3PV0A

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
370
structure length
370
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 86
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pv0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pv0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pv0A01
4IEEA 2A7QA 3H3VH 1N5IA 3CH5A 1NY4A 3RNLA 1ZU5A 1SVIA 1RRGA 4CIDA 2BE5C 2W0MA 3L8YA 5LDDC 5FI1B 3G71A 1OFHA 2QZ4A 3JZMA 4NHOA 4AH6A 1ZJ6A 4RFSB 5DIFA 2WJYA 3PEUA 2QI9C 3CRRA 4ACBA 4RD6A 5AJ3Q 2D2EA 1CRPA 1HE8B 4LX0A 2VY3A 3LBHA 1YIJA 3QKUA 1IQPA 1T3SA 2DWOA 2R6GA 2BCJQ 1GO3E 2KI5A 1GL9B 4GLAC 4KLZA 4A6PA 1N6PA 4BXXG 2ZE7A 2BDTA 1ZRHA 4A3GG 2VLIA 4P4UA 1ZP6A 4NH0A 4Y7NH 1I4DD 5JHGB 4RG1A 3SNHA 2I1VB 1HV8A 2ZYUX 4TMZA 4LJYA 4EQ6B 2ZITA 4TKOB 1KO8A 3PJRA 2CW0C 3I4NG 2OTLA 3E9IA 3GFPA 4IVQA 2MSEB 4BA1I 5C0XI 3S17H 1ZM9A 5FUXA 421PA 2A5GA 4AYBE 2JJ1D 2MO1A 4LPSA 4G5QA 1AN0A 2VHCA 4P31A 2EWVA 1QVAA 3VU9B 4RD2A 3F2CA 4HB3A 4DUZL 4AI6A 4LBVA 1B9MA 4ALPA 1GVNB 1L7VC 1VHTA 3H0KA 4DLSA 3GLFA 3G82C 2EVBA 5FL3A 3FMFA 3X1YA 1IXRA 1DOAA 3GEEA 1C9KA 4FMCF 2ZIAA 3KJHA 4MRRA 1COWD 1J8MF 1E0AA 4BRWA 3RS3A 2A2ZA 4GOJA 1F60A 4ERNA 1CEEA 4AWXA 2E75C 4IEIA 2GJSA 4POGA 3QBTA 4UPAA 2BBTA 4LFBQ 1TQ2A 1Z7TA 2CNWD 2K5UA 2O0HA 2P3SA 3S2DH 1VG0B 2UU9L 2FOLA 3MGCA 3CMEA 5HTKA 2W58A 4B71A 3G0HA 2O5IC 4DNIA 4PFSA 2ATWA 4LZZA 4IFDG 1X6OA 2RHDA 4HAXA 1ZM4A 2Q3MA 2Q2UA 3ETLA 3SOPA 4P4SA 1YR6A 3J7A5 1TWAH 1NBMA 4Z1MD 3QG5A 1UKVY 2OE2A 2B3GA 1PYSB 1LS1A 4POFA 4GNXC 1G3IA 1WBBA 2VH5R 3I62A 1N5KA 4QBFA 4BXXH 3K0FA 1IBLQ 4A3GH 2HF9A 2PMDA 1X3GA 2JA6G 2RHQB 1A4RA 4DR4Q 3K70C 4AKIA 1SVWA 2O8FB 3VX3A 4GOPC 4RVCA 1WQ1R 3I4NH 4Q1BA 2ZJZA 2OSBA 1EESA 2ZRIA 1KAGA 3AVXA 4GKKQ 1R8SA 1RYFA 2VHTA 5DI9A 2YNMA 3B1ZA 3BJUA 1E2NA 4JVSB 1VDZA 1JJVA 1VYUA 4AG6A 1RYHA 5C18A 2QY9A 2HDNB 3OTOL 1Z6AA 3NEJA 4D82A 3TUIC 1KIXA 4E07A 4FXPA 1RW4A 1M7HA 4US0R 2CDNA 2ONKA 4I4LA 4NCHA 5EP4A 3HKZE 2GK6A 1XFAA 2RGEA 2RGNA 1GILA 3HOYG 1LV7A 3BS4A 2KBNA 5BWMA 4NYMQ 1KYIA 2JLUA 4F93B 4TQ9A 4C0KA 4TVAB 4KLNA 1VF5C 2XB4A 1VECA 2KBEA 5FL7A 1WCV1 3BB3A 1UBFA 3MG9A 3EQLC 4IFDH 2NVTH 3WBJA 2KCMA 2WP8J 4D4JA 2Z4SA 2AFHE 2G1JA 2IW3A 2BMFA 1IYUA 2YWHA 3QXSA 5AUNB 4CVNA 3A74A 1KK3A 4KBFA 2ZRMA 3KQHA 1S3OA 4MGKR 3W90A 5M3MH 3ADCA 2HEIA 3PO2G 2V4ZA 4NXNQ 3A36A 1H9JA 1KXLA 1UPTA 1VF7A 3K09A 2IYWA 3MCAA 4DT1B 4EAQA 4DV6L 3W3AA 1HNWQ 3HDTA 4A6XA 2A19A 4C2MH 2JA6H 3HU3A 721PA 5HZHA 3B1XA 1M8PA 2ZR7A 2QPOA 1KIMA 2QA5A 4OK5A 1YR7A 3QEOA 4TMTA 5JRJA 3GTLH 4AIIA 3GCGA 1DAKA 5L3QB 4HZUB 4G0NA 3OEHA 4TWZA 2ZRCA 1MKHA 4IPCA 2F43A 2RMKA 3BFXA 2QNRA 4TLAA 2NZHA 1PLKA 4EFMA 2O8BB 1KL9A 1KC8C 3THYA 1FMLA 5BYKA 2GCOA 2RGGA 4I1UA 4PHTA 2J0SA 1G8GA 1DXMA 1G3RA 2QAJA 5JS8A 2GILA 1H9SA 2O8EB 3N70A 1AIPA 1OH5A 1KRTA 2GAAA 2IYSA 1Z06A 2ODEA 3HOYH 2Q6TA 2A68D 5JFGA 1RL2A 4PTLA 1E9RA 2VQEL 1DBSA 4GKJL 4Q1CA 1N25A 4P3YA 2VQFL 4H1VA 4RCYA 2JE6I 2Q9BA 1ETUA 4IXMA 4NKRA 3RSOA 4GL2A 2O8DB 3CNOA 1KAWA 1DAEA 1S1MA 1SXJE 2UXBL 5KYKA 1YZGA 1G6HA 3CQZH 3EX7C 3DKPA 2Z0MA 3L7ZC 3CZPA 3CC7A 1KSJA 3CF0A 1EQQA 3Q85A 1LFDB 1HY3A 3V00A 3ND8A 2BM1A 2REBA 2RGDA 3EG5A 3FYHA 3SBEA 4A36A 3A0JA 4V0KA 3B6EA 2IUUA 1R0XA 4AYTA 3PO2H 1E9FA 1ZD9A 1US8A 1MKYA 2YC2C 4A75A 1NMYA 3T5GA 3SYKA 1UWVA 2V8OA 3FHOA 4CEJB 2WMNB 3GLHA 1Z5ZA 1E4VA 2QE7D 3CF2A 1F2TA 1OXXK 5DE3A 2ODBA 4FCVA 1TUIA 1TEVA 3IHLA 5EP1A 1MABA 2ZVQX 2QSZA 5HPYB 3BH6A 4MGIR 4B6FA 2K14A 2QQEA 1ZC3A 3JVVA 4S35A 1VQKA 4LCBA 2K7VA 4HEJA 3ADBA 1Q3HA 1XDBA 3KKOA 1ONBA 3BJIC 4KJZA 1X9NA 2N49A 2JLZA 2VSFA 1XXHB 4OI0A 4JC0A 1W4CA 5M04A 2Q0HA 3RAPR 3U60B 5C0XJ 2KCCA 3Q8XB 1U98A 1W36C 3FFAA 4JBWA 2CE7A 1FGUA 4OYHA 4LHZA 3AB3A 4DIDA 3FP9A 1Q1ZA 5TVKA 1E2HA 1N36Q 5JBQA 1SVKA 1U0HC 3H15A 5KPDA 2J0VA 2BDOA 4B44A 2P5TB 1E96A 1Z8FA 2YZ2A 4P71A 1XTIA 4ILEA 1L1OB 2ZI3A 3FB4A 1G3QA 3GLGA 4MRSA 1L8QA 2CXXA 4YCWA 3TVTA 2QSYA 1KRSA 4TTRA 4MDEA 2JLWA 2GTPA 1P2UA 1R7RA 4JBMA 3ND9A 1P6XA 2EQBA 1Q7YC 3U3RA 1TF2A 3CR7A 3LX5A 2C98A 4IDOA 2BMEA 4ITRC 3DHWC 4Q9LA 5DNYB 4LHYA 1SXJC 4FINA 4HATA 2ZI7A 2F4VQ 5KOYA 3OYYA 1Z0DA 4AQYQ 3TS2A 2NG1A 4BLOA 4URXR 3HGBA 1YZKA 3AEVA 1N33L 2IS4A 1JR6A 4P32A 2ALYB 2WKRA 4Q03A 3CW2C 4N0DA 4YMSA 3RRYA 2QEQA 4OI4A 2F6RA 3GJXC 2CL0X 2VP4A 2DWPA 4PMWA 4Q7JB 1GKIA 4QBIA 3SYNA 1QG2A 4E03A 3N6RA 2QBYB 3PQCA 1XJQA 2RKOA 1NL3A 3IHWA 3K80C 5JEAJ 2L5TA 1K3RA 3IBYA 2ZTCA 5L3RA 4GDFA 2NN6I 4RCNA 2ODWA 4L16A 4V0NA 5LD2B 3S1AB 1SULA 3SJAA 1QF9A 3LNCA 2A30A 2J45A 1HT2E 2WKPA 2XTMA 3GLIB 1LB1B 3UATA 4EPWA 1N8RC 1S40A 4JT2A 1CJMA 2F1MA 1RJ9B 1NMFA 2H18A 2QGNA 2GJ9A 4LHXA 4JLAA 3TSOA 2NMVA 4H0LC 1KDPA 2GEVA 2YU9H 2ZI6A 1N32Q 4X64L 1SVOA 3ICEA 1X6VA 5BW8A 4MDFA 2MO0A 1JAIA 4A4DA 5K8TA 2AFIE 821PA 3B6YA 4JI5L 1G6PA 4HAZA 4M2LA 5LB4A 2VUMG 4GMXA 2PT5A 4DR5L 3QVVA 2PX0A 1AM4D 2UVQA 1ZVQA 4ASUA 4DK6C 2I1QA 3G6EA 5BYJA 2F55A 1O78A 3ULJA 4R98A 4PQRA 4PC6A 2F3IA 3VFDA 3I61A 1H9KA 3R7WA 4IJMA 3K8AA 1GITA 1CJKC 1YU9A 4OX9L 2Z6KC 1YVDA 2FXQA 2UKDA 5UKDA 4ACAA 221PA 4B3RL 1GTVA 1NLZA 