3PV0A

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 86
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pv0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pv0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pv0A01
4LFAQ 3PGZA 1KXLA 1IBKQ 2GAOA 4R4QA 2GVDC 4NMMA 4UXJA 1EESA 2ZUCA 3THWA 1KK0A 1IN8A 2X77A 4OWTB 4M9QA 3F0TA 1IXZA 2D06A 4IDNA 2CHGA 4LC0A 4AI6A 5C3EH 1IBLQ 4DR6L 2K5NA 3CCUA 3TRZA 1KI6A 3A8KE 4HB2A 4LCBA 4RG1A 1K5GA 3PEWA 1VQFA 4HJAA 1LTLA 4B44A 4B32A 1YNJC 2IEYA 2IXGA 4JV5Q 3I4OA 1WE2A 1NJFA 4M2LA 4JYBA 2A3RA 1ZMXA 1GRQA 3LX5A 1VECA 1Z8FA 3NKVA 5SZHB 1VIAA 2WOJA 2ZEJA 4BA2I 5JSZB 2P6RA 4JI0Q 2VQSA 2PI2A 1YR7A 3FKSD 3WRYC 1OFHA 3MD0A 1KY3A 1Y8PB 1MKHA 1MO3A 1XX6A 5GVSA 3NBYC 4BFVA 1KK3A 4DR1L 2GKSA 1C9OA 2J9RA 4QHTA 1FP7A 3SYLA 2K52A 4LF7Q 1QHIA 1G6PA 5GVRA 1N6PA 1KO8A 4IOLA 1JALA 2MQHA 5JCZA 1NN0A 3B6YA 3M3YH 1DAKA 4EJSA 1E2NA 1A82A 4GT1A 4JI6L 2RHQB 1XNRQ 1JB1A 1KI9A 5HE8A 3J7A5 1P73A 3K1JA 1Z6TA 2Q3HA 3IPXA 2AL7A 2X2EA 4LF5Q 4LV6A 1GOTA 3S1AB 4QM7A 3V00A 4YQFA 1Y8NB 1TXYA 4RD0A 2B8GA 2PZFA 3QKUA 4Q7LA 4B48A 1N33L 1IM2A 3WBJA 1R9TH 1E1QD 5KDLA 1FJGQ 2CXXA 2Q3MA 4CGZA 1X54A 1TL7C 1HH4A 3K8AA 3RS5A 4ERNA 4C0BA 4X62L 3CAMA 4Z1MA 5AJXA 3RS2A 1IY2A 1VYUA 1WRBA 2F1IA 5AUQA 2ZI4A 3LVRE 2BE5D 3SZRA 2HHHL 1PH6A 1Z6XA 5JI2E 4A3BH 4O0MA 4PZZA 1EIYB 2B63H 1PLJA 2V6IA 3NWJA 4MGYR 1XEWY 3KQUA 2D2FA 3SJZA 4WAUA 1BYUA 4E22A 3PV0A 5CYPA 3AKDA 1C9KA 2LXJA 1YBYA 1FMLA 2ZJ2A 3AF1A 4DXAA 5AJWA 3OTOQ 3UANA 1IBRA 4IJLA 1NMZA 4BBRH 2F3TA 1Q46A 3OE7A 1SKYB 4TL7A 1FNMA 1DAIA 5IK2A 3CZQA 1II0A 2JIZD 1KD1C 4RKFA 4L5BA 2P6UA 2A5FA 4OQFA 2QRNA 3EWSA 1UE1A 1E7ZA 4PAQA 4OWWB 2A7QA 1NMGA 1YHBA 2AFHE 3CPEA 5HE9A 5AJVB 3QG1A 3KKQA 3K0EA 4PSVA 2QBYB 2XGJA 1Z29A 3QPWA 1JJ7A 5BR8Q 3ER0A 3M4OH 2W2TA 1Q12A 1XEXB 2C5LA 1KRTA 3QXJA 4DDVA 3HOZH 5FOTA 3I8XA 3M9BA 2ODWA 4YC7A 1S40A 4RKEA 4KLKA 2QN6A 1QG4A 5E95A 3RANA 3AFQA 3K0XA 1QHYA 2I4IA 3LO5A 3Q7QA 2K32A 2ORIA 4YXWD 4F4JA 1AQUA 4IFDG 3H2YA 3CP0A 3A6PC 5JJLA 5LPNA 3TRFA 1QVGA 3CX8A 5FBQB 2WSSA 3PIPA 4MYCA 3MAAC 2F43A 3GPLA 2Z4SA 2VSFA 1E0KA 1CKOA 1PVOA 2V1UA 1KAOA 4PV1C 3LBIA 1Z6AA 3A74A 2H7VA 4NYIQ 2HYIC 1KI3A 2OEPA 4LF9L 4FMDB 3NEYA 4PZ6A 1UKEA 1VHTA 1G3UA 2VRWA 3DLLA 3EIEA 3VNVA 4JLAA 3HDTA 1Y8OB 1ZJ6A 2NG1A 3LVQE 4PHGA 4UKDA 3O8BA 3QKRB 4LOAA 4Q7JB 2W2VA 1JXOA 1N6RA 4DV2Q 1VS0A 1R5OA 3CR7A 2PEZA 2KE5A 4ILEA 1VQPA 3TAUA 2RGAA 1B7YB 2XAUA 4PHFA 1UEIA 1VQ4A 1YZUA 4JOIA 3B78A 4A3DG 3QPUA 1N0WA 1OE0A 1NVVQ 2ZYTX 4C3ZA 1JMCA 2VIIA 3FDIA 3B7GA 2CW0C 1W47A 4MDFA 1X86B 4GL2A 2CCKA 2FWRA 3QXSA 1EXMA 1G8PA 3LXRA 1PV4A 2ZS8A 4XOIA 5EP1A 3T35A 3DXJC 4M1SA 4MZ9A 1Q1QA 2GAAA 1MOZA 4M9SA 3RABA 1PH4A 3QF7A 3FPAA 4P4SA 2YYZA 1S96A 3S24A 2CLDX 5HCIA 5JEEA 4US2R 3CCRA 4MRPA 3BAFA 3ASYA 4PO8A 1W3SA 5GAEC 1VIYA 3OHMA 4P4UA 1EK0A 1JR6A 2C99A 4M53A 3H94A 1PZNA 1QJOA 2GJSA 4D4LA 4Q47A 1FOEB 3KOJA 5BWMA 3RHFA 3MWJA 3IILA 1E0AA 4Q4HA 2W2XA 1WCMG 4DNTB 2F3IA 1U8AA 2QY9A 5SZJA 2XX3A 1M7HA 3ZIAD 4YMVA 1XD9A 2QENA 3FWYA 2EU8A 3ZZUA 1E4YA 2JDID 3S1NH 1T4GA 4JLMA 4TQUS 3BU2A 2WMOB 3S14H 3TLXA 1QHHA 1TQ6A 4NH0A 4ZCIA 2JJ2D 2WHXA 3U44B 3TH5A 3I62A 4EIWA 1EOVA 1SRUA 4GKJL 2ES2A 3EG5A 5FFMA 4HSEA 3P27A 4G7HC 1W2GA 2EDGA 3MXUA 1HR0Q 2QMEA 1E98A 3SU8A 1HQYE 2C2HA 3B13B 2R92H 4DBLC 2O8CB 4RCZA 2N8NA 2P0EA 4DDWA 2NMVA 4WVFA 1COWA 2EIFA 3J80c 3STBD 5AUPB 4IW3B 1RRCA 3M85A 3NH6A 4DR7Q 2E75C 3A7LA 2HJGA 1X6OA 1W49A 4DPGA 1N32L 3AGQA 2O5VA 4TLDA 4DR7L 1PYSB 1SHZA 3ULLA 1M1KC 4OK3A 4Q1EA 4C0LA 3U7GA 2NPFA 1EWHA 1XTSA 2WP8J 2E2IH 1E9FA 1RZ3A 3FE2A 4NP6A 5FOWA 3SFZA 4MDEA 4URUR 2ZR9A 4BLSA 1UPTA 1OW3B 4PR0A 3A37A 2JXMB 1GL6A 5FH9A 3RR5A 1A63A 1G16A 2IEZA 2GXAA 5KHOC 3EPLA 1KAGA 1RL2A 5FTMA 5AJ3Q 3M4YA 1F6BA 3I1FA 4O2DA 1HYQA 2BH2A 1N25A 1ANKA 2R8RA 1VPLA 2XITA 1R0YA 2ZRJA 3AB3A 4C2TA 2J7KA 3EAQA 2RMKA 4R2IA 4V0ME 4DLVA 1G5PA 1HUQA 1XTDA 2XTNA 5IF9A 1N5LA 3C15C 1ZM2A 4JLOA 4A3IH 3BH0A 2VQFQ 2R9VA 3O8RA 3LX8A 4DR2Q 1KHIA 5C0XG 3FYHA 3TR0A 1G4AE 4BLRA 4QGUA 4IDHA 1E2DA 2ANBA 1F2TA 2EFHB 5FOUA 1CKEA 3TR5A 2XNSA 2QF7A 3NDBB 4K46A 4DNIA 2OQ0A 3EARA 3VX3A 3VR6A 2ZT9C 2KCTA 1WFQA 1NL3A 4FXPA 1KO7A 1FL9A 4FI3C 1E9AA 1HEIA 3GTOH 2ZUDA 2K5HA 3LW7A 2ONJA 3ZVRA 4LJAA 4JJZA 2JLZA 1DD2A 4JBYA 5DGXA 2VSOA 1FFHA 1XU4A 1GP2A 1Z2AA 2N3SA 1Q0UA 1G8GA 1YZKA 4GKKL 3MSXA 4GNXA 3CNLA 2QMHA 2A6EC 2OLJA 1WMSA 1BMFA 3QKSB 1IJEA 1KZGB 4DCSA 2NO1A 1TEVA 4LFCQ 1L0WA 1TWHH 1XPOA 3GJ3A 2JEAI 4OKSA 4A8JB 2Y8EA 2E76C 1QZGA 2ZRIA 4ZPXA 4NYMQ 4GSYA 3EA0A 4LJYA 4EPRA 1OXUA 1GNQA 3JVVA 3ADCA 1Y1WG 2ZJZA 2HDNB 4LV8B 5LMNQ 4ZI3A 3P4YA 3CONA 4ARZA 4L5TA 1ZIPA 2GZHA 2HJVA 2WAQE 1FJGL 2Q2HA 4LJ7A 4Q9LA 3ZZ0A 1RRGA 2MSEB 3NEJA 3TS0A 4HLUC 3IO3A 1M1YE 2WAXA 1E1TA 4CIDA 1H8HD 2WAQG 3H3VI 3SR0A 4ZV4A 2WMNB 2CKZB 3IKJA 4HJ8A 1RFLA 3R9IA 1UKYA 4B3TQ 4CW7A 2FEOA 3MUFA 2W6IA 3OW7A 4KN4C 4B6FA 1JQJC 3FMIA 4R4OA 1AE2A 1E2FA 2OBLA 4U02A 1G9XA 3T1HL 2RGDA 3WWVA 3CC7A 1D8LA 1TAGA 4QL5A 4QOSA 1NN5A 4A9AA 4B43A 2I1VB 4B3RQ 5JWOA 1W1WA 4JBKA 