US0R 4IQZA 2QN6A 4QHSA 2WWYA 4B3RQ 4HJ5A 3Q72A 2DGYA 4TZ6A 3PIOA 121PA 1SVKA 4DK0A 1EFCA 1WRBA 3CC2A 5IYBH 3HKZE 2I3BA 1IYUA 1L1OC 1OYYA 1IN6A 2WOOA 3AV0B 4IHQA 4P4SA 2D62A 3GTKH 3KUDA 4WVFA 2VHTA 521PA 3IPYA 4Q7JB 3T51B 3LXXA 3N6RA 2CVFA 4QHTA 1SULA 3T56B 3STBC 2UXDQ 3CF2A 3ZH9B 3U3JA 3KKMA 2REOA 3QKRA 1KOFA 3RR5A 2VP2A 1MRNA 3KJHA 4JVNA 2NVTH 1B8AA 1VYVA 2A69D 2IX1A 4YMSA 2ASEA 4F4IA 2XB2A 4C7OA 1RRGA 3NE5B 1U0JA 3CPWA 2FSIA 2VP9A 4WJ3M 3UG7A 3LLUA 4CIDA 3OEHA 4B2IA 4XVRA 1E6CA 4ZKEA 1KD1C 3LGJA 1HR0Q 4CGZA 2C78A 3K9NA 2ODNA 4RZUA 3EIEA 4TLBA 3I7FA 2G83A 1U8AA 4L5SA 3SN6A 4CRWB 4EPXA 2GF0A 1ZYRC 4JBWA 3H0GG 1XTSA 2Q21A 4FN5A 3KLRA 2FGKA 5SZHB 2OHFA 2WKRA 2HQLA 1N36L 3CF5A 2B92A 2IYVA 4RCNA 3WMFA 1R4AA 4KVGA 2W2TA 3V00A 5KDDA 3KDFB 1VIYA 2GJKA 2N49A 1NJGA 2DNCA 1XXHA 4LC0A 4B3ML 1NG9A 3UPUA 2E75C 4PG3A 1JECA 5M5YH 4JLAA 2WICA 4JI6L 4BEBA 2W0MA 1II0A 3RABA 4BFVA 3WP1B 1C4OA 3UG6A 1FL9A 2WPDD 3QEOA 2JEAI 1GKHA 2ODWA 4C30A 3ZZTA 4D6PA 1W1WA 3OF5A 1II9A 4Q1DA 1N25A 1G3RA 3SZRA 2YWHA 3B78A 4M1OA 5DSZA 2IW3A 3K53A 2HLDA 3T12A 3ASYA 2QI9C 1NVWQ 2ZITA 3UWOA 4IOLA 4B43A 4CEIB 4GN4B 4QFMA 4CVNA 1PUJA 1YZ6A 1ZNZA 1UKYA 4D0LB 4A3MH 3SE0A 2GHIA 4N0DA 4Q4HB 3T5GA 5IP7H 4NPHA 3KXLA 1JI0A 1HCZA 3JVUA 3CH5A 1A62A 1WYDA 3ONWA 3CMEA 2LMCB 1S9HA 4JYAQ 3ASZA 1Y8PB 3HPRA 4V0OA 3QENA 1KNQA 4PXAA 4URUR 4LF5Q 4A3EG 4UP8A 2VNUD 4IPHA 1KRTA 2R93G 1H8HD 2AWNA 1Q20A 2CLDX 2MSCB 2Q3MA 3IBYA 5F9HA 2NTYC 2MNAA 1DPFA 2D2CC 5LMUQ 1N0UA 1U5KA 1E2ZA 1T5IA 3O47A 4MDEA 1JR6A 1JPJA 4R4TA 2K32A 3GFOA 4GBMA 1XMQL 3OYYA 1WP9A 2ZYUX 4RD3A 1IBMQ 4DV2L 5FOXA 2ZPTX 5CJPA 2J46A 1WCMH 4Q01A 3MEFA 1OKKD 1ZIPA 3LW7A 3DO6A 4JLMA 2OFWA 1OHHA 3EWAA 3LDAA 4D0GA 4DV4Q 3TR5A 3K9HA 3U60B 3ICEA 4EPVA 4B35A 2PJZA 2ZS9A 1E1TA 4OXPA 5IT9c 3OEEA 2ZSDA 4NCJA 3TUIC 2YC4C 4GOPB 3P20A 1AS3A 4DKXA 2C35B 5HTKA 3EZ9A 4P71A 4PV1C 1UEIA 2JA7H 5LBIA 4CW7A 1G3MA 1TWAH 4KKTA 1GAJA 2GTPA 3Q3JB 3ZVLA 2Q0HA 5JMTA 5GJBA 3F2DA 1CFMA 2K7VA 1HZAA 4DHEA 1E4YA 2VPPA 4DV6L 2KHIA 3PG5A 5GROA 2NN6I 4TYWA 1ZC4A 1SQ5A 1Z6HA 2Z0MA 3C8UA 2E2HH 3G6EA 2OLJA 5CK4A 2D7CA 2J0VA 2K33A 1G17A 1DAGA 2VIIA 4P31A 1HNZL 1YU9A 621PA 5LD2C 2R7FA 5EP1A 1CJTC 4GRAA 4DSUA 3J81i 4GKJL 5L3SA 3EPLA 5M3MG 4RFVA 3S15H 1A0IA 2MQHA 2AHOA 3CX8A 4V0ME 4C0HA 2O8EB 2VSOA 5DN6A 1NN0A 3RLFA 1N33L 1R6BX 1XD2B 3PCOB 4B3BA 4LHVA 4Q4HA 3TS0A 4JJZA 3HOZG 4YC7A 4DSTA 1T3LA 1DARA 3I61A 4BXXH 4URXR 1U90A 5H1SE 4JBJA 4X64L 2YYZA 4PAQA 4B3SQ 4A3DG 1Y63A 1CKOA 2ZRPA 3SR0A 1BS1A 4IXMA 4DR2L 2ZS7A 1QUQA 3RS0A 4C3ZA 3KQKA 2I5MX 4DPGA 4D4JA 1KSFX 2HLDD 1OH6A 4KBGA 1AS0A 3ND8A 4OO1I 1E0AA 3CO5A 4WBSA 1D9ZA 1U0HC 3H0KA 4TL8A 2QG6A 1ZU4A 1K5GA 2YTXA 1TF7A 1XRJA 5KUTA 4ILEA 5C44G 1M7BA 4G7ZC 4ME3A 4A3FG 1GL6A 2WWIA 4NTZA 2IYSA 4TMXA 3WP0A 3GLGB 3TAHA 3C41J 2JXMB 3CKLA 1J7KA 2VSXA 1UWVA 1GD7A 1YVCA 2I0QA 1G8GA 5CDFA 5E3HA 1EX7A 1N6NA 1SHZA 3IIKA 3THYA 4IFDI 4DUZQ 1SZPA 2EW1A 2IXFA 3SYKA 1GRRA 1NY4A 1I4TD 4M9SA 1ZUNB 4QRHA 1W49A 5EP3A 2YVUA 3EARA 2NIPA 1G3UA 1Z0DA 1UF9A 3UDIA 1YZLA 1S3OA 3IPXA 2CCZA 4HJAA 1E94E 1XD2A 1KGDA 1TQ2A 3AKCA 5FLMH 4AQYL 4A3IG 4GMXA 4IW3B 2JAQA 4C4PA 1KIMA 1DELA 1JPNA 3B5JA 4A8JA 3MWKA 2VQSA 2ZANA 3TW8B 1NMZA 1ONLA 1T5LA 4NXMQ 2VH5R 4LHWA 1GTVA 4M0LA 2VP0A 4GKJQ 3CZPA 4Q02A 3AGQA 4JSYA 5EE5B 3N2IA 1Z9FA 1VQIA 1E2GA 2QAGA 1S1MA 3B13B 4DCTA 4DWJA 4BPBA 3HFZB 4DZZA 4BFWA 3B1WA 1AGPA 2BHRA 3THWB 5DI3A 3T1HQ 1IBML 3I4NH 1AQYA 3B9QA 3DMNA 1TUIA 2UUCL 4MH0R 2BE5D 4IXNA 3QJYA 1MIUA 4G5QA 4UJ3A 1W7AA 4R1JA 3K81C 1E2DA 