4G3XA 1JE5A 1FQKA 3KXLA 4F4CA 3I5XA 5F3WB 1GZSA 4YMVA 2FEOA 3L82B 2GHIA 4GLXA 2N78A 2IA5A 4DSUA 1ZIOA 3K9GA 4LC1A 5FPKA 4YHHL 4LF8Q 1OH7A 2XNSA 4LYHA 5AJXA 4GN4B 1KO5A 4DV0Q 3CONA 3L8ZA 1VQGA 4IVPA 2CL6X 4DLYA 1JJ2A 4LF5Q 3I92A 4NCKA 5J4KA 4JV5L 4W5HA 1P7CA 4DDWA 2KSQA 3HJNA 3LA6A 3PF4A 2PJZA 4E22A 5FLMG 2EXDA 4LV5B 2UXCL 1JJGA 2LKDA 2OBLA 3CCLA 4O2LA 4BY1G 1FP6A 3PFIA 4B3MQ 1X3FA 3QENA 1SROA 2PCFB 3STBC 3M4YA 4LF7Q 1D5CA 1S9HA 1Z0AA 5IDVA 3CB4A 5KUTA 2D74A 4YLGA 3J7ZC 1E4YA 4D0GA 1QHHB 3DMDA 2IHFA 4M1MA 2H7VA 4IOLA 3KL4A 1ZC4A 2JEBI 1GM5A 3BH0A 4HDOB 2E2HH 4B6EA 2GEDA 4D4KA 2OCAA 3C14C 4FIDA 4A2QA 1WRBA 2VA8A 2VUMH 2I4IA 3JVUA 2FJUA 4QGUA 4DV3L 4Q4AA 4URWR 4E09A 2B7CA 2ZS8A 2BH8A 5JWHA 3H0GG 1OJLA 1ODFA 2FEMA 2GCNA 4TL8A 2V7QA 5GADl 3RN2A 2VSOA 3UWKA 1G291 3HOVG 3OAAA 3QXHA 5IK2A 4ZPXA 1U0LA 1JB1A 4X66Q 1A62A 4LFCQ 4HJ9A 2FZ4A 2O0KA 1GRNA 1G9XA 3T53B 3OEED 1XD8A 2OESA 1D8LA 1XNQQ 1KI3A 1YR9A 2QRNA 2KCTA 3AUYA 3Q5EA 3DXJC 4H02A 2CLCX 4IOMA 4QC2A 3F5FA 2ANBA 1DO0A 2ATVA 3S16H 1VCMA 3WNBA 4KI0A 3T1QA 4DV1Q 5J4VA 2X2EA 4DNTB 3PUVA 5C4XG 1E1RD 1X56A 2EFEB 2QN6A 1P2VA 1HZCA 4RZ2A 1BBWA 2A69C 1Y1VG 2F1RA 4PQYA 2B8WA 2P6RA 5FLMH 4RFVA 3PV0A 3WDNA 5JEDA 3SYLA 2A78A 3WHLA 4JIMA 1HTPA 4BY1H 4YONB 4LW1A 1IYJB 4GZLA 2F3TA 1N5JA 1NE3A 1QG4A 3PVSA 1SHZA 2Q9AA 1AE3A 4KKSA 3AP1A 3NIBA 2BH2A 4JBJA 1CJTC 3W3ZB 1NVUQ 4AIMA 1U8ZA 4CYMA 4PO9A 5DSZA 2B21A 4L5QA 1OFUX 4GNXB 4LF4Q 2ZETA 2O52A 4UKDA 3QKSA 4C3JH 4DR2L 1DTSA 4MA4A 4NYIR 3DZDA 4TL6A 4QNMA 4H1UA 1YZQA 2HJGA 2ZR9A 3H0GH 4JG2A 4B3SQ 3B78A 2PMKA 4KSCA 1HZ9A 1GNRA 1KMHA 2OFXA 3IGFA 4OQMA 4AKEA 3U44A 4DDTA 1UE5A 4GOPB 4HIDA 4IPDA 3HOVH 2KWIA 3PIRA 5LBIA 1UKYA 4BEBA 4WZBE 3CX8A 2KHIA 3NG1A 1VQEA 1NBWA 1ZAKA 1T5LA 1YQTA 3Q9LA 4C30A 1PUJA 4IPHA 1M7BA 3TKLA 3CM0A 4LGMA 1PA6A 4PR0A 1X8JA 3KQUA 1K8GA 1U90A 1IOZA 3K0SA 4Q9HA 1YZLA 2ZSAA 5KSZA 4QKQA 3OFNA 1NMXA 5AR1A 3BH7A 3FWYA 3SR0A 2MQHA 4F4IA 5C4XH 2A1AA 5HGQA 4KBGA 3PUZA 2HHHQ 1R5NA 1OIWA 1PH8A 3GTPH 1CKEA 2I5MX 2Z6VA 1Y1VH 4B33A 2W2VA 2OFOA 1KNXA 3LLMA 3W5JA 2CE2X 4U02A 2HCJB 3HOUG 1CS4C 1XPUA 1VG9B 3J81i 4A2WA 4R4IA 1C0AA 3CNLA 3EW9A 4UP7A 4HAUA 3W6PA 3J80i 1U8AA 5LMNQ 2RGCA 4U7DA 2BE5D 2C96A 3DEFA 5FOWA 2PJRA 3WMEA 2ZUCA 4N3NA 4D80A 3BB1A 2Q2IA 1R9TH 1TQDA 2X77A 2NZOA 2XEXA 3BERA 1W4RA 3ZQJA 1G17A 1UAAA 1E7ZA 4L5TA 4IKEA 4A1FA 4O0AA 1KI1A 1MJEA 1NN1A 4GZMA 3LW8A 4A8JA 1GUOA 5EZ5A 4G7HC 2ZRJA 4PC3A 1NIJA 1W2GA 3I4LA 4H13C 2G83A 2E74C 2Y0SE 1JPJA 2KBFA 3EZ7A 4AKGA 3TQYA 1IN4A 1IBKL 1IXZA 1PUIA 2C78A 3S1RH 1EFRA 4APVA 4CEHB 2QTHA 2R7ZG 4LBWA 2PQAB 3RRMA 3TJZA 4A3LG 1ZNYA 1JJ7A 3TVDA 2O8FA 4Q19A 5FUWA 4LWCA 1NJIC 1DE0A 1T3LA 3UDIA 4JBYA 2EYQA 1OHHA 2WOOA 3QKRB 4DR6Q 4QFMA 4QL3A 4PO8A 1L2FA 1PYBA 5AWFC 1DADA 4EFNA 2ZYWX 5LB2A 3CPFA 5IP9G 4KFRA 4FDBA 1MOZA 1RE0A 1P8LA 3VKHA 3CRLC 1XNRL 2FPMA 3FMCA 2AR7A 2HXYA 4LV6A 4A3FG 2D2CC 3H94A 1E2JA 4C7OA 1RRFA 4D0NA 4JLBA 1W4AA 3M4QA 3VDYA 2QAGC 1XD2A 1Z0JA 3EZ2A 2PH1A 4HYYA 2WHXA 4LJ4A 4JI8Q 1E32A 3GDEA 2R8RA 3C16C 3KDFB 1E2GA 5SZIA 4HJAA 3T1HL 4PPQA 2DFKB 3QNUA 5L3SB 3BAFA 1R5OA 4BGDA 2XZOA 4YCVA 2VEDA 5EE1A 4HLDA 4QY7A 2KHJA 3CIOA 3LW7A 3KYHC 2Z4RA 3LFUA 4QGHA 4A3EG 1M74A 1XCGB 1GIAA 1VQPA 1TQ4A 4R7ZA 4PXAA 3WNDA 4A82A 3DM9B 4UXIA 3MD0A 1EWRA 1OSNA 2QMHA 2EW1A 3CR8A 4N0EA 3CH4B 1AGRA 1CJUC 2J1LA 4RD4A 1UEIA 1P5ZB 3GTMH 3H1TA 3GLFE 2UUAQ 1WBDA 4MYTA 1YHNA 3THXA 3K70D 2ZJ5A 2K32A 4BBRG 1GUNA 2PCLA 1E9CA 3B9PA 1YJ5A 2R7ZH 3P32A 1H95A 2IYZA 4D4MA 4A3LH 4UP9A 2ERYA 3B85A 3D31A 2ZEJA 1CU1A 4AK9A 4EKDA 1XMOQ 4JI0L 3LVQE 3M6AA 4B35A 1CR2A 2YC4C 4HZUA 1OV4A 4FMBB 2ZRNA 5IP9H 3KLRA 4BZPA 3B1VA 3W5IA 4B3BA 1OXSC 4LF9Q 2K5NA 3L0IB 1FX0A 1Q21A 1Q0UA 5F2EA 4A3FH 1W36B 2GZHA 3GJ3A 3KXKA 1KDRA 2K5VA 2FSIA 4YC7A 2ZJ2A 5CYPA 1II8A 3W9YA 3DMNA 3B5JA 1VQNA 2VP6A 4R71A 1NBME 1SHKA 1U99A 2K33A 3UE0A 4AYXA 2E9SA 4BFVA 1ZU4A 2J0UA 3H4MA 4A3DG 3CCSA 4M9SA 4LHWA 3BE4A 5EE0A 2H5EA 2PZGA 1WCMG 1N3BA 1H9MA 1V9PA 1VG8A 4G5OA 4LBYA 2VP0A 1G5PA 1GUGA 3BRWD 2BBWA 4JI3L 1E1TA 1TF7A 3CLVA 1G6OA 2JLVA 4CW7A 2ZROA 3B82A 4LV8B 4EJSC 3KF8B 4UP8A 2QL6A 3T1YQ 1ESNA 4A3EH 1SXJB 2IYQA 4HSEA 4NTZA 2N1BA 3SEAA 2IHEA 2WJVA 3QSYA 2GJAA 4E5UA 3GPLA 1NI3A 4BQSA 2DHRA 3CC4A 1GUSA 2JEAI 1O3YA 2JIZA 2B6HA 4IFDI 3P20A 3UWOA 3BOSA 3THWA 2CJWA 4DDUA 5GADC 5KNDA 4KHZA 1CXZA 1E79A 4IDNA 4DLXA 4TQUS 4PC7A 4KLKA 5E7MA 3WYFA 4HJ5A 3E0EA 2G3YA 2NGRA 3DLLA 4BBRH 4YY3Q 3Q7QA 4CEIB 2FFHA 4LDJA 2HCBA 1R8QA 2F1IA 3CBQA 1KJYA 1UBCA 3MMPA 5K8IA 4DEYA 1IONA 1IXRC 1UE7A 1ZM3A 3K9LA 4G5RA 3FKSD 2YWEA 1KSGA 4CF7A 3SGIA 1BYIA 3E2IA 3EBEA 4C0QC 4DUGD 2GXUA 2CEAA 3K53A 1Y3AA 4M1WA 3KF6B 4XWKA 2V4DA 5FPHA 4LJ8A 2FPKA 4LC0A 1IN8A 2AN9A 3CPJB 2IX3A 2HT6A 4C0AC 1KHTA 1MIUA 1VQ6A 1G4AE 4JBXA 2H5XA 4HLUC 2DPXA 4IOKA 4JI6L 4JLDA 3U4QB 4M1SA 1ESMA 2JGNA 1HR0L 5D3QA 1NP6A 1U81A 4A3DH 2FDCA 1VQ8A 1WCMH 1AKEA 2BOVA 2KE5A 2W2XA 1Q1QA 1L1OA 1Q3TA 2JA9A 4IVRA 3BFKA 5HCNA 5JI2E 1AS2A 4JYCA 1B23P 1DS6A 5IWAL 2KJQA 2ZJ8A 2DR3A 3CUEF 5KTYA 2PNRC 1L4UA 2IYTA 3DZ8A 