3VR5A 2CWAA 2HXYA 4P31A 3WYGA 5M04A 1GUOA 3EN2A 2C9YA 5K36H 4LHXA 3TK1A 1G5TA 1VDZA 4QQBX 2VH5R 3LQRA 2XJ4A 4ARZB 3LDAA 3R8FA 3IEUA 4X8OA 3W5IA 3NHAA 4JI7L 1CR0A 1OYYA 1ZD8A 3AYHB 1IOZA 2GZDA 3EXAA 3LLMA 3OIYA 4PHHA 1SE8A 5H1YA 1C7YA 2GRJA 2ORWA 3HOYH 4IJHA 2IHYA 2QEXA 5IRCD 5IWAL 2CEAA 2Z5FA 1CKNA 1UKZA 2FH5B 3S1MH 1E2JA 1Q7YC 1JJGA 2DYKA 1MRSA 1FTSA 3E2IA 3KUDA 4JSYA 4A82A 3HPRA 3GJ4A 1E9EA 4R4IA 1EFHA 3BK7A 1Z7TA 1UWVA 2NZJA 1Q82C 2ZJ5A 4IO9A 3EC1A 3T1QA 2VS1A 2F4VL 4EPTA 2F3RA 3FHCB 1ZU4A 3RS4A 3OIVA 1G64A 5LB4A 3OESA 4CEJA 3IIMA 1ESNA 2K33A 5C44H 3QXHA 2ZAMA 1DAMA 1HNZQ 1XEFA 4YDHB 4YCUA 2I5MX 1NF3A 2YOHA 1NMFA 2ZYVX 2Q2UA 3V9PA 1BKBA 2A1AA 4RD3A 5SZKB 3CRMA 2OCPA 1TADA 2IUSA 1NMXA 5H8WA 4LYHA 4Q9HA 3HOWH 4M21A 2NN6I 4AQYL 4G7OC 1KDTA 3THYB 4DUZQ 2BDTA 3W34A 4Q02A 4TYWA 4A3KG 3N6RA 4F93B 5KDDA 2QAGA 1N36Q 2VHTA 3A58B 3IPYA 2ZRDA 4R9UC 2CHVA 4F38A 1G21E 1XB2A 1TWFH 1IBMQ 4OONA 1XMIA 5CJPA 2ZM5A 1SVOA 2Q6TA 3OAAD 4OO1G 2KBEA 5TMPA 2ZRFA 1H95A 4OWXB 4A0GA 2A68D 3LD9A 3T61A 3GJ6A 4A3FH 1MT0A 1Y69U 3CW2C 3EA5A 4W5WA 3T53B 3TUIC 1US8A 2K50A 2VW9A 1G20E 1SVLA 4QM6A 1ZINA 3K81C 1AS3A 2QTHA 4OHWA 4M1TA 3BDOA 4ZIRA 1X3GA 2O0KA 4BBSG 2WWFA 2OSBA 1GUGA 3QENA 2V1CC 1CR4A 2IYQA 2V6JA 2V7QD 1GL9B 4H13C 4HZIA 5L3SB 3RN2A 5B30A 1TWAH 4GZLA 3EPKA 2LXKA 1ZYRC 1NY4A 2E5LL 3MFYA 1S72A 3WHLA 3AH8A 1VF5C 1HH2P 1KI4A 1H9KA 1GNRA 1XMOL 4M9ZA 4POFA 1KHTA 1E79A 2YINC 2J0QA 2JJ1D 1VCMA 4GZMA 3OOCA 2R92G 1Q57A 1WI5A 5FLMH 4NHOA 4C3HH 2OWOA 1KMHB 1CSQA 1OYWA 1RIFA 1Z0JA 4FN5A 4I1SA 1VG1A 5L3QB 1HT1E 4GPTA 4XH9B 5GADC 1YIJA 1MO6A 1UBEA 1WDTA 5JEAH 3G5UA 1E1OA 5CJ2A 1G4UR 4YCVA 3HR7A 1AKYA 1G41A 5FL7D 2IHFA 4B71A 4EPWA 2PT5A 1V43A 1YQTA 2XXAB 3CF5A 4DUGD 3BORA 2IC5A 4OX9L 1EUJA 2J7PA 3J81i 4TMXA 4I81A 1T3SA 3DZ8A 1S9DA 4C0SA 2WICA 2HF8A 1D9ZA 2NPIA 3BE4A 3A8IE 3HYTA 1OV4A 2DN8A 4NYJR 2CLSA 1VQBA 4OI2A 1N9WA 3O8CA 1Q90A 4KCGA 1XP8A 4A4DA 4JBJA 4JI6Q 2PMKA 3FKIG 3AFPA 2DNCA 2KI5A 4GMDA 3G4SA 3AGPA 4Q5IA 3IRBA 3KX2A 1DG3A 3MJRA 4Q1DA 5CK4A 3TUJC 4P4SB 1NBWA 3LWUA 3IHLA 2B21A 4JZKA 2ATXA 4G7ZC 3T34A 1P4SA 3CLVA 4HLQB 4Q7MB 2Z43A 2QNRA 4DLZA 4BLOA 3SEAA 2ZE7A 1Y14B 2FPLA 3LBHA 3IQWA 1FZQA 1K5DA 1KC8C 1AH9A 5LMUL 1KNXA 5KNDA 4TVAB 3KJEA 4MUAA 1OFTA 3W3AA 4HR7B 1KQSA 4B3XA 5JS8A 2F1MA 4POGA 1KIXA 2B8WA 1GM5A 4GN4B 1U99A 5EZ5A 4DR3L 2GVZC 5C4GB 4JVNA 3OFND 2ZTEA 2QT1A 5GJVC 1JJ2A 1SFOH 4L8JA 4A6XA 3HKSA 2BBTA 4K0KL 3I3SR 3KL4A 3UWOA 4BQSA 4LZZA 2PPBC 1GL7A 4Q18A 1YVDA 5AJZA 1NN1A 4A92A 1OB5A 1XZPA 4I1UA 4OYHA 2W83A 5JFGA 4EFLA 3ND9A 2ZI6A 4EUNA 1XTIA 2JA5H 4D0LB 4B3SQ 1NG9A 3RLFA 1K0RA 1DELA 1J8YF 1II9A 2MO1A 2A5JA 3AF2A 1YJWA 4DCVA 3AEZA 2RAPA 1EWIA 4E09A 1I2MA 3ETLA 4TTRA 4E5UA 4L5RC 4IQZA 1U0LA 4MITA 4AYTA 1BYIA 2XZPA 1EX6A 2QGZA 1S2MA 4OQXA 1ZM4A 2XSZA 2EW1A 4RJLA 4AG5A 3K0FA 3ZD7A 1Q21A 2CWPA 5BN5A 4KBFA 2W0SA 1N34Q 1I2DA 4PANA 4DR3Q 1R0XA 1LS6A 2PQAA 1V1QA 4URYR 1KY2A 2ZE5A 4HEJA 2OTJA 1M90C 4IHQA 4R2HA 3PF4A 5DI3A 2JJ8A 1EFRA 4I1VA 3QOFA 2CCGA 3NH9A 3PR1A 4A15A 3T56B 2QSZA 2ZS7A 3L0SA 4NCKA 4B75A 4CZ2A 1K8MA 3NBHB 1OPXA 1WCV1 3KTAA 5F9HA 1AE3A 2OQKA 3UE1A 3NC0C 4B3GA 4OO1I 2R6AA 1S1CA 3FMFA 5C2JB 1DOAA 1DEKA 4DV7Q 1HURA 1E1RA 2GILA 4ASUA 5LB2A 1E2EA 4BFUA 5C1BA 4HB3A 1PH8A 1YJ5A 4RZ2A 2C95A 3PUYA 2WSMA 4WZ6A 5KPDA 1A6XA 3EZ9A 1W0JA 3U6KA 1K9MC 5HCNA 1W36C 1SXJE 3HR8A 3KFXA 5F98A 3CCLA 4AKGA 2ZI3A 3PEVA 2VEDA 2PX0A 1X1SA 2WM9B 2ZRHA 2DFKB 1ZU5A 2HF9A 1IY0A 2IYLD 2J3EA 2GCOB 1WOCA 1G3RA 1GJXA 4JSTA 4EDHA 4DEXA 2ZRMA 3KUCA 3HOVH 2Z83A 3KFUA 3MCAA 5HZKA 2XOKD 3C5CA 4A3EG 4UP8A 2BEKA 4UNRA 5G3YA 3L2PA 1XF9A 4V0MA 1I94L 2IUTA 5B2ZA 1TF2A 4XSGA 4IEEA 4BPBA 2WWIA 2F55A 2VZAA 3KQHA 1VG9B 4HIKA 3NXSA 4UQOA 2HT1A 2ERXA 2WVJA 1N0VC 1RYHA 4BY1H 1XMQL 2CMKA 4ZDWA 5L3QA 2HXSA 4O3MA 3QIAA 4A3LG 1W0KA 3VX4A 5D3MB 2FFAA 3I32A 5B57C 3B85A 3THOA 1N6KA 1GD7A 2GCNA 2ZSAA 4DK1A 3ECCA 4C4PA 3SNHA 3HOXG 2KHJA 2RGCA 2ZITA 3RN5A 3S1AA 2WWXA 1IBLL 2ZJQA 2E5LQ 1BBUA 1XTJA 3EZFA 2VTKA 1DGSA 2OV2A 4TLEA 3RRZA 2VLIA 4V0OA 4EPVA 3ASZA 1CKMA 2YTXA 4B3TL 3SGIA 3TQYA 2IX0A 4BEBA 1N5KA 4A3LH 4DK0A 2Q8IB 3L0IB 4W7SA 3AQQA 3GTPH 1SMXA 5IT5A 1W36B 1NJIC 2YWHA 5HPYB 4DCUA 1X3SA 1EX7A 4NKRA 1VQLA 3TSZA 1KKLA 1IBKL 1E2QA 2WTUA 3RNUA 1GNPA 2GA8A 5JWRA 4F91B 4JLDA 4RCNA 4CRWB 3NE5B 2OCBA 1RJ9B 1SVIA 4JI3Q 4GN5A 4GN3B 1BKDR 1EFCA 4L5SA 4TYPA 5CYOA 2JA8H 3FHTA 3W8NA 1QVFA 4ZKDA 1RRPA 1W48A 3DO6A 3K9LA 5D3MA 5FTKA 2IS6A 1DS6A 4DT1B 3KF6B 5AJ3L 4BASA 1HT2E 4HYYA 2QAGB 5JI3E 4BLPA 1KNQA 2GNOA 2X19A 5FPTA 4GNKA 5EP2A 5F2EA 2D62A 1ETUA 1GG2A 2WWGA 3C14C 3U60B 2I3BA 2UKDA 1OH5A 1A2BA 4JOIC 4R1JA 1AM4D 1ZM7A 4O2LA 3T06B 2J87A 3EIHA 2UXBL 2ZSDA 3ULJA 1U8YA 1SVSA 3AQ4A 1LW7A 5L8VA 1SVWA 4FMCF 3BJUA 3X1XA 2FZLA 1RW4A 2GJKA 521PA 1TU2B 1HNXQ 2AWOA 3M4QA 3M1IA 3QKTA 3I5XA 1L1OB 1AK2A 2RGXA 3F2DA 3FFAA 2AUJD 4A3JG 1F48A 1VQ5A 3BZCA 4JLJA 1W5SA 5GROA 3GO5A 1R5BA 3TW8B 1I4LD 1B23P 1Z6YA 1X65A 2H57A 1B9MA 1GFIA 2LSSA 1AA9A 1GVPA 5JECA 2GF0A 3LNCA 5IWAQ 5LMNW 5KOYA 1GHJA 