3PV8A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddttp-da in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3pv8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3pv8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pv8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3pv8A01
3C2MA 3Q8SB 3O4QA 4CFCA 4YNQA 4O4GA 1QTMA 9ICJA 4DEZA 4M9HA 5JUMA 5J0XA 2IOCA 3S3MA 4HUGA 4Z6FA 1XS9D 3VN5A 2A1JB 5HRSA 4RNMA 2QK9A 3Q8QB 1D9FA 3H4DA 3V6HA 3SUNA 1S10A 3KD5E 4KI6A 3ASMA 4NLKA 3LP1A 2RKIA 4M3ZA 3ZT4A 3E2EA 1SL1A 3AVAA 2XY8A 2FBXA 3M9MB 1X2IA 3QZ8A 3AVLA 4RT3A 5BPCA 2E4LA 4M3YA 1ZQYA 2JZBA 1ZQXA 3TAEA 4I28A 1KDHA 2YNHA 1ZQKA 4ELVA 2PFOA 3RBEA 1S0NA 4DL7A 1C6VA 3OSNA 2W9BA 2C2DA 7ICSA 3NH2A 5IINA 2NRWA 3TARA 1SL2A 9ICKA 1IXRA 3T5HA 4JV1A 4ZH4A 4KHSA 3V7LA 1NK6A 3ZSVA 3HL8A 2Z1GA 5DQHA 4DOAA 1KLNA 4F3OA 4MEXA 4F2RA 3AA3A 2IA6A 2A1SA 4BWMA 4FBTA 4J9LA 1BPYA 5CB1A 4JRPA 4YQWA 3G6YA 3SCXA 1RCHA 4FJXA 4M3UA 4RZRA 2DPIA 4AHVA 5SZTA 4HHTA 2B6AA 2F8SA 4LZDA 3BDPA 2PZSA 2FPMA 4OPKA 3VQCA 3MDAA 2HVIA 4FS2A 4FJ7A 4IRCA 3LAMA 4FXDA 4J9SA 3NF7A 3AVIA 1NKBA 3MFIA 3JPTA 4Z6CA 2KFNA 1RDBA 4FJHA 4M9LA 7ICUA 5IIMA 1WCLA 4PPXA 3UXNA 4QOZB 4CEQA 4B3OA 2BDPA 3O3HA 4EP5A 5KRTA 2ISOA 1T03A 2FPKA 1VSHA 1VRUA 2DFEA 4UAYA 5CZ2A 2OWOA 3ZDDA 3KTQA 2W9CB 4AH9A 2G8VA 4PGQA 4F2SA 2QKKA 9ICUA 5DDMA 5CY4A 3T1AA 4CCHA 4FK0A 1GOCA 3LP2A 3T3FA 4DL6A 7ICEA 3MEGA 5DG7A 3MBYA 5KFTA 4RPYA 4Z4IA 2VWKA 2BKEA 1ZQTA 1QSLA 2Z1HA 3KKSA 4TUPA 3TR8A 4YFUA 2ZJ8A 2PYLA 3NTUA 3HJFA 3T5JA 2OPQA 3L3UA 3MDCA 3KHGA 5KG1A 1TAUA 1COOA 4RQ6A 4GW6A 4O5EA 2P66A 5KFQA 3F9KA 3GQCA 3PVXA 1A77A 1RDAA 3IAYA 4KLMA 1KLMA 1Y88A 7ICGA 4ECVA 1JLAA 3OYGA 2UVVA 7ICOA 3V81A 3LDAA 3PW4A 4PH5A 3B6PA 2XHBA 2X6NA 1C0UA 1RILA 3ITHA 3JSMA 4CESA 1NK5A 3G6XA 4I2BA 5KG2A 1S0MA 2XCPA 5KGXA 1VSJA 2IHMA 5HBMA 2ATLA 1IKYA 4M3TA 4IQWA 1S1UA 4AHTA 3NAEA 3KK2A 8ICTA 2RF2A 3DRPA 3SQ2A 2YHBA 2OYQA 3DMJA 3RMCA 1ZBLA 4KN7A 4E7JA 3AO2A 1H38A 3KJVA 4QZDA 4M6WA 3ZT0A 3MR2A 4I2GA 1FXXA 4KTWA 4DG1A 3BGRA 4E89A 2DPJA 3GILA 4E3SA 3MECA 3NGYA 1NOYA 1ZBUA 4J2BA 3RRHA 5KTQA 5KT3A 2IAJA 1J54A 4BDYA 3DLKA 1KFSA 1L3TA 4O3RA 1CXUA 3HWTA 1X9WA 1JLBA 4CGIA 2ZTDA 3SV3A 3KHRA 4E7LA 3UXPA 4ID5A 1D5AA 5DB9A 7ICFA 1UWBA 3RMAA 4FS1A 4ZTJA 4NY8A 1S6PA 3L2RA 1BPEA 1A5XA 3KKRA 4J9QA 4R8UB 5J2FA 5HMMA 5J2EA 4IRDA 4BXOB 1BPZA 4KLOA 4RQ7A 4KN4A 4UBBA 4HYKA 4EZ6A 7ICTA 4CEFA 2WOMA 2YHAA 4PY5A 3AA4A 2HNYA 1SZPA 3TABA 2X6SA 5DB6A 3QEVA 2HVHA 4PQUA 3M8PA 4J9MA 3EWAA 4KLLA 5J2KA 1C7YA 5F9LA 4B9LA 4CJRA 5J29A 1RXVA 4J2DA 3QEAZ 4C8KA 4J2AA 4FBUA 1EKEA 7ICPA 1U47A 2JEJA 3OYHA 4F91B 3K57A 7ICVA 3BQTA 3K58A 1DGSA 4FJ9A 1RT2A 4JS4A 4FJJA 4ECTA 3DLEA 5HP4A 1FKOA 5DG8A 4RU9A 5HROA 3C1ZA 3ZCMA 4ID1A 3QEXA 1HYZA 4CJKA 5CR0A 4UAWA 3MR5A 4ECZA 1RT3A 5JS2A 3C6UA 3GIKA 3VQ9A 1RT4A 4CEAA 5J2GA 1S76D 4CGDA 9ICIA 1T4GA 4DSJA 4HTUA 3A2FA 3RR7A 1ASVA 4DTUA 4CEZA 3H8JA 3RR8A 5C42A 1NOMA 4IQTA 2NRTA 5D46A 4MF2A 1DTTA 3HVRA 5J2QA 3SPZA 4UB1A 4YMNA 3DI6A 4W5QA 1S9GA 3L3VA 2FC0A 4FLVA 3BQ0A 3AVFA 1AROP 4M42A 5I3UA 3AU2A 4H4OA 4YR0A 7ICMA 3RMDA 2XY6A 3UQ0A 4O5KA 3PMLA 3CM6A 3RJJA 3CFRA 8ICLA 4M9GA 2G8FA 3M9OB 4EYIB 4TURA 1C1AA 1BHLA 2PY5A 2LSNA 1VSKA 4GMJB 4K4IA 4YG2A 1NKEA 1HJRA 1JXEA 3ZDBA 2NRZA 5J0RA 2KFZA 4DWIA 1MC8A 2DFFA 5IIJA 3KK1A 3MR3A 3NH1A 4YN4A 1NK9A 4KMUA 1VSDA 2V9WA 3EY1A 5DK5A 5D4BA 2XCAA 2ZUCA 5J0SA 4GC6A 4PWDA 4BE0A 4F4WA 2KQ2A 1QSSA 4JV2A 1JLFA 3AVHA 1ASWA 5J0TA 4DF8A 3HK2A 5KFYA 3H8SA 4W5NA 1ZQLA 1J9AA 1S1WA 3AVGA 3AVJA 1ZJMA 4CEEA 3LZIA 5KFLA 1XSPA 1L3UA 2W9CA 9ICOA 3VQAA 5HRNA 4QWBA 2I9GA 2P5GA 2EX3A 3EPGA 4ED2A 4CF2A 4DO9A 3JPSA 4C8MA 1NJWA 2HHXA 2WONA 2DY4A 4RQ0A 1JIHA 3M8QA 4M9NA 3AO1A 1VRTA 1ZQFA 5KT7A 2R8JA 1JKHA 3RAQA 3OVNA 