2OM2A 1IN6A 3SJZA 4TSFA 3TW8B 5IE8A 4MUAA 2IYYA 4RY2A 3UG7A 4DUZQ 2FU5C 4B47A 1EXMA 4BFYA 1OXTA 1NN0A 4LBZA 2K5HA 3G48A 2WMOB 2EQSA 3J81k 1KO4A 4L5RC 4PZ8A 1W0JA 2ZJRA 1TUEA 1ZM2A 3IEVA 5FTJA 3ADDA 2D62A 2GESA 4YXWA 1K73C 3BU2A 1PLJA 4TT3A 5JRZA 3M4PA 3LDAA 4UNSA 2F7SA 3SC3A 5FFMA 2LSSA 2WAXA 1SKYB 2WOJA 4C2UA 3FHTA 2H8KA 4DUYL 4ZCLA 5FBWB 2Q9CA 2YTYA 1Y8NB 4ON9A 4KFTA 3S14H 2V9PA 3ZJYA 4GN3B 3CCMA 1I5FA 4X8OA 5A5GA 5CJ2A 2WPDD 2UU9Q 4M1KA 4BLRA 2I5LX 1H65A 5K8LA 4DK3C 1QVFA 5M5WH 1NRJB 3KTAB 3QPWA 121PA 1Y1WG 4HIOA 1OKKD 3BXZA 1Q22A 4M9QA 1VYTA 1KKLA 2CLDX 5FTLA 2Q2TA 2RGNC 3VR5A 1UE6A 2MSCB 1GVPA 1N5LA 1XB2A 2OILA 3ZIAA 1SGWA 2Q8IB 3EPHA 1W36D 2H57A 2ZSDA 4FCTA 2QF7A 3TEHB 1KDTA 2JJQA 4W9MC 1Z28A 2Z83A 1S0UA 1YI2A 4JKYA 1IHUA 3ZS8A 1P73A 2AD5A 3BORA 2ZRBA 4V0MA 2QENA 4LSGA 4RD0A 1AA9A 4OQNA 3CF5A 1GL7A 1FR3A 5TY0A 3RRZA 3TW4A 4XSGA 4P33A 3O8CA 1FW6A 3EZ6A 3GLHE 2BKUA 2DN8A 2D0PA 2AWNA 3S15H 4HLUA 3KFUA 2GETA 1OIXA 2GJ8A 1SXJD 1S4QA 2C2HA 1NIPA 3K81C 4W5WA 1E3MA 4DAMA 1W2HA 3K09C 3R8FA 1GP2A 1SN8A 3LQRA 4BZQA 5GJVC 4DB4A 4LUOA 1CIPA 4B2LA 1ZMXA 3OTOQ 2CK3A 2WIAA 2OQKA 2JA1A 3G5UA 4HDQB 1YZUA 5GJCA 1CFMA 3TUJC 2PT7A 3ZZUA 4TYNA 2J7PD 1XJVA 1BBUA 2RHSB 1Z07A 3RC8A 1YE8A 1NKSA 1K0RA 1Y14B 2FPLA 1SMYC 4PG3A 1VQHA 2B29A 3RABA 1JR3A 5F9HA 1H8HA 2BJWA 2L15A 1DAMA 2FSGA 2X19A 4WW0A 3F3YA 2AKYA 4Q1FA 4OQXA 4NMMA 3GJ7A 3PCOB 5TDHA 4OO1G 4QIWE 3QIAA 3WMFA 3VR1A 1P2SA 2RAPA 3RRNA 2WFWA 2WSSA 3U4ZA 2PLFA 3HOZG 4F92B 1IY1A 1Q44A 3KJGA 2NO9A 3L2OB 1NSFA 3SHFA 2AUKA 2C95A 5CM9C 1NLFA 1GHKA 3K0AB 1JAHA 5JJLA 1X1RA 1YEZA 5EE3A 2DNEA 3AYHB 5EUMA 3GLGE 1YHAA 2ORIA 3FMPB 4RZUA 3V9PA 3FVQA 3TR5A 5JHHB 2PPBC 1HTWA 1XTJA 3SN6A 2GEUA 3FOZA 1MV5A 2ODNA 1GKUB 1TWHH 3RDPA 5BN5A 1Z2CA 4A15A 4YWMA 4DV6Q 1GWNA 4P4TA 4JK1C 4P75A 4TQAA 1J5EL 3JC66 1IY0A 3QPUA 4B73A 2PEYA 1RFLA 4HB2A 1BMFA 4LRWA 4P72A 4Q5IA 1QUQB 2ZM6L 4MITA 5ELXA 1UDXA 4KCGA 5GAHC 1G16A 5FOXA 3UMFA 1ZNWA 4B34A 3LXRA 3NE5B 4X62L 4DEXA 1PFSA 1VQFA 2R7DA 4D2IA 4R4QA 2AKWB 4DCSA 4HLQB 1P75A 4ZI3A 4MKHA 4A93G 1FJGL 1D2NA 4S2EA 1OXUA 4DK1A 1I94L 3AV0B 4OL0A 4Q4HA 2ZSEA 4Z8YA 2JATA 2QORA 1F48A 3A37A 4B3FX 1Q8KA 4PSVA 3W1BA 1W1WA 2IYUA 4BY7G 3QE0A 4GT1A 1VQLA 2H16A 5IYBG 4BFWA 2VQEQ 4DCNA 4GKJQ 3G4SA 1E2ZA 3K9NA 4IFDJ 4KXFB 1IJEA 1D2EA 1VS0A 5TARA 2VQFQ 3SQXA 2VS1A 3DM3A 4PZYA 4QHTA 4A3MG 1BKBA 2NIPA 3KX2A 3HOZH 2UXBQ 4DR1L 5C4JH 5M5YH 2FNAA 3HP1A 2DFLA 3K7AH 3STBD 2ZQ5A 1ANKA 2WTUA 4CT4B 3ZVMA 2RGXA 3REFA 2BMDA 1VKJA 1II9A 3X2SA 5C44G 5J4LA 1T6NA 5CJPA 4BECA 2XGJA 1E0JA 4FMDB 4JS0A 3I73A 5HKKA 2P67A 2ZRAA 1KNQA 2RGAA 2JQOA 2WBLC 2GZDA 3MXNB 2L0XA 2R93G 4XVRA 1WDTA 5KNBA 3IRBA 3QXCA 2A5YB 1D9XA 2P0EA 3AVUA 1G7RA 4C0HA 3ZYCA 1QVRA 2XNDA 1DG1G 2A6HC 3QKTA 1W0KA 2YINC 3K1JA 1EGAA 5KNCA 2PZEA 4IQZA 3QXXA 3AB9A 3GTJH 1JNYA 4PX9A 2ZTEA 2CFMA 1CKNA 1YVCA 3VQTA 5LMUL 1XMJA 3GP8A 2O8CB 1W47A 3L2PA 4GP7A 2EFHB 2ZTDA 2ZE5A 4PPFA 4BFTA 3I8SA 3HOXG 4ZO4A 1V43A 3VR4A 1E3PA 4A93H 1UKEA 2DFNA 2XX3A 3AKDA 3MJHA 3PITA 1J7KA 4Z51A 4QJ4A 4URYR 1JB7A 1HEIA 1XEXB 4TYWA 3A58B 1FTSA 4KVAA 1TL7C 1UEJA 3M85A 2H92A 4BY7H 4ESHA 1N34L 1XMIA 2QAGB 2ZJOA 1G64A 4JI7L 3EA5A 5IYBH 2A69D 3WNCA 4DCTA 4LJZC 1Y63A 2IF2A 1UBEA 2RGBA 4WIAA 3IQXA 3CF6R 2MMCA 4FMCB 2ZJBA 1GRQA 4XWAA 4LUVA 3AVYA 3X1XA 4KAXA 2W6JA 4R4TA 1KMQA 4KU4A 1O87A 3PXGA 5JSZA 4L5BA 4C4PA 1YRAA 4C0JA 5C44H 2LXJA 1X1SA 2C03A 4B32A 1TWFH 3NC1C 3NBZC 3QQ5A 1N33Q 2JDID 4PZZA 4DCVA 1FQJA 1KI6A 5GROA 4PC1A 3LWNA 4TTPA 2R93H 4M8NE 4RKFA 2EWWA 3A1UA 2PNHA 2V3CC 5ELNA 4XD7D 1MO5A 4Y0AA 1M7GA 3FTQA 2HQLA 1NG9A 3VX4A 4PPNA 1TAGA 1S3GA 3CP0A 5M5XH 1GJXA 3EARA 5FPSA 5EXPA 5IT9c 1E2QA 4HUQA 5E4FA 3FPPA 5G40A 3WWVA 4DR7L 3BWDD 1X8KA 2IF0A 5CYOA 3NWJA 4MUBA 5HR5A 3T61A 4KHPL 1AS3A 1J90A 5J5CA 4PZ7A 1F6BA 1OYWA 3QJYA 1QRAA 3HOXH 2JJ2D 3LBNA 4EPXA 1H8EA 4A0HA 2HXSA 3A1TA 3U3KA 1FL0A 2R6CA 1O7IA 3CCQA 2W00A 3LV8A 4PAQA 1KK2A 4X64Q 5F98A 3AVWA 1YR8A 3IILA 5ANRB 3U58A 1TX4B 4LJ9A 1GKYA 2QGZA 5CDFA 4JI5Q 2HIVA 1DAGA 4DR5Q 3P4YA 2ANCA 1HR0W 4M53A 2YOHA 2FFAA 2ZRHA 3C5HA 4KFSA 1R0YA 3A4NA 4C3IH 1T4GA 1TTTA 4B74A 2ZRLA 2XTIA 3KQKA 4AC9A 4MYUA 1T9HA 4P0TA 3MWLA 3SBDA 3AP3A 5FOSA 3VNVA 1SVMA 3WMGA 4GZYC 4ME3A 4OX9Q 2DFTA 5DN6A 4EJSB 3P27A 2CCZA 2VRWA 1A8VA 4B3RQ 4BLQA 3MAAC 3B1WA 2AHOB 1E69A 1XF9A 3DM5A 2ZRPA 3T5DA 2HIXA 2Q3FA 4PC2A 4DJTA 2GBLA 3UPUA 1F2UB 1TU2B 1PJRA 3QEJA 1A0IA 3A4MA 4YHHQ 4JLJA 4TL7A 2JK8A 4D81A 4F4JA 2WJGA 5EZ6B 2GA8A 1VQBA 1EFTA 2IS2A 1HE1C 2OLKA 1S2MA 3B60A 4LJ6A 2J9RA 1X3EA 4A3IG 2KA7A 4JV5Q 3LQQA 2XXAA 4DV2L 2ZI4A 3GLFB 2MFIA 1KOFA 3JZAA 3KKQA 5DI3A 1YJNA 2WWWA 3T35A 1NTGA 2UXCQ 4IJLA 1Z6YA 3OIWA 1XJ0A 1AQUA 2BM0A 2CBZA 3ZGXA 4FWTA 1E98A 2VTKA 3ZDQA 3FHWA 2FX3A 5GQOA 3ICQB 4HAVA 2WM9B 2IS6A 4ZV4A 2JJ1A 4Q4JA 2FE4A 4II7A 5TMPA 4GOKA 2G6BA 4OK6A 2D7CA 3NBHB 3UDFA 2FF7A 4NXML 3BZKA 1Z29A 2CLSA 4WJ3M 3TSZA 3UXMA 3KXIA 4A3CG 5FBLB 1MH1A 5FUYA 1YNJC 3BFVA 1E2VA 3B13B 2B8TA 3O8BA 5CITA 1UF9A 1ZM7A 1K9MC 1HH4A 4DV3Q 2DBYA 3PO3G 4DAYB 4NCJA 