1KRSA 4PZ6A 2F1IA 4I7ZC 2HYDA 2ZRLA 1G8YA 3FDIA 1Y1VH 1JEEA 2OESA 4BLOA 4EPTA 4IEEA 4DDWA 2A19A 3Q85A 1C0AA 4JV5Q 2WPDA 3B9PA 1DAKA 1G6PA 1I5FA 1T6NA 2YV5A 1K8GA 3KXKA 2VZAA 4GLVB 1VQLA 1I6VC 3QEJA 5FPKA 5C0XH 5DN6D 1CP2A 2R7DA 3BE4A 5DGXA 3J7ZC 4DV1L 1NBMD 3K70B 3K0AA 2F1MA 1QVGA 3RN5A 3I32A 1Y1WH 3D6TB 1Y69U 3UDXA 2NQ2C 1M2OB 2ALYB 1G5PA 1HQCA 2H17A 2OILA 3GQBA 4EPRA 1JR3D 4HR7B 2K52A 2CCGA 1PH4A 4B71A 1J90A 4L5QA 2ES2A 2ZROA 3OAAA 3CB4A 4GOPC 1CKNA 1E9EA 2OTLA 4GZYC 1BBWA 3KOJA 1G16A 5TY0A 1SLJA 1I4LD 4UPAA 4GKKQ 2GCOB 3CC4A 1N6OA 4EFMA 2YWFA 4DK1A 4IPCA 4YONB 1KZ7B 1MO5A 5C0XG 1LTLA 3ULLA 1E96A 2QRZA 3GCGA 5E7NA 4KLNA 4A2PA 1CRPA 2QA5A 4QOSA 2N3SA 1E2QA 1QHXA 4RKFA 1AE2A 3WYGA 3GLIA 2VEDA 4D4KA 5KO2A 3UDFA 4JI4Q 4EQ6A 1IW7D 1HZBA 1Q22A 4A3CH 1IZ6A 1Z0AA 1D9XA 1IL2A 2IK8A 2OV2A 5EXSA 1FUKA 2A5DA 1VYTA 4TTPA 5JEEA 1GOTA 1N2CE 5FI0B 5JEAG 4LOAA 3H15A 5SZKB 3FHTA 4LUZA 3IHWA 1SMYC 4DAYB 4LNQA 4O25A 3U44A 3K9GA 1HR0L 1R5OA 1E9RA 1NMYA 4NMMA 5AUPB 1S4QA 1YJWA 5FLMG 1M7GA 1MO6A 3H0GH 3ZJYA 5HKKD 4Q9IA 4AKIA 4OK6A 1ZCBA 3GEEA 2IC5A 1IQPA 3NC0C 4TVAB 3PO2H 3EC2A 2WM9B 4P74A 3CRW1 3DDCA 2ASBA 3OZXA 3TUJC 721PA 1VCOA 3QG5A 2WB1E 2EXDA 2UXDL 1ZNWA 4KFUA 2B7CA 5GADC 3QXCA 1CJMA 1E79A 1D6JA 4PO9A 4G5OA 1QJOA 3V4RA 3NEJA 3NWJA 2HIXA 1X86B 3DZ8A 1PH1A 2IYLD 1TUEA 1PLJA 5EP4A 3R7WA 1F2TB 3UANA 1W4RA 1NVVR 2UUAQ 2P5TB 3IEUA 5J4VA 4O2DA 1IJEA 4B3RL 5HKKA 3AFPA 4B76A 4NYIQ 1PYBA 1KKLA 4HSEA 4DR1Q 3GLIB 1COWD 1N33Q 2FV8A 3TSWA 4A3BG 2RGEA 2ZU0C 2OQ0A 4KHZA 2LXKA 1U98A 2OEPA 4JKYA 4BA2I 2VS1A 4KCGA 4Q18A 3A1TA 4DC9A 1NN1A 1XEWX 1JJVA 4GZMA 4DNTB 1NBME 1E79D 3CCQA 4FMCF 4G3XA 4FMDF 1K73C 5HE9A 3HOYH 3FP9A 3P4YA 1B9MA 2CL7X 1Z6XA 1HE8B 2D2EA 1HY3A 4YDSA 1GUNA 3A5UA 1GILA 3K7UC 1G7TA 1Z0IA 3EAQA 4LJ7A 1JR3E 3HOXG 2ZRDA 4NL4H 2R6DA 4RKEA 2Z6KC 4TTQA 4ERNA 1LUZA 2KCMA 4Q03A 5EQTA 5J40A 3RSLA 2ANBA 1Z28A 1HZ9A 1H9RA 3OESA 2VP4A 1NP6A 4U02A 3WRXC 4ZKDA 1Q81C 2RHQB 2F3RA 1GUTA 1HT2E 4DR4Q 2ZREA 2J7PA 2CVHA 3QOFA 4DUYQ 1PLLA 1GUGA 3RS5A 2OWOA 2JJ1D 4HIKA 1VQ5A 4JI1Q 4LJ8A 4GOKA 2F52A 5IP7G 4A4IA 3G0HA 2YTYA 1S96A 3H2YA 1CR2A 2ZRNA 3IRBA 5GVRA 3V4FA 1YHNA 2JJ2A 1IBKQ 2X19A 4OK5A 1TKWB 3KYHC 4ALPA 1FJGL 1G8FA 1T3SA 1TQDA 1LYLA 1SVIA 1DCZA 2VL6A 2GWHA 3QXXA 3S1RH 3E0EA 2RGXA 3M0EA 4JL8A 3TBKA 4E03A 4LY6A 4UY8C 4ASUD 1TQ6A 4BWYA 2NVQH 4HEJA 2QMOA 1SVWA 3CD6A 2DFLA 4Q1BA 4UNSA 3F2CA 3N5CA 4KMUC 4DXAA 3BC1A 3TMKA 2K14A 3ZD7A 4Z8XA 2AKWB 1OXUA 3MUFA 5KNCA 1L4UA 1W4BA 2QPOA 4A3BH 4LJAA 4Q4LA 2GJ9A 2EWVA 1X1RA 4RZ3A 4GLXA 1TU4A 4LYAA 2E1RA 4R4CA 1SVLA 5GJWC 1G8PA 2H92A 4L8JA 4PHTA 1YR7A 2Q2TA 2G88A 5B2ZA 3M1IA 3ULJA 1WOCA 3VQTA 1X8KA 3LA6A 3TREA 1DGSA 1E0JA 2ZU6A 4POAA 2DUDA 5B64A 2J0SA 2EJMA 4Y7NH 1SN8A 3A37A 1YJ5A 2JA5H 3EASA 5A4JA 5BN3A 1IHUA 1P2SA 3B7GA 1TTTA 4EPYA 4BBSH 4K0KL 2BDOA 1KY2A 4K46A 4W5WA 3VR3A 4A3KG 1F48A 4KFSA 4NYIR 2R6CA 3OHMA 1VG8A 5JFGA 1SXJB 5C4MA 1XDBA 2V4ZA 5JWHA 1G3QA 1RE0A 4A92A 4EIWA 1E9BA 1FOEB 4QIWE 4R98A 1XMOQ 1KQSA 1T3HA 4OYHA 3RHFA 4PO8A 2HCJB 4H0LC 3EWSA 1PMRA 3IKJA 1LTQA 2QEQA 4L8GA 1L2FA 5GAEC 2Q9AA 3LX8A 3S2HH 4H1VA 4MZ9A 2IF2A 1GVNB 3KF6B 1N5LA 1FP6A 3KXIA 4MRNA 3QKTA 2EQSA 2UXCQ 4R4OA 2QEXA 4X8LA 4JI7Q 1VQ6A 5IYCH 2WVJA 5AUNB 2B7BA 5C4XH 2JA6H 1OIVA 1P60A 3B1YA 3LD9A 3DLLA 2NZHA 2V1XA 4HUQB 2CNWD 1OJLA 1CR1A 1XD9A 3HOUG 5AJ3Q 4G5SA 4PSKA 3CW2C 2YOFA 1E2LA 4AI6A 4IDNA 3SYLA 1JT8A 1AZSC 1SKQA 2ZI5A 2D4HA 3EIQA 4GOJA 4RD2A 1GZSA 4Q7MB 3EBEA 3ICQB 3KKNA 2JEBI 4P4TA 2GJSA 3LWNA 3WNCA 3AEZA 5LB4A 