3UPQA 2BPCA 3AVBA 2IHNA 1QLNA 4FJIA 4IR1A 4X5VA 1CEZA 2AU0A 8ICQA 4JV0A 4TSXA 3BQ1A 2YNFA 1A5VA 3H08A 1WLJA 2BQ3A 4I2PA 5EWFA 2HHVA 1VSIA 4QAGA 2PI5A 4CJPA 2D0CA 5J2BA 2BQUA 9ICEA 3AA5X 4F5NA 4BDZA 3CFPA 5J0WA 4DL4A 5J2IA 2PI4A 3QLHA 4GXKA 4NM1A 3VQQA 4BE2A 1RBTA 4YD1A 3OYMA 4GXIA 2Z1IA 4CF0A 3C2KA 3QO9A 2I1QA 3HO1A 1N6QA 1RTDA 1WSIA 3O4NA 1JLCA 5KG7A 1WAFA 1I39A 4K4HA 4CHOA 3L2QA 3V9UA 3C6TA 5DB7A 3RJGA 4B9SA 3GV5B 1VK0A 1TGOA 3TFSA 3CM5A 3LWMA 2FBYA 4RQ8A 4YXMA 4QZAA 1SV5A 3RJFA 4FM2A 4ECUA 5JS1A 4AILC 3KLEA 2M9NA 2IBKA 4R5PA 3ALYA 4UB4A 2BE2A 1TVAA 3AV9A 1MSWD 4UB2A 9ICVA 1GOAA 3BJYA 2P6RA 7ICLA 8ICIA 3RH5A 4O3OA 3TAMA 2DTUA 3Q8MA 5BOMA 9ICTA 4Z4CA 3SUQA 1ZQQA 4CGJA 5DQIA 4B8AB 2FBTA 1BGXT 3LP0A 1U49A 4KHYA 1B92A 4RPZA 4FZYA 3PW7A 4R8UA 1HNIA 4KO0A 3HSTB 4BXOA 3NF6A 5L9XA 4C8LA 4CIFA 2VG6A 1L3VA 3JPRA 4DQQA 3PW0A 1MQ2A 1HJPA 3V1OA 4DSKA 1YT3A 3UIQA 1CUKA 3OHBA 4FJMA 5KFVA 4QZBA 4M47A 4N76A 4LVSA 4BACA 4H4MA 2E6LA 4HUEA 3UXOA 5FDLA 1VSLA 3T5KA 4DTOA 5KFZA 4IRKA 4IDKA 4B9VA 2JEFA 4ECQA 8ICUA 3U6FA 4Z6EA 4BWJA 5DQGA 3OYBA 1XHXA 2BANA 3SI8A 2GUIA 2ITGA 4Y1DA 4FYDA 1IKVA 4CJ3A 1ZBHA 3V6JA 2UVUA 8ICCA 3TFRA 3ZSQA 2VA3A 3O3FA 2HHSA 4AHUA 9ICNA 5DLFA 1X1PA 4I2EA 4DMNA 3LZJA 2KTQA 2AJQA 4ZTFA 4FO6A 3VQ6A 4I7FA 3LAKA 3AVKA 5L1LA 8ICJA 1TK5A 5J2DA 1ZQMA 4M41A 4ICLA 4MFBA 2MAXA 4QZHA 4RQ1A 4CK2A 4KLFA 4CFAA 2HNDA 3V6DA 2ZTCA 2YNGA 7ICIA 1YTUA 2WTFA 4ZHRA 4FLZA 1BL3A 1RBUA 1K6YA 4Q8FA 3O3GA 2BQRA 4PHEA 2ZJAA 3C5GA 4F50A 3DLBA 3WNHA 3FFIA 3SUOA 3Q8PB 5K14A 2C2RA 3ZT2A 3M8SA 2W8KA 5KFFA 2VA2A 3S3NA 1DLOA 9ICMA 5J0YA 1BIUA 4DF4A 5J2HA 1N5YA 3V7JA 1HQEA 1EXNA 4B9TA 3SQ0A 3CG7A 4K8ZA 1RXWA 3B6OA 3C95A 1HNVA 3ZSZA 3ZD9A 1W9HA 1QE1A 3GV7B 1WN7A 1JLQA 1WSJA 4O5BA 4F93B 3K4GA 3HXMA 2ASDA 4Q0BA 3AUOA 5KFMA 4JWMA 4I9QA 5L1KA 3QZ7A 5KFNA 3C21A 4HUFA 4N47A 4DL3A 5KT6A 3QEWA 3PX4A 4M9JA 1TK0A 1N56A 5KFRA 4CEOA 5KFBA 1LV5A 5DBCA 1IKXA 2NRXA 4LSLA 8ICWA 4F5RA 4JLHA 5DLGA 4DTRA 3IG1A 3TQ1A 4IQUA 4ED0A 1BIZA 3KLIA 5IIKA 2H5XA 1HYSA 5HMLA 9ICHA 1KVCA 1QHTA 1RDDA 2BCSA 4MFAA 5FROA 4HCBA 2B4JA 3GIJA 3RBDA 4C8NA 2YNIA 1NJYA 3ULDA 4FJLA 4Z6DA 3MXJA 5FRNA 2AQ0A 1ZQPA 4ED3A 1Z25A 5KFOA 5J0UA 1NJXA 1BVSA 4LZGA 2LYHA 4O3PA 8ICEA 2ZTEA 4Z4EA 1JMSA 2GWSA 9ICXA 2FMPA 3V1RA 3RRGA 2ALZA 3KHLA 4OLAA 2HHWA 3F73A 1SKSA 4JS5A 1HUZA 3T19A 4KRFA 3RH4A 2P6UA 4MFFA 2HB5A 3MEDA 3QIOA 4QWEA 2BGWA 4E7HA 1ZQUA 4KHQA 3DLRA 1BCOA 1C1BA 4FLYA 4M0AA 5KG4A 1IO2A 3M9NB 2OPRA 4TUQA 4CJUA 3HYFA 4IR9A 2FBVA 4I2HA 4CE9A 5EWEA 4JRQA 2OA8A 1NOZA 1KSPA 4Q8EA 4RNNA 3L2WA 3ISCA 1HUOA 5HLFA 7ICQA 1BCMA 2KN7A 2D5RA 1HQUA 3GDXA 1Q8IA 2VWJA 1ZETA 3JPNA 1ZQDA 4KLJA 4LH5A 4OGCA 4DFMA 2C2EA 1N48A 1VSMA 3VA3A 1TK8A 3EPIA 4CF1A 5C25A 2FLLA 3G6VA 2AGOA 5C5JA 2ZJ5A 3N97B 4RW9A 1WSEA 4OGEA 1KEJA 3K5OA 4G3IA 1HMVA 2YKMA 2A1JA 4DFKA 2KZ3A 3LANA 4DU4A 4NCBA 4UAZA 4DFJA 1KFDA 4RW6A 3OS0A 1WCNA 3GIMA 4BDPA 1UA1A 5EWGA 4WE1A 2PFPA 2B5JA 2IMWP 2UVWA 4ED1A 1CZ9A 4KI4A 3CQ8A 3JPOA 2A1RA 4RW8A 2ZUBA 5T7BA 3RWUA 1S5JA 4EBDA 3SYZA 4BGDA 3KLHA 3FYHA 1IH7A 1EX4A 2GBZA 4EP4A 4KLDA 4JK1A 3FDSA 4PHAA 1BISA 1RBRA 1KVAA 4FK2A 4KITB 2XRIA 3AO5A 4B9MA 1ZQHA 4W5RA 1Z3EB 2P5OA 3NHGA 1W0HA 3LP3A 4Z4HA 4KV8A 4RQ5A 1ZQJA 3NGDA 1XO1A 4QWCA 4NYFA 4JUZA 4CERA 9ICWA 3NGZA 2FLNA 5CP2A 5DBBA 3WNFA 4ECXA 1T7PA 1TKZA 1RBSA 4NCAA 1BQNA 4TQRA 4CHNA 3MABA 5KFHA 4CK3A 4BE1A 3NH0A 5J0OA 3ZT3A 8ICKA 1KTQA 3C2LA 4YFKA 1CZBA 4F4XA 3PW2A 3OYIA 5F9NA 4I2IA 3AO4A 3NDKA 4FLTA 3MAQA 2XO7A 1XC9A 4I2FA 4PGYA 2BCUA 4DOBA 3V4IA 4M45A 8ICNA 1RT7A 1U04A 4R63A 3VQ7A 3SNNA 4KTQA 1ZQAA 2HNZA 1F21A 4N5SA 1UAXA 5IIOA 2XGPA 4CHYA 7ICNA 4JWNA 4XA5A 4F5PA 2X74A 4CJ4A 3AU6A 3OYAA 4KB1A 4NLNA 3AO3A 1L5UA 4Z0UA 1DOQA 4M3WA 4W5TA 4F5OA 5CWRA 1G15A 4CHQA 1UT5A 