1PH5A 4YDSA 1MO4A 3TMKA 1WMSA 4B2IA 1COWA 2CHQA 3I1FA 1KZ7B 1EQRA 1K5DA 3A8KE 5AJVB 2F1HA 5FBQB 3QVUA 3RLNA 3L43A 4D25A 4M1TA 1AH9A 1F5NA 4QG7A 2NOAA 4GSYA 4LJAA 3SU8A 3V4RA 2R9VA 1GKHA 2CNWA 2JJ8A 1BYUA 1JQLB 1SVLA 2HUPA 4ZIRA 2YOGA 8OHMA 3IO5A 1SRUA 3TBKA 2OWOA 1HT1E 1OPXA 1I4LD 1GUTA 3M3YH 4QQBX 2REXB 2ZI9A 4NYJR 4ZCIA 3CO5A 3C8UA 4QNRA 2WJIA 2AXPA 4BFXA 3F2BA 1KY3A 4LYAA 4IOCA 4Z1MA 1PH1A 4MQBA 1NVVR 1ZINA 3NDBB 1FPMA 1YRBA 1U2RA 2JLRA 1VQIA 1FTNA 2WIBA 5AUQA 4A3IH 2QPTA 2WICA 3VTKA 2B7BA 4Q02A 1J8YF 4ARZA 621PA 4C3HH 5CB8A 2X1VA 1E6CA 3B8HA 4URZR 3FGNA 4AY2A 1HJPA 2HLDD 3TE6A 1D2MA 1IBML 4PANA 3W6OA 2GNOA 3VAAA 1RIPA 1M6NA 1N6OA 3IUYA 4GP6A 2QP3A 4M0LA 4RKEA 3EWSA 3K0CA 2IBMA 4O2RA 1IM2A 5KDLA 1HQCA 1CUKA 2QROA 2PI2A 2RH5A 3M0EA 1ZUIA 3SJBA 4DZZA 4A9AA 2VYFA 4EPTA 1N2CE 1W44A 1ZCBA 4YMUA 4O3MA 4OBEA 2E2JH 5B64A 2XOKD 5KO2A 3RHFA 4A3CH 3CKLA 3GEIA 1I2MA 4XVUA 2BA1A 2FZLA 4DR2Q 2QUZA 5IF9A 3S1QH 1OT3A 3PO3H 2WAQG 5H1YA 4M9ZA 4W5JA 3ULLA 4BZXA 3U4QA 4ABYA 1GNQA 2EJFC 3AUXA 2IWRA 4C9BA 4DV4L 1HNXL 3L0OA 5EUQB 5JI3E 3M7NA 4TYQA 3WBKA 3NBXX 4IFEA 2CKZB 4MKFA 1JEEA 3RC3A 2WAYA 4NB3A 2QEXA 4DKAC 2PEZA 5G3ZA 4A8JC 3IKJA 5IT5A 2NN6G 4MYHA 1HURA 3PF5A 2AD1A 1W4BA 4LYJA 1Q1BA 3A8TA 4JL6A 5K36G 4RFSA 1EG7A 3AKYA 4L4UA 5DYGA 2ZU6A 1AK2A 3UIEA 4B3XA 1CR4A 4AURA 2EFDB 5H68A 2DNCA 2W6IA 4I1VA 5DGXA 2R6DA 5H1SE 1MR3F 2VIIA 4IOJA 1IW7C 1LTQA 1JJCB 2IEZA 1CTMA 1E94E 2UUBL 5IRCD 3FMOB 3K70B 1HNZQ 2X2FA 4XTCS 3DL0A 1LUZA 1KY2A 1N0UA 3THYB 4U00A 3IFTA 1WA5A 2G0NA 2GCOB 1GUAA 4EQ6A 1EYGA 3T56B 1G5TA 1EUJA 4Z8XA 3BK7A 2OO7A 2ONJA 1H9SB 3VKGA 4PPGA 1TKWB 2HV8A 2OCPA 2FV8A 2OHFA 5FOVA 4UNPA 3VU9A 1U9IA 1Z0IA 3TSWA 1P4SA 3C41J 5JECA 2NO7A 5CLLA 4D6PA 3EC1A 1TADA 3DPUA 3GJ5A 2IT1A 4MRPA 2OZEA 4TTQA 2GRJA 3VHLB 3P4XA 4V02A 1SE8A 1ASYA 1EK0A 2OV2A 2ZU0C 4R9UC 1E1QA 2ZM5A 4NL4H 1A6XA 1NVXQ 1JQJC 2G1KA 1A2KC 2CCJA 3ADKA 2C8VA 1HNZL 4BE7B 1NBMD 3R9IA 5A4JA 1L4YA 1IBKQ 3LAWA 2GXAA 2FA9A 4AD8A 1IJFA 4ZDJA 2FGJA 3RS4A 4A0RA 1V1QA 4KV9A 1VQJA 4LFAL 4Q18A 1CSQA 2A5DA 2JAQA 3LRPA 1HQYE 2YYZA 3NEMA 2VP2A 3GLHB 2NN6H 3LNNA 3CCEA 2E5LL 1TQ6A 2FH5B 1VQ7A 3QF7A 3QY0A 4OHWA 2QT1A 4CT5A 3KB1A 1BKDR 2GVZC 3AQQA 3H3VI 3TR0A 5K36H 3EPKA 1MABB 3FE2A 1ASZA 4IJHA 1QHYA 1S9DA 1ZNXA 1XNRQ 4Q7LA 3U2QA 1RPZA 2NO6A 4MKIA 1VQMA 1E9EA 4DR3L 2IXFA 3CRW1 2R6AA 1XEFA 2IX0A 2F3RA 1D8TA 2RF4A 3ZLJA 3CCRA 1VTKA 3AKCA 4I1OA 2YV5A 2JEOA 2GVAA 4YWLA 2PCJA 2QE7A 3WHKA 2VQSA 3JAMc 1B70B 3T1HQ 2JA5G 2NVXH 1U8YA 3I55A 1NJFA 1MT0A 3CCJA 4EPYA 5CK4A 3LWUA 3U50C 3HU1A 4R2HA 3AM1A 4JYAL 4DSOA 5JCPA 4RMFA 3RSLA 3EAQA 5FTMA 1KSFX 3T1VA 3X1ZA 5JMTA 3FKQA 1YKSA 4W7SA 1Y8PB 3GD7A 3SDZA 4MGZR 3AFQA 4X65L 2EVWX 3EPJA 1KI9A 4KN7C 1JI0A 4URVR 3VMFA 3GLGB 2AL7A 2N8NA 1E1OA 1LF0A 3EPLA 5FL7D 1DPFA 4G7ZC 4UNRA 1NG1A 3NELA 3ZVLA 2WZQA 2IY5B 2OBMA 4LF6L 1EWHA 3HWSA 3LH5A 1IN5A 1AKYA 4OHVA 2O0JA 4DV7L 2JCSA 2QU8A 5G3YA 2VL6A 3ZD7A 3HOUH 1GHJA 1NN5A 4Y52H 3DOFA 3HU2A 4EDHA 4GN5A 3EN2A 1E2DA 4JJKA 2XGTA 4V03A 5FR1A 2VO1A 1QUQA 1FOEB 3KJIA 4JI0Q 5DISB 2HYIC 4FW9A 1E0KA 2ZJYA 5TXGA 1BOFA 2NVQH 4MRVA 2AMCB 1K5GA 5BN3A 2YTXA 4GRAA 5BXQC 2A9KA 2VHJA 4GI7A 1C7YA 1I2DA 3GFOA 3U3OA 2VP5A 4CDGA 3TAHA 4BFUA 1CTQA 5GVRA 2QA4A 2QM7A 1XJCA 1LACA 2PMZE 1NY6A 1L0WA 3QF4B 5D3MB 2WWIA 2ZRDA 4NDZA 1YNNC 5SZHB 3OOCA 1E9AA 3EASA 3I3SR 3OW2A 3OEHD 1EFWA 3U3JA 4DT1A 2B8GA 4KO8A 1G3UA 1YHQA 3AKEA 2F9LA 2IWHA 2PL3A 2JA5H 1DEKA 3ZVRA 4WOPA 3RWMB 4G5SA 4EX5A 3PR1A 2IYVA 2D0OA 1R5BA 3TZUA 1Z0KA 3U7GA 4D4LA 4ESVA 4JI3Q 4V0ME 2PX3A 3BDOA 5BN4A 2C99A 5JEEA 2A5JA 5L3QA 4JLVA 2BCGY 2VPPA 1LVGA 2QMUA 1XD9A 5IP7G 5BR8L 1UADA 4YMTA 1W0KD 2O8BA 2VSXA 1L1OC 2FFBA 1MO3A 3AGQA 3HOWG 4JI1L 1P9RA 1J99A 1Q57A 1TF5A 3BD9A 3KKPA 3QUSA 3KJPA 2OBNA 1FYCA 3DOEA 3IPXA 4GS3A 4JI4L 3J81j 3A5ZB 4G7OC 4LWZA 3R7WB 2O8EA 4JKIA 2ORWA 4URUR 2JLXA 2BKEA 4NONA 4DIEA 4NYIQ 3I2ZA 4IO9A 4X6AH 4UNQA 4HUTA 5C2JB 4DV5L 3T06B 1KK1A 1YBYA 3CX6A 3GJ4A 2O8DA 1XZQA 4XH9B 2Q2HA 3DVLA 4Q7KA 1JR3E 1CI3M 1A1VA 1S1CA 4D26A 3MRSA 2E76C 3EZFA 3NBYC 2XZLA 3MFYA 2O8CA 4DLUA 3S24A 4QJ3A 3TGPA 3CZQA 4XIGS 1WOCA 3ZJYC 1W46A 2V55B 2BIFA 2ZYVX 4IRUB 2W83A 4PAMA 1BH2A 1JECA 1UEBA 1ELOA 4K0KL 2UXDL 4B3TL 2OCBA 4BFSA 3AGPA 4TMXA 2Q3HA 1SZPA 5GAGC 2FFQA 4JI6Q 4PSAA 1E2IA 2MMGA 2QT0A 4CEJA 4L9WA 1HR0Q 3ASZA 3GFTA 2VNUD 1VQCA 4JOIA 1GL6A 5EXTA 4QGGA 2UZIR 3KKMA 3VR6A 5KHOC 4LHVA 4R4OA 1A63A 2DYKA 1VQAA 2P6NA 1ZNZA 2OLJA 2PZFA 1E22A 3S2HH 3A1SA 5IWAQ 3KUDA 1XMQQ 1PHJA 4DHEA 4KN4C 3ULPA 1Z9FA 1W2BA 2ZRGA 4JSTA 2I5HA 3E9HA 1AZSC 4HLCA 2WKQA 1X54A 3AVOA 1E2MA 2N46A 5IP7H 2NZ8A 4NYMR 4EIWA 3PEWA 4IFBA 3D0FA 1XXHA 4DRZA 1VQ5A 3R9WA 1A5TA 4RSGA 4NE2A 1DG3A 2YWFA 3HOWH 4KFUA 1YNXA 2ASBA 1S3SA 1QJOA 2OXCA 1NMGA 2YVUA 3FMIA 3GMTA 1N6HA 1W48A 2OAQ1 3IPYA 1WI5A 4U5XA 3RVBA 4DUYQ 5FTKA 4OWTB 3T15A 5GVSA 2CCGA 2A6HD 4MYCA 4JZKA 4TLBA 3UK6A 1DGSA 4OHXA 3ZD6A 1UDWA 3C15C 3GEHA 3EXAA 2YJTD 3LBIA 1DELA 2DB3A 2ZS9A 1RIFA 1XMQL 5FPTA 2CQOA 1XRJA 5C4GB 4DVGA 5HY6A 4NCIA 2GJKA 1DCZA 1UJ2A 