1H9SB 2MNAA 1FUKA 1I4TD 1OKKA 2J1LA 2YVUA 4BRUA 3QVUA 4LPKA 3GLIA 3ZD6A 4FW9A 1M7BA 4Q03A 1BH2A 2DFLA 4HJ7A 1RIPA 2JA9A 4KKSA 3CNNA 1QVRA 3MJHA 4EQ6B 1GUSA 4AURA 2IXFA 1LY1A 3AVUA 2OESA 1XCPA 1LTQA 4UXIA 3WNDA 4DHEA 1I4DD 3VTKA 4XVUA 4JI2L 1GTVA 2NQ2C 4N0DA 1E4VA 4LNQA 1QBKC 4RY2A 4WBSA 5E7NA 3SS8A 2AXNA 5G41A 2FDCA 2K4KA 1HNZL 1KGDA 2P65A 2LWIA 2A6HC 4RZUA 4AD8A 2ODEA 2DY1A 1PYBA 4C2MH 3ULPA 3PO3G 3RZOH 1AZSC 1CFMA 1MH1A 2BMFA 4R98A 4Q00A 4TLBA 2FMXA 4ZCMA 4DT1A 3P32A 3JAMi 3EC2A 2V8OA 3TVDA 2Q2IA 4QGGA 2DHRA 1Q86C 2IYYA 2VHJA 4LJZC 2FJUA 3GJ0A 2B63G 2W0MA 2ZRGA 3ZH9B 4J15A 4JI8L 2NN6H 1HJPA 1KDPA 3QJYA 4JC0A 4KLNA 5DLQE 5FBVB 5KUTA 2P5TB 4V0KA 4D0GA 2E74C 1SXJD 3HFZB 4TWZA 3PUXA 3RVBA 3FVQA 3KB2A 1A1VA 4PO1A 3RS0A 1LF5A 5DLQC 5KSPA 3ADKA 3O8DA 3X1YA 5JWHA 4TYQA 2GEUA 4ZDJA 2ZPTX 3Q7PA 4LHVA 3UMFA 2VP9A 2YV5A 1YRBA 5FPYA 3S2DH 2A69D 1S4QA 3A5ZB 2GDJA 2CL6X 2AHOA 3OE7D 4C7OB 1N6OA 4Q4AA 3KJPA 2IX1A 3CM0A 4B2LA 2PLFA 1IL2A 2A69C 2JA1A 4A36A 3PEUA 3KKOA 2CHQA 4L15A 4GNXB 4YMTA 1W5TA 3A7AB 2O52A 3WDNA 4ZCLA 4P71A 1YZLA 2OO7A 2LMCB 4N0EA 1QHXA 1HZAA 4EQ6A 2DPXA 3CKLA 2G0TA 4MKFA 1U9IC 3A4NA 2VP0A 3KDSE 2A30A 4JKYA 4BZPA 5KO2A 3QXCA 3VAAA 2A5YB 2QGQA 2FOLA 1JEDA 4GBMA 2UXCQ 4MH0R 1J5EQ 4KHPQ 5FOXA 5DYGA 1NTGA 3H0GG 3CRRA 4DV7L 3HOYG 4IVRA 5C4XG 2R65A 2RKOA 1EGAA 4L8GA 2BMEA 4YMSA 4RFVA 5HZHA 2DWPA 3CF6R 2WPDD 1WXQA 2XXAA 4A6PA 4BLTA 1BIFA 2AKYA 3A5UA 1J70A 1X3FA 3ZS9A 4TMTA 4JI5Q 4PC3A 2GXUA 2GCPA 3F2BA 5KSOA 1R4AA 2GJ8A 1Z5ZA 2FSFA 1ZD1A 3EASA 4DRZA 2Z6VA 1KL9A 5C4XH 4C3IH 1H8ED 1NNEA 3PEYA 2EYUA 4OI4A 3KQNA 5LD2C 1IXSB 3AKEA 3AKYA 1XNQL 1NP6A 4FD2A 4XD7A 1A5TA 2D2EA 3T1OA 4NXNQ 3WMEA 3CIOA 2IYRA 3JC66 3CZPA 4TKOB 3WRXC 1Y1VH 3T1VA 2IS1A 5HY6A 2A9KA 2DCUA 4KXFB 4UJ3A 4CEHB 1KYIA 2GEDA 3QUSA 5KSZA 2FSHA 3R9WA 1PUJA 5FBWB 1GUTA 5GJWC 5FI1B 4KO8A 4NTZA 5H70A 1JR3E 2DGYA 1UF9A 2BBOA 4JI5L 5HR5A 1TWGH 2FFQA 2ZM6Q 4X66Q 2IF2A 2YWGA 4LHYA 4MUBA 1Q20A 1YE8A 3W5OA 3PITA 1QZHA 4GRAA 3Q8DA 3BGWA 3U61B 4LY6A 4RFSB 5E7IA 1DG1G 1H9SA 2V4DA 3QE0A 5FBRB 2IS4A 1XTKA 3T1TA 4DK3C 2DFNA 1E3MA 4PXAA 4M8NE 3EIQA 1U9IA 4BZXA 3PCOB 1VQ9A 2ORVA 1PH9A 1N8RC 4PPGA 3M4PA 4EQ5A 4B3RL 1IY1A 1HNWQ 2UUCQ 4URWR 1SMYC 2H5EA 1BBWA 3B9PA 4LF8Q 5IP9G 4NZYA 1F5NA 1PLKA 3P26A 4N1AA 5H68A 3CH5A 4CYMA 1JJVA 1ASYA 1VQAA 3IBGA 3C41J 4U7DA 2WWWA 4DK6C 2Q9AA 2AMCB 2SHKA 3CUEF 4KVGA 4KVAA 2RF4A 1DAEA 2BM1A 3SBEA 2ZS9A 2JJQA 2BDOA 2F52A 4DAYB 4HAUA 4HLDA 3FFBA 4PHTA 4US1R 4F92B 3IUYA 1K3RA 1G7TA 4ESVA 4BECA 1WJJA 3CRW1 3DMNA 1FYCA 4OHVA 3K80C 4LUVA 1G7RA 2OT3B 4G0NA 2R6DA 1ZUIA 2AXPA 1HY3A 1QRAA 4H02A 4TL8A 1K83H 1KO5A 3TIFA 4LFBL 1ZW6A 1OXXK 2CNWD 2KENA 4MYUA 2ALYB 4OQMA 4WZAE 4UJ5A 5IY0A 1RJ9A 4KSBA 2YWFA 3PENA 3TMKA 1NBMA 3GJXC 2VHCA 1YJNA 3AF4A 1KJZA 2P2LA 3CCJA 3FHOA 1Q44A 1VYTA 3W8RA 2KBFA 1XMVA 2ZVPX 4KMUC 4HAZA 4IVQA 1Z63A 5C0XI 1IYJB 3KQKA 1IHUA 3T51B 2JJ1A 2XB4A 4DSOA 2R7ZG 3NBZC 1FX0A 4TSFA 1UKVY 3LNNA 4DR6Q 1Z0AA 2ASEA 5SZIA 1K6MA 1NVWQ 5LDDC 2ZYUX 4B76A 1W36D 2XTIA 1IN5A 1AKEA 4XTRA 5D3QA 1R5NA 1N5JA 3C8UA 5CLLA 5FL7A 1MIUA 1JXMA 3ZYCA 5IYBG 5B58C 5EJEA 3SQXA 2IX3A 1XNQQ 4KKTA 4RD2A 3F1ZA 4B3SL 4A3CG 5AUNB 4XWAA 3HOUG 2FNAA 5B64A 3MWLA 1M2OB 1RKBA 1YNNC 4IDOA 4KI0A 4TT3A 4BXXG 4MKHA 4R71A 4YMUA 5F9FA 2QQEA 4EFMA 4FDBA 4JIMA 2B7CA 3CCEA 2O5JC 3K0CC 5K8UA 4BFWA 4F4IA 4JT2A 3RC8A 4KU4A 4GOXA 2V1XA 4L4UA 4QJFA 2BM0A 3CPJB 3AVYA 3GDEA 1AZTA 2FXQA 4GOJA 1KK1A 3RC3A 2ZJAA 2IHEA 4CF7A 1E9DA 1HTWA 2R2AA 1CF4A 1KJYA 3MLEA 4FMCB 1WBDA 2OM2A 5J4KA 1HTPA 5FLXc 1R10A 2QAJA 2ZSEA 4HAYA 1M6NA 5BR8L 1J2JA 2N78A 2JA5G 1FQJA 3G48A 3I56A 4JV5L 2NZHA 2QBYA 4DUYL 4LX0A 5C18A 5FL3A 2QEQA 1PH3A 2WKQA 2XTZA 5J40A 2AD1A 2V55B 3R9XA 4Q19A 3N70A 4GLVB 1NBME 3S15H 2QM8A 2C9OA 2G6BA 1IYUA 4MGIR 4D2IA 2J5XA 2QE7A 1HNXL 1XTRA 3RNLA 1KI7A 1OXTA 1Z0FA 2FN4A 3Q9LA 4Q4HB 4JJKA 2BA1A 5G3ZA 4EFNA 4X6AH 3TQCA 3THWB 4UNPA 4HDQB 5IYCH 2VA8A 1YR8A 3D0FA 2GJAA 1SQ5A 2WIBA 4AYWA 2JE6I 2EQSA 1YJ9A 3D8BA 1P72A 2BOVA 2NOAA 5DN6D 3EPHA 2ID0A 1CJUC 2IXEA 3GJ5A 2F6RA 2XNDD 3GLGE 2PH1A 4IJMA 1X9NA 2GEVA 2ZJOA 3BBPA 4ME3A 2YU9H 1NLYA 1ZNXA 2NZ8A 4KODA 5DISB 2D74A 1F2TB 2QI9C 1Z47A 3GLHA 4IDQA 5G40A 3RWMB 3WNBA 4MKGA 1E0SA 1WB9A 2ATVA 2VP2A 1A2KC 3U5ZB 5KNCA 5M3MH 1XDBA 2CL7X 3DMDA 5IYCG 4M1WA 4RD6A 2Q0HA 3KFVA 1C1YA 1G3IA 4JK1C 3I72A 3EIVA 2H5XA 1I94Q 2HCJB 2W6ID 3MEFA 4U00A 2K5VA 1XPUA 1B0UA 2GESA 2IYVA 3GEEA 5TXGA 5EE0A 4O25A 4TYYA 3X1DA 3R20A 4DKAC 1VQ8A 3QKRA 3RAPR 1E9RA 4UY8C 3T12A 1N6HA 5KU1A 3JZAA 3VMFA 5J4VA 1GKYA 5FTJA 3WY9A 1HZCA 1NIJA 2NGRA 2YJTD 2A6ED 1P62B 3A1TA 2YOGA 3CRKC 1II8A 4LI0A 2DNEA 3EQLC 4NXMQ 1CTQA 2GXQA 1TTTA 3CO5A 1Q1ZA 3B1XA 1KMHA 3KF6A 4IOKA 1E2LA 2W00A 4Q9JA 4M4SA 1E9CA 1R8QA 2BCGY 2CLCX 4B47A 4DV5Q 3ZVLA 4LF4Q 2ZR7A 2AD5A 3BZKA 1FQKA 2LKDA 2HIXA 1AGRA 4LJ5A 2JA7G 5KSYA 5KPJA 4AYBE 4JVLA 3GLGA 2D7DA 1W0JD 4NBSA 4OHZA 3CC4A 3A1UA 1UBGA 4LJ4A 5C44G 1UM8A 5JCPA 4W9MC 4C0JA 3ZJYC 1A4RA 1X8LA 3KLRA 4CEJB 1VQEA 2OCEA 1EFWA 5DO9A 1G3QA 3KDFB 