9ICRA 3ZSOA 2ZUDA 4PGXA 4F5QA 4EEYA 1ZQEA 3D45A 5CZ1A 2AQ4A 5J2JA 3L8BA 4DSLA 3QIPA 2C22A 3EZ5A 1FK9A 2J6UA 1T8EA 2HHTA 5KG3A 1ASUA 3I0RA 4RG8A 5E41A 7ICHA 5CYQA 1JXBA 4KLHA 1KRPA 3KD1E 5J2AA 1TVRA 4DS4A 1HRHA 3RJIA 1RYSA 4MFCA 3PNCA 5CJ7A 3MXMA 3D0PA 4QW8A 2ISPA 1ZQBA 3PMNA 2XC9A 2XY7A 1WNSA 5BOLA 3V7KA 2MUTB 4Q5VA 1K1QA 2W9AA 3OYFA 4TUSA 4YXJA 3RB4A 1ZQIA 4ECYA 3RB0A 3DM2A 2RPIA 4MQ3A 1S9EA 3KIOA 1S97A 4OPJA 5J2NA 3HX0A 5KFKA 1C1CA 3HM9A 4QWDA 1S1XA 5D3GA 3PX6A 1C0TA 4RPXA 3LPTA 7ICJA 1RT6A 4H8KA 4I9LA 3OS1A 4NLZA 4DTXA 4DSEA 2IGIA 3DYAA 4P4MA 3HPGA 3NCIA 4ELUA 4QWAA 4RUCA 2W42A 2Q0ZX 5J0QA 4M04A 2BHNA 3N4MB 1XSNA 3JYTA 4J9KA 3HP9A 2D0AA 9ICLA 4YD2A 1LW0A 4EBEA 3H4BA 2FMQA 4I27A 4QW9A 4MEYA 3EYZA 2YKNA 4PHPA 4E7KA 3AVNA 4YVZA 4J9NA 4L8RB 3H40A 4DS5A 3OYKA 5SWMA 3NE6A 5CA7A 8ICVA 5CYMA 4FJ5A 3ZSYA 5CHGA 3TAPA 4P4PA 3OHAA 1J53A 2ASLA 4FJ8A 2EHGA 2AGPA 4OJRA 4KB0A 1S77D 3RMBA 8ICRA 4NXZA 5DBAA 3KLGA 4O9MA 3RH6A 3OS2A 5KFSA 1B9FA 4O44A 3B0YA 4E7IA 4QZ9A 9ICCA 3OGUA 1ZYQA 3SQ1A 4KLQA 2QKBA 4F4YA 3MR6A 2W8LA 5C24A 3HP6A 2KZMA 1GOBA 3ISDA 4FM1A 4Q45A 1LW2A 2BCVA 4PHDA 4DFPA 2J6SA 3DOKA 1Q9XA 3ISBA 3NFAA 2BPFA 4DOCA 3VQDA 3CYMA 1LB2B 3NF9A 3LDSA 4I2DA 1SKWA 4O3QA 4IQVA 3TI0A 1ZQZA 4CFDA 5KT4A 1RNHA 9ICBA 3V9WA 3QNOA 5KRSA 3SQ4A 2G8UA 3OYJA 4KHNA 3ETLA 3THVA 4XRHA 5KG0A 2FPLA 4CJ5A 4W5OA 1A5WA 4I2JA 4KLSA 1BQMA 3IHQB 1J5OA 3U3YA 1EXQA 4ECSA 1WSGA 3HVTA 4CFBA 4FLWA 2G8IA 9ICSA 3OY9A 4DL2A 4IFVA 1T3NA 5J1EA 2I5JA 4M3RA 4QZCA 4KHUA 3NBPA 3ZSXA 4J9RA 1IM4A 4O55A 3QEPA 1NK7A 4J9PA 1YTAA 4CJFA 2G8KA 2Z1JA 3GFKB 5DMRA 4CJSA 4IFYA 5I42A 4I2QA 5EU7A 1WSHA 4DL5A 3QINA 4CK1A 3ZDCA 4E19A 4N41A 1NK4A 9ICAA 5KFCA 3T5LA 4CECA 2D0BA 4OKKA 5J2PA 3P1GA 4O0JA 4IG0A 1REVA 5KFJA 1B22A 3V1QA 2C28A 2F96A 1JXLA 4I29A 2G8HA 4O3NA 1U9LA 2VA8A 2ATQA 1WSFA 4KKOA 3MXIA 3DLHA 3K2PA 3PUFA 4ECWA 3IM1A 3C1YA 3C94A 3S3OA 2DFHA 4F3TA 1XHZA 4CEDA 2YV0X 4J2EA 3RJKA 3DRRA 4RW7A 4UB3A 1WAJA 3ZDAA 3SPYA 4CJLA 2PFQA 2O4IA 3BQ2A 4Z4FA 1TV6A 3RJHA 4CF8A 4UQGA 3QEIA 4DU1A 2V4RA 5DB8A 3JPQA 4IBNA 4XIUA 4FCYA 2Y1JA 4IKFA 3L2VA 1B43A 8ICAA 5L1JA 2JLEA 1NK8A 2GV9A 1BPBA 3KLFA 3PV8A 8ICHA 4B08A 4OLBA 1ZQOA 3DLGA 3M8RA 2XGQA 4K8XA 4KREA 3PR5B 4YP3A 3OYNA 2VANA 1VSFA 1BI4B 2HHQA 4DQPA 3LALA 4QZIA 4LH4A 4YMOA 4E1MA 1D8YA 4QZEA 3VQEA 4FK4A 2X78A 4RW4A 5J0PA 1K1SA 4DQRA 3VQ8A 1JN3A 1ZJNA 1D8LA 9ICFA 2BR0A 5EOZA 4QZ8A 5HHIA 9ICGA 2JGUA 4RT2A 1EETA 3HPHA 3MGHA 3TAFA 3OYDA 1U45A 4KAZA 2MUTA 1X9SA 3UQ2A 3LPUA 3L2UA 5KFWA 3RAXA 1TV9A 3QERA 3ORYA 5KT5A 4F92B 1CLQA 3WNEA 2IC3A 4NLGA 1ZQGA 4KHWA 4KTZA 4HCCA 2VG7A 4UB5A 2R8KA 4YCXA 2Y1IA 4PUOA 1XI1A 2F1IA 4FW1A 5L1IA 4DTMA 4DTSA 4ECRA 1XSLA 1UA0A 2OZMA 4DSIA 5FRMA 3QEBZ 2BCRA 3K5LA 3DRSA 3HT3A 2F8TA 3QETA 3NGIA 1ZBIA 5TZVA 4RQ4A 1JLEA 1SUQA 1LAVA 3S9HA 5DGAA 5DDYA 1FKPA 4AHSA 5J2MA 1D9DA 1X9MA 3V6KA 3PY8A 3AVCA 4E0DA 4F8RA 2BGGA 1RPLA 3DOLA 4TQSA 3B0XA 1V9PA 2AGQA 3GIIA 3VA0A 4KPYA 2Q3SA 2E6MA 1TL3A 3ISNC 2IDOA 1QS4A 5D49A 4DTNA 2BPGA 4Y1CA 1Z00B 4XQ8A 3MFHA 1T05A 4QZFA 2ZE2A 4B8CA 2W9MA 2DFLA 3LWLA 5KG6A 4YR2A 1KFTA 7ICKA 3WNGA 1KCFA 3P5JA 1XWLA 4C8OA 4QZGA 4M3XA 4Z4GA 4ED6A 3PW5A 5IILA 9ICQA 4RNOA 3C23A 3V9ZA 3SZ2A 1RDCA 1ZQNA 5DG9A 4AHRA 4CJTA 3U3GA 1NJZA 4YMMA 2PFNA 5KT2A 4ED8A 3OYLA 3IRXA 4DQSA 4FJNA 4LD0A 1XU4A 1QSYA 3K5NA 2UVRA 4E1NA 4R65A 4O5CA 4F4KA 3TANA 4FVMA 1RTHA 1S1TA 1Q9YA 2JZBB 1SL0A 2R8HA 3PR4A 2VG5A 3ZDEA 3SJJA 4AHCA 4NM2A 1JL1A 1ZQRA 1TKDA 1MU2A 2NRVA 5KFPA 4YR3A 2RN2A 1BPDA 3RB3A 4GVMA 4OKJA 2G8WA 2W9BB 3SV4A 4FLXA 3MEEA 7ICRA 2R7YA 1SKRA 4CIEA 1KVBA 1CXQA 3ZSWA 3Q8KA 3V9SA 2IS3A 3TAGA 3H8WA 4IG3A 4EZ9A 9ICPA 4GLXA 3OSPA 1TAQA 4DTJA 3RJEA 4OKEA 4O0IA 4KLIA 3EW9A 4J9OA 3PO4A 5HP1A 3Q8LA 1JX4A 4RQ2A 3NF8A 2JEGA 