4UJ5A 3WY9A 1KD1C 1G5RA 3K0XA 3QPVA 4HDCA 1Z47A 1XPRA 5ELOA 4OJQA 3TNFA 3ZS9A 2DGYA 2J5XA 5DH9A 4QM6A 5C46F 2FG5A 5FOTA 1GNPA 3KJEA 3NHBA 1HA3A 3CCUA 1N6KA 3H84A 3OEEA 4JMPA 1ZW6A 1JXOA 4ZDKA 2LXKA 4JVLA 3BBPA 5B2ZA 5C4MA 4BLTA 3SFZA 1PH2A 1T3HA 3EIVA 4OJKA 1WJJA 4GPTA 4JI2Q 2ZJQA 5L3VA 3ER0A 4X8MA 2QBYA 4FMDF 1XNJA 1QVGA 3GQBA 4OXPA 1X55A 1E1RA 1LYLA 3IIJA 2CVHA 4A3BG 3S1AA 1KHIA 2UZ3A 1XTDA 3NBFA 4QM7A 1LY1A 1SKQA 1FZQA 2JASA 3NHAA 3QKSB 4POAA 1GRRA 4V0OA 1NKTA 3GLIA 5A0FA 2B8FA 2A8VA 3NEYA 3RLFA 1EIFA 3MSXA 1ZBDA 1RJ9A 1IZ6A 4ASUD 3U44B 4GMDA 1KMHB 3NC0C 2AHOA 4YWKA 3NXSA 2GVDC 4YMWA 2A6EC 5DLQE 1F2UA 2ZYTX 3BC1A 3GJ6A 3KFVA 2MSDB 3AF3A 4JLMA 4JI2L 4RJLA 2DCUA 2BBSA 2OXRA 4DLVA 1VQ9A 4QHYA 4BFZA 5FPYA 1FUKA 2NZJA 4FWIB 5A35A 2XTNA 1M90C 1FNMA 1GSIA 2W2TA 1OH8A 1HUQA 2IUTA 5AJ3L 3AVQA 1G20E 1IBRA 1YHBA 4KYIB 4PSKA 1G8PA 1J6QA 4LI0A 3TLXA 3Q8DA 3ZZ0A 5KDOA 4LOAA 1RRPA 3IO3A 4LY6A 3CX7A 4PV1C 1G41A 2VHUA 4PHHA 2WB1G 4JVNA 2CHGA 1OB2A 1EFCA 4M1YA 2QG6A 1G7CA 3E5HA 4I99A 4TMKA 2QP4A 4BWYA 3D8BA 5E7NA 2PLRA 1J5EQ 3CNNA 3IEUA 4TMWA 4F91B 5AJWA 5FR2A 2AXNA 2IYLD 2P65A 4KMUC 2WV9A 1VYVA 3RZDH 2XJ4A 2ZM6Q 2K75A 1YITA 1Y1WH 4A3BH 4PAOA 4OI1A 2R44A 4LJ7A 3NKVA 5CB6A 3RYTC 2P5SA 3RNUA 2P6UA 4X62Q 3MJRA 2GF0A 2ZRKA 4A8JB 5M3MG 3LXXA 1GAJA 1I4TD 3SFVA 5JS7A 3SJCA 1FJGQ 4XSHA 3I4MG 2XSZA 1XTSA 1I94Q 4P73A 5IYDG 2V7QD 1QHHA 4FD2A 3OAAD 5IK2D 4WJ4A 1T5IA 2ZANA 4LFBL 3HKSA 5EQTA 5IHPA 3PGZA 1K8MA 2D06A 2IL1A 5EXSA 4A0GA 1WYDA 4ZI2A 1CKOA 2G77B 1CLUA 4BLSA 3L0SA 5DLQC 3K9HA 4JT4A 1I6VC 5JCZA 3KOJA 5DO9A 4G1UC 4OWXB 1BS1A 1I50H 1QVCA 4JBKA 3ZH9B 1KK0A 1B8AA 2C77A 4DR1Q 1VQOA 2OEPA 4FI3C 5CDFE 4MZ9A 4C7OB 2YOFA 3O8RA 1LABA 2CWPA 1KI4A 1RVDA 4XJXA 1FVIA 5F9FA 1NVWQ 1XD2B 5HE9A 3X1WA 1NY5A 1ZD8A 3T1TA 4QJ5A 3UMSA 4XTRA 1IBLL 1J2JA 3E70C 3HYRA 2GDJA 2E2IH 5C1BA 4LNQA 4DR4L 2GZAA 3OESA 3RZOH 4C0SA 2RCNA 4NZYA 3KUCA 2V1CC 3GJ0A 4O2DA 1LF5A 1N6NA 1HZBA 4RD3A 5IYCG 3LD9A 3WRXC 2FGKA 2GK7A 4GKKL 4OO1H 3B2EA 5LMNW 1XMSA 2K52A 1WF3A 3LGJA 2I0QA 1XEWX 4L9SA 4DCUA 1QDEA 1X8LA 3K8YA 2GN5A 2DWQA 5LMUQ 4IPGA 3CMAA 1LNZA 3AF1A 1J70A 3KDSE 2W6ID 3A5UA 2ZAMA 1II0A 2ATXA 3W5OA 3A8JE 2XAUA 3I4MH 3THXB 1EX7A 5C0XG 2OUKA 5IYDH 1C1YA 3I72A 1F3OA 5AK0A 4EQ5A 5DHFA 3RS0A 1EOVA 4AYBG 2IXEA 3ECCA 1K83H 4HZIA 1G8FA 1XTRA 4LYFA 4TLEA 1IY2A 2LWIA 2Q21A 1IN7A 2EJGC 1G51A 4GNXA 1N34Q 2HYDA 1M34E 2BC9A 5HZKA 4JI7Q 2BA0A 3HPQA 5FTNA 2NVYH 2EU8A 1DARA 1AZTA 1XTKA 5FOUA 4GLVB 3PIOA 5JWRA 3OFND 3W34A 1XMVA 3E1SA 4JL8A 4TMVA 2WWYA 1LM0A 3CRMA 1FX0B 4GOPA 1X86B 2QP9X 2FN4A 1E1QD 1II8B 4L8GA 4NXNL 1E9SA 4F7WA 4C2TA 3QBVA 5EAYA 4TYPA 1TPZA 3U5ZB 4IXNA 2J0UB 3SE0A 1HNWL 2D4HA 1TNDA 3OHMA 2JLQA 4Q4LA 2C9OA 3EIQA 4KVGA 5HE8A 5J4HA 5LPNA 1FMJA 2PBRA 3T34A 1JT8A 1DAIA 1Z0FA 3GTQH 3H86A 5IYCH 4CZ2A 4TZ0A 5JEAG 1K8AC 1JPNA 2GF9A 2MNAA 4QHSA 4I7ZC 1N9WA 3PEVA 3A8IE 4A3MH 1KAOA 4UNNA 4C0LA 2JLYA 3M1IA 1E2FA 2ECKA 3WYGA 3VR3A 4QL5A 1CULC 1WE2A 2GBLC 4DBLC 4DR7Q 3THWB 2DY1A 4CRWB 3MWJA 3TRFA 2CJWB 3BIFA 3I8XA 4JLNA 5GAEC 1WFQA 4KHPQ 5FBRB 1JEDA 4UJ3A 4DSNA 4Q66C 3WXMA 3RN5A 5E7IA 1YZNA 4L15A 3OF5A 4K8OA 5JLJA 2ZRFA 5C0XH 1L2TA 2HF8A 2VL7A 2ZR0A 3GTOH 3Q7PA 5GJWC 1EFRD 2E87A 2BWJA 3VHXA 5AUPB 1UE1A 3K7UC 2BBOA 3TIFA 3A1VA 2O5JC 1QHSA 1A2BA 4DLZA 1OHHD 1IW7D 3AFPA 3UDXA 2D7DA 2EJMA 2PI2E 1P16A 2H1LA 4OK3A 2J41A 3EA0A 1I3QH 4P74A 3GTKH 5FI0B 1ZYUA 3I7FA 1PH4A 4DLTA 4JCVE 1G4UR 5JWOA 5H70A 1PH6A 4H9GA 4YQFA 3AVTA 1D6JA 3HKZG 2O5VA 2HJVA 1OH6A 4CEHA 3EIHA 4Q01A 2PQAA 1KSHA 1E9DA 2XZPA 2IUSA 3D3QA 4IDHA 4PZLA 3H2YA 4MNOA 4X8HA 1E2KA 1ONLA 5C3EG 1VCIA 3P1JA 3FKSA 1HH2P 3QKRA 4QGFA 4Q9KA 3U9SA 5EP2A 3UMRA 4BEJA 2VW9A 1VCOA 4IDPA 4DUGA 3BG3A 1YJ9A 3BB4A 2HT1A 3TK1A 1XP8A 3CPHA 1MJCA 1KO1A 4M21A 1GFIA 3IDQA 3CD6A 1EFUA 3W6NA 2VF7A 3AF2A 2P2LA 2WWGA 1N6LA 4NP6A 3CPWA 4B75A 3U6BA 5JEAH 1VG1A 5FJ8G 3GJ8A 3NENA 3B1YA 4JYBA 2QGQA 4PQFA 3NDPA 1KI2A 4DV2Q 1E2PA 1T0JB 1TEXA 4GBMA 3K0EA 2WWFA 3TUZC 3OE7A 1HPCA 3KDFA 5P21A 3I5YA 1CRQA 1M1YE 3OIUA 2AK3A 4B43A 2WAQE 2WJJA 5AJYA 3Q5DA 2KENA 5L3SA 3PUYA 1SKYE 4TN1A 3ZQ6A 1OLOA 4M1OA 1R10A 1NN3A 3S1NH 2TMKA 2Y8EA 2C35B 3CRVA 1N36L 3OPOA 3T1OA 3AEZA 3OW7A 3U7HB 2LKCA 4R2IA 1P9WA 2GKSA 4EPVA 3F8TA 1OFIA 2CHVA 1TWGH 3PENA 4NXMQ 1P72A 3C5CA 3TS0A 3QOFA 2R2AA 3EWAA 4EFLA 1TMKA 3QF4A 4IOAA 5D3MA 3NH9A 1U94A 5FH9A 1TU3A 3REGA 2QTVB 2IEYA 3OZXA 3K0CC 4QBGB 1NNEA 3FKIG 1ZD1A 2J87A 3U4VA 5CIQA 1EFHA 3TH5A 1P61B 3UDGA 2F4VL 2VP9A 1XBTA 4AQYL 5M3FG 1KO7A 2W0SA 2C04A 1G1MA 1TU4A 2F1JA 3LY5A 1MO6A 2WPDA 2ERXA 2QM8A 4OKSA 5C3EH 3U6KA 2J46A 2FWRA 1Q46A 1N0VC 3LX8A 5DYIA 2OQ0A 1OKKA 2K50A 2GCPA 1TWCH 3C4JA 2NPFA 3EZ9A 3AVVA 4JJZA 2CWAA 1CR0A 3I4OA 3OIVA 1C9OA 1JXMA 1W5SA 2D3WA 2R65A 2GWHA 3CRQA 4BLPA 4LUZA 4M22A 3AVPA 4BPBA 3B7GA 3BGWA 2RB4A 3I32A 3DDCA 4GFDA 5KDDA 4A3KG 1B7YB 1G21E 1NJGA 2ID0A 5FJ8H 2V1XA 1IAQA 2B92A 2ZT9C 1R0WA 4H44C 1QZGA 2IHYA 1KQSA 4P4SB 1Q86C 5KU1A 5H8WA 2JIZD 1EWIA 1XZPA 3RLOA 2OAP1 4MGYR 4B3DA 4OONA 3M9BA 1IBMQ 1E79D 1WB9A 