2KENA 4TQUS 1KL9A 4DAMA 4PTLA 4KVAA 1YHAA 3PR1A 4UP9A 4TMTA 5G53C 1SVSA 1VQPA 2KE5A 5H68A 3RRYA 4OONA 4GN5A 4CDGA 3PQCA 3A1UA 3AUXA 4PFSA 1ZD8A 1C1YA 2FSHA 1Q82C 1G6OA 2ZS8A 4OKSA 4M1WA 4NB3A 3L0OA 1KK0A 4TLDA 2OAQ1 1BDOA 2QBYA 1KO4A 1K5DA 4Y0AA 2ZJZA 2D7DA 4XVQA 2A69C 1JAIA 1X3SA 2EFDB 2DHRA 2N1BA 2REXB 4M9QA 4MQBA 4MUBA 2YOHA 2AL7A 1F60A 4B75A 1L8QA 4JLVA 1KDPA 1HJPA 1SR3A 3UDGA 3SGIA 1M74A 1UDWA 3NG1A 2NG1A 1KAGA 2R62A 4KFTA 2GRJA 4LDJA 3AM1A 4FCTA 3LRPA 4JLPA 2W6JD 4NE2A 4L16A 5CYOA 5IK2A 3ECCA 3HJNA 3K0FB 3L82B 2Q2UA 4HDQB 5DYGA 1ZINA 2UUBL 2GK7A 1ONBA 2P5SA 3FB4A 3TQCA 3TE6A 3EC1A 4MGIR 2PQAB 1Z83A 2ZRIA 1VG0B 5H70A 1XMJA 1RL2A 3IDQA 2KBFA 4BLQA 1X3FA 4Q66C 1VQ9A 3CRRA 2JDID 4DEYA 4KXFB 1XP8A 5EUMA 4F4CA 2ZRFA 5AR1A 4Z51A 3CRKC 1QRAA 2GXQA 5JWRA 3NEMA 4HIDA 1AKEA 2FEMA 1MJEA 4QGFA 4LYHA 3C14C 1OKKA 4BXXG 1OFHA 1UBGA 2G77B 2N8NA 1DEKA 4HJ9A 5CLLA 2WBLC 2JA1A 2J7KA 1L0WA 4XTRA 1XMOL 2BWJA 4M22A 5FUXA 2PT5A 1AGRA 5HGQA 3SQXA 1GHJA 2BH8A 4JYBA 1Q12A 1KJYA 3F3YA 2PL3A 5EUQB 4WXPA 4LF7Q 5IYCG 3TUZC 1XZPA 4JI8Q 4JL5A 2GK6A 4M1YA 3T1HL 1WJJA 1FR3A 2GXSA 2WWHA 4ARZA 2WFWA 4LF9L 5K8UA 5AWFC 1ESMA 1Z0KA 3SBEA 1VQJA 1TF5A 3AVVA 4XVUA 5C4GB 1Z7TA 1WBDA 4PQYA 3G48A 3A58B 4QQBX 3PCRB 2JJ2D 4HLUC 5FOSA 3J80i 4LFCL 3NBZC 1W2BA 4M1KA 3ERSX 4A3GH 4IFDG 1W5SA 3CBQA 2JE6I 4IOJA 4BFTA 5FJ8H 2G1JA 2HIVA 2UU9L 2YU9H 3UWKA 3B82A 4L9WA 2GBLC 4DCNA 1KXLA 1L1OA 4LUCA 2XXAA 3UMFA 1FVIA 2P3SA 4C7OB 1KI1A 3L0SA 1TWFH 4PAOA 5IE8A 2REBA 1E7ZA 4M1TA 1NKSA 1O7IA 4OQMA 1UE7A 3M3YH 5L3RA 1H9KA 3JAMi 3GDEA 2ZJPA 2HHHQ 1EFWA 2PH1A 2CLSA 3NHBA 3I72A 4JSTA 1HYQA 5FTNA 1F2TA 4JI5L 3WWVA 1YJ9A 1QF9A 1YR8A 1ZUIA 2VO1A 3L8YA 2HXSA 3VKWA 1N6HA 1PH9A 3P1JA 1WQ1R 1ZCAA 3I8SA 4PC3A 2VA8A 3G5UA 4B44A 1IBKL 1KI4A 4J0QA 1Z47A 4J15A 4OWTB 4K0KQ 1OIWA 2OCAA 3BB1A 4G5RA 3CXCA 1VYUA 3BJUA 2PPBC 1R5NA 4JMPA 4JI3Q 2ZM5A 2D0PA 5DNYB 2LKDA 3OEHD 4EFLA 3K70D 2A8VA 4BFZA 3A4LA 4PX9A 1SGWA 3ZQ6A 4B6EA 1ZYUA 2AKYA 4TYNA 1G8HA 4WZ6A 4LF8Q 4K81B 3PJRA 1C9OA 1OLOA 4I81A 4HJ7A 4LYJA 2ZRCA 3H86A 4OI2A 3M4PA 2C2HA 3QNUA 5JEAJ 5C46F 4MGKR 3ZD6A 4DLTA 1G5TA 3HOXH 5AK0A 1ANKA 1FQKA 1Z6GA 3SBDA 2ZETA 1VHLA 3AGPA 1XTQA 3KQHA 3U4VA 3BB3A 4LPKA 2ZJ8A 1JB7A 5M3FH 4Z1MD 1GNPA 1R2QA 2R9VA 3BDOA 2R6FA 2Q6TA 3CRVA 3L8ZA 4PPFA 4V03A 3EPKA 2B63G 4YCUA 1XD8A 2ZQ5A 3GLHE 1X56A 1L4YA 2IHYA 4YCVA 4QGGA 3GLFB 3BZKA 2OXCA 1LACA 1H9JA 2R2AA 3TQFA 4GDFA 2FNAA 5JCZA 4AYWA 2QQ0A 2Y8EA 3QXHA 1Z2AA 2IX3A 2VUMG 3V9PA 4GP6A 4MYUA 1V9PA 1E2PA 1FL0A 1I3QH 4XWOA 1XTDA 3Q7QA 1OIXA 3S2DH 3QKUA 5DYIA 2J0UB 4MRSA 2ZTEA 4QM7A 1NJFA 2GJAA 2A6HD 1CKEA 2KBNA 1KI3A 2C99A 2FFAA 2IYYA 1U8YA 4DLYA 3PUZA 5FBLB 1OXSC 4KJZA 3B1ZA 1YZUA 3NHAA 4RFSA 1Z63A 2YC2C 3FHOA 4BASA 4M8NE 1NY6A 1OW3B 1Z5ZA 2YINC 2ZYWX 3P27A 3L43A 3VKGA 4HJ8A 1H8HA 2L0XA 3VX4A 2OCBA 2VYFA 3GEIA 3T1OA 3AB9A 2KB0A 1ZU5A 2FEOA 3DM9B 1XMQQ 2PBRA 3IO3A 2RGGA 4MTNA 3FKSD 2ZUBA 1D7QA 1HR0W 2DWOA 3CPFA 3RYTC 3GLHB 3EW9A 1PZNA 2V4DA 3H4MA 1VQOA 1MV5A 2AWOA 2RGBA 2DR3A 4Q48A 5HZHA 3RVBA 2OO7A 1TWCH 1IBLL 3W8RA 1KI2A 2A78A 1I4DD 4UP7A 1E3MA 4I1VA 3HOWH 4MUAA 3PVSA 4KO8A 1E2FA 2WAQG 3CR7A 1E4VA 2VF8A 4BY1H 2CL6X 5CIQA 1P9RA 1RRFA 3ADCA 3ZLJA 2VHQA 2UXCL 5KNBA 1OSNA 4HDOB 4IVQA 4UNPA 1A7JA 1XBTA 5L3SB 2OSBA 1OPXA 5DI9A 3O8RA 2IS1A 1EYGA 4DCVA 3WHLA 3HOYG 3EA0A 4NBSA 4BE7B 4PZ8A 1SMXA 4C3HH 3B1XA 4N1AA 4D4MA 1OFIA 1R10A 4M4SA 5FBRB 5J4KA 3GD7A 5JJIA 2C96A 2OE2A 4HB3A 1GRNA 1TL7C 5KNDA 4GNXB 1E99A 5KTYA 1GVPA 2RMKA 2IS4A 1T0HB 2VP5A 4BZPA 4LUOA 3FWYA 