2PXIA 4CJQA 8ICZA 3TWHA 1ITGA 5HRPA 4RQ3A 3MGIA 2F1JA 1EP4A 2KW4A 1YVUA 1TFRA 4XUSA 4FJKA 4NYNA 3GV8B 1S1VA 1S9FA 3HPOA 1UT8A 4QCLA 3KK3A 3I0SA 4FZXC 3OJUA 4CF9A 4PA1A 3JPPA 3E01A 3C5FA 3P83D 4DU3A 1RT5A 1ZQCA 1UOCA 1O1WA 4F4ZA 3SUPA 2HHUA 3VQ5A 4GXJA 4P2HA 1U4BA 4G1QA 4DQIA 4CHZA 3Q8RB 2ETJA 4KLEA 5J2CA 2V4QA 1A76A 2ZD1A 3TAQA 3OYEA 1HPZA 3K5MA 4FJGA 5KFUA 1RZTA 4R66A 4DLGA 3OJSA 5KFDA 3AA2A 1IG9A 1RBVA 8ICFA 4M2YA 1JLGA 1VSEA 3ZT1A 2HW3A 4Q44A 2JEIA 1TKXA 2R8GA 4Q43A 1B9DA 1ZQSA 1BI4A 1RTIA 5KFEA 5KFIA 5KG5A 3PX0A 3G0ZA 1Y97A 3VQBA 4CGFA 5HNKA 2RDIA 3ZSRA 8ICOA 1ZQVA 1DTQA 3IS9A 3V9XA 4P4OA 4DSFA 3K75D 4K4GA 8ICPA 2NUBA 5KI6A 3I8DA 5KFXA 1RT1A 4GC7A 1IKWA 4RUAA 4CJVA 2FMSA 1BPXA 4I2CA 3VQ4A 4FLUA 4MF8A 4CGHA 4N56A 2J6TA 2PYJA 8ICSA 2B21A 1LAWA 5DKWA 2P51A 5KFAA 4HVJA 8ICGA 4FW2A 1Z26A 2ZQBA 3QE9Y 4OVLA 4NCGA 1NK0A 1JL2A 4B9UA 4CEBA 3V72A 1R0AA 4KLTA 1NKCA 2BCQA 2XY5A 8ICBA 1U48A 3QESA 8ICMA 2KZZA 3OYCA 1LWCA 3AVMA 8ICXA 1PZNA 4EYHB 1C0MA 3SI6A 1TL1A 1ZBFA 3VQPA 4M6WB 3CFOA 4O3SA 5HRRA 2FLPA 1S0OA 1LWFA 2P1JA 2F1HA 1QQCA 3RB6A 4FM0A 3ZD8A 1L3SA 4KLGA 2QXFA 1S0VA 1I3AA 4CIGA 2HMIA 1RTJA 4B9NA 4ELTA 3PO5A 2OZSA 3K59A 4DTPA 1MQ3A 1RYRA 4I2AA 1HYVA 4EBCA 4CHPA 4ED7A 4DLEA 2OPSA 2OPPA 1ZQWA 2RDJA 4FZZA 2R8IA 5HHHA 5IIIA 3HW8A 1TKTA 8ICYA 3RTVA 3KHHA 4KLUA 4LY7A 4LSNA 1LWEA 4UBCA 2ASJA 2O4GA 5KGWA 4R64A 4CJEA 4KFBA 1Z00A 3QNNA 1S6QA 3H7IA 5DGBA 4CGGA 3G10A 5KFGA 4CJWA 3LK9A
chains in the Genus database with same CATH superfamily
2HNYB 3Q8SB 3O4QA 4O4GA 1QTMA 4PQUB 1T3VA 4CLFA 4UOHA 4TU9A 2IOCA 2F9JA 2PC6A 3WKBA 4IOCQ 3VVTA 4LFAF 2E5JA 1P8ZA 1XS9D 3A0IX 3CDBA 4OHWA 1J27A 3V6HA 3CC2N 2KXHA 3IR5B 4CIOA 4CO1A 3D6RA 3ASMA 4NLKA 2R7XA 1Z1ZA 1BWVA 1SL1A 2W7OA 3N5BA 2FBXA 3M9MB 4CF4A 3LDOA 1ZQYA 4L6V3 3DLEB 4LJXA 2MLXA 4IKAA 1VJ5A 4K50A 2Q6BA 2KVIA 3NLCA 4JI0J 4NZ7A 5LMUK 5AQRA 1YUWA 1KD1T 2E1CA 1S0NA 4DL7A 3FZBA 2W9BA 2AV5A 1FDAA 3CCUN 5IINA 1MA9B 5AQKA 4ZH4A 2QWMA 4KHSA 1U2FA 2VBWA 5DQHA 2RE1A 5BYQA 1CSJA 2KEYA 4H0PA 3OTCA 4HDGA 1VK8A 3AA3A 1XR5A 2IA6A 3ZTSA 4C4WA 2A1SA 1TL7B 3LTOA 4ZP9A 1X5SA 3QFPA 4QYZK 4LF9J 3ZI4A 1PYSB 4J9LA 4WXWA 1BPYA 2CJAA 4JRPA 3UW1A 5L9NA 1RCHA 3F2CA 3MMJA 3NOCA 2FPMA 3DLJA 3ENHA 4NA1A 2YVSA 3LAMA 4FXDA 3AVIA 1TYQB 4PWDB 5A2QO 4Z6CA 4U67L 5KQDA 5AM5A 1WCLA 1IVZA 4PPXA 3UXNA 3UNGC 2BVZA 1SC3B 3GU3A 4FFDA 1T9WA 4FN5A 2H65B 1VAZA 1HNZF 5KRTA 1GK8A 1S1WB 4UAYA 3OFEA 2RIJA 4JI2K 1U1OA 5AJ3K 2E5SA 5ALKA 5CABA 4AH9A 1NAQA 2V34A 2VODA 5C12A 3ENOA 2EAMA 4PGQA 4X64K 4F2SA 1ZM4A 9ICUA 3T1AA 2WONB 2RDDA 4JK9A 5IWAF 2B7CB 2A10A 5DG7A 1TAMA 4NI2A 4L3NA 1XNQF 5KFTA 3QGIA 2Z1HA 2Y9UA 4PZVA 2MQOA 2PYLA 2HHHK 1L7NA 1FEHA 3T5JA 3FCVA 2CNKB 1COOA 4RQ6A 2UYTA 4GW6A 2P66A 1SQEA 2GWJA 4PPZA 3F9KA 2NS1B 1PJ7A 3TPQA 4B9QA 1A77A 4NLRA 2JNJA 4DV0K 3IAYA 2JGAA 2CPZA 3S1TA 7ICGA 4OLOA 3FJ2A 2MTLA 2IM0A 1JLAA 3OYGA 4Y2YA 2UVVA 3PW4A 3B6PA 2XHBA 4B3MJ 3THTA 1VQ9S 2ITMA 1QAXA 4JI1J 1RAGB 1S1XB 2E1MC 2LU1A 4B3RK 3J81O 1NK5A 4IEIA 4UAUA 3QX7A 2Q79A 1DQ9A 2QB0A 3UN5A 4F7VA 4I2BA 1A7GE 5I3QA 3DYAB 3QU2A 4CRXA 1IKYA 1YGYA 4TLRA 1VBXA 4IQWA 1S1UA 2ZGZA 1WSVA 4LF4K 2DBYA 2RF2A 5IC6B 2OYQA 4X66J 4E7JA 4U96A 2AYGA 3WK5A 1RWVB 3HJVA 4QZDA 4ZVFA 1WF0A 1SXLA 4I2GA 1FXXA 4KTWA 3KLEB 3BGRA 1X4FA 1WG8A 4OHXA 3NGYA 2KJVA 4J2BA 2BKNA 7FDRA 5KT3A 3CJ8A 3DLKA 4LRAA 1L3TA 1RWNB 5AQPA 2G13A 2DXFA 1MN9A 4JNEA 5GTHU 4KPCA 2IBOA 1SPBP 3OR2A 2KICA 2EH9A 3OR1B 4DUZF 1RWMB 4ZVPB 2VL1A 4BR5A 2HZCA 1S6PA 3QUCA 3L2RA 1BPEA 1I5OB 1A5XA 4FL9A 2VOOA 5J2EA 4RQ7A 1RHJB 4EZ6A 1TU0B 1H2TZ 2WOMA 3QT7A 4PY5A 2ZH9A 3VVUA 4FWOA 3BF4A 1NHKL 4CO0A 1T94A 4RLEA 4KLLA 5GAHI 5H9FK 3DXMA 1DGJA 2CNLB 4M1KA 1RXVA 1EZZB 3CCRS 4J2AA 4FBUA 3NY0A 1QUVA 2IDLA 4GKJK 4X4NA 2R7VA 3ZFVA 