2A3RA 1B0UA 3KJOA 2AUJD 1KGDA 3L0PA 4I81A 5AUOB 1N32L 4Q9IA 5J4YA 3K0FB 4PHGA 1QZHA 4LK2A 2A5FA 2EDGA 2IHBA 5B30A 1SXJA 4QRHA 3W1GA 1EX6A 3MEFA 1UFQA 3ZVNA 1EIYB 3UANA 3T12A 4OHYA 1P60A 1X3SA 3PIPA 1CKMA 2WVJA 4DKXA 4FN5A 4BUJA 3PUWA 3CW2A 4WVFA 5J40A 3JAMi 1K8OA 1PMRA 1Q82C 1SVSA 5IY0A 4ZDIA 3RS2A 2J7PA 4QJFA 2V6JA 1E99A 2BV3A 1GOTA 4Q7MB 3FKIH 2X8AA 5EE5B 4KKUA 1P62B 1HZAA 1U9IC 3THOA 1Q12A 4DV4Q 1HNXQ 1KDOA 2F9MA 2BEKA 3IIKA 4A92A 4Z54A 2G9NA 5M3FH 5JZVA 4CEIA 2QQ0A 3KB2A 1OXVA 2ZTSA 3KQLA 1E9BA 4L5SA 4UY8C 4DXAA 1BDOA 1C4OA 1G18A 4WA7A 1LTLA 1E2EA 3N2IA 3Q3JB 4Y0VA 1T5EA 4LF8L 4US2R 4UXJA 1T0HB 4DV0L 1N6IA 4RD1A 1FUUA 5EJEA 1QHIA 3KF6A 2FSHA 2A68C 4LF5L 4JLPA 2ZJPA 2WJHA 1Q90A 4A3KH 1VIYA 1IYVA 2OG2A 2IYXA 4TSFD 3SZRA 2EFGA 3TQFA 1DD2A 2NO1A 2AX4A 2UUBQ 4B3ML 4N1AA 4D0LB 2VHQA 4LF7L 2N42A 4ZKEA 4O0MA 1W0JD 1BIFA 3FPAA 1IXSB 5B57C 1CF4A 4YXWD 1M2OB 1QHXA 1ZKOA 2ZPTX 3AH8A 3EIEA 4JL5A 4Q4HB 4TT3D 2J7KA 3ZZTA 3I56A 1NSTA 4Q9JA 3MXUA 3VR2A 3CWZA 2NTYC 1Z83A 3V4FA 4OQLA 4C3ZA 1A82A 2IS1A 1PH9A 4JSYA 1MRNA 521PA 4WBSA 2ZS7A 1KKMA 2Z6KA 1T91A 4O25A 3RS5A 5FBVB 4CGZA 3TRZA 1KJWA 2GXSA 2ORVA 2UUCQ 3AF0A 4B48A 3CAMA 3RR5A 1CBUA 2YTVA 1OYYA 2WSMA 3RANA 3BZCA 2NQ2C 1W7AA 1OTCA 2K4KA 1E24A 1Z6XA 3HFZB 4X66L 1XCPA 2F43B 4LFCL 2V54A 3ZIAD 2G88A 4JVMA 1OF1A 4OQFA 3W8NA 1BVSA 2BEJA 5E95A 3GO5A 1XNQL 4LFAQ 3CXCA 1QZXA 4KKTA 1T8UA 1VPLA 5E7JA 3KTAA 4G01B 4Q21A 1HQMC 5SZKB 5KPJA 3ERSX 2E5LQ 3LO5A 3SHWA 5J3BA 4DV1L 4US1R 1CR1A 3HPRA 1CP2A 1JALA 2IC5A 4NU0A 5G53C 2UUCL 1R4AA 2ZI5A 3WYAA 4XOIA 5FLXc 4BBSG 3WP0A 2VZAA 4BASA 5TB5A 4MTNA 4DR3Q 4UXHA 3PSIA 1RZ3A 1Z08A 2CL7X 4GNKA 1CKNB 1PV4A 1OIVA 4XWOA 2JLSA 1KI8A 3HR7A 2C5LA 1G3MA 4DNRB 5JJIA 2C9CA 2CK3D 1WP9A 2IXGA 3CRKC 1PH7A 3WRYC 4DWJA 5B58C 3D7MA 4KSBA 2ZSBA 1RKBA 4QXAA 1OE0A 1US8B 3ONWA 2C9YA 3DO6A 2ZUDA 1LS6A 3DKVA 4JYAQ 3F1ZA 4RZXA 1FL9A 2IYRA 3A6PC 5JJKA 2XJ9A 2NPIA 4LF4L 3GTGH 1F2TB 1E2WA 1H8HD 1JR3D 1SLJA 3S1MH 2R6FA 3MWKA 4WXPA 4KITB 4X65Q 3O47A 1Q81C 3CC2A 2GAOA 3AF4A 4Q1AA 5G41A 3RWOA 5SZJA 4I1SA 4RCZA 4B3SL 4K81B 2WSSD 2H17A 4ZCMA 1ZUNB 2IK8A 4UQOA 1CJVC 2ZSFA 1V8QA 4LF6Q 1AQYA 2R62A 2E8GA 3U3MA 4AKHA 4Q48A 2R92G 1XXHE 1XPOA 4HB4A 4DV7Q 1FP7A 2D2FA 5JSZB 2QMOA 3U7FB 1RRCA 3P26A 1LW7A 5DHAA 4OHZA 4EUNA 3SS8A 2JA7G 4TZ6A 2XSZD 1K8RA 2YKGA 4ZKDA 1GG2A 3UG6A 1KI6B 5K8UA 1DAHA 1KTVA 1S96A 2BMJA 1S72A 3PCRB 2G0TA 4WZ6A 2E1RA 2ES2A 3KLWA 5EXXA 1P3JA 4QBHA 1R6BX 2ZE6A 2RHMA 4A2PA 3K0AA 4HAYA 2HHHL 1HCZA 1BMFD 4RZ3A 5CM8B 1ZYRC 1UM8A 4BBSH 3VA7A 2J59A 2D5DA 1P2TA 4K46A 4OWWB 1TXYA 1E2LA 4DLWA 3SQWA 4OI2A 3PEYA 4NYJQ 2A6ED 2JDIA 1XCMA 4HUQB 4JLKA 4QGAA 2VF8A 3A4LA 2ZXUA 1U5KA 4XVQA 4GOXA 4BRUA 1Z6TA 2OCEA 1U0JA 5LMNL 2AKAB 1NVVQ 4XD7A 3MUFA 1NMZA 3UE1A 3N2EA 1HYQA 5FUVA 1K6MA 1H9RA 3VKWA 1SR3A 4YDHB 4AG5A 2GVBA 1VQ4A 2F52A 1G7TA 1W49A 1NF3A 3X1DA 1JMCA 2FSFA 3R9XA 1Q20A 4TLCA 1A7JA 4B76A 2J0QA 1SQ5A 2BHRA 1S8FA 5BR8Q 4HJ7A 1DVRA 5L8VA 4JOIC 3CCVA 4OGQC 1VHLA 2JJ2A 2VBCA 3SI7A 3A1WA 5EE9A 4JI1Q 2JA8G 1VIAA 2OFWA 1OW3B 4Q47A 4TLDA 1ZCAA 4Q1EA 2J3EA 2EFCB 2OCYC 4JI4Q 1V5WA 2BVNA 4PO1A 3GLIE 1P9NA 3LVRE 2QTFA 2R92H 4PHFA 1CSPA 4DK0A 1I6HH 2AWOA 5J47A 1KI7A 3KKNA 2ZREA 4DR6L 1T8TA 2JA7H 1YZ6A 4PZ6A 1G7SA 2CVFA 5HKKD 3VNUA 4DV5Q 2CMKA 4LUCA 4KODA 2N3SA 4KYUA 2BJVA 5HCIA 1X65A 1WXQA 2AK2A 4QOSA 4AYWA 1AJEA 2GXQA 2ZE8A 3D6TB 2XTZA 1Z3IX 3AQ4A 3LLUA 4F38A 2Z5FA 4Q1DA 4B3GA 2EYUA 2XNDD 4A0FA 1Z63A 1YZTA 1O7LA 4FCWA 4IHQA 4J0QA 2XB2A 1DAFA 3MLEA 3PG5A 1Y8OB 2XXAB 3FFBA 1N0WA 4NPSA 2YWGA 3O8DA 4R1JA 2WWHA 2I3BA 4JI8L 3ASYA 5DI3B 2EIFA 4K0KQ 2UXDQ 4B3TQ 3U7EB 2LCFA 2V1UA 1VCNA 1GDDA 5KSPA 4TYYA 4B3CA 2SHKA 3IQWA 2JXMB 3QI2A 4M9XA 3M4OH 1UBGA 2Z0SA 4IW3B 4MKGA 4NPHA 4WZAE 2DUDA 4HI0E 1NLYA 3QG1A 5CLQA 4DC9A 3NH6A 3NTUA 1D9ZA 4Q4JB 1XX6A 3EC2A 3PUXA 4LPKA 2QRZA 1Q1EA 1ZIPA 4G5GA 3R20A 2KB0A 2ZUBA 1KZGB 5AJZA 3R8CA 2NO0A 3TREA 4WXRA 4A3JG 4B2PA 1DO2A 2FMXA 6Q21A 1FNNA 1R2QA 1QBKC 4Q00A 4C0BA 3W8RA 2R7FA 2UUAL 1KJZA 4EPRA 3KZ1E 4R4CA 3OIYA 4BA2I 2JA8H 1VMAA 3CWQA 4YCUA 3A7LA 2W6JD 2ASEA 5LD2C 2B63G 1XEXA 3AP2A 4X8LA 4NBSA 1Z6HA 5CIWA 4ZIRB 1BO6A 1GD7A 2QAGA 2WB1E 1VQDA 2YHSA 4LJ5A 1XMOL 1XEWY 2ZJAA 3B9QA 1Z2AA 3FHCB 5TV2A 3TAUA 4DLRA 3J81c 3UKDA 3CPEA 4MRNA 5KSOA 1Y69U 1G8HA 4NCNA 2OTJA 3J80c 4HIMA 1AS0A 4LF9L 1FFHA 1OFTA 4HAWA 2Y0SG 4HR7B 2QPAA 4WAUA 3KQNA 4M4SA 4OO1I 3NVAA 4Q4AB 1QHGA 1XU4A 3MWYW 4LK1C 2IX1A 4TL9A 1UKZA 1G19A 1G8YA 1N6RA 3WP1B 3F0TA 1EWQA 3F2DA 4HIKA 2Z43A 2LMCB 4IDQA 4L8JA 4ZDWA 1PH3A 4ARZB 4V0LA 5KSYA 3RS7A 2QMEA 3A7AB 1MRSA 2CCKA 3KFXA 3TQCA 1RC8A 1B9NA 1AGPA 4EJSA 3Q72A 4HJ8A 3IBGA 5E3HA 2REOA 1H8ED 4J15A 3HR8A 1Z6GA 2ZAOA 3U61B 4DSTA 3T1YL 4DPGA 4DDVA 3C7KA 2OT3B 1PZNA 1W3SA 1YJWA 4HB0A 1ZUHA 4MH0R 1IL2A 5CK5A 1JBKA 1SMXA 1PVOA 4A3JH 1R0ZA 1W5TA 4A76A 2HLDA 1SFOH 1QHNA 3FDIA 1OB5A 1E0SA 4DB2A 3T51B 3N5CA 2ZVPX 1AE2A 1XTQA 1PLLA 3HYTA 5EP3A 5BQ5A 3OE7D 2WWXA 4YY3L 3D4RA 1D7QA 1Z22A 2XITA 4JLOA 2B63H 2V6IA 1M1KC 5GJBA 4A4IA 3QXJA 1XWIA 2XOKA 5DN6D 3IIMA