2J0VA 4ALPA 4O2RA 2JIZA 4G5OA 3GQBA 1WCMH 1OF1A 4YWMA 1CUKA 1EYGA 3REFA 2FFHA 2W6JA 4ESHA 4IFDI 4YWKA 4KFRA 2VHUA 4AKIA 2BCJQ 3CRVA 5E7JA 2N1BA 2A78A 2JA7H 2P5SA 4MNOA 4A4IA 3B2EA 4IOJA 1YI2A 1X55A 1SHKA 3FGNA 5FUYA 1CKNB 3WYFA 4FIDA 1S3OA 2HIVA 1S3SA 2CK3D 1OTCA 2ZTCA 3F5FA 1T0JB 3HPQA 1QVCA 3P1JA 1GSIA 5DIFA 4B33A 3EX7C 4B3CA 3HKZG 4Z1MD 4Q4JB 4XTCS 1T9HA 2XZOA 4BFSA 2OCYC 2O8FB 1G6HA 4A3FG 4S2EA 4B3FX 3AVXA 3BG3A 1DAFA 1RVDA 2G88A 4NE2A 3U4QA 4R4TA 2GTPA 3DEFA 3OEHA 1CJVC 4JVMA 4EJSC 3U3KA 3U7FB 3GJ7A 1EWQA 3SE0A 2WSSD 1P2VA 1FUUA 1CP2A 3QQ5A 1KJWA 3VFDA 1NSFA 3Q85A 4H1UA 2MMCA 5EQTA 3RS7A 2KWIA 1U98A 1MV5A 3KXIA 4Q1BA 2AX4A 4DV0Q 2B3GA 3UWKA 4TZ6A 4X66L 2VYFA 4DV0L 3PUZA 1T0HB 4H9GA 3VR4A 3FOZA 4XVQA 1LM0A 1K8GA 5EXXA 1JR3A 1R6BX 2OHFA 3LBNA 4UNNA 4MGZR 2ZU0C 2K14A 3NBXX 3FPPA 4BFYA 1E9SA 2UXCL 1ASZA 1UJ2A 1G8HA 1JECA 1NSTA 2Q9BA 3T5DA 2A19A 1J7KA 3L8YA 1TUIA 2QG6A 5DHAA 1TKWB 4PO9A 4URXR 3FTQA 1YVCA 5CB8A 2E2HH 3I4LA 3CQZH 2PEYA 3OPOA 2QU8A 1T3HA 4MTNA 1U8ZA 4EJSB 3EW9A 1NG1A 1O3YA 4M22A 3ZDQA 1OFIA 5BXQC 4XSHA 4MRRA 3SJBA 3PUWA 2R93H 3X1ZA 4NCNA 4C0HA 2VY3A 3S1RH 1BS1A 2HHHQ 5HGQA 1MABA 2CQOA 1XCGB 2VPPA 1BOFA 2QQ0A 5J4HA 1TEXA 1DO0A 1JEEA 2PZEA 1IBML 2ATWA 3TUZC 4NCIA 4B3MQ 2FGJA 2QTFA 4HB4A 4IFBA 3PO3H 2E9SA 2NO9A 3Q72A 3ZVNA 4UNQA 2GBLA 3WYAA 3ZIAA 1GUNA 5J3BA 1NY5A 2ZSFA 4P72A 1ODFA 1XFAA 1TF7A 4QGFA 3AVVA 3RRYA 4CVNA 3UDIA 2NIPA 4LW1A 2ODNA 3TKLA 4BFZA 4AH6A 2WJIA 4QBHA 1VG0B 4WXPA 3BB4A 1P9WA 3AKCA 1Q22A 3LWNA 4MYTA 4UNSA 4LF9Q 2AKWB 4A3IG 4QG7A 3WBKA 2KSQA 2ZI9A 2IYTA 5JJIA 2A5DA 2GETA 2JLSA 2ZANA 1IW7D 4JVSB 1OFUX 2WWHA 3CRLC 1VCIA 5EXPA 4EAQA 5BW8A 1TMKA 3DOFA 3FKSA 1VYVA 2BBWA 2VF8A 4KV9A 3KYHC 1VCNA 3AVOA 1Z6HA 2YHSA 3CNOA 4D81A 5DH9A 1U2RA 2ZE6A 5JHHB 5IE8A 1KKMA 2GZAA 2CJWA 1EWRA 5GJCA 2WOOA 2C35B 1D9XA 1A62A 1VQCA 4KKUA 1TNDA 3CPFA 1TQ2A 5L3RA 1U94A 4DV3L 1G6OA 3NC1C 1WF3A 1UBFA 4B3BA 2VSXA 4AK9A 4V02A 4JLVA 3L8ZA 4DV4L 2GVAA 3CCQA 2YOFA 4BRWA 2Y0SE 4UP9A 2EFCB 4DV1L 1CRPA 1JB7A 4JI3L 3P4XA 2IA5A 3K0FB 2HUPA 3CX6A 5FPSA 2B8FA 3CD6A 1SXJA 1TPZA 2GWHA 4MYHA 2ZTDA 1J8MF 2RH5A 4HUQB 5AUOB 4JI8Q 2JDIA 1I5FA 1N6LA 3L0PA 4JT4A 4QFMA 2GVBA 4RZXA 5K36G 4QY7A 3VNUA 1E2HA 2XSZD 5HTKA 2WJVA 5JSZA 3UMRA 2C04A 3WP1B 1M74A 3H0GH 1VHLA 1KTVA 2JJ2A 4L9WA 4A0HA 3CR8A 5CDFA 3W9YA 4ZIRB 2UU9Q 2I5HA 1P9NA 4PFSA 2KCMA 3J81c 1ZUHA 4NXNL 1YRAA 1L2TA 4A3MG 1YZ6A 4RMFA 1PHJA 1FNNA 1OSNA 2PMDA 3BC1A 3JVUA 3KXLA 4QBIA 1YHQA 2BVNA 1IQPA 1FGUA 4LK2A 1EFUA 4OQNA 4WJ3M 4QBFA 4DLSA 2QA5A 1E24A 2D3WA 4DSUA 4URZR 4DV6L 3U58A 1TU3A 2OLKA 3MMPA 3QXXA 4A93H 4HIOA 2CBZA 2UUAQ 1E2IA 1E2PA 3THXA 4HIDA 1E1RD 1BO6A 2ZIAA 3JZMA 4ASUD 4V03A 5EUMA 4DLYA 4HIMA 1CBUA 1CLUA 1OXVA 1E94E 4JL5A 1HA3A 2BE5C 3U4VA 3HU3A 2WFWA 2D7CA 5DNYB 1WA5A 3U3OA 3GTKH 5K8IA 1BMFD 4P3YA 4IOCA 5IK2D 2L15A 4XJXA 3WXMA 1B9NA 2PCJA 3UG7A 3ZQ6A 2UZ3A 2CCZA 4NYJQ 5KYKA 1ZRHA 4AKHA 3BH7A 2JEBI 4D4KA 1I6VC 1ZKOA 4ZDIA 1Q3TA 2GN5A 1E1QA 3N2EA 2F1JA 3VR2A 1UDXA 3GLFB 3CMEA 3BFVA 5EUQB 4BY7G 3LY5A 3SFVA 3U7HB 3KF8B 4LPSA 2ZJRA 1VQNA 5LD2B 1AN0A 1QHHB 4FINA 2R6FA 3LW8A 3A1WA 2RGGA 3A1VA 4LBVA 4A2WA 3TSOA 1YHAA 1GKHA 1FVIA 2PL3A 2FSIA 3E5HA 4U5XA 1W0KD 2EWWA 1I50H 3BJIC 2HLDD 1DE0A 3RYTC 2J41A 4EPXA 1XXHB 1XNJA 3W6OA 1UFQA 4DLTA 1O78A 3OW2A 2WIAA 5CLQA 1HCZA 5AK0A 4BEJA 3VKHA 2OFWA 4A3GG 4Q66C 2P67A 4RCYA 1EQQA 4DAMA 2N49A 4B73A 3TEHB 3PG5A 4DV2L 2WV9A 5DI3B 1ZD9A 1N33Q 4RFSA 3UK6A 1E3PA 2JASA 1NY6A 2F7SA 2G1KA 2A2ZA 5JRZA 2O8EB 4JI4Q 3IO5A 4LBYA 3I5YA 3AF3A 1TF5A 3TGPA 1ZM3A 2PI2E 5FUWA 4PTLA 3W1BA 5FLMG 4DR4L 2YNMA 3I61A 3CMAA 3NHBA 2JLVA 4AY2A 3K53A 2VUMG 4HI0E 2A5GA 3U9SA 3HWSA 3K8YA 5CIWA 221PA 5CK5A 3J80i 4AYBG 1XTQA 1YKSA 3QSYA 4MKIA 1CJMA 1K73C 1KDOA 2AR7A 2BIFA 4QJ5A 1SXJC 4ZO4A 4QKQA 1L1OC 2WJYA 4OXPA 1D8TA 3LQQA 4DLXA 3AVTA 4RVCA 4D26A 3QF4A 3N2IA 3I4MH 4JI2Q 4TQAA 3GJ8A 1Z0KA 3L2OB 1YEZA 1KI8A 2ZRKA 3A4LA 4HDCA 1Q1EA 4QRHA 4EKDA 3U44A 1DAGA 4A3BG 1QF9A 1RE0A 1S1MA 2HYDA 4TL9A 3KJIA 6Q21A 2IF0A 1IJFA 1HV8A 3ZGXA 1XMQQ 2HEIA 3KQLA 2JK8A 3ICQB 1O7IA 4C3JH 3KJOA 1GITA 1T5LA 2WKPA 4Q9KA 3IEVA 2CVFA 2L0XA 2Z4RA 5BN4A 4Q1AA 5TARA 3FMOB 4LF6L 4PSAA 1U90A 2IWRA 4LRWA 4H0LC 2H1LA 1GVNB 1YZNA 5JEAG 4DV5L 1SXJB 1KMQA 3AVPA 3B1ZA 4JLNA 3GLFA 3CF2A 3H1TA 4G01B 4BUJA 2EXDA 2AWNA 1NVVR 1ZCAA 3U3MA 4D25A 2JLUA 3DOEA 3CX7A 2RGNC 1EFTA 4KBGA 5IP7H 1P61B 4LJ9A 3T1YL 1R2QA 3EZ7A 4GNXC 4PSKA 5CIQA 3UIEA 4DCNA 2A68C 1NVUQ 3CF0A 1W46A 3B1WA 4AKEA 2UUCL 2FPMA 3K7UC 1KI1A 2GHIA 3SOPA 2OBNA 1LUZA 1XXHA 2FF7A 4UXHA 4HZUB 4QGAA 1Z83A 2A6HD 5H1SE 3DM5A 1UBCA 1FL0A 1KI6B 5IYDH 4JKIA 1IZ6A 2D0PA 1E2VA 3KXKA 4LJ8A 1YR6A 1L8QA 3K09C 4B6EA 1COWD 2O8FA 1WYDA 2EFEB 1E69A 2BMJA 5CB6A 2JEOA 1VQMA 1A8VA 3EBEA 5IP7G 4LYFA 5DHFA 2BJVA 2XGTA 4QIWE 1N34L 3LFUA 4PPQA 3E1SA 5E4FA 2FV8A 1N5IA 1YZTA 1J5EL 3H84A 5GADl 2I5LX 2Y0SG 3H0KA 1U0HC 2K75A 3EZ2A 4QXAA 3AV0B 2Z0MA 3UDXA 4TT3D 1E79D 1XXHE 4JMPA 3V4FA 4C2UA 4V0LA 2EJGC 1CJKC 2IS2A 5J4LA 1XMOQ 2JQOA 3CCVA 3GMTA 1R0WA 4NB3A 