4TTRA 1KO1A 5J47A 4BBSG 5CK5A 3HKSA 1Y1WG 1KI6B 2CWPA 1R8SA 2G6BA 1FP7A 2OFOA 3NDBB 2RF4A 5ELNA 1I2MA 2C77A 4WAUA 3ZJYC 1VQNA 1Q21A 1RIFA 3E5HA 5TB5A 1XJCA 3W1BA 4N3NA 1LVGA 3VR5A 3LX5A 2HF9A 1QZHA 2YHSA 3MXNB 3U50C 3LW8A 4DV5Q 1GKIA 2NPFA 4BLTA 3EG5A 4HUTA 4DLZA 2AN9A 1VKJA 3M6AA 3M4OH 2WB1G 3GEHA 5GQOA 1K9MC 5EXTA 5C18A 2PLRA 3I5YA 3CUEF 1IY0A 3MWJA 1Q90A 3U7EB 4TSFA 4KLZA 1MKHA 4LF6Q 4LFCQ 2XNSA 1F6BA 3ZS9A 4DLVA 4LUVA 4MRVA 3VR1A 5TVKA 1HNXL 4X66L 4ZDWA 2OCYC 1X8LA 3L0PA 2FFBA 5M04A 1KI9A 5IF9A 1CJUC 3LO5A 1KSGA 3QPWA 5AJXA 2QUZA 1II8B 5G40A 1MR3F 3OIVA 1COWA 4V02A 1EFRD 1M34E 1UFQA 2PZEA 3TLXA 4PZYA 4E22A 4QKQA 4FW9A 2J87A 2GILA 5C3EH 2H16A 5FUWA 2CLCX 5LD2B 3QIAA 3RS7A 4RVCA 3CPJB 4BFUA 1ZM2A 1T8UA 2QMUA 4A6XA 4XSHA 4AH6A 1K8RA 2D06A 2I4IA 4JJKA 1AKYA 3FPAA 1MRSA 4PSAA 4CEJB 4AY2A 1U81A 4LK2A 3U3RA 1ZM7A 4ZIRB 3FFBA 3W1GA 2IUTA 3IO5A 2O8CA 3KJOA 2P67A 3KQUA 5BR8Q 3A1SA 2C8VA 1EFUA 4D2IA 5JRJA 3R8CA 1E0KA 2RGDA 3C5CA 4B34A 1GRQA 3QKSB 1Q86C 1J70A 1KDOA 4BA1I 1EOVA 1WE2A 2JASA 2ZRJA 3A36A 5IK2D 2ZI6A 2Q9CA 5K8IA 3K8AA 2FZLA 4FMCB 2HF8A 4JS0A 1HT1E 4OO1G 3TNFA 2E76C 3CNOA 2QTFA 4LCBA 4A0FA 4R4IA 5FL7A 4DLUA 4D80A 1LABA 5AJWA 2B21A 2DFKB 4IO9A 4DR3L 2L15A 1LW7A 4L5TA 3I4MH 1ODFA 2PEZA 1CULC 4KV9A 4PO1A 5L3QB 3T61A 2UUAL 5AJVB 5BN5A 3TVTA 4C0LA 2ZJQA 2FSGA 2PJRA 3GFTA 1FPMA 3WY9A 3A8JE 4ESHA 1EG7A 4B2LA 1MABA 1I2DA 5GAGC 1NN3A 5J4YA 1NY5A 4G0NA 2BIFA 4YQFA 1OB2A 3OW7A 1FQJA 3DEFA 3Q8XB 3QF7A 4XJXA 5CDFE 2CXXA 3WNBA 4E5UA 1KAWA 2EFHB 4OQXA 4ZCLA 2H1LA 4URYR 2V1CC 2XNDD 4AYXA 3SS8A 3Q5DA 4X62L 4IDPA 5FLXc 1AE3A 4JVLA 2ZSBA 4P32A 1W2GA 3CX7A 4PC1A 2NGRA 1IXRC 4D82A 2A5FA 3BU2A 1N34Q 3PF4A 1CI3M 1YIJA 3OE7D 3QBVA 4X8MA 1UEJA 1E2IA 4W7SA 2YWGA 1WXQA 4JG2A 2PMKA 1KDRA 4A93G 4NH0A 2C95A 3WBJA 3J81j 2ZVQX 3BH6A 4AIIA 1ASYA 2O8FB 2FXQA 3FMPB 1N5JA 4OO1H 1E2JA 1HTPA 2G3YA 1EIFA 4CZ2A 5FI1B 5J3BA 2BDTA 1U8ZA 4HYYA 4LFBL 2KCCA 4B3TQ 1Z29A 4JLKA 3KJGA 3TKLA 4S35A 3SU8A 4FMBB 4NYJQ 1SXJD 2V7QA 4JI8L 4UNRA 2ZSEA 3LXRA 4A3CG 1NL3A 3X2SA 2R92H 3MRSA 4PPNA 5CM8B 3KJPA 4A15A 1YKSA 3AVYA 5LMUL 3PSIA 4HIOA 2JJ1A 1KMQA 1W0JA 1AS2A 4LHZA 1L2TA 1NTGA 2IXGA 5E7JA 4DEXA 3LNNA 2IF0A 5EZ6B 1KHTA 1QHHB 2E9SA 2VHJA 2W2XA 2GN5A 1PH7A 1FUUA 4RMFA 1U9IC 4EJSC 3FE2A 1DAHA 4OHYA 4DUYL 4EFNA 2UKDA 4OQLA 3Q8DA 4LFAQ 2GXUA 2PNHA 4D4LA 1DBSA 1XCGB 2LWIA 3PO3H 2PI2E 1HE1C 1P7CA 1OB5A 4DDTA 4Z54A 3AP2A 3MMPA 1GM5A 3ZDQA 1DADA 2CHQA 1YE8A 5E95A 3CCEA 5K8LA 4EAQA 1GKYA 3K80C 1US8B 2JA8G 3W5JA 4AKGA 1RJ9B 2MFIA 3PITA 3SC3A 4CYMA 2H8KA 1P2UA 1CBUA 5TV2A 4B32A 4BZXA 1QZXA 4RZXA 2A5YB 3G4SA 3ZVNA 2EFGA 2WAQE 3RSOA 2VQFQ 2DNEA 1HH2P 2W00A 4X62Q 1IXRA 1EXMA 1XX6A 2ZE7A 4BLPA 2UUCQ 4PANA 4UKDA 3AVWA 1G4UR 1QVRA 1XMSA 3TSZA 1TEVA 4A93H 4QJ4A 4C2MH 1KKMA 2CDNA 4O0AA 4YWLA 2O52A 1VMAA 3AP3A 4URVR 5IY0A 1QVAA 3VDYA 2X8AA 4ZI3A 5FTKA 3WDNA 1T0JB 2AK2A 4QBHA 4BLSA 5DLQC 3RDPA 2JA5G 1NLZA 2HT1A 4M21A 2Y0SE 5AJ3L 2F4VL 2W6JA 4U00A 3W8NA 4C0KA 3MXUA 4A3IH 1LY1A 4QNMA 5KSPA 4LC1A 4Q21A 2ZR0A 1BBUA 2PZFA 3KL4A 4JLDA 1TXYA 1TWGH 1R7RA 1YZQA 2AD5A 1X54A 2E2JH 2FH5B 2WZQA 1CIPA 1FMLA 4D26A 1N5IA 3AUYA 4B48A 1Q1BA 5B30A 1ZKOA 1XPRA 2AK3A 2ZE8A 1QHGA 2HCBA 4EDHA 2X2FA 2WAYA 2WJGA 3RC8A 1Z6TA 1XEXB 2JDIA 2KJQA 4JI3L 4FDBA 1TEXA 1CEEA 2PMZE 2YTVA 1VQMA 3RRMA 3QI2A 2ORWA 4HZIA 4TYYA 1HZCA 3U61B 2EWWA 4A2QA 3R8FA 4MGZR 3SNHA 2O0HA 1YBYA 5GJCA 1GFIA 1UE6A 4R4QA 3PO3G 3PFIA 1A4RA 3CPHA 4KHPQ 2CJWB 4HI0E 4PR0A 3UKDA 5BWMA 2GEVA 2IEYA 1EWIA 4UNQA 3U3KA 3ND9A 4JI6Q 