3TKAA 3CJ3A 3KBBA 1GT8A 4ILMA 1GLAG 3BQTA 1Y64A 4PG7A 2BABA 1NU4A 5AQGA 4FJ9A 1IWGA 4JS4A 4FJJA 1SWWA 4RWWA 1YJ9N 4A5AA 1JK9B 5DG8A 5AQOA 4RU9A 2B7BB 5KQ8A 5HROA 4M95A 3TA1A 4CGZA 4AL6A 2GH1A 1RAJA 1HYZA 2E9RX 4EELA 2RHSB 1ECWA 1UVNA 1T4GA 5B0AA 3A2FA 1B0XA 4ILGB 4NLOA 3RR8A 1NOMA 4IQTA 2NRTA 1DTTA 5LOQA 2GNKA 3SPZA 4MFBB 3WK8A 3DI6A 2UXDJ 4PAAA 2HNDB 4W5QA 1S9GA 4FLVA 4DKWA 1VQSA 5I3UA 5DDPC 2DR9A 3CE8A 4YR0A 3RMDA 2Q0UA 3UQ0A 4DN9A 5KNIA 2G8FA 4GV3A 5AM2A 4TURA 1BHLA 4G1IA 4P75A 2LECA 4FF3A 3IRUA 1HJRA 3ZDBA 3CO0P 3M8ZA 2KFYA 2P35A 5BN9A 4CNYA 3KK1A 3I56S 2IRYA 4YN4A 2BOPA 2R7OA 3NH1A 4OO1J 5DK5A 5EUHA 5D4BA 3IAM9 3A0HU 5J0SA 2P8IA 4K0KJ 2E8AA 2OEKA 1JJ2R 2AF6A 2O67A 1QSSA 4JV2A 2HFOA 2J7KA 3CW2C 3AVHA 2LCWA 1ASWA 1TL5A 4DF8A 1DY3A 5J1NA 1R0CB 4LF8F 3NS5A 4X4VA 1QVGM 1R7IA 3SDEA 4WYLA 4MO5A 3TJ9A 3UI3A 4RWXA 2I9GA 5E0OA 2P5GA 3CJKA 1EKRA 4UZBA 3DV9A 4DO9A 3JPSA 4YOUA 4AYBF 2H4YB 2R4FA 2FC9A 6FD1A 3M8QA 3AO1A 1IJFB 1VRTA 2A19A 4ZS6A 3RAQA 3FRZA 3OQ2A 2IHR1 2FJVA 1CJTB 1QLNA 2ZJRQ 1URRA 1OWXA 4FJIA 4X5VA 4BR0A 1FJGK 3WK4A 3ONQA 2P9KA 1YZ7A 4WP3A 1XR7A 3QUTA 2XS7A 4WFYA 4DV3K 1WEZA 2KDOA 4DCOB 1VSIA 4ISGA 5HOOA 2CWKA 2A6MA 4Y0WA 5J2BA 1ZAWA 1FTRA 4JKHA 2X1BA 4BRNA 4WKRA 3QLHA 3VQQA 3A1YG 4BE2A 1RBTA 5AKZA 3OYMA 1K44A 4CF0A 3C2KA 2CGLA 3J80O 1N6QA 3KKAC 1JLCA 2M5YA 1XEZA 3AB2B 4K4HA 2MHNA 3C6TA 4GY2B 4C0OC 2O8CA 2WSCC 4B9SA 1TGOA 1U0HA 3CM5A 3U1LA 3BY5A 4ECUA 1FFSB 3UMGA 1JJ4A 2DF4B 3MEDB 2RU3A 1O13A 2M9NA 2IBKA 3M6XA 4LREA 4R5PA 2V6AA 1C1BB 2E5LJ 3ALYA 3POTB 4UB4A 2QI2A 1RHRB 4ZIVA 3C28A 1MWQA 3VAGA 4FNIA 3D6MB 1MSWD 3P31A 5ADXA 3BJYA 3CC2S 2P6RA 7ICLA 2RU9A 1XC3A 3NRZA 3TAMA 3R27A 4H03B 1IBMJ 4Z4CA 3SUQA 4CGJA 5DQIA 4QS8A 4EFAC 1ZS6A 3BYPA 4YDUC 4JI0K 5KAFU 4B8AB 2FBTA 1O0PA 1U49A 1RDUA 4F4AA 3CJAA 3PJWA 2MKSA 4KO0A 3P45B 1HBNA 2XMWA 3NF6A 4D3GA 5B09A 5A8KB 3O9SA 4C8LA 4LBIA 1IR2A 4WXOA 2V8VA 2MZSA 5I4MA 1NGFA 3V1OA 1CQNA 4M5NA 1UTAA 2N3LA 4LF9K 3SSRA 2OKQA 2V5HG 2B5JB 2Q0RA 3MD3A 4DI6A 1F0MA 1VSLA 4C98A 3W3SA 5KPRA 1AW0A 4IRKA 2EFOA 5FD1A 1V6HA 4NLVA 4B9VA 2V4JB 1I1GA 4HTJA 4BWJA 4KE5A 1XHXA 2BANA 3SI8A 3K1ZA 3CDAA 3Q89A 4C9DA 2CFXA 4FYDA 4CJ3A 2UVUA 1RTZA 4DR6K 1N0UA 4WF9Q 4TLQA 4FXWA 3O3FA 1XNRF 2F5GA 2GHWA 4AHUA 1ELOA 1X1PA 3NVZA 4P10A 2FJWA 2R7WA 2DNRA 4FO6A 2YWKA 4I7FA 4EO6A 2ZWHA 6FDRA 1Y3KA 5L1LA 8ICJA 5GADU 1BUPA 1JUDA 3W8PA 1EX8A 3A8IA 1FWPA 1RHMB 3R9PA 4ICLA 4DV5J 3QYYA 4QZHA 4RQ1A 5AQIA 4CK2A 2MZRA 4CFAA 1P9YA 4DR1J 2UV8A 1UP1A 4ZLNA 1VQ6N 3DXBA 5GAGU 4S0MA 5IXUA 3C16A 2EKNA 2CYYA 5A6WA 2YKAA 3QQCD 2DRBA 5I3PA 1RBUA 1K6YA 4CTAB 3MMCB 4PHEA 3K9KA 1HKAA 4UASA 3L4PA 3TRGA 4OI0A 2VUGA 3L3FX 2AW0A 2NPIA 5K8MA 3G8SA 1HX1A 3LDLA 4MKYA 3Q8PB 5K14A 2C2RA 4BJQA 3M8SA 2W8KA 1HBMA 3S3NA 3L7OA 1OH8A 4IDHA 5J2HA 1N5YA 2FHOB 3C0BA 2H3IA 5ALOA 2V8DA 2N7CA 4B3MK 4NLCA 2MA1A 2OIHA 3B6OA 4X65J 3C95A 4JI1K 3BR9A 4OHVA 3I28A 2J7UA 4L76A 3CCSN 2ZIWB 3GV7B 2GTDA 1UMJA 1YJUA 2W01A 1HD1A 1TVRB 3QZ7A 1VOMA 4X66K 3FCHA 3NS7B 4CO3A 3WXJA 5KT6A 2QARB 2RP5A 4OJ1A 4LFCJ 1TK0A 4KMOB 1N56A 4NXMF 1Q46A 5KFBA 1X4GA 5DBCA 1VQOS 8ICWA 2BW7A 1IQZA 2ZUGA 3CC7N 4NMXA 4DTRA 1PC4A 3FLCO 2K3KA 1K0VA 3IG1A 5EE9A 3DM2B 3O5TB 3IBCB 4IQUA 3U9DA 1Q18A 1S7HA 3KLIA 5IIKA 4BHQA 1SB3C 9ICHA 2FVPA 3MUVP 3VGUA 2F8HA 4A4JA 3LO3A 1KVCA 4TU7A 2UXCK 2YTCA 5D4LA 1JJHA 2B4JA 1C1CB 4WFXA 1U8SA 3EGZA 2B4OA 1R6VA 4Z6DA 1DK3A 1FD2A 5IT0A 4JKBA 2LEBA 4I1TA 1QQMA 1ZQPA 4ED3A 3Q24A 2BJ3A 3OW2M 3VAJA 5K4LA 2MKKA 2ZTEA 2OMLA 4J7CA 3NG8A 3HZ6A 5KPTA 2KT2A 3P8BB 2ZH1A 3R8EA 3W2WB 1T11A 1UHUA 2WHEA 2EW9A 3L7UA 4PL1A 1R8HA 3FE1A 1UZDA 2P9NA 4U95A 2HI0A 4A8FA 1NGBA 4B1UB 1EHWA 1D9AA 3W62A 3VPZA 1U02A 5IV3A 3T19A 1RWKB 4YY3J 3ENBA 4BRHA 4BR2A 2VIHA 3PKMA 2EFPA 1ROFA 2HB5A 