4Q1CA 2Q21A 3GP8A 3GTQH 1N2CE 4TQ9A 3DDCA 1GDDA 2ZROA 4GMXA 3HKZE 2ZYWX 2OTLA 2DR3A 2F43B 1UAAA 2R7FA 5L3SA 4IPCA 3X2SA 2X8AA 3GEIA 4TMZA 3ZJYA 4Z51A 5FBLB 1JT8A 4AWXA 3BXZA 3R8CA 4AC9A 1SLJA 4DIDA 2R62A 2C9CA 4BWYA 4A75A 3I4NG 1Z0DA 4P0TA 1MO4A 4NDZA 4P33A 3N5CA 4LHZA 5KTYA 5E3HA 2B29A 3CXCA 4IFDH 1WQ1R 3K70B 4PQFA 4PAOA 4LUZA 1FPMA 1H9RA 1SVKA 4IFDJ 4HLUA 1XCMA 1H65A 4XWKA 1V9PA 3ZQJA 1X56A 2V7QA 1G19A 3LA6A 1KSJA 2H8KA 4TYNA 2H92A 4RSGA 1P5ZB 3U3JA 3B60A 1P16A 5GAGC 4LDJA 2V3CC 3NTUA 3MXNB 1CJTC 3K0CA 4ACBA 4ACAA 4GDFA 3EWAA 5TDHA 3L0OA 5AR1A 3PO2H 4A8JA 2ASBA 4DB4A 2QP3A 4BY7H 4HZUA 2KB0A 3LV8A 3CWZA 1T3LA 1XJ0A 3CH4B 4Y52H 1GKIA 1GUAA 2C96A 2O0JA 4A3EH 1E2GA 3VR3A 3VA7A 1F3OA 3HU1A 1LYLA 1XMJA 1SULA 2HV8A 1DTSA 4GS3A 4NCJA 3G6EA 1G51A 1I3QH 4P73A 2D2CC 4PX9A 4PZ8A 4JBMA 1VTKA 2NTYC 2RGNA 1T5EA 1LF0A 2CDNA 4AYXA 3PJRA 3WP0A 4A3DH 2ZE8A 3U3RA 4MRNA 1Q1BA 4A3GH 4RZ3A 4WIAA 2EFDB 3OEEA 3W1GA 2DFTA 1QHGA 3BOSA 2J7PD 4PC2A 4DLRA 1XEWX 1PH1A 3D31A 3GTLH 4F4CA 4HDOB 1H8HA 2GF9A 2QUZA 4IXNA 1AIPA 1UE6A 2E2JH 4APVA 1H8EA 2CVHA 3H86A 3LLUA 5L3VA 1G3MA 4QJ4A 4JI0L 1ZCBA 1FR3A 3K0AA 4IFEA 5DYIA 3X1WA 4TLCA 4R4CA 1FW6A 4MQBA 4BBSH 1II8B 3VKWA 5P21A 2MO0A 1T5IA 4MRVA 3T5GA 1HE1C 3UKDA 4AG6A 4EPYA 3RWOA 2Z0SA 3EZ6A 3SHFA 4DDUA 1D2MA 1MRNA 5HKKA 1IN7A 1IXRC 3QF4B 4QC2A 1JJCB 4PZ7A 1OIWA 4Z8XA 5C3EG 1UADA 1B70B 1QHSA 3KZ1E 4A8JC 3AVWA 2QP9X 1O87A 3TVTA 1DXMA 1KO4A 2UU9L 3AM1A 2UUBL 1Z0IA 1E0JA 1NKSA 2ZJ8A 1SZPA 3PCRB 1XNRL 1I6HH 1NLZA 3BS4A 3L7ZC 3G82C 1DCZA 2FFBA 3MRSA 3PIOA 2JGNA 2OFOA 821PA 1ZNZA 4CEHA 4C0KA 1LACA 4PZLA 4LBZA 3J81j 3H3VH 1P60A 2ZREA 4G5RA 5IP9H 2ONKA 4Q1FA 3SHWA 4YY3L 3SYNA 4US0R 2IYUA 2WJHA 1UEJA 4M1YA 4DV1Q 2OZEA 3JAMc 2F9MA 3CWQA 4DR1Q 3LRPA 3QVVA 4PC7A 421PA 2E87A 1HZBA 3HJNA 5JHGB 1Z9FA 5LBIA 4A1FA 5CM9C 4P74A 4G5QA 1OIVA 3B6EA 2VHQA 1XRJA 1Z3IX 3J81k 2QMOA 1Q3HA 4K81B 4CEIB 2VUMH 5DI9A 4IRUB 1JE5A 2PNHA 3W6NA 3FKIH 5JEDA 2BBSA 4O0AA 4GI7A 4M1OA 3DVLA 1DO2A 1XD8A 2XTMA 1VQGA 4YMWA 4LFCL 2EYQA 2JA8G 2AHOB 1X8JA 3T1HQ 2EVBA 1CSPA 4A2QA 4KITB 2QGNA 3DHWC 2GCOA 2XB2A 1IN6A 3MWYW 1EG7A 4NU0A 1G17A 4NL4H 2BEJA 1Y3AA 3H15A 1EFRD 3GTMH 3Q3JB 5TY0A 5FJ8G 3S1QH 4TMVA 4YWLA 2G1JA 2ZAOA 1NN3A 4D4JA 3K7AH 3VR1A 1FTNA 2EJFC 2C03A 3FMCA 2REBA 4KAXA 2MSCB 1Z08A 2FGKA 4LF7L 3TS2A 5C0XH 2OXRA 1UDWA 1PH5A 3S17H 1M8PA 4DKXA 1VQHA 3DPUA 3S2HH 3QEJA 2FSGA 5IYBH 1OT3A 4W5JA 4P75A 2ZETA 1E2ZA 4ZKEA 1WP9A 1AS2A 4E03A 3VQTA 3WMFA 2IL1A 3BB3A 4GOPB 3GLFE 3B82A 3BB1A 4IPGA 1MJCA 3FB4A 3PIRA 4FMBB 4D80A 3K09A 4ABYA 3U4ZA 2ZRAA 2NN6G 1HQMC 1OHHD 4NPHA 4TN1A 3NENA 3QBVA 5FPHA 4ZI2A 3E9IA 2QPTA 2BMDA 3DL0A 2VO1A 4PAMA 2VP5A 1P2TA 2NVYH 1FX0B 2JCSA 4DSNA 4L9SA 1S8FA 4DCTA 3A0JA 1P75A 3Q5DA 1W4BA 2VF7A 1YHNA 4YONB 3K9GA 2XOKA 3WMGA 2ZJYA 4XWOA 1RRFA 3UDFA 3PVSA 5K8LA 4CDGA 2YC2C 3TZUA 4JL8A 4WA7A 3SJCA 2QA4A 1W2BA 1F2UB 3L82B 1CU1A 1NJGA 2FX3A 1QHNA 3U7EB 1Y1WH 4NPSA 1PH2A 4YXWA 621PA 4OJQA 3TREA 3B9QA 3W3ZB 2TMKA 3ICEA 1US8B 5C0XJ 2IK8A 2ODBA 5AWFC 3OAAA 2O8CA 2E1RA 4FWTA 3I92A 3GLGB 4JG2A 4JYAQ 3LAWA 1CRQA 5EE5B 3GLIE 4TZ0A 1AQYA 1T8UA 3NEMA 2OE2A 2WJGA 4J0QA 2J0UB 3AP2A 4MA4A 1YZQA 4B74A 4D0NA 3RRMA 3HYRA 1E22A 4II7A 1J90A 2ZVQX 3B8HA 1KZ7B 4WXRA 3GLHB 2K7VA 3C5HA 5A35A 1ZIOA 4LYAA 3CPHA 1CS4C 3QEOA 4F7WA 1D6JA 5JS7A 3KJHA 1OH8A 3I8SA 1G5RA 3AVQA 4AQYQ 2KHIA 4YHHL 2EQBA 1QG2A 4CT4B 1V5WA 2O0HA 3PF5A 4CEIA 5C4JH 2ZM6L 4FCVA 3GCGA 5DN6A 1H9JA 4A3MH 5M3MG 1OKKD 4GP7A 2VP4A 4R7ZA 3BFXA 3OZXA 4BZQA 4YCWA 5EAYA 4Q4JA 1MKYA 2FG5A 2FA9A 2AK2A 2O8DA 3GFPA 1TX4B 2QM7A 4OI0A 2CE2X 1QUQA 3RLOA 3MGCA 4TTQA 1DPFA 3TE6A 5ELOA 2QRZA 2JLRA 4H1VA 4LWCA 1XWIA 3I7FA 1LABA 3L43A 3NBFA 4JI1Q 2RHSB 2D4HA 2R7DA 3DKPA 3NDPA 4BY1G 5KNBA 3PO2G 4LJ6A 3PQCA 2EFGA 4Q21A 4HLCA 1GAJA 4DUGA 2EWVA 4IVPA 5CM8B 1OJLA 4YLGA 1OH6A 3HOXH 4JLBA 4ZDKA 4LF6Q 1F2UA 4HUTA 1G8YA 3KDFA 2OG2A 2C77A 4AIMA 1W4AA 4PG3A 4IKEA 4L16A 4DWJA 2QPAA 3D3QA 4KYUA 1N36L 1MR3F 3WNCA 3TW4A 1BVSA 2ZR0A 1GKUB 2E8GA 2F1RA 2WKRA 4PC6A 4GFDA 5EXSA 3TJZA 4JYAL 1IONA 2JLWA 1CULC 1YR9A 3HOVG 4QL3A 2ERYA 4HJ5A 1SKYE 1KI2A 2J0UA 2N42A 2V9PA 2KJQA 1JPJA 1TUEA 4GOPA 1S3GA 3SI7A 1LB1B 1VQ7A 4JS0A 4LYJA 3QNUA 4BGDA 3U50C 4I99A 5J47A 5M5XH 4DR4Q 1JQLB 4PPNA 5FTLA 3QPVA 3UG6A 5K8TA 1OH7A 2KBNA 1ZC3A 1LVGA 1B8AA 4DIEA 1P2UA 3EPJA 2HT6A 2DB3A 4G3XA 4OX9Q 5UKDA 4OGQC 3B1VA 4KSCA 2PNRC 1GIAA 2OBMA 3I55A 1HR0L 2YTVA 2G3YA 2HCBA 1Q8KA 4K0KQ 2OCAA 3K9NA 4LWZA 1G7SA 2F9LA 4DZZA 5FPKA 2XEXA 2O8BB 4FWIB 2QT0A 3ONWA 1NRJB 5CDFE 1JBKA 3ZS8A 4Q4LA 4G5SA 3AF0A 2O5IC 2IY5B 1NKTA 3AEVA 4URVR 5JLJA 4OL0A 4DNRB 2W58A 2J0SA 2NVQH 1JAIA 3K0AB 4JBWA 4Y0AA 1IW7C 2QL6A 3KKPA 2YWEA 1L4UA 2NVTH 1LV7A 3QY0A 3E9HA 5FJ8H 1KSHA 2J59A 3GEHA 3LGJA 3LXXA 4A3JH 4NYIR 3OEHD 5C4MA 2HLDA 3RDPA 2L5TA 1GRNA 1Z07A 1YU9A 5JBQA 2GJ9A 2PCFB 1U0JA 2X1VA 4Q4AB 1HPCA 3SYKA 2WPDA 2BV3A 1ZUNB 3Q5EA 1VG8A 3I4MG 1XBTA 1G8FA 3OF5A 3W5JA 4C0QC 1SROA 5BYKA 3F8TA 1OXSC 1X3EA 1ZBDA 2YTYA 1EQRA 2ZRPA 4Q48A 1AJEA 3IHWA 1DBSA 3I2ZA 