2O8DA 1F5NA 2CBZA 4TWZA 4D81A 1NG1A 3H84A 3MSXA 4U7DA 2CNWA 2OTJA 3RWOA 4QHYA 2WIAA 2CWAA 4JI2Q 4DVGA 2WOJA 5A35A 1S3GA 1XTIA 3GFPA 4OWXB 4FIDA 2BA1A 3I62A 4DR1L 2HUPA 2ZYVX 5EE1A 2LXJA 5LMNL 2RGNC 3KQNA 3FMCA 2IYXA 1R0WA 3GTMH 1VECA 5M3FG 5FBWB 4RCZA 1YHQA 2NPIA 4PZLA 4DR2Q 4KITB 4YMTA 4DLRA 2W6ID 3LH5A 1KI6A 2AFIE 2OZEA 5CM9C 2WV9A 2G0TA 1TWHH 1N9WA 2CEAA 3MWYW 4APVA 2Z43A 4RCYA 2JQOA 1GUAA 5DI3B 1IY2A 5J5CA 2D74A 3VHLB 1R8QA 3RWMB 5JCPA 2KHJA 2IS2A 1IXZA 3QXJA 4BY1G 4HB0A 3AEVA 4WZBE 5EXXA 2Z4SA 2BBOA 4KKSA 1CKMA 1AZTA 4OJQA 4KBFA 2JJQA 3K0CC 1OT3A 2BEKA 2ZM6Q 4FWIB 1GUSA 3ADDA 1X8JA 2XITA 1MO3A 1RVDA 3OIWA 1OHHD 3K9LA 1Q8KA 4A3LG 4XD7A 5GJVC 4X64Q 2F1RA 1XF9A 2WJVA 3W3ZB 2ODEA 3SI7A 1ASZA 1NVUQ 3J80c 3BBPA 1Z06A 5UKDA 3AVOA 4TMKA 4IOMA 1FTSA 4TYPA 3T35A 1ZJ6A 4JT4A 5JLJA 3A74A 4GOXA 3C7KA 1PV4A 1O78A 3RNUA 3HOVH 1ZW6A 4OI0A 1E32A 3IGFA 5F98A 4IFBA 1VF5C 2V54A 3MLEA 3RLNA 4C3IH 4B3FX 4GNKA 3SJCA 3M9BA 4AWXA 5JI3E 4JK1C 3BRWD 4NCKA 1T5EA 1U2RA 3CCSA 3K0XA 1EWHA 1Z6AA 4YWKA 2A5JA 2GCOA 1R9TH 4Q9LA 1R0XA 1OH5A 1SHKA 1O3YA 2BCJQ 3VU9A 3IIMA 3KB2A 1MKYA 2EDGA 2A6ED 2CCKA 4IOKA 2ZJ2A 5JEAH 2P0EA 4X6AH 4PC6A 4LV5B 4QC2A 4DR4L 5BYJA 2QTVB 2EJFC 2CK3A 3VHXA 1OYWA 4Z1MA 4IVRA 4HAXA 1OFTA 3NKVA 2R92G 3F5FA 4LBYA 3HP1A 4R2IA 1EFRA 4JI2L 2V8OA 2VHCA 3B2EA 3E9HA 5HY6A 3A4MA 5KSZA 3U4QA 1RRCA 2GVAA 3QXSA 4PAMA 4P72A 3KJEA 3U3MA 4QL3A 3O8BA 3RS3A 4YHHL 2N46A 3CONA 1A8VA 2ZM6L 5G3YA 4RY2A 1YQTA 4A4DA 4F93B 1VQ8A 1G41A 2JA9A 4KSBA 2UZIR 2WMOB 3SYNA 4XH9B 3KKOA 1RPZA 4LF9Q 3K1JA 3AFQA 2ERYA 3CCVA 3LVQE 3BOSA 1NSFA 5HCNA 3TRFA 1G51A 3PF5A 1E9CA 5GADl 5FH9A 2F43B 3A1WA 1MOZA 3ETLA 4A8JB 4NDZA 4L5BA 2DWPA 2CK3D 1AM4D 2F1JA 2NO6A 3BWDD 2R7ZG 2XB4A 2PCFB 4NPSA 4XOIA 5FPTA 4DUGD 4Q00A 5JECA 1MABB 1ZBDA 1IAQA 2FPLA 2ATWA 1LV7A 1GWNA 2AKAB 5JHHB 3GTQH 3GJXC 2P2LA 4Q1EA 1CF4A 4PC7A 4MNOA 4US2R 5FJ8G 4TQ9A 5L8VA 4HAYA 3TVDA 1ZD1A 1X65A 1KK1A 3EIHA 1CSQA 4Q9JA 1SKYB 2XTMA 5TMPA 3BD9A 2XXAB 2ZE6A 5IRCD 1J99A 1OXTA 3I55A 2GDJA 4RD4A 1FNMA 5DH9A 2BJVA 1XNQL 2KBEA 4LZZA 4PHFA 4B3GA 4W5JA 2NMVA 4D25A 1OF1A 3VNVA 2A6EC 4TLAA 4TKOB 3GTOH 3A8TA 2ZYTX 3KDSE 3PENA 1P16A 4PMWA 3U9SA 4UXJA 4V0KA 4ZIRA 4DV3Q 1UM8A 2VUMH 3L7ZC 1FFHA 4O2LA 5LPNA 1SVMA 1CJVC 3KKQA 1BO6A 1SFOH 4E09A 4MRRA 2QMEA 5C0XJ 3PIPA 3NIBA 4DK3C 2OLKA 2K4KA 2GF9A 2X2EA 2ZI4A 5FTJA 3W6PA 2XTZA 3D31A 5BQ5A 5ANRB 3W6OA 3U7HB 1CKNB 2D0OA 1NF3A 2GETA 3VR4A 4EPWA 4ESVA 3OE7A 2YZ2A 2BM0A 4O2RA 5IHPA 1XTJA 3OOCA 3A7LA 1IXSB 1QVFA 3MWLA 4V0MA 5E4FA 2EYUA 4PPGA 5JHGB 1AH9A 4H1UA 4L4UA 2EJGC 4EJSB 3GJ6A 1LB1B 2VRWA 3NC1C 4JLBA 2VY3A 2ERXA 3K0CA 4PSVA 4Q5IA 2ZEJA 2JA6G 5KDLA 3NXSA 4YCWA 3LBHA 4QG7A 3TSOA 3JC66 1DE0A 2QENA 4WOPA 2XSZD 1GUOA 1NN5A 5EE0A 4PQFA 2QP3A 1GIAA 1HA3A 4GZLA 3NTUA 3I4OA 1TAGA 2ORIA 1GO3E 4DR6L 5GAHC 1S3SA 3MCAA 4QJ3A 1NMFA 2XJ9A 1M1YE 1W2HA 1ZP6A 4LX0A 4LWZA 4TSFD 5G41A 4URZR 2IS6A 2WKQA 1D8LA 4WA7A 2QMHA 4WXRA 1HTWA 2ZR9A 1I94Q 2UXBL 4AQYQ 1XTKA 4ZPXA 3R9IA 1XXHE 2A7QA 3TS2A 1NIJA 1H9SA 4R71A 1RFLA 4XWKA 3GP8A 2JLQA 1S1CA 5K36H 4OQNA 4YMVA 5A0FA 1KO8A 2IYZA 1JJCB 1CUKA 4JT2A 4OHVA 3FTQA 2UU9Q 3IHLA 4NP6A 1D5CA 4NU0A 3E1SA 4DV7L 1NNEA 2B3GA 4YMWA 3ZVMA 2JLYA 4QGUA 5ELOA 3CLVA 4DSNA 1TMKA 2KI5A 2JLSA 1O7LA 1G21E 2OBNA 3OFNA 4GFDA 4NCHA 4B3CA 3RRZA 3GLIE 3OIUA 5G3ZA 5JBQA 4Q4AB 3LBIA 2HHHL 5FTLA 1YR6A 2IUUA 4JIMA 1QHYA 4DV2Q 1ZRHA 3SJAA 4Q7LA 3KF6A 3KLWA 3A8KE 1DS6A 1VQAA 2WHXA 3T15A 3A4NA 2FSFA 1UE5A 3FVQA 4YWMA 2J0UA 1HNWL 1XMVA 2R93H 3BERA 1G7RA 3TK1A 1KIXA 