chains in the Genus database with same CATH superfamily
4EGSA 2NUPA 4J1NA 4NFSA 1PNOA 4P4NA 2XWJB 1CRPA 1T3SA 3PXDA 4GU5A 2BDTA 1PXUA 2A3NA 3SNHA 1HV8A 2ZYUX 5D7NA 2VYCA 2X76A 4IVQA 2MSEB 4BNLA 2X14A 4Z9YA 4P31A 2EWVA 1GVNB 2ZBFA 5ISRA 1CQXA 4AG3A 2HU8A 4GOJA 1X3QA 4ERNA 2FFJA 2J4FA 2QRQA 2O5IC 4Y2VA 3C2PA 3FTDA 3MTBA 3CURA 3HY3A 3MOIA 4CMJA 1MORA 3GCZA 1S2NA 4HMQA 3P0RA 2ABWA 3FWZA 2BFPA 3ZHOA 1E2NA 2C2YA 3ZGVA 4RIFA 2BKXA 3TUIC 2CN1A 1URPA 2J08A 1TA9A 3IODA 5EVJA 1NW7A 2WYWA 2FJ0A 5JD3A 3F96A 4CM9A 4V2UA 4D3DA 3EQLC 1SB9A 2J6IA 3NOOA 3ONFA 2K87A 1UCFA 3N28A 5I9IA 1CVLA 4DR5B 1AKUA 3PGXA 721PA 1YKGA 3OOYA 2QPOA 2Q4OA 1NUUA 4UZSA 4TUYF 1PIWA 4YHHB 1PLKA 4P58A 4LSWA 3HKEB 1KERA 4IEFB 3W3AH 3R5XA 4GKJL 4EB3A 3NDRA 4NKRA 3CVOA 1AHIA 4NFHA 3DKPA 2Z0MA 1UJMA 1HY3A 5AKYA 2FPIA 5BVGB 1FIUA 1R0XA 1QYDA 1YFKA 2GQ0A 2BD0A 2IZ0A 1X9IA 1JFFA 3G2IA 3WOEA 2C88A 3KKOA 1VE9A 1XXHB 2E4VA 4B44A 4P71A 1XTIA 4XW2A 1FNSA 1C9EA 4HTFA 3MXPA 1L8QA 1XLTC 4PRYA 4YCWA 4MIEA 3M2PA 2VQDA 3A4IA 3U3RA 1OVGA 5KOYA 4BY9E 4PCVA 4UEKA 4Q03A 1KFEB 4FYYA 4PHCA 4DAVA 5EHGA 5H9WA 1N7HA 5WRFA 3IBYA 1IU9A 2ODWA 3NSWA 2J0EA 2DSNA 3RV3A 4HNUA 4GPZA 4JLAA 3WV4A 2RKBA 4M0KA 1SUFA 1IBSA 2AFIE 4Y2HA 2DJ5A 5LQJA 2OR3A 1NM5C 2H4YA 4U68A 1H9KA 3ILSA 3RTDA 4WBNF 3KG2A 2NXEA 1TWHB 4X3CA 2C0PA 1PEKE 1ZHHA 3H87A 5J4KA 1JIVA 1YZVA 3QVLA 3E58A 2LKDA 3TRKA 2P9QA 1X7ZA 1LSSA 1K4KA 3WOHA 4Q3LA 5FNZA 5JLAA 4M1MA 3B52X 3NPAA 1LO5D 2OCAA 4Y30A 3JVUA 3N8KA 3K5NA 4B0OA 2V7QA 4F9TA 3H9UA 3OZUA 3ABOB 4NFYA 2ANBA 1XLWA 1XNHA 3O94A 1QRUA 2CSUA 3H13A 4RZ2A 1GOZA 3HJHA 3T7AA 4GW3A 4U0JA 2I3ZA 5AHKA 2C9BA 5F51A 4I8DA 3PQDA 3WKAA 4C5BA 1AE3A 1B43A 2BH2A 2PZUA 2B21A 5EMLA 3LK6A 5KTPA 3OIFA 4KSCA 3B78A 4DMHA 4R69A 3IKLA 5LBIA 2RH8A 4BWGB 3ZCRA 1T5LA 1YQTA 3WFZA 3K0SA 4HOYA 2IL8A 1QCBD 3TZDA 2G9UA 5K51A 5ICMA 4KBGA 3OY7A 1U6KA 1VP9A 4U02A 2HCJB 4JOCA 4HH4A 1C0AA 1I2AA 4PEVA 2WHEA 1NF9A 5ELMA 2GK4A 3I2IA 1W8IA 1K6EA 4JI6B 1UAAA 2JIRA 1KFCB 1KI1A 2V96A 1W2GA 1JWBB 2KBFA 3Q12A 5LLSA 4HZGA 1ZGBA 3UDIA 4XD2A 4PO8A 1JT2A 5AWFC 2ZYWX 1D1SA 4DUYB 3O3CA 1SKUA 2AR7A 3P9KA 4PVDA 4A3FG 1E2JA 1OAKA 1S89A 1W4AA 1OGYA 4YP1A 4PLFA 1RRKA 1E2GA 4BCCA 1R5OA 4RVUA 2VEDA 2OO3A 2J48A 3A3PA 4R7ZA 2XIWA 4U5QA 1U1IA 1CJUC 2FETA 3BTVA 3PNQA 2XR1A 1IDN1 1O6BA 3AHDA 4Q1VA 4RS3A 1TK3A 1V96A 2R7MA 2ZRNA 3D5TA 2OWEA 3L0IB 3DLTA 3VTAA 2GZHA 2VA9A 4YC7A 2K5VA 4UUPA 5J58A 3NHMA 3JD2A 3UAWA 3UE0A 2P2DA 2E9SA 2J0UA 4IN3A 2BFDB 3ETJA 3C43A 3EISA 3BS1A 2XB9A 4UP8A 1NUQA 2I07B 3GPLA 1NI3A 5EYPA 4C9BA 3WK5A 4DLXA 4ER6A 3OUZA 3E48A 5CM2Z 2FFHA 1B15A 5ISMA 4DEYA 1QAQA 3OCZA 2PSFA 3GZTB 3C5WP 3UXEA 2VCYA 4C0QC 1Q14A 3PFKA 4OLJA 4TXMA 4GR9A 1BSVA 3G5TA 3BXFA 2XGGA 1E8NA 2P8SA 4ZOBA 5FLKA 5D3QA 1T10A 3RYIB 1U7TA 2DFPA 2ZJ8A 3HB5X 5CUQA 1QO7A 3OLCX 3OCJA 1EXMA 2K5HA 4FHGA 3IEVA 2D62A 4P3PA 3RT1A 2YHBA 4TT3A 1BHSA 4GLJA 3BHJA 5FBWB 1Y8NB 5LMUB 1ET6A 4M1KA 4AZWA 4L76A 3LCVB 2AI1A 4C20A 2DUUA 3NAMA 3LPDA 3MGBA 3C7CB 1P9LA 3PI6A 2FPPA 5JSQA 1FW6A 3I1JA 2GETA 2GJ8A 5G3LF 3PJFA 3R8FA 3K09C 3FDXA 3LQRA 3DZFA 3OTOQ 5IVPA 1CFMA 1M2FA 1ONNA 5IJAA 3QLVA 2HA5A 1NKSA 1YUMA 1H8HA 5CW1A 5B4UA 1CUDA 3VR1A 3CTPA 3FFTA 1B14A 1A95A 1NSFA 4QMGA 4E12A 5JHHB 2VQ6A 1EEXB 1TWHH 2CV0A 4AY4A 3D8NA 3FGPA 3VPSA 4XDYA 4LXXA 4HB2A 4O2AA 1HXYD 3IMFA 1JLLB 3H8SA 2WIDA 5B6PA 1H22A 4X62L 2RG1A 1PFSA 1FDOA 4KIUA 5T6BA 1ZL2A 1O9HA 1VQLA 5IYBG 2QYSA 4I36A 4LZWA 3DM3A 2AEFA 4D42A 4MINA 3NETA 2YWDA 2XQFA 4A3SA 5CDYA 1JFSA 1II9A 1KEUA 3X2SA 5HKKA 1NONA 2L0XA 3AO0B 2DPHA 4Q4CA 1PVDA 3PMFA 2PZEA 2ZTHA 4YR9A 2VAPA 4S1VA 4HFMA 1IDOA 3VR4A 3MJHA 3R76A 4URYR 2H92A 1L4MA 1J2TA 5KNCH 2F4IA 1NW9B 3LKZA 4FFWA 5EMJA 1SFOB 4LOKA 4C4PA 2L9HA 5FDFA 3UH0A 3ESYA 2C03A 3QQ5A 4DSAA 1IQUA 1BMDA 2WV7A 2OXTA 4FMPA 4BMCA 2PNHA 3I9JA 3K6SA 5LCXA 1MPTA 2ZBEA 1YCFA 2F1OA 2F0OA 4IXDA 5D8DA 3FPSA 3PR2B 2CC2A 4E14A 4GEKA 1G2IA 1DZIA 4GOND 2F0JA 3EJIA 1SC9A 5C8YA 2XOXA 3T9AA 2IPLA 1GKYA 3W8EA 3E27A 1A3CA 3DC2A 2FFAA 1FS4A 1M1ZA 2CXSA 4EJSB 3VU1A 2ZRPA 4K9RA 2H08A 1Z8HA 4O4HF 1JQEA 3PC7A 2JK8A 1HM5A 1ZVJA 3EUWA 4LJ6A 4Q82A 3H05A 1EBFA 3LQQA 5DGHA 1XL1A 3TRIA 2DH5A 2VTKA 1DINA 4ZV4A 3DE4X 2JBWA 3BZKA 4WJ3M 5ALMA 2X5OA 4QUIA 5FB3A 1B2LA 2ZB2A 2L18A 1CZWA 1GA1A 1F5NA 3V4RA 1BYUA 1JQLB 4FBGA 5T7BA 4ZOAA 3FEWX 2YOGA 3IO5A 1SJ9A 3V96A 4ZCIA 4GMGA 3ONVA 2H3EA 4DV7B 2IIBA 2FUG6 3N75A 3VOSA 3E1KA 2VAVA 2C29D 2X1VA 1YFJA 4E0BA 2FJPA 4PCUA 1M6NA 5E6UA 2FUEA 3DO8A 3OQNA 5KDLA 5KEEA 4ENWA 1CUKA 3WB9A 3WGZA 5GINE 2VYFA 3RIEA 1N0HA 5L7WA 2NVYB 1BW9B 3BXEA 5IF9A 1OR8A 4YI3A 2OXEA 4B4KA 2IWRA 1VQ1A 2B8JA 5CFNA 1TVKA 4IFEA 2CKZB 3RC3A 2VVTA 3WQHA 3IKJA 3HOYB 4MIOA 3DHQA 2Q62A 1P7ZA 2AQ2B 2EFDB 1MR3F 2KMLA 2UUBL 2G17A 3I4FA 1NHWA 2O3UA 3T56B 3QW4B 2H63A 1I9CA 3ES9A 3PSAA 4B3TB 1Q95A 1LDMA 3UO8B 4M8KA 1F8YA 5EZSA 1SE8A 2OV2A 3QPAA 3FDJA 1UWCA 3R9IA 4EJ6A 1IBKQ 3E6ZX 1OZHA 4H7PA 4A0RA 4XRGA 4KV9A 1S5PA 2FH5B 3QY0A 1G21A 3KB1A 2EHJA 3H2HA 2NO6A 3W5CA 1K27A 1WCYA 4XYOA 4JELA 5KVAA 1L5LA 5DX1A 4V24A 