1W4CA 4C30A 4TL6A 2AK3A 3DM9B 1VF7A 1F60A 1NLFA 2UXBQ 1XJQA 2ZRLA 4IDPA 4IEIA 721PA 4W5HA 5FOVA 3WHKA 1JR3D 1AGPA 4DR2L 3M0EA 4DEYA 4L5QA 1HZ9A 1XD2A 3KB1A 3KKMA 4QJ3A 3UPUA 1E9BA 2WZQA 3U6BA 4X8MA 2DWQA 2IT1A 1L1OA 2UVQA 4DV3Q 5M3FG 1HE8B 1M7GA 4X65Q 3IFTA 2Q2TA 1NIPA 2G83A 3NIBA 3PFIA 3UATA 1ZYUA 4N3NA 1GO3E 4M1MA 5LMUQ 4X62Q 4FCWA 1BDOA 2R93G 4ON9A 4GKJQ 4C9BA 4A3CH 3D7MA 1NI3A 3FKQA 4PQRA 1N3BA 1N0UA 1VKJA 1SR3A 2BHRA 2IYXA 2NO7A 4KFSA 3G0HA 5TB5A 4BXXH 1MABB 1QVAA 1K8RA 4IPDA 1E96A 4OBEA 3GFOA 2ZXUA 5GAHC 4Y7NH 3VDYA 2QTVB 1FP6A 2JAQA 1RYFA 4MRSA 5M5WH 4OHXA 5M3FH 5KDOA 3ZVMA 3ZLJA 4B35A 1XJCA 2WAYA 1S0UA 4Q01A 5FR2A 5J4YA 2VQEQ 2IYWA 5ELNA 2JLYA 5IDVA 1D2EA 3K70C 3KKNA 3OTOL 3AB9A 2F4VQ 3GD7A 1QDEA 2QORA 4GLAC 3G71A 1XMSA 2GK6A 2ZI7A 4KLZA 1ONLA 4LFAL 1UE5A 1W2HA 2XJ9A 4NONA 5EZ6B 1YNXA 1LS1A 3CW2A 2N46A 5TV2A 2ZJBA 2DWOA 2FE4A 3BERA 3TQFA 4M9XA 3ADBA 4JI7Q 5A5GA 3IQXA 1QUQB 3CPWA 4I4LA 1T91A 5FTNA 4H44C 1KO1A 2O8DB 2YC4C 4B3DA 2OXCA 4DDTA 2CFMA 3KJGA 4KHZA 1D2NA 1TQ4A 1ELOA 5FUXA 4AIIA 3HP1A 4RD1A 3THYA 3IIKA 3E70C 4DLWA 5A4JA 2PX3A 1KSFX 4DSTA 4HJ9A 2IBMA 1PJRA 3K70D 3HOZG 1VCOA 3SQWA 4DV6Q 3I4NH 3R7WA 2PT7A 1OB2A 2K5UA 4GP6A 4LUCA 2PMZE 5EE1A 4M0LA 4YDSA 4EX5A 3U4QB 3SDZA 2G0NA 3OIUA 4LK1C 3FHWA 1YITA 2JA6H 1R8SA 2Q3FA 1J6QA 3A4MA 4LC1A 4CT5A 4DC9A 1GWNA 1WBBA 1TWCH 2PQAB 1P2SA 2H17A 4QNRA 1L7VC 2QPOA 2REOA 1X6VA 2ZRNA 4MGKR 2ZU6A 2R6GA 1ONBA 1Z22A 2Z6KA 2D0OA 1VQDA 2J46A 1R7RA 1ZNWA 3GTGH 5EE9A 2MFIA 3TNFA 2OILA 4C0AC 2RB4A 5CITA 1PLLA 3B1YA 3U2QA 4A76A 2VQFL 1KK2A 4I7ZC 3SJAA 4B3ML 2ZQ5A 2JLXA 1PH7A 2BKUA 3K9HA 2RGBA 3MWKA 3BWDD 2LCFA 2YZ2A 3VU9A 4Q7KA 5LMNL 4UPAA 2P3SA 3NELA 5BYJA 1XPRA 2VNUD 3AP1A 5IHPA 2J45A 4K8OA 1IN4A 2CE7A 3STBC 4BE7B 2HQLA 1HQCA 2OAP1 4P32A 3BH6A 2C8VA 3A8JE 4NCHA 3A1SA 4JLKA 4LBWA 3FP9A 1Z28A 5FI0B 4GKKQ 3F3YA 3VKGA 2I1QA 1A7JA 4HB0A 2IWHA 1KIMA 2BC9A 4GLXA 1TQDA 4OK5A 2B8TA 4M1KA 2UUBQ 2GBLC 4QBGB 4WOPA 4TTPA 1T8TA 3K0SA 1HR0W 2Q9CA 3ZZTA 1SKQA 4POAA 1G291 3GFTA 1CR1A 3AUXA 4OO1H 3HU2A 4JI4L 1GHKA 2GK7A 3SC3A 5ANRB 1ZNYA 2XZLA 2NZOA 1HNWL 1KDRA 1KOFA 3QI2A 3M6AA 4D4MA 2AFIE 4PMWA 4OK6A 5FR1A 2IYZA 1Y1VG 3VHXA 1Z2CA 3C4JA 4TLAA 1XJVA 3NVAA 2ZRBA 3REGA 2QZ4A 4V0NA 1E99A 2ZTSA 3ERSX 1Q81C 4A0FA 1LFDB 2XNDA 1EIFA 5FUVA 4B34A 5DSZA 2NO0A 2BA0A 2Z6KC 2FZ4A 5J5CA 2G9NA 1G1MA 2R44A 2VBCA 1E2WA 3GTJH 1E32A 1M34E 2CL0X 2PJRA 2BWJA 4NYMR 4D6PA 2ZRCA 4G1UC 3CBQA 5JMTA 3GLHE 5F3WB 2VL6A 121PA 1QZXA 1GRRA 2H18A 4DR5L 1ESMA 1N32Q 1MO5A 3SBDA 4JLPA 5JZVA 5HKKD 1PA6A 3CC2A 3E0EA 4LF8L 2A8VA 2OUKA 1JNYA 1SVMA 2JLQA 1O7LA 4DLUA 2G77B 2LKCA 1PFSA 4LUOA 1VQ6A 5E7MA 3PUVA 4HAWA 2EJMA 4BA1I 3VHLB 4YHHQ 2BH8A 2QE7D 1P8LA 1P9RA 1IYVA 4UP7A 3AP3A 4KN7C 4FMDF 2ZSBA 1VQJA 3C16C 3PSIA 1ZP6A 2MSDB 4X8LA 4XD7D 3RZDH 1CTMA 3RSLA 4IPHA 1LNZA 2AKAB 2PZGA 3T15A 2BJWA 4WZBE 1RC8A 2O8BA 2B92A 4DB2A 1OLOA 2DUDA 1VQKA 3P20A 2CCJA 1P3JA 3RRNA 4IOMA 4BFTA 2O8EA 2KCCA 4PPFA 3RLNA 5GQOA 3QBTA 3H4MA 1OIXA 4HAXA 4LF4L 5M5YH 2VP6A 4I1OA 4WJ4A 2C98A 3A36A 1L4YA 3IBYA 5EP4A 1DADA 1DARA 3UMSA 1JPNA 1U81A 3CCSA 4LSGA 1CI3M 1E2KA 3MG9A 3R7WB 3BD9A 4OI1A 4DVGA 1D7QA 3T1YQ 1W4RA 4KHPL 4LV5B 4XVRA 5G53C 1NE3A 3UE0A 2ZI5A 3KTAB 1K8AC 2YKGA 1E6CA 2MMGA 3C7KA 4KJZA 4GOKA 2F1HA 1K8OA 2W6JD 2X2FA 4KFUA 3OFNA 4G5GA 3QKSA 1GZSA 2IHBA 2ZUBA 2WJJA 1S9HA 3AUYA 3HGBA 2R7ZH 3A8TA 4KFTA 1H9MA 3SN6A 1G7CA 5DE3A 3LH5A 3DKVA 4X64Q 1R0ZA 1VMAA 4DUYQ 5AJYA 3S16H 3W6PA 2VL7A 2GXSA 2I0QA 3VU9B 1N6NA 2BKEA 4BBRG 2D5DA 2RCNA 2V54A 3FMPB 3IGFA 3IDQA 4BFXA 4LFBQ 3QG5A 4FCTA 4A2PA 3HOUH 3OIWA 5IYDG 3F2CA 2RHDA 4QNMA 4BLQA 1KSGA 2CJWB 2KA7A 2FPKA 2QSYA 5JJKA 2UUAL 4IOAA 2PCLA 1IXRA 1JAHA 5IT9c 1ZM9A 1CR2A 5EXTA 3NG1A 4DJTA 2QMUA 3B5JA 2ZJPA 4NXML 4GZYC 4LGMA 2PLRA 4X8HA 4KYIB 4HATA 3W90A 1NVXQ 2CNWA 2QP4A 3DZDA 5BN3A 1Z6GA 5JEAJ 1OHHA 1DAHA 3D6TB 2C78A 3V4RA 1N6IA 1L2FA 1NBMD 3J7ZC 3CCMA 1DVRA 5GJBA 2VQEL 3CRQA 4LHWA 1YZGA 2P6NA 4QGHA 3M7NA 4OHYA 3CB4A 3RSOA 5FOSA 2PJZA 1PMRA 1UEBA 2FU5C 2RGEA 2CK3A 4Y0VA 1P7CA 1P6XA 4A0RA 3GLIB 4PZYA 3DM3A 4C7OA 1E2MA 4TSFD 1C4OA 5BQ5A 3OYYA 3I73A 2DBYA 1A0IA 1TU4A 1IAQA 1UE7A 4X65L 4DV4Q 4OQLA 2AN9A 4Q9IA 4WW0A 1NMYA 2REXB 2JA6G 1VQOA 4B2IA 4HUQA 1W7AA 2IW3A 4QHSA 3UXMA 5EP3A 3UDGA 2WB1G 4JCVE 4DUZL 2AUKA 3THXB 4X64L 1FMJA 2R6CA 2V4ZA 4P4TA 5EE3A 1PUIA 2EVWX 1CXZA 1GILA 4XIGS 2NVXH 1XEXA 1KRSA 1SN8A 2JATA 3RS3A 2WWYA 2WB1E 1ZVQA 3TAHA 4PC1A 4LF5L 2B6HA 4TMKA 1W44A 4RD4A 5ELXA 1CEEA 2OAQ1 1VQIA 4B2PA 1XZQA 2FEMA 1JI0A 2OFXA 1X8KA 3BFKA 4S35A 1Z06A 4DR5Q 2UZIR 3ADDA 3ND8A 1C0AA 2QAGC 4JYCA 1Y63A 5A0FA 2QROA 4E07A 3TBKA 1X1RA 4QHYA 4TMWA 2RHMA 1SGWA 1MJEA 2PBRA 1U5KA 4JBXA 2ECKA 2IYSA 1T6NA 4PQYA 1D5CA 1J99A 2H16A 2IUUA 1ZC4A 4D82A 3IIJA 3KLWA 4IXMA 4GOPC 4OJKA 1RPZA 2UXDQ 5C46F 3TSWA 4HAVA 1KAWA 2WBLC 5TVKA 3PXGA 1ZAKA 4JL6A 5JRJA 2UXDL 4A93G 4Z8YA 3BIFA 3BRWD 2B7BA 1V8QA 3HOWG 4Z54A 8OHMA 1XD2B 1G18A 4ITRC 3D4RA 2ANCA 4A3KH 3O47A 2NO6A 3OEED 4JI1L 4YY3Q 1CIPA 1AS0A 3Q8XB