5KU1A 5IT5A 5JSZA 2ZJRA 3QF4A 1GKUB 2CJWA 3D8BA 3AF3A 4LBZA 5KHOC 3FGNA 1YRAA 4TN1A 4H13C 4HLCA 4HUQA 1E1QD 1C9KA 1S9DA 4I99A 5KPJA 2K50A 2A3RA 1Q0UA 2QA4A 4C0SA 1EFTA 3OFND 4FXPA 5HR5A 1JQLB 5K8TA 4AD8A 1Z0JA 3PGZA 5IDVA 4IPDA 4A3JG 4IDQA 3TQYA 1YNJC 4HDCA 1HNWQ 3THXA 5BYKA 5IYDG 3I4LA 1P73A 1NIPA 2ZJOA 2FE4A 3JVVA 1XNRL 1BYIA 4B73A 5BN4A 5FPYA 5KPDA 3AF4A 4M53A 2ZUDA 1P6XA 3BH7A 1N6RA 1TU2B 3A5ZB 1XJVA 5EXPA 4LF6L 3TR0A 1NBWA 1QHSA 3WBKA 3DHWC 3U3OA 2O0JA 4A3EH 4TYQA 4IPGA 2ONKA 1TPZA 3H3VI 3T53B 1LNZA
chains in the Genus database with same CATH superfamily
2WYVA 3Q2KA 4P3OA 2WJZB 3TEJA 3V1YA 4EM6A 4PZ7A 2LPMA 2OG2A 1H65A 3CINA 2SHKA 1KI8A 1R37A 2WF5A 3B12A 1KJQA 2VAMA 3V6MA 3WGUA 4D3SA 3PNPA 2Z6BA 4PN3A 3ZV4A 3KLPX 1YRWA 2ZJAA 3KU4A 2CXOA 4Q37A 4Y52H 5I9SA 3TD9A 1E1RA 3E81A 5CXSA 5ELBA 1BH2A 1H8ED 2P79A 1AF7A 1WMSA 5KHAA 2VTVA 3GJ5A 1UKZA 4I1YA 5B4TA 5LZ5A 1B4DA 3OJLA 4H77A 3ZJTA 1PNTA 2MR6A 3RC9A 4IDHA 1WSAA 1WI5A 4MRPA 2WP8J 3MTAA 3D6WA 1VHTA 1AHIA 3K8YA 4WLOA 1F9AA 1PVOA 1OUMA 5SY4A 4F9TA 5KTNA 2XMSA 4HTHA 1HZZA 1YCHA 1CR0A 3CH7A 2QX8A 3AL0C 2EYPA 3S81A 5JAQA 2A7XA 5CMLA 3VR0A 3KLMX 3V1UA 3Q0TA 3NDPA 4DUPA 1Z13A 1JQEA 2PX3A 3L1VA 4YHBA 4ENSA 3S2HB 1QHNA 3CNNA 5C81A 4IX9A 3ES9A 3LBNA 1UKCA 4OP1A 3AV3A 4RKRA 4OXYA 4JP1A 1IWPB 1E3IA 1UJ6A 4HD8A 1A3CA 1TE2A 5JOQA 3GW8A 1EM8B 4TV9B 1MQ8B 2DPMA 4KAFA 4MMXB 4DSOA 2VAXA 1V8ZA 4R4JA 1Y48E 1Q2XA 1OGJA 5TQ0A 2PX2A 1STYA 1BMTA 2FU5C 1FS4A 3NORA 5F77A 3TRJA 2HN9A 4BKRA 3C85A 1TQOA 1K9VF 4WXEA 1CVRA 1SYBA 5ITWA 2XD9A 3AKDA 3EDQA 1E1QA 4XDXA 1VQFA 1NYQA 2B8TA 2Z1MA 4QARA 4RD6A 3QQPA 4ZOLB 4I9NA 4ZHQA 3TJZA 3RZDH 1CJKC 4IICA 4F3NA 1TWCB 1DXOA 4HFJA 5MN4A 3IAEA 3BXOA 1R5JA 4YLGA 1ENPA 2W37A 4ESVA 4J7CA 4JY7A 3K1AA 1VPVA 4KLRA 1EIYB 2PPLA 3R5HA 2EOAA 1EP9A 4AYBG 1KC8C 1BOFA 1JXMA 3F4LA 5I8ZA 2HIGA 3ADKA 3JYPA 5SYNA 4ZDJA 5CAEB 5CFOA 5I6DA 4K5VA 2HAEA 3KTAA 3FVRA 4FFVA 1RMTA 2I1VB 3IAM6 1ZITA 1ZJJA 2R4UA 3S7TA 2B29A 1UEBA 1ZK3A 3BFKA 3EXFA 3N8IA 2PWBA 4B84A 4N48A 3PV0A 3L06A 4Q4JA 4DEVA 4TLMB 3MAJA 4DLAA 3M7GA 3SK5A 2PX5A 1KK3A 1SOUA 3GAMA 4HYTA 4O4HB 3S2IA 3V2UA 1Z2DA 3FCCA 3HDGA 1BGWA 5BW5A 2G5GX 1JIKA 2O5VA 2X42A 3NV9A 4FD3A 4MR8B 1BF4A 1YSCA 2GZDA 2QPTA 5A5DA 4C9BA 2PT7A 3BJIC 3RKUA 1IW7C 2J9RA 2JVIA 2O2JA 2OBMA 3H9UA 4GVXA 2HBZA 3AEUA 1YOVB 2R5WA 3F6CA 2Y05A 4WECA 4R1MA 4EKYA 4GGMX 3FRJA 1B1AA 1Z2NX 1WUTA 4X7PA 5M3MH 1AUPA 2QRLA 1SNMA 2GUGA 3MT8A 1JKFA 1YB4A 3RRFA 2Z8YA 1O94A 4QGSA 2WLTA 4ZAXA 3AVTA 1YDEA 3QHQA 1UK8A 4CIDA 4OK3A 4JI1L 2WD8A 3F0TA 4LQDA 1WU7A 5J63A 1L5WA 2XLBA 3WYBA 1YZFA 4P22A 4W6ZA 3KZCA 4XYLA 1IK6A 5E2BA 5K51A 1SHJA 3SIRA 5IANA 5JZVA 3SIPA 1DO2A 2XTIA 4YUWA 1F5SA 4EW3A 4X24A 4RXUA 2AF4C 3DMDA 2JFHA 4QFBA 1Z0FA 2O19A 2IXAA 3C1UA 1JEQA 1J5EQ 4R7GA 5IT4A 1CY8A 1JFLA 5DCYA 4EEZA 1ID8A 2YWBA 4X9XA 4TL7A 3SS9X 3GFQA 2R5NA 5LLSA 1IATA 7ADHA 1NZDA 5M5WB 1RAIA 3OTOQ 4OX9L 4WKGA 5TMBA 3VKHA 4PIVA 5E8JA 4YI3A 1QYDA 1J0EA 1O1YA 2QRVA 2Y1CA 1A7UA 3F6SA 3HU5A 3PPVA 4YRPA 1CQZA 3QLVA 1FS5A 1ZEQX 3GTMB 2PWZA 3FUTA 3H2GA 5E6RB 3HU2A 4EG5A 5IF3A 3E5MA 4HAUA 4RGMA 5CEJA 1Y81A 2C04A 2DBYA 5B1DA 3TX6A 4DKJA 4HS4A 3OTOL 4OX9Q 2ZXOA 3IERA 4UVGA 3I5XA 5ENVA 5JH7F 1F2UB 1JU3A 5FO7B 2B6NA 5DNUA 1XCPA 1B43A 2MJLA 4JUDX 1CQFA 1E3PA 2NU7B 2W58A 4M9ZA 1N7IA 1IVNA 1RJ9A 1JPVA 2NZXA 2F8TA 5KYVA 1YJBA 1H42A 1QHEA 1W1UA 1PGNA 3FZGA 4AYBE 2H0AA 4JHLA 4G4SP 2QE6A 2NUPA 2XRYA 1U0FA 4W5TA 5FF9A 1E8MA 3ZIAD 1Y5IA 4R9NA 1SIWA 4IIGA 3SEQA 3ZOKA 1RZUA 4D9KA 3D8UA 4U1RA 2KWIA 