3QIOA 4P2MA 1JJCB 5A0YA 3DLRA 1BCOA 3WXKA 2AXTU 1ZRNA 2P9LB 2P9SA 2YJFA 3ILOA 3HYFA 1YJVA 4JRQA 2Y9HA 2OPPB 4Q8EA 4MIWA 1NZ8A 1FFGB 2A2CA 3P96A 2DQNB 1N33F 2WSFC 3SR6A 4JI4K 3GDXA 4X4TA 3HOTA 1ZQDA 3HHNB 4KLJA 2C2EA 1GLCG 5GVQA 4CF1A 4C80A 1N4LA 2FLLA 2DNQA 3DOKB 3MCSA 4K5SA 1X4AA 2WZ1A 3D7SB 2AGOA 3FAHA 1PO6A 3ZEUA 4OZ5A 3SFGA 4Z7CA 2H3VA 3GFHA 2YX6A 1KEJA 1Z2LA 3RGIA 2YKMA 1NHVA 4I69A 3LANA 3D6TB 1HJOA 1KFDA 1FERA 3D6JA 3QWUA 4RW6A 3BGFA 3TOQA 1WCNA 3C2PA 4WE1A 2PFPA 4K4TA 4DX7A 5AZIA 2CJ9A 2G5HB 1DRZA 5BYRA 4WQ4A 1J5OB 1CJUB 4NOHA 3HVTB 4KT0C 1QH9A 3CQ8A 2BEFA 1VQNN 2DR7A 3C6HA 5J1EB 2ACMA 3IBPA 3DAWA 5T7BA 2JOQA 1G4CA 4BGDA 1TMMA 3KLHA 1IH7A 3TSQA 4IXCA 4M63C 3S41A 1KAYA 2VDIA 4PHAA 3FDSA 1PBAA 4OZ2A 1FX4A 1ZOTA 3QFWA 4MHVA 4K0KK 3HX9A 2GHVC 2B9EA 3TYTA 4XPEA 2P5OA 4BUGA 3NHGA 1U2RA 1SC1B 4Z4HA 4QZVB 3GYXB 3CPWR 4IFYB 4OPAA 3NGDA 1XO1A 4QWCA 5F8LA 2NQPA 3OFFA 3EVWA 3KFWX 2OSQA 1TKZA 4IG0B 4DV4F 1K9MT 2E7VA 1RBSA 4CHNA 5KFHA 4I67A 3PHTA 4AXJA 3EJMA 2C42A 2FJAB 4KKOB 2ZJQL 2CN1A 2HQIA 3PACA 1GH8A 5AFUH 4F4XA 3OYIA 4DR4J 3NDKA 3H42A 3MTKA 2E5GA 2HVDA 1KC8O 3DRRB 8ICNA 3FBBA 2Y8WA 3VQ7A 2HNZA 1F21A 1UAXA 1J5EK 3RVCA 1TV6B 4IUFA 7ICNA 4JWNA 1FX2A 1LK7A 1WI8A 2X74A 3B6BA 4CJ4A 3OYAA 4KB1A 3QUQA 2MGZB 4YHHK 1P8GA 3E9OA 1VLOA 4Z0UA 2YKPA 3KLFB 2E8MA 4AF1A 2ZUDA 1RKIA 3PRBA 5AI0A 3OUYB 4EEYA 2WBMA 4DSLA 3QIPA 2F9TA 4M5HA 4GIBA 2C22A 2EG1A 3G6EN 1FK9A 2DT9A 2J6UA 2HHTA 1LKZA 1Q95G 3RU0A 2IFXA 4Y2UA 5GADP 4LF5F 4Y0FA 3MM8B 1ASUA 3VQTA 2E1ZA 2RSQA 2MY8A 2HGLA 2LFVA 3OPXA 5E3PA 3HSJA 3KD1E 2BKPA 3BB5A 1HRHA 3DC2A 2XVTA 4X62J 1GLEG 3D28A 3D0PA 2M70A 4HHHA 2XICA 3VEXA 3WT0A 1F3VA 1EETB 2XY7A 2RS2A 5EDWA 4CP5A 4A8YA 2E5LK 5BOLA 3CRXA 5ETPA 3AGKA 4Q5VA 8RUCA 2CA9A 1GFWB 4QR0A 4NV0A 1S99A 3WK6A 1OY9A 4AYBD 1LOTB 1GX6A 2QIFA 3I6PA 4UTGA 1WBDA 2O8EB 1S9EA 1Q82O 4AXIA 1C0FA 1RE1B 1CULB 5M2UA 5GAEU 1WOQA 5E33A 5HO4A 1NSPA 3GWCA 5D3GA 3NCRA 3PX6A 2RD5C 4RPXA 3LPTA 4BRFA 4H8KA 3EXCX 3OS1A 4NLZA 2PFFB 4P4MA 1QVFM 1Q81T 3HPGA 3D68A 2ASMA 2DITA 2ZC3A 1YBUA 4M04A 3N4MB 1JRPA 5EOYA 2ZM6J 1VBKA 4NEYA 1LW0A 5F3TA 2VCPA 1MMDA 1SJ4P 1BWEA 1FKPB 3OL9A 4L8RB 3AVNA 4YVZA 2WK4A 3H40A 4D3HA 3SCIE 3TVYA 1HQ2A 3NE6A 5CA7A 4ANEA 1YJ7A 3ZSYA 2W2QP 1N5TA 3JSRA 2YI1A 3DXKB 1M90O 1B4SA 3ETRA 2ASLA 3AMZA 2AGPA 4BRKA 2QM1A 4KB0A 1H0HB 8ICRA 2GVDB 5H2FU 2OFHX 3KLGA 2UXBJ 3OS2A 1X6JA 4QZ9A 2RMLA 2QYCA 3A3OB 2QKBA 4AP9A 2K1RB 3MR6A 5C24A 5E3CA 1SV0A 2KZMA 3ISDA 1VQYA 3O1WA 3GDQA 5D4OA 1RBAA 2RRAA 4DFPA 3RUBL 1FFWB 3NFAA 3J7ZO 1C20A 3VQDA 3WUHA 1S22A 2GO9A 3CYMA 3LDSA 5DM7Q 4IQVA 4ILLA 5FPMA 3THWA 4DV5K 5KT4A 5C0YA 4F04B 5AI5A 3L4QA 3V9WA 4USAA 2ESEA 1MMNA 1HWKA 4DR1K 4KY3A 1L7MA 2HBYB 1M1KO 4ETXA 4NA3A 3MWTA 1YHQS 3MMBA 2RQMA 4I2JA 4KLSA 1BQMA 3FZ2A 1Z1BA 4OHYA 2EQYA 5ALJA 1IBKJ 3R6GB 2J0QD 2G8IA 2D1CA 3TZZA 5LMUF 4DFDA 2COLA 2I5JA 2VG5B 1X6IA 2ZOGA 3LW5C 3KUHA 1Z4OA 3NBPA 3VCBA 1RT2B 1FRJA 1IM4A 3MR7A 2CJKA 3MEEB 3QEPA 3F41A 2AZ1A 3S6JA 3CD7A 3QU7A 3SK3A 2C3PA 5AQWA 4X65K 1NSQA 2HAIA 2KYZA 1DZ5A 1WUDA 2JWLA 5HP1B 1FKAF 2OI2A 3H5SA 5KFCA 3LPYA 4CECA 1YAGA 4DV6J 1REVA 5T7LA 1S1VB 2H5EA 4A8EA 2WB1F 2L08A 1BMQB 2ATQA 3TU5A 3DLHA 3PUFA 4LFCK 1H2UX 4YORA 3C1YA 3TNVA 3F5EA 3FBFA 1XHZA 2ZIXB 3ZLJA 1WBBA 2EXUA 4P7VA 3WXIA 4URGA 2AT1B 1KBRA 2O4IA 3RYLA 3MWPA 3DHWC 4Z4FA 8AT1B 3QEIA 2YWFA 1PSDA 5AI4A 2ZD1B 4JI2F 3B8HA 3NMUA 2AWZA 1VQMS 1S6UA 1YITN 5DDRC 1IQTA 1UFLA 3R6LB 2XYHB 4EX6A 1B43A 2JLEA 1NK8A 1N88A 2KM8B 1FRHA 3PV8A 4X64F 2F4VJ 3DLGA 1NMDA 2DHXA 5EXWA 1RHQB 1KHVA 4I4BA 1BI4B 2HHQA 1RTIB 1MA7A 4LH4A 2HCFA 5THWA 1FCAA 4WQ5A 3VQEA 4AFFA 1NZAA 5J0PA 3O2IA 1IBCB 4CLZA 3VQ8A 3UCUP 3I31A 3F2DA 4FWSA 4LQ3A 4U7UK 4HWIA 9ICGA 3R9KA 4YY3K 2L3MA 3ENAA 3QWPA 4DV0F 3HPHA 1VS3A 