chains in the Genus database with same CATH superfamily
4LFAQ 3PGZA 1Z5GA 5HCUA 4F97A 1MX5A 1T3GA 4R4QA 2GVDC 1IZ0A 3Q5GA 3MRTA 5KQLA 4NMMA 4UXJA 5ALEA 4YEDA 2ZUCA 4EGCB 1P6QA 3BXFA 1IN8A 4R4JA 2JA8B 2EYJA 3MW8A 4KGVA 1GPBA 5G4LA 1VL8A 2YBDA 1CD5A 1RPAA 2D06A 2D1RA 4IDNA 5IOCA 4AI6A 1SG6A 1XDUA 1ZCFA 2OHVA 4DV1B 3CCUA 3TRZA 1BC5A 4FYXA 4R40A 1PG2A 2W70A 4HB2A 3MOSA 4IXTA 5H02A 2EHDA 3EMBA 1C3LA 2QVZX 1VQFA 4CDRA 2WDZA 3VKVA 4B32A 1YNJC 4ZGGA 2PD6A 2FWBA 1SUWA 4JYBA 4LF8B 2A3RA 5DNVA 2V6GA 1ZMXA 2V5VA 1VECA 2WNSA 3B3AA 3NKVA 1GQ2A 1X1TA 4XM1A 4BA2I 2FDRA 2PKWA 3QHQA 2D5CA 5JSZB 4KR7A 4B7XA 2PI2A 3C1FA 1YR7A 3E81A 3FKSD 3HCOA 3WRYC 1FCJA 1U0FA 1KY3A 3G2KA 4GHWA 1Y8PB 4E4RA 1JHUA 1QGUA 1R3UA 1XX6A 2PR2A 1KK3A 2R4QA 3FSEA 4DR1L 3PFFA 2GKSA 1Z0UA 1C9OA 1DO8A 1PVVA 1FP7A 3GNLA 3KC2A 3FWKA 4QHTA 3SYLA 2K52A 3F5SA 1N6PA 1GGEA 3H5TA 1JTVA 1RQNA 1SU7A 2IHUA 4RQBA 5K6AC 2JHAA 2VDVE 3DZKA 3VV3A 4PG8A 1A82A 7MDHA 3K92A 1OILA 3FHLA 2F1OA 3LX6A 4GOND 5FRDA 2RHQB 1U2GA 2MTBA 3ZCQA 4F06A 3J7A5 4P4LA 4UFPA 2NAFA 2RCFA 4FR5A 5L7WA 5TQ0A 3HXKA 3V00A 3WL4A 1EEHA 3PTLA 1Y8NB 1TXYA 1IJKA 4RHCA 3UFXA 2K01A 2PZFA 1J2EA 4MV9A 2CH4W 3IXQA 1IM2A 3UO8B 3K4HA 3MFQA 3OZTA 3B9BA 3HYLA 3WBJA 2C7OA 5D3DA 4TGLA 3HS0C 2XUDA 3KVOA 4D9EA 4WY8A 4XWGA 2MINA 1NVAA 1M2FA 2PWZA 4H6WA 2G9ZA 4A26A 2OPBA 1VA5A 2NADA 2P1RA 2WWVD 3TEJA 3CAMA 4MJLA 2XGGA 1VYUA 1WRBA 3DV2A 2R8ZA 3LVRE 3SZRA 16PKA 2P0AA 1Z6XA 1OC2A 1E18A 5JD3A 2ARKA 4BVGA 5JI2E 3OZDA 4BVJA 1NT2A 5EIWA 4ZCTA 5K5PA 2QD3A 5DX8A 3KQUA 1RDFA 4JBLA 4NX2A 1WU7A 1O95C 2D2FA 3OLWA 1Z0ZA 2D1SA 4Y2VA 1W5AA 5FWDA 3OU7A 3UFBA 2DY7A 1UC4B 1C9KA 1TT2A 3BILA 3AF1A 3JYLA 2QUIA 5AJWA 4FSDA 1Q0QA 4BBRH 1Q46A 3OE7A 2DE0X 2Y0DA 1SCUB 1VPDA 3E9CA 3GTKB 1FNMA 4TL7A 5BWLA 1ABEA 3D02A 3CZQA 1II0A 2GZ1A 1KD1C 4L5BA 2NSJA 1GYPA 2A5FA 4HFJA 2FMIA 1U7OA 4RQAA 2AG6A 1B3BA 4OWWB 4ZARA 4GMKA 3ZTTA 4YJDA 5F7OA 3CVYA 1YHBA 1RWMA 2AFHE 3BEOA 1YQUA 1HRKA 3KKQA 1QR2A 5INTA 3ETEA 1GZDA 2OAEA 1NVBA 3TNJA 3PO2B 5LYJB 3ER0A 3M4OH 3EFEA 2W2TA 4QA9A 2W4QA 5EWJB 1EEID 1KRTA 3FX2A 3GEGA 3QXJA 1HORA 3I8XA 1YQQA 3M9BA 2ODWA 1S40A 4MYDA 4R83A 4IHJF 1PBTA 5E95A 1K92A 2OORC 2P4HX 4J1NA 4KAAA 3H9QA 3K0XA 1PV2A 5ICGA 2IZOA 3BTSA 3EQZA 1K0FA 2Y4NA 2NUAA 2PZMA 3QLVC 5KGUA 4BNYA 2O1WA 1T8PA 4AW9A 3D5EA 3SMQA 3TRFA 4TSRA 3PIPA 4K26A 3GPLA 2F43A 3ICOA 3UGQA 5CG2A 2VSFA 2G5TA 2P62A 4JOCA 3TP6A 1XXLA 5MF6A 3A32A 4JEIA 1KAOA 3TIIA 2EBFX 4E5NA 2V1UA 4I5GA 1Z6AA 2F0DA 1S89A 2H7VA 5K8VA 5CUQA 3OJLA 2WD8A 3X0DA 3AR4A 3QVTA 3P96A 5HMMA 3NEYA 3PNVA 5M3BA 3ZXSA 1DUVG 1VHTA 2VRWA 4ZQFA 3CSDA 1AZQA 5LZ9A 3VNVA 4G07A 1DKQA 3LVQE 4PHGA 1FSFA 3IMEA 3SXPA 3QLTA 3DPIA 3QKRB 4LGVA 5DSXA 3R8BA 2XYPA 2UXCB 1I4XA 4V190 2D1FA 2JFOA 3CR7A 1QK4A 2PEZA 1Z5UA 1VQPA 4C21A 1UEIA 3ZBPA 5HQTA 1VQ4A 3A2MA 3QPUA 5CFMA 2NBFA 1NVVQ 2FPWA 1RXYA 2ZBVA 3I01A 2P9BA 3S2HB 2FWRA 1GLNA 1EXMA 1G8PA 3LXRA 1PV4A 3QXSA 4M0CA 5EP1A 3RSQA 3T35A 3DXJC 4H31A 3WIEA 4S1WA 5L53A 2PUAA 4M1SA 4MZ9A 4X5OA 5SYMA 5J58A 2FKNA 3H6KA 3RABA 1AW7A 3ZXUB 3FPAA 2YYZA 4FVTA 5DP2A 4RK7A 1UZAA 1H2AS 4FYDA 4JC4A 3JZDA 5B55A 3SXUA 4US2R 4XIIA 2WTEA 4I7EA 1STYA 5GAEC 1ENYA 1T15A 3WISA 3WFZA 2FWNA 1SU6A 2X2OA 1NJ2A 3FZYA 1EY6A 5LQRA 2GJSA 1KOJA 3EF1A 4Q47A 3KO8A 3IESA 3U7IA 4O2BF 1V95A 2I6QA 3R3VA 1BKSB 2W2XA 4G5XA 5GM1A 5SZJA 1PRTD 1MTOA 2XX3A 3A9WA 5P8WA 2E2WA 4C6RA 5BVHA 5TLSA 4MWSA 4RLFA 5C8VA 3JXEA 4Z9XA 5BV0A 1DC4A 3PQ3A 1OQAA 4PANA 4WBXC 4XUEA 5EGNA 4K40A 3BU2A 1A9ZA 2WMOB 3K9WA 4O4JB 3S14H 4OB8A 4TWAA 3TLXA 3Q7TA 5CPBA 4OP1A 1BXRA 3NUZA 3NASA 4JR2A 4LA4A 4EIWA 4GKJL 2GZRA 4DMMA 4PBSA 4G41A 1KYWA 5HFJA 2GAIA 1VFNA 2JFGA 3P27A 4LRTB 4UAVA 1HR0Q 4IBOA 4CIAA 4UHVA 5SICE 1XNRB 4BB9A 2H48A 2J5QA 3OPMA 3HCNA 1EX9A 1XN4A 4WX2B 1X38A 3UOWA 1U9RA 5JZ9A 1K3UB 4OM8A 2EIFA 3J80c 3STBD 4QEZA 1TMYA 3IVCA 4R0NA 5AK5A 2ICAA 5AUPB 1L0BA 3BKWA 3UMCA 2B4QA 1B26A 1N75A 1ZOOA 1NXSA 4DPGA 1J5PA 3P5BA 3JZIA 4FHFA 4RE5A 4DR7L 5IUJC 3ULLA 1M1KC 1Y6GA 1E5QA 4XYEA 2PH3A 3U7GA 4B3DA 1XTSA 5BQPA 5LP6F 1E9FA 5DMHA 1KZYC 3PPIA 3OTIA 3UJBA 4DSUA 3MEHA 2CXPA 1Q0HA 3A37A 2YDYA 4GI2A 5DRTA 4HQLA 4ZVSA 3HOVB 1GL6A 4FLEA 1B2TA 2PFKA 2IEZA 1A63A 4BNWA 2BFMA 5CA0B 4R9NA 5EC8A 5FH9A 5K0EA 1D4OA 1PEKE 2GXAA 1ZXBA 3H1GA 1F6BA 3I1FA 1HLPA 3TSCA 3RNOA 1UXHA 1Q17A 2R8RA 3UTDA 1Y3CE 3AB3A 4NK5A 2WVGA 1GZHB 3RHTA 1JPVA 3V8MA 3HVRA 4V0ME 4REOA 1ZGCA 5ERYA 3ZNPA 4BYMA 5DBIA 2FR1A 4LF9B 3IVGA 5JSHA 2VQFQ 2QMZA 3IP9A 3KU1A 5KOIA 1RABA 2H8GA 1XZNA 3LQYA 1G4AE 1DMSA 1ITZA 4F4HA 1EWYA 1E2DA 1JT2A 2ANBA 4K9RA 5FOUA 2IPXA 4RK0A 3E18A 4UEOA 4CMEC 2PUEA 1JQYD 4CMKA 1J07A 2W2LD 2OQ0A 3W7AA 1DKRA 3AY6A 2KCTA 3VM6A 5JXHA 1M1NA 2O59A 1DZ1A 3BJZA 1MN6A 1NL3A 2Z30A 4G23A 3USZA 4UMFA 1FL9A 4EFDA 1I4EB 1E9AA 3GH1A 3GTOH 2ONJA 2K5HA 3JASA 4D96A 3U3DA 1H1LB 4IGAA 4J8QA 3ET5A 3NV7A 5SYAA 2QYSA 3TGWA 4JBYA 1YDEA 1VJ5A 2LIVA 2VSOA 1Z2AA 5AHWA 1WSAA 2RH4A 1YZKA 5F1PA 1LJUA 5HK8A 3MSXA 4AJ1A 4GNXA 1N8KA 1Y34E 3CNLA 3MMZA 1JDNA 2A6EC 1JDVA 1QO0D 2VNHA 3QKSB 4KN8A 5C7YA 3K1AB 