1RKNA 2FY8A 1RZ3A 2H4OA 5HFJA 2V45A 3AM3A 2ZXPA 1M33A 4K14A 3MRXA 3PUKA 3R3UA 2QRJA 2O6HA 1EE1A 4PYNA 3TEHB 3FKIG 1RM0A 2CZQA 4JOIA 1N32L 3FKQA 4I66A 1OY1A 1GLNA 4IX1A 2KCTA 4RD0A 1JIJA 5A7GA 2XCTB 1TLLA 1RFGE 2GARA 1POWA 5A5VA 3WZMA 3ABOB 4OBXA 3P32A 1W29A 2HLPA 4FZ5A 1VJ0A 3VNUA 3EOZA 2OB1A 4XB2A 1JBEA 4FXDA 2OCIA 5E6SB 2D2VA 2GO1A 2JLRA 2ZIGA 4K8OA 2NUAB 4LJYA 1VQKA 2O8BA 1A82A 3D4RA 1GZDA 4P86A 4ZAZA 3OWHA 2FB9A 5GY7A 3TZLA 1QYXA 3K0SA 2RE8A 4R6XA 5LA6B 4RSGA 2GHRA 4JKIA 1RLTA 2EWMA 3ZHOA 2Z95A 3BIOA 4GI5A 1P9WA 1ZX1A 1V7PC 5BNZA 4CDEC 1DVRA 1CQJB 3JQEA 2FFRA 3PXAA 5ALKA 3T5AA 1SCKA 1GKKA 4KQ2A 4BLRA 3O5AA 4GOPA 3U3ZA 1WB6A 2IBTA 5LYJB 2QMQA 2WSSA 3CG0A 3CRQA 4HYEA 3R6WA 2JGNA 3VSEA 2R7KA 3GOHA 3BIXA 3KJIA 2CC2A 3GNLA 8MHTA 4UU8A 4HNAB 2O8EA 2YY6A 1PIWA 5KYKA 5EKLA 1E1YA 2YMPA 3CW2A 3ZY2A 4UHKA 4G9BA 2ADMA 3HYCA 4KGDA 1G7SA 4URHA 1DRKA 2D2FA 2JI4A 1W47A 2ZJBA 3L8FA 5DYTA 5E9JA 5LU9A 1FJHA 1RPTA 4JL6A 4MUXA 2M6SA 1T1RA 4FKMA 4KYUA 4OKNA 5EIHA 2VSFA 3DL2A 4A0HA 4WJZA 3RTBA 3WSTA 1T43A 1Z22A 2V4MA 2M9MA 3OLCX 1CUUA 3EF0A 3G71A 1MHPA 1K68A 2UVQA 4EYEA 3MN1A 3AUTA 4M0DA 4MQMA 4OMCA 5B57C 2FN7A 2RHOA 3JQRA 2W83A 1NR4A 1YS2X 1E2NA 1Q3TA 2BM8A 2FI1A 2QUAA 3N8KA 4P3YA 4JI8B 2PFGA 3DE1X 5FP0A 2W8ZA 5TRTA 2OGTA 1FF9A 3QTLA 2XBLA 3C5HA 1IOLA 3V34A 4EX6A 2VK1A 3DBRB 3AFOA 4GC9A 1P4SA 1L6IA 2J41A 2IV2X 3RFTA 4EW2A 4Z7OB 1R4NA 1T5TA 5L3VA 1LM0A 3OFSA 1SXIA 3MFQA 2IVZA 3ZDRA 5JDIC 1UJ2A 1I7SB 3VO8A 4PONA 2WJPA 2Z9DA 4KTVE 5HIAA 1A6XA 4IVNA 4PHGA 3M33A 4D4HA 2DSNA 3K5WA 1SNYA 1SXQA 4AWAA 1NPTO 1JORA 1N9ZA 2GZ1A 2IH2A 5C0XI 4KXMA 1Y89A 2RGNA 4DY4A 4HAOA 1RI1A 3BRCA 2RDFA 1DKQA 2CFTA 2EAUA 3TW4A 4YRIA 2P65A 4AKEA 5A5FA 3K09A 5HGTA 2O4XA 5ALHA 5H1YA 4C1NA 2Z57A 3MILA 5B6PA 2PN1A 4BU1A 4RDIA 4ZLTF 4JI0Q 1Z35A 1KYIA 1WJGA 2X5XA 3RYHB 1GY8A 1ULTA 2B2UC 3I0ZA 2VUHB 3TL6A 1M76A 1ZK4A 2ZSAA 3QJGA 5NLLA 3WIOA 4M37A 4AMYA 3GJ0A 1ZOPA 1X6OA 1C9NA 2JJMA 2Q5FA 2FMIA 3DYIA 4JOSA 4M0MA 4PAGA 5FB3A 4E12A 4YRGA 4ZYXA 2WMNB 1SXJE 3FGPA 3NONA 4QT4A 5DJ5A 2Y4OA 3BXZA 1ND5A 5KJEA 4YRKA 8GPBA 3ROFA 4LIPD 3HYNA 3HKZB 2OUKA 3WRXA 2HQRA 3T1VA 4X1IA 3IA2A 3OY7A 2Y66A 3TUZC 1ULHA 1YNNC 1EEHA 3FKSA 3C3CA 5A4MS 4RTOA 4KD4A 2FLVA 4NNJA 4X63A 4JBXA 3V4OA 4B4VA 2ZJ1A 4DDUA 4R41A 2JIZA 3R23A 4CCWA 2F3IA 1UBCA 4RVGA 3L4JA 1GGNA 2BGKA 3OMCA 2MO0A 1V5WA 3LECA 3S7ZA 2O05A 4B7UA 3HQ4O 4A3KH 2PR2A 5BQXA 2F9MA 4XD7D 1V7CA 2CHGA 3ZH2A 2FPKA 4C7XA 4DLWA 1DPGA 2I0FA 3AF0A 3RBAA 3V4ZA 5I7EA 5IYZB 2XX3A 4K28A 4NQRA 2V0GA 1AA9A 1EDZA 3PJEA 1Z26A 3Q11A 4WRRA 2D5DA 4MPJA 3TSZA 2DFTA 4O2BF 3QKWA 4IDOA 4MUIA 3GEGA 3FHLA 3CCJA 3KK0A 5JPNC 4KIWA 3AHDA 4DNPA 4IDEA 4G7OC 4IV8A 2GEDA 2H57A 2WRZA 3OIYA 1FVHA 4PLWA 1QUEA 2B8FA 1M72A 1I5EA 5CP8A 4AZ3B 2P5ZX 4FM9A 3DVLA 3HR7A 2IHUA 1RTNA 3R9XA 3HCBA 4C0QC 3FYUA 3N53A 1DYQA 1MOSA 2OFPA 3RZOH 3LUAA 4Q3NA 1MNAA 4AN1A 1U8UA 1WULS 2LRHA 1DOHA 4GBGA 4ODGA 1P4JA 4O4IF 3N2LA 3W78A 1RPJA 3ZG6A 3ZKWA 5B58C 5LN1A 2DT5A 3SSMA 2RB4A 4RPJA 5C1OA 4E5KA 5ELCA 2VPWA 1IHXA 3KVYA 1ICWA 1SCQA 4EB0A 1B23P 4CWAA 1B9NA 4ZO4A 3S1RB 2NO0A 3TBFA 4XVCA 5CIWA 3BJZA 1HLPA 3GFRA 2Z09A 4B3JA 3QG1A 3CCFA 3D4OA 4ZYSA 4EYQA 4YH1A 3QXGA 2ZVDA 2QT0A 3NH6A 4IDCA 4D0NA 1NW7A 1TF2A 1WA5A 2XQIA 1R6UA 2PL5A 3AIMA 4K3UA 3BMOA 3L2OB 4DMRA 5ITSA 1XU9A 3LDFA 2VT6A 4ZKDA 1CQWA 3GO5A 1CSPA 3DD5A 3OIDA 4F1WA 4ZI7A 4X65Q 2G7MC 2H07A 2O2SA 4N7MA 1XQ1A 3FNIA 4MHOA 1WLSA 3D4WA 4FEEA 1K6MA 3X1DA 2LBPA 5JRDS 4EQ5A 1TEZA 3IV9A 3FTCA 4H4DA 2ZSHA 3TH5A 3CR8A 1RZRD 4LK1C 