1FJEB 1U45A 3IWXA 3LPUA 4LRFA 3PKYA 4BRQA 3NVWA 1TV9A 2PMWA 4B3RF 3QERA 3H0LB 2MQQA 1VBZA 2AP1A 2GHPA 2CZVC 1ZQGA 2XMUA 4BRIA 3M8YA 5DJBA 1R0AB 4LF4F 1SH0A 3MM6B 4FZLA 2R8KA 2QL9B 2A1AA 4H5VA 3T79A 2Y1IA 2MRLA 4PUOA 2AEMA 4DTSA 4ECRA 1XSLA 4N8NA 1UA0A 4IFEA 1LEOA 4ALZA 3T7ZA 3M1FA 5C2FA 3LH2S 3NL0A 2C3UA 2BCRA 1VQKN 3HT3A 2PEBA 3GSIA 3VGVA 5TZVA 4I64A 3LPEA 1JLEA 5AXLA 3PIOQ 1X5TA 3EVOA 2DBBA 1SUQA 3S9HA 3M2UB 3N4PA 5DGAA 4AHSA 2HEKA 4JI3J 4ZVUB 4FWRA 3V6KA 3PY8A 2KU7A 1Y5LB 2P9UB 3TTDA 2BGGA 2DNYA 4TQSA 3B0XA 4U9RA 4CI6A 1TKTB 3QJJA 3UN2A 3VA0A 4C11A 4WFBQ 2EVZA 1ILYA 4AUKA 2EFVA 3HI9A 5IT9Y 1WG1A 3ULHA 5GAEP 3MPVA 4Y1CA 4M7YA 1T05A 4GKKK 4QZFA 3I4PA 3UE5A 4B8CA 3H0RB 5KG6A 5JU5A 1KFTA 7ICKA 4O4GB 3WNGA 1VQ8S 2GS8A 4L75A 2R7TA 1Y00A 3W5YA 3FUYA 2QWQA 1KS2A 4E1JA 1PK1A 9ICQA 4TY9A 3CCQN 2KK0A 3SZ2A 2CPFA 3KUGA 4AHRA 2KE7A 2BUPA 4Y2AA 2PA3A 1RU2A 5AT1B 4ED8A 3WQTA 1WG5A 4LD0A 3M30A 1QSYA 1N8RT 4ATNA 1WWUA 2KJWA 4QU6A 5BRFA 1JMTA 2QTDA 1S1TA 4NRTA 5HJYA 1N34F 1ICEB 2FD2A 2R8HA 3CDUA 1KW4A 3PR4A 4NM2A 3K5PA 1ZQRA 1OS5A 5KL1B 2NRVA 2G9OA 4OYWA 3G96A 2W9BB 3SV4A 1U6FA 4CJ7A 2ZBPA 1YRXA 2MQPA 4CIEA 2F7VA 3IC1A 3Q8KA 4TXSA 2P9PA 4IG3A 3BV8A 2AJ1A 4GLXA 4WZQA 3OSPA 2J76E 3RJEA 2NUUG 2WC9A 4ZN3A 3TUJC 3DJCA 4RQ2A 5F3ZA 2ZH6A 5M1FA 2PXIA 2R2RA 1FT8A 3T1YJ 2W7PA 3HOSA 5GMKa 4PHTX 3MGIA 3AAWB 4KHRA 1Y5IB 1TFRA 4UY8O 4X62K 3VMFB 4CWBA 3CCES 4A8QA 3TW0A 3DGPA 1E4GT 3I0SA 3TEHB 4FZXC 3JPPA 3J81j 2DKZA 3P83D 1RJJA 1OSCA 1O1WA 2W2NP 2V67A 3QBCA 2HFVA 2HHUA 3VQ5A 1FEZA 1QDUB 4GXJA 4P2HA 1U4BA 2DO4A 1Z2ZA 1JI7A 4OI4A 2C2KB 4B3SF 3ZNUA 5D78A 2GO7A 2EAPA 2BE9B 1SIWB 2PA8D 5KFUA 3G25A 3OJSA 4XK8C 2EPIA 2HFZA 5AKGA 4P0PA 4JI8J 2HW3A 2OELA 3HZEA 2JEIA 2R8GA 1U7LA 4Q43A 1NDLA 5ETVA 1TUYA 1DK2A 1HHTP 1NHUA 2O5DA 5KFEA 1X9XA 2KT5A 5KG5A 4FPBA 3PX0A 2GGPA 3HHLA 2VJVA 4CGFA 1SCJB 2ZM6K 4NI2B 5GADI 3ZSRA 2H48B 1FJGF 4PYAA 1FVSA 2Z2YB 5D0GA 2VF3A 2AJFE 4FNHA 2WAQF 4DV3F 2M7SA 2X7IA 1F2GA 2NUBA 3I8DA 4KH4A 3R5BA 1E4FT 3AOAA 2I6XA 4NO7A 5AQNA 2EEYA 1Y11A 4CJVA 1BPXA 5AKXA 3B82A 4YOXA 3IDHA 5EGYA 5GAGI 4FLUA 2BA9A 4JB8B 3N7SC 2OTLN 4MF8A 2J6TA 1QUPA 8ICSA 3CXCR 2QSWA 3U9ZA 4GV6A 1UZHA 4HVJA 1FIQA 1JLAB 3D6HB 4LF7K 3I5CA 2UXBK 1RK8A 1Z26A 3LM9A 2D0OA 4MK8A 4QIEA 2ZQBA 2DGTA 4LFBK 2CQDA 3VCDA 3BO2A 2QB0B 4KLTA 1DFDA 3H5UA 2XY5A 4CH7A 1YDLA 3QESA 1IKYB 1S1UB 1WKKA 1YKWA 4JAXA 2RF2B 3D2SA 3CMQA 4H0TB 3JTNA 3OTDA 2K8GA 1QZ6A 1UAWA 3CCLN 4MDBA 3BGRB 4L3QA 3OXFA 4O3SA 1NM2A 3CSKA 2DGVA 2Y8YA 1D8ZA 2XIDA 1R8BA 2JRSA 2XMKA 2NYHA 3KOOA 3FBEA 4KLGA 1O6XA 3DLKB 4WKYA 5JXSA 4CIGA 4OJPA 4ELTA 3CCVN 1MQ3A 5D0EA 1KQKA 1IBKK 3PYFA 4FDFA 4ED7A 2W2MP 4JI0F 4CHPA 3OR2B 1ZQWA 1LVHA 2XYGB 5CA5A 2RDJA 2GC8A 5ETMA 3HW8A 1FXRA 3KHHA 1VQ7N 1RLCL 4KLUA 1NNEA 1S6PB 4OYIA 2ASJA 2O4GA 2IDEA 3QICA 1SB6A 3QNNA 2DY1A 1S6QA 5KFGA 2WOMB 1BD6A 4HI2A 2CQ3A 4PKHA 9ICJA 4DEZA 4LF9F 4M9HA 4K4SA 2MKYA 2BTFA 4LF6K 3O44A 4DV6K 4CZFA 3DXMB 3D3BJ 3VN5A 4RNMA 4ZITA 3O0FA 1TUGB 3UR0A 3HDSA 4QIWC 1R6YA 2QWLA 4F36A 3AB4B 3SUNA 1S10A 4KI6A 1ZA2B 1KDNA 4M3ZA 3ZT4A 3E2EA 3FFKB 2E8PA 2MJUA 4ZJLA 5BPMA 3WK9A 3QBXA 3AVLA 2FF3B 5BPCA 4M3YA 2BH1A 3GJTB 1ZQXA 3A8KA 3R1XA 3TAEA 5E26A 1KDHA 2CNNB 5HROB 3AAPA 2W41A 1ZQKA 2Z4PA 4ELVA 1UETA 4GVBA 2PFOA 2PMZF 3RBEA 3J81Y 2BKOA 3CD6N 3L7PA 1C6VA 3OSNA 2C2DA 1U26A 1NDCA 5G5GA 2QN6B 2F4VK 3NH2A 2ZH8A 2BJ9A 4JB3A 2CQ1A 1SL2A 1IXRA 3T5HA 4JV1A 3ZSVA 3HL8A 1DTTB 1N36J 4C8ZA 3PRDA 2V9KA 3ID8A 3DI6B 4MO4A 4LIRA 4F2RA 5BN8A 2R2SA 5I3UB 1RWPB 4JI6J 1XUPO 5I9EB 3PFOA 1VI7A 2FHMA 5GIPA 3B8AX 3TTCA 2XLIA 4Y2TA 1WI6A 4CO5A 4YQWA 3EZWA 4FJXA 2DPIA 4K7QA 4ES2A 2B6AA 2ZF5O 3BDPA 2PZSA 3KK1B 2HVIA 4FJ7A 2WB1D 3X3UA 4IRCA 4B3MF 2CPYA 4CDIA 3VZIA 4IO9Q 3BP8A 2MZ1A 3CJ5A 4JI1F 3L09A 1RDBA 2O8FA 7ICUA 4QOZB 4EP5A 2J7WA 2F2AB 5M1KA 1M5OC 2OWOA 4X66F 4M5MA 3ZDDA 1NNDA 3FMWA 1OH7A 2IM2A 3SDEB 1MDUB 3KTQA 3KMSA 4JYAJ 2VQEK 1OPIA 4GNIA 3IM9A 2APOA 3FQKA 2QKKA 5DDMA 5CY4A 3CJKB 1K73T 2CADA 3BO3A 3LP2A 4DL6A 4OJ6A 7ICEA 3M8QB 3MEGA 3BS5A 2JC1A 4FKXA 1VRTB 4DUTA 1VQLS 3C46A 4RPYA 1VQKS 4Z4IA 1YJNN 2BKEA 4FVCA 3KKSA 2P9KB 2WMMA 4YFUA 1OYDA 3HJFA 1ZD5A 5KG1A 1TAUA 2DRDA 3PVXA 3PIPL 1RDAA 4FWQA 1HW8A 1KLMA 2EWSA 1AT1B 3CI5A 1UCNA 1HIWA 3GJSB 2NCKL 4C48A 4UT4A 4WJ3B 2NR0A 1EIYB 3V81A 3QLHB 2X6NA 3I82A 2ADCA 2ZITA 3ITHA 3TZYA 3CERA 4CESA 5A8RA 1RWUA 1N6QB 1JLCB 3P4UB 3NKYA 4JKEA 2LU2A 2O8CB 1R27B 2ATLA 3CJ4A 5E5NA 8ICTA 2A5XA 4J9VA 1U0HB 3C19A 3DMJA 4KN7A 4EGLA 3KJVA 4MKBA 4FKYA 3PEHA 4NEZA 1N63A 1S3XA 2ZXHA 4R5PB 2DPJA 1OKJA 3EWGA 2QFIA 5SUHA 3C7NA 3E9LA 5KTQA 4QU7A 2IAJA 3S6EA 4CNZA 1J54A 2RHFA 1FE4A 4BRLA 2D3UA 3T69A 3TAMB 2OFGX 1JLBA 3E51A 2VGMA 1RHKB 5AQFA 4UAVA 5A2QU 3AD9C 7ICFA 1UWBA 4N7TA 3M7DA 1GO3F 3O08A 4NY8A 5EY4A 4B3TJ 4J9QA 2XI2A 4KO0B 3IDWA 1HBNB 1ZZNA 1RQ0A 2H3EB 1NJIO 4ED5A 2YX8A 5FLXY 2UXDF 4P2FA 7ICTA 2E1YA 3CCMN 4CEFA 1OVQA 3CF5L 1WC3A 3CJTA 2ZH2A 2X6SA 5DB6A 2PD1A 2QLWA 4WK1A 3QEVA 5AKHA 3K7RA 3T1YK 1VGYA 4J9MA 3UVJA 2IIHA 3EWAA 5J2KA 1ZBTA 5AQLA 3T1HK 4ETZA 2VWBA 4Y2JA 2QE5A 4J2DA 3WQUA 2G1HA 3MD1A 1EKEA 3E66A 1WEXA 5AQQA 2J9DE 1U47A 3OYHA 4FPIA 2R9LA 4K0KF 4F91B 1N0VC 4WFNQ 4FXVA 4BG9A 3MK6A 2NSCA 3K58A 4X4RA 1DGSA 2BANB 3NAHA 2P9IB 4NLDA 3THPA 4OZ3A 4OJ5A 3MM5B 2DGQA 3BSAA 3ZO7A 3C29A 5HP4A 4LIWA 2VU5A 3OBIA 4ZCKA 2F63A 2CDRB 2VJUA 5CR0A 1RT3A 4RX6A 5L39A 3J80Y 4U7CA 3C6UA 3PG9A 3D2EA 3HHKA 2O1PA 4CEAA 4I7FB 2W03A 1XIQA 1W97L 4JI8K 4CGDA 4DSJA 4KIAA 1KP6A 1ASVA 2K4HA 3ELHA 1SAZA 2V8PA 3DDNA 1KNZA 4DTUA 2AJ0A 2EBGA 3MM9A 2CQ0A 4BX9C 4ICLB 3HVRA 5J2QA 2Q43A 4UB1A 2DKXA 4YMNA 4CBWA 3H0MB 3J7YP 1XJWB 2IVFB 3L3VA 1VIOA 1NXIA 2D3O1 4M42A 2RQ5A 2CDQA 7ICMA 9RUBA 2ZH5A 1XMBA 4O5KA 3PMLA 3CM6A 2ROPA 3RJJA 3CFRA 4JI7K 2ZEJA 8ICLA 4M9GA 2CRLA 5AE1A 2RRNA 2GJIA 2UU9K 2UV8G 4YG2A 4RW7B 4IO9L 2C2NA 4DWIA 5K14B 3EO3A 5IIJA 1B0PA 1WDDA 1HBMB 4KMUA 2V9WA 2XCAA 4GC6A 1N5YB 2LM4A 2OTLS 4OI2A 1R59O 3MI7X 2YHWA 4XEIA 2NV3A 1W7AA 3OVBA 4DR5J 1WJ9A 1WWVA 5KFYA 3HK2A 3CQYA 2JZ5A 4W5NA 1ZQLA 4MKVA 4US9A 3JSBA 2J9CA 3IRWP 2X3GA 4WFZA 3AVJA 1ZJMA 4E8UA 1L3UA 9ICOA 3VALA 2W9CA 1DGKN 3VQAA 2EFGA 2XSJA 4K25A 2E5LF 2M3DA 4ED2A 4CF2A 1NDKA 2HHXA 4TKTA 4RQ0A 1KR4A 2PSZA 1BLUA 4OZ0A 3T9ZA 1LFPA 5ALUA 4NLSA 2NZTA 5K8OA 4BRDA 1ZQFA 5KT7A 1NMNA 4JKDA 2ZC4A 1JKHA 3U27A 3UPQA 3US5A 2JJ4D 2IHNA 1IJJA 2WBNA 2F8LA 3IG1B 1IBMF 4DPWA 2FHJA 4TSXA 2OMOA 2C3MA 2YNFA 3KLIB 1HA1A 3FK4A 3H08A 3OL6A 1WLJA 4I2PA 2CQ2A 4DPTA 2YHXA 1HWLA 2WAQD 4QAGA 2PI5A 4LC9B 4CJPA 3JAMY 1URNA 1JB0C 3MX2A 4BDZA 1F44A 4QS9A 5F3XB 2Q1LA 5J0WA 2YMPA 1O51A 1K8AO 1VCTA 2LLZA 5ETQA 4NM1A 4YD1A 3VQSA 1QQOA 1ZQ1C 1YLXA 1ZM9A 2DNMA 3HO1A 1YQHA 1RTDA 3G71N 1KKXA 4KSEB 4WYWA 5DB7A 3A4TA 2P9NB 4CF5A 5EHHA 2DHSA 5E84A 5IFMA 4QZAA 4BC4A 3AQOA 3OXLA 3K2YA 2PGCA 5JS1A 4AILC 5H1SV 5A0YB 1GLJO 2EZZA 3I4HX 5M1OA 4EHTA 3G86A 2W3SA 4IOAQ 3V5RA 3ILIA 1S5LU 1UEUA 2P9SB 1DRGA 4ZOHC 3EMTA 5A76A 4UB2A 4YDXA 1ZH5A 1CZAN 4FYYB 2B4PA 2W25A 2CXYA 4NLPA 2DTUA 2ERRA 3CDWA 3UDEA 3HSDA 5BOMA 4RNFA 1ZQQA 4ZCLA 4BBYA 2GMHA 1X9JA 4DPYA 2ZJPQ 1YRTA 1BGXT 1RCOB 2VONA 4RPZA 2YXLA 1JROA 3PW7A 4FF1A 2K8BB 3H0PA 4R8UA 2AYEA 1SXDA 3HSTB 4BXOA 4DV5F 3ZEUB 3D0GE 2DCUB 4F3QA 4P52A 2LBOA 3QGHA 3MWBA 3EKSA 4DR1F 3D7EO 2YKMB 2BX6A 2QZ8A 1BA1A 2XM3A 4G9ZA 1DARA 2K8AA 2K4IA 1FD8A 4RW6B 3WKEA 4FJMA 4JI6K 4QZBA 2GQ2A 4M47A 4WE1B 2QC3A 2E7XA 3M6VA 5AZIB 1VQ4N 4BACA 3FEZA 5AK6A 3M2VA 4MJKA 4DV2J 4O5FA 3GYNA 4DTOA 4WFNL 1SH3A 1OYEA 3CPEA 1JXVA 5AQJA 5B66U 5AIAA 2KNJA 5AK5A 3KLHB 3ALRA 1T6DA 3G9CA 1IR