1PR5A 1I10A 1TEVA 2KMLA 3H2KA 4TV8F 5LQUA 4BBJA 3MPUA 4OKSA 1DKMA 4YT2A 2WB2A 2C2MA 1P45A 5JO0A 1PTJA 1FNUA 1C0LA 1Q16A 4Y6RA 5CDUA 4DDKA 1T2EA 1B2LA 2B69A 3M6WA 4MW4A 5LMNQ 3PXUA 4G5YA 1O7JA 4ARZA 4QYWA 4L5TA 1ZIPA 3OA0A 3FXAA 5IPFA 1FJGL 2Q2HA 1EMDA 1DTWA 2V9CA 2PMFA 3KVVA 3ONVA 5F1OA 1JG4A 3N7UA 1DRVA 1VGQA 3OSUA 1YS4A 3FJYA 3H1BA 2OEOA 3IO3A 4EYGA 2HGZA 3JR3A 4F7XA 1E1TA 4CKYA 4RULA 1FRFS 4ZV4A 4OB6A 3H3VC 1GV0A 1RNLA 1YT5A 2WMNB 3VA5A 3AESA 1NXTA 3T3OA 1N3YA 2WSBA 1XWEA 1GZ5A 5KOJB 3F3KA 4DADA 1JH9A 4KYTA 4BGEA 4V1CA 1UKYA 4B3TQ 1D0VA 3IAS6 4B7ZA 5ICMA 4I3HA 3VOAA 1JZTA 5HURA 1ZISA 1JQJC 2VN8A 1H6CA 2FWPA 3PPYA 4U02A 4B6FA 1EVLA 1I4OA 2XQVA 4UM9D 3T1HL 4ZQGA 1WEHA 3WWVA 2OKCA 1D8LA 2RGDA 3A11A 3C7AA 3U7QA 4DUZB 3QYFA 4B43A 3OI7A 1HDZA 3B5IA 3PRYA 3DOUA 4Q3KA 2CWAA 3WYGA 4YFYA 1GUOA 1YNND 1UJNA 1UKAA 1SBYA 3MWDA 3TK1A 2YHBA 1G5TA 2CZCA 2J6IA 3LQRA 2XJ4A 4G8JA 2J3JA 2A86A 4OEMB 1CR0A 2HKIA 3OIYA 5C7IO 5G3LD 1PYWD 2PYZA 4R41A 5D1NA 4G8BA 1SE8A 3FPBA 5H1YA 5IARA 5AOCA 4KQFA 1YXMA 1LRJA 3JVEA 4IJHA 2IHYA 4PAWA 2C7PA 4B4KA 5IWAL 3DXFA 1ADFA 2CYAA 2FH5B 1B8PA 3DNFA 3IPCA 4MJXA 4FOOA 3JQQA 1FTSA 4G89A 2XI4A 1QFMA 4S1TA 2ZIUB 3NB0A 4J4TA 3CU5A 4R4IA 2OBBA 2OGSA 1Z7TA 1UWVA 2ZJ5A 1GUWA 1NC3A 3DT6A 3EC1A 1SXQA 2ZAYA 4LVNA 2X0FA 2VS1A 3DQZA 4EUKA 4BXOB 4YIJA 5LB4A 2WJ3A 2BCEA 4GYJA 4N7JA 5CFNA 4G4JA 1XEFA 4YT8A 1BXRB 1NMFA 1BKBA 1MUUA 1ZD2P 2CFIA 5C4XB 2OCPA 3CRMA 1BGVA 1NMXA 4XRGA 1G8KA 2NN6I 3I70A 1YRHA 4G7OC 4NJMB 4D9JA 4DUZQ 2BDTA 1MJGA 2GUWA 3GRVA 3N2NA 1AGXA 1Q2XA 4PLPA 4A3KG 4Q02A 1PWHA 1UBKS 2VHTA 1RHKA 1PG5A 2IOQA 1WMAA 2MSLA 1FRVA 2CHVA 4O2AA 4PZUA 4QDZA 4E33A 4YXFA 4M60A 2CV0A 2QTRA 3UCXA 4RH6A 1XMIA 2ZM5A 2JJMA 3OAAD 4XGKA 2I2DA 3V7WA 1GR0A 2KBEA 5DT2A 2PSHA 2V59A 1H95A 3SKXA 4RXUA 4YCJA 3WQHA 4Y6OA 3GJ6A 1FYWA 2BFDA 4KN5A 2QLTA 2WILA 4D41A 4CMHA 5EJFA 1K6JA 3RUZA 1DDIA 1Y7HA 2CHFA 2Y9PB 3KPYA 4MUYA 2F17A 4LQ4A 4O3FA 4ZCPA 3SQOA 2YFHA 3STWA 4ENPA 4BBSG 2WWFA 1A2QA 2PKYX 4MIKA 4Q4DA 5CH5A 2V1CC 1DGQA 4JN6B 4I7AA 4A23A 1GL9B 3EYWA 4HZIA 3LK7A 4ZQCB 1PTOH 3DLPX 1XELA 4QL3A 2WK1A 3EPKA 5LQMA 4FEGA 3WKEA 4DTIA 2GNPA 4LRUA 3AH8A 4IAOA 1PGJA 3IL2A 1CQJB 2ZUEA 5JQGB 4AP6A 1IK4A 2OQ2A 4C14A 2IPKD 2PS1A 3ANYB 4FGKA 3E03A 4MCHA 1W29A 2J0QA 2R92G 3RTAA 3G2IA 4QT4A 4LVCA 1WI5A 2Q29A 2Y1DA 4XDZA 3STHA 1KMHB 1OYWA 2WUEA 4JI3B 1TD1A 4DC0A 1KA9H 1HT1E 4IUQA 1V8ZA 1MO6A 1B0PA 1UBEA 5JEAH 1WDTA 1E1OA 2C4MA 2NXWA 1G4UR 1E1DA 3HR7A 4JIGA 4RKQA 3WGJA 2IHFA 3JQ7B 1KIFA 2XOXA 3OOJA 1LTHR 3LPCA 1N2HA 5I9MA 5BOSA 4U8HA 5FP0A 3HCBA 5JXJA 3LL4A 3DBHA 2BR3A 5C1IA 4DUGD 1QDLB 4BP8A 1B43A 4BO7A 3HKZB 4TMXA 2PUVA 2F64A 4MVJF 5EHNA 3A2LA 5JBNA 1T3SA 1S9DA 3S2GA 3HO8A 2DN8A 1UC5B 3O3NB 3OC0A 5KMGB 1XP8A 4JI6Q 2XBMA 3IE2A 1KHHA 4KOAA 2CWWA 4X1IA 3UH1A 3G4SA 2WQZA 3QVKA 4Q5IA 3VNQA 4IMJB 5IRCD 2RKSA 3MJRA 4JP1A 1R6XA 3DMFA 1K0UA 1A4XA 3FUXA 3O8OB 2JJYA 3CLVA 3TTUA 3F9IA 3VTZA 1FY2A 1JC7A 1GGHA 1XL0A 2QNRA 3E61A 2ZE7A 1BXTA 1Y14B 3LBHA 1E3TA 1FZQA 1K5DA 1MENA 1KC8C 2A4KA 2GX6A 2B94A 5LMUL 4ED9A 1TDJA 2FDXA 3DEJA 5KJEA 4N9WA 5NLLA 5JS8A 3MM4A 1RKXA 3LNTA 2Z8YA 3BSWA 2EXZA 2CD9A 4JQCA 1L4NA 4CCAA 1KIXA 5EZ5A 5HQ3A 4GN4B 1U99A 1AOXA 3OFND 1ZCZA 1WWKA 2OFPA 3K7EA 4I66A 1I2ZA 2FMHA 3BREA 3B7PA 5GJVC 1YULA 1SFOH 2CVOA 2HY7A 3CGGA 1K3BC 1S5BD 2BBTA 2NYUA 3I3SR 3KL4A 3UV6A 2FMFA 2J3LA 4E5UA 4FZJA 3HEBA 1OB5A 3ICPA 3P19A 4OYHA 4IIJA 3W4KA 1JLKA 3ND9A 1WLYA 2Y1GA 1YC5A 1XTIA 4WA8A 1F0NA 5FD8A 4EUNA 4LJRA 2NXCA 1EBFA 1K0RA 3LQ1A 5EMMA 1HOXA 4I4TF 1II9A 3H4TA 2MO1A 3P9PA 1T9ZA 3OE5A 4O59O 4R1SA 2B8NA 3AEZA 1O54A 3FJ1A 2HF2A 5D7BA 3PQ8A 5FTWA 4M54A 1QPGA 4X7MA 4LZAA 1U0LA 4DCMA 4TM7A 2WINI 2XZPA 1HTLD 1A3CA 4AWAA 2QGZA 1S2MA 3O38A 1EU3A 2I65A 2XSZA 3VI3B 4AJ4A 1O9HA 4K6MA 1WP4A 2CWPA 5BN5A 1QYDA 1DBWA 2GEKA 3DDZX 3E27A 5C1DA 3Q6MA 4FFWA 1NQ5A 4URYR 2COKA 3SIPA 4WK2B 5AVSA 4D9IA 3CFYA 4MKXA 4R2HA 5FPPA 3PF4A 3NOQA 1YS7A 4DQDA 2PAAA 3SBXA 4JQZA 4WRRA 4GU5A 3T56B 3RI3A 4B75A 5FHRA 4JVZA 1WCV1 2I3GA 3MWFA 4NJEA 4BV2A 3DFUA 1JDTA 2BN4A 3NC0C 3KQQA 4HFRA 2P8JA 1P4RA 3QP9A 3B6JA 3UMGA 4YYZA 5C2JB 3RV3A 5MGBA 1NAHA 1EVQA 1HURA 2EZTA 1E1RA 4JENA 4Q7KA 4ASUA 1L3IA 1EVKA 2XQFA 3W9UA 1AKUA 1LPAB 1QYWA 4ARBA 1GUFA 5C1BA 3EODA 5AW0A 1U0RA 1Z4JA 2C95A 2FVYA 1A6XA 1ZN2A 4FYJA 2ADFA 1U7WA 2HHCA 2P0YA 3CCLA 1JKMA 5BRAA 1I3KA 2Y1XA 3PEVA 2OA0A 2TSSA 3ZGZA 2WA2A 1FXSA 1Z33A 3QUCA 3ZHBA 1ARZA 3EA4A 2BAGA 4U7JA 2HDWA 3G3EA 5F2NA 2I78A 1DX9A 2PX6A 2Z6AA 1EB9A 1FFEA 4LJSA 4MLDA 4DEXA 2IOYA 4BWVA 4ZRNA 1I9GA 3WMXA 2YMQA 2Q1TA 3MCAA 3AC0A 1HPLA 5AKJA 1WKBA 5G3YA 3CLHA 1CY4A 3D6AA 4Y7CA 4XSGA 5B2ZA 4BPBA 1W0CA 1ODCA 2PGXA 4WOKA 1TTQB 2VZAA 1VG9B 3EFOB 1Y6JA 5AYVA 5L3QA 3FMVA 1YS9A 2HXSA 4QTXA 3HB0A 4A3LG 4LYDA 2NPOA 4IGKA 3VSEA 3VX4A 5B57C 2KS6A 2P2CA 5A9SA 5FO0A 2GCNA 4I2VA 4LSWA 4BLPA 4C4PA 1T9GS 3HOXG 2I34A 3IQGX 4JT9A 4KB5A 4ND5A 5DLDA 3PKIA 5F51A 4HNVA 3RN5A 3ZWVA 5BSKA 1RWOA 3ROFA 4QNNA 4YIKA 2E5LQ 3EZFA 3DLAA 1JOOA 1HDRA 1LWNA 1NXPA 1VJ0A 2D59A