1ETUA 3SFVA 2BBSA 3ROEA 3B8EA 1EESA 2VFAA 4LJSA 2VQ6A 2BKUA 3P96A 2HTFA 4EHBA 4P75A 1ZAYA 4GPAA 4C3VA 1IOWA 3JQ9C 4RA9A 4HH3C 2O7SA 3RTCA 4CLOA 3LPCA 3N8NA 5TS2A 2NO7A 5AP9A 1QG7A 1R6XA 1W0KA 1XCMA 4JOQA 3ZR4B 2F0UA 4EP1A 3U7FB 4YVFA 3PDWA 1A3UA 3EXIB 5FWXB 5AXCA 4BFLA 4F6RB 1VE3A 3D2LA 3N86A 3OT1B 1Z6YA 3FTEA 1GQSA 4MGYR 4PG4A 5LLDA 3E4DA 3PLNA 2ZWAA 3WLLA 1QIJA 4PYMA 1WBBA 2H51A 2O3UA 3QVOA 4TRMA 2XYGA 4PCAA 3AU7A 1LI5A 3QHAA 1SNOA 3ADBA 3L1KA 1FYVA 3OHXC 1I3OA 1KMHA 3NTRA 4I6EA 4G65A 4KNWA 3RTDA 5A3QA 2Q8PA 3QLJA 3EEQA 1E1CA 2IOYA 2Q4TA 3CM0A 3OEWA 4L4RA 4WIAA 3CVYA 2ODQA 5IBRA 5J59A 1J20A 3FPLA 4HB2A 4BB9A 2EG5A 1LPBB 2A59A 2OR3A 4O4JB 3KAPA 4BKPA 2HYIC 4KGZA 3X1XA 2FSVA 1NUCA 4FOLA 5D8DA 4CR8A 4OGLA 2AHOB 2X41A 1Q7BA 3TPCA 2AJDA 3OIPA 1W94A 4MVXA 4M1QA 4NZNA 4OGGA 4UQOA 1E6MA 4LJ4A 2ZT8A 4EB8A 1B74A 1MC5A 2JJ8A 2W11A 1OD6A 2VK4A 3FDXA 3FR8A 3JTEA 4UCXA 4JI0B 4P4UA 3LJKA 2WSMA 4LQCA 4PICA 2Q3LA 3KTDA 5I7RA 3F4KA 3E2IA 4GPIB 1XPOA 1JHUA 1MTZA 1RQ2A 2E49A 3FCUB 3I42A 3UQYS 3LG2A 3WA6A 4DT1A 3GYGA 3MG9A 1UDRA 1T91A 4OA8A 1NVEA 4D79A 1VG9B 1W85B 2VDPB 4TL9A 4XEHA 1U1CA 4ENVA 4WN9A 2RVLA 2BF7A 2IHVA 5JSYA 2IHBA 4MITA 3VBEA 1KOJA 2AI3A 1Z25A 5CTAA 2Z0SA 3HEAA 2CQOA 3CCLA 1X55A 4OIKA 3E9IA 1NX6A 3SQWA 1JMVA 2HSEA 3CZQA 1KTVA 2DTDA 4BTEA 2IZZA 4K9LA 1E5TA 4XQJA 1RD4A 2JAWA 2A1UA 3ESYA 3JPWA 3RIEA 4AP5A 1OXXK 4XIGS 4IAOA 2VK2A 4JUCA 4XVHA 3PI6A 2RGCA 5JXJA 1WCMG 2NVXH 2K28A 5FFNA 1Q3HA 4KPEC 4EK9A 4QY7A 1LS1A 2WUVA 5EYPB 2CLMB 3OSZA 3HADA 3FZYA 5IM5A 5FLXA 3AQQA 1QUQB 4QJFA 3S16H 1K8ZB 1TQHA 5BW8A 2ZRBA 5LMCA 4LK3A 2C1EA 4XGKA 1OV4A 1OXMA 2CVPA 4NYJR 5BR1A 1S5ED 4J1NA 4QGAA 2B0JA 3DA8A 4WBXC 4GG1A 2R7ZH 1FUEA 4G1UC 4PYOA 4RQBA 5KINB 3VX3A 1O95C 2Y0SG 1PN3A 1XYYA 3PYMA 4R5HA 4GD3Q 4ZOLF 2GWRA 5SICE 5JD4A 2QPAA 1GSHA 4BAZA 1F14A 5ILQA 5A6VA 2NO1A 1JAYA 4KG7A 1PDVA 4BVEA 2WV7A 3NBFA 1CFJA 4CFYA 1SFOB 2ZXFA 3ZVRA 5M7EA 4DV0B 2FN4A 3ADPA 2BKEA 4PX3A 4NP5A 4OU4A 3PD7A 2G72A 3IE2A 4FI3F 2EARA 4GXRA 5D87A 5LNK6 3SWWA 2HV8A 3H2SA 4AX8A 2WAXA 4NE9A 3BL6A 4XYGA 4YRJA 4C07A 2C5GA 2HHLA 4ZVQA 4YMHA 4HN9A 2JVJA 1P9LA 1CWUA 1U5BB 3CX6A 4FXOA 5D3ZA 3M3HA 3LQRA 3ZWAA 2LDXA 5HK8A 5IWAQ 1WTPA 1P7VA 4CEHB 4EEXA 4EY4A 3GTGB 3I6YA 3LP5A 1FGUA 4OL9A 5DE3A 4ARZB 3FOEC 3ZJVA 5FBVB 3A54A 1KY5A 3BFVA 1G4AE 2B4AA 3KU1A 1Z5WA 2I6SA 2RGYA 3AUFA 1TVCA 3LCUA 4I9HA 4UJ5A 3ZXXA 1CUVA 1U2DC 2QTHA 2BEJA 1EQVA 3N7TA 3PFKA 4J03A 2UZ3A 4QNRA 2FA9A 3GRYA 1YIAA 5EE9A 4GKBA 1V1QA 1LFDB 1M90C 2H63A 3GHYA 4OUKX 3K9QO 2JIPA 4Q1CA 1BR9A 3JALB 3L93A 4N65A 4BO3A 3UBTA 3WA7A 4GXTA 4QWWA 3DBIA 4YXFA 2X0NA 1JF8A 5H59A 4O8CA 4BL5A 3EW7A 4QUKA 2WHYA 4IFTA 4P7BA 4P54A 4DM3A 2F1HA 4LPSA 2EKLA 1Q19A 2OOSA 2YN0A 1QWSA 3KBXA 2PMDA 3NDJA 4TKUB 5TPZD 3SHQA 1CE8B 1RR6A 4Y2VA 1IM2A 2XJ4A 3TZCA 2BBWA 2GMWA 4QUDA 1X1CA 1O95A 4JBLA 5I5EA 4DR6B 3NI2A 3L4KA 1RIPA 4MLPA 1HQYE 1NMXA 5EGTA 3JQGB 2VHXA 1SCDA 4COOA 5JQGA 1TI7A 2BSQA 4F91B 1P3Y1 1VQHA 3A1CA 1X7ZA 3EVEA 1FFGA 1OVMA 1VDZA 1QHIA 4U5QA 2Q4EA 4RV4A 1ZHOA 3HXOA 4MHEA 1PJRA 4M83A 4EATA 2H54A 1RI2A 1G8AA 1UPFA 1PDQA 1RCVD 1WPGA 3KZNA 3REQB 2GT1A 3WQRA 4DXDA 1U5AA 5HZGA 1T2DA 2WEKA 4YFYA 3K5NA 1KYTA 1O4WA 2FZ4A 2YOGA 2P9FA 4KHPL 2QYOA 3FPPA 4N8DA 1UOPA 5FYDA 2ID0A 4NXML 1RYMA 5EJIA 3ZU4A 1N4AA 1NQ5A 3M34A 4JJ8A 4RESA 3UK6A 4A0RA 7ABPA 3L4BC 1FFWA 1W46A 4JI7L 1LTGD 4RSMA 3CNHA 3S2ZA 3IAYA 4B2PA 1MJGM 1T1SA 5BOSB 4UHJA 4RWSC 1OBOA 1TVEA 1YZKA 2O2ZA 5EZYB 4P0TA 3O0TA 1M7HA 1ZEJA 1QMPA 4I46A 1PFBA 3OQNA 1WZ2A 2ENBA 2VJNA