1TZKA 4R2HA 5AK6A 4YJHA 3Q8MA 2MJ8A 2J3LA 1Q50A 4M0EA 2E2WA 1IAVA 4IX1A 4Y52H 1MQ8B 1K68A 4G67A 4UE6A 5TXGA 3ZWYA 1MPXA 3ZNPA 1M2EA 4R1TA 3U3OA 2G67A 1PQUA 3LBAA 3OPXA 3OW2A 1A69A 1NPTO 5CX4A 2IWHA 2BHSA 2NAPA 5CR9A 4WOPA 3PR1A 2D0OA 2PZBA 3EFEA 1NQUA 4CF6A 1UJ4A 3PFGA 3STYA 5IP7G 4ER5A 4HNSA 4OFWA 1MO3A 1P9RA 1WHTB 4LWZA 1N2JA 4R9SA 4CL0A 4URUR 3PK0A 4BIIA 3GZNA 3DXXA 2ZIFA 3OU6A 4I50F 1RIIA 4N6OA 4GO1A 1SO8A 4FSDA 4ZQ3A 4Y2QA 3SYRA 2AW3A 5DN9A 1UEBA 2VDLB 1DP4A 1MQ9A 1QH1A 2PXHA 4LDZA 3WSTA 2UZIR 2YFQA 3LUJA 2G76A 2Y1FA 2P6NA 4UEOA 3UQZA 4CMKA 3ICOA 1A5TA 4GKKB 1TLTA 3DMTC 1UJ2A 4HDCA 3K0XA 4JMPA 3HOVB 4UTZA 3G88A 3S81A 2BSQA 1I1NA 1YB2A 3ER0A 4DVJA 2CVHA 4AY5A 2A9OA 1Z33A 2IH5A 2MSDB 3AI2A 5AW5A 1JFRA 5FPYA 3MTGA 1DONA 3E05A 3WOVA 3SSAA 5A7HA 2YIJA 1RRPA 1GUYA 4G1EB 4PV1C 4IUUA 1XRNA 1EFCA 1EPUA 3SHOA 1XZLA 3E5HA 2WJ6A 3ZU3A 3W7BA 1EB8A 2VJLA 4IICA 3P8ZA 2R44A 4MAAA 3EAFA 3RNUA 2GF0A 4A8JB 5BYAA 3M3HA 5B3LA 4MNTA 1V8OA 4FD2A 4F45A 3HKSA 3ZV6A 2OECA 4L8YA 1YB7A 3LDUA 3ZH9B 1HMYA 1KK0A 2C77A 4FI3C 1V9CA 4BV3A 3K5HA 1ESDA 3DEKA 4FZ5A 5A4IS 1J2JA 2E2IH 3S8MA 3KUCA 1N2CB 3H2IA 3TQSA 2O07A 4OO1H 5GTDA 3AF1A 4L4ZA 2EW8A 4IRXA 2FFRA 1P39A 1NGSA 3M8KA 5AI6A 5AK0A 3RS0A 4AYBG 3GRKA 1WB6A 2YRWA 4HH1A 2EJGC 3BJMA 1YE3A 4BMPB 2NVYH 4DJDC 1JVSA 4NOLA 3QEBZ 5JWRA 4JL8A 3WK9A 2GLTA 2NYVA 3TXYA 4FNMA 4F7WA 4YUZA 4RLSA 1QE3A 3EZXA 5C5DA 4RVGA 3FNFA 3HBLA 4BVEA 3EDYA 3HL0A 4DDMA 2JL1A 3A1VA 4GLOA 4J0KA 4MTLA 2EJMA 5K3AA 5CEFA 5CG2A 3D0RA 2PQAA 4ZMBA 4RJJA 3VYRB 3HB0A 1YI1A 2DAPA 3IAM6 4LRXA 3CPHA 4M21A 5KOHA 3RVDA 3VYUA 5ERGB 3ZK7A 4PFQA 1QSGA 3P9CA 1KI2A 2X5JO 1SD2A 1ZG3A 3I5YA 1FNCA 4TN1A 4FHCA 4KXMA 1EP1B 5ALDA 3CRVA 4DLKA 5H3LA 4YRSA 1Z74A 4QQRA 2XUFA 2W37A 2ZWAA 1SRRA 5I9MA 1Z4NA 2AYYA 2ID9A 2IEYA 3U0VA 4JGGA 4IMPA 2CFIA 3AIMA 4DJJA 5GGXA 1Z18A 3BE8A 2CWAA 2WF7A 4EYOA 3JALB 4OQZA 3DBOB 3B7GA 4I19A 5KDDA 3PF9A 3BGDA 4LNUA 4H7DA 1R0WA 1QZGA 5EZYF 4QYMA 4QUEA 4I81A 2LIVA 3E4CA 3RVRA 3N0TA 1P60A 2FW9A 3SIXA 4H7KA 1WB5A 3O9VA 4AUNA 3QFRA 5LLDA 2BV3A 4CM3A 1RXYA 1SUEA 3C39A 1PDWA 4CEIA 3IYLW 4OU4A 5JDIC 3J80A 1PJCA 1E2EA 3GPCA 1AMOA 3R3OA 5JNRA 1N75A 4YMIA 3CFYA 4YXWD 1RMYA 3MXUA 4DTCA 5H5JA 5JSYA 3SXUA 3G9XA 3F6YA 5JD6A 1F0NA 3CAMA 1CBUA 3VO9A 4NDNE 1R0RE 3TR6A 3HFZB 4RH1A 3PO2B 1VCHA 4NAVA 2EL9A 1F77A 5SZKB 4KN6A 2IOQA 2F64A 5IBPA 3X1JA 4UHKA 4B9AA 1MHWC 4EY4A 5JJIA 4FB5A 1PH7A 4GZ5A 3ONWA 5AH0A 2R93B 3HGMA 2E7ZA 3QE4A 3M1AA 4RCZA 5G0SA 5IAAA 1DTWB 2H17A 3H9GA 3ZE9A 4LF6Q 2VDKB 4ENUA 4JJIA 4BKQA 3DEHA 4XCXA 1OOEA 5K8UA 4CQMA 4LI3X 4DARA 1EQ2A 3VA7A 3WLJA 2PVSA 5FFFA 2JDIA 1XCMA 4QGAA 5CRIA 3HZZA 2AKAB 2R0QC 3BHMA 1NVVQ 2A5HA 3R3JA 1HYQA 1TIKA 4BDSA 3FGZA 3JVDA 1NRXA 3H97A 5FWXB 2HRBA 4KRGA 1C3XA 2XKKA 3WGVA 4DUZB 3JQ8B 4PHFA 3D6UA 1CSPA 3GEPA 4JSRA 3CBGA 1GJRA 4TKUA 3L8HA 1K1EA 3DMRA 5KNBD 2NNLD 2XTZA 1Z3IX 3AV3A 1JKJB 3DLCA 1CK1A 1XKXA 5G4KA 1K6XA 4B3CA 2B9EA 2DUDA 2CXRA 3M3YB 4RETA 4BPRA 1TUGA 4Q00A 4YJ3F 2ADOA 4EWLA 2OOSA 1JTVA 2QTRA 1EEHA 3ZY5A 3QH4A 3AP2A 1M1UA 1ULUA 3PKJA 2OA0A 5IT0A 2CDRA 3J81c 4XYQA 4E2XA 3TCNA 5BMOA 1C5KA 3AJ8A 3KQNA 5ALLA 1QGDA 2X9VA 1PH3A 3UHAA 2MWMA 4LS3A 4CI0B 4GEGA 4E13A 1BD3A 4J15A 5FF9A 1QFSA 3FLAA 4RA8A 1YJWA 1XX8A 1YVRA 3T51B 3N5CA 3AEKB 1AE2A 2V6IA 1M2JA 1WXXA 3NNNA 5ELFA 1RKXA 3GO4A 5IYZA 3MW8A 4Q4DA 4YLYA 4BNHA 3A05A 4RTSA 4KXWA 1JUDA 3DOJA 3T1NA 3NATA 4LX0A 2DWOA 1LQTA 1EDZA 3TP7A 4F2PA 4G1VA 4AICA 2JJMA 4UZEA 4NMWA 3GFPA 5AW7A 4ZCQA 4WESA 1GGVA 3KV3O 2DLCX 4AYBE 2MO1A 2JNWA 3O8LA 4AI6A 2C0QA 4ALPA 3EMDA 1T25A 5CB0A 1IXRA 5H80A 3KK7A 4DC0A 3MWFA 1LBSA 4OYLA 5I4DA 2EATA 1C8BA 3FZGA 7REQA 4REQA 3AM4A 3Q8LA 3ETLA 1KGSA 3FI0A 4Z1MD 2FRDC 1PYSB 1ZIDA 3OSUA 3GCWA 4RBNA 1IBLQ 2ACKA 2PMDA 1FRQA 1BVHA 3CV3A 4V1CA 1T29A 3HEBA 2ZJZA 1KAGA 5LQUA 2RJOA 3HFJA 1VDZA 1VYUA 4E70A 1RYHA 3IOMA 5FHQA 1L3BA 1QQ7A 4NCHA 3TFQA 2I22A 2RGNA 5C5EA 4QG3A 2JA5B 2ZYDA 3BS4A 2KBNA 2JPDA 5DM63 3RYFA 3QWNA 4MUFA 3PZRA 4M8SA 2HGSA 2X5NA 3DCNA 2AFHE 1SUAA 4QATA 2YWHA 2GH1A 1KK3A 4BJ5A 4NDAA 1KXZA 2JA6H 3M9XA 2EZVA 4BZWA 4Q24A 3BHNA 1KIMA 2Z56A 1ZI9A 4I6JA 2Z98A 2AMFA 1PJSA 2OK7A 4G0NA 5JRDS 4TLAA 2NZHA 2GCOA 2PNFA 4L5AA 2A0YA 2HFKA 2VKQA 3A9VA 1DBSA 2XE4A 4L6AA 3GLUA 1BXGA 3IV7A 5IJ9A 4GL2A 1SXJE 1SE3A 1ZZEA 3CLHA 5EMNA 5TS2A 1LBHA 3K6RA 2HBRA 4RV4A 3C6QA 1KTKA 5BWOA 2Q49A 2NUTA 5AW8A 2VF5X 3PO2H 1USIA 1UKBA 1OU4A 2WMNB 2GBPA 1GD1O 1QP7A 1OXXK 1TUIA 1TEVA 4B8ZA 3SKVA 3IP1A 3V8QA 1MVLA 2IUEA 4JC0A 4C7VA 1TVCA 3Q8XB 1D07A 3DUFA 1NUCA 2BDOA 1UP6A 1DX6A 2QTBA 1FFBA 4MDEA 1P2UA 3ND9A 4XQQA 3ZDCA 4DF7A 3IEIA 2QNIA 2F4VQ 3QMPA 3HGBA 1YZKA 1N33L 2IS4A 4EA8A 3PQCA 2VAXA 2RKSA 4V0NA 3QFSA 3S1AB 2A30A 4NEGA 3QP9A 1T6YA 1TTHA 1E4EA 2BOSA 2D13A 1PRYA 2VT2A 4H0LC 2GEVA 3ICEA 2JFWA 3B3GA 5HDQA 1IG3A 1U7ZA 4MCIA 4JQCA 1ZYRD 4JI5L 5M7EA 2VUMG 3NCHA 2OGTA 3FETA 3KQTA 3W7AA 2UVQA 1ZCFA 5IKPA 2ASVA 3C3WA 3ZZNA 1CJKC 4WZAB 4IZ6A 2EE1A 3FUVA 4MIUA 5FPKA 3N2GB 3O3NB 4LYHA 3GIWA 3WLLA 2CL6X 1K8QA 4KE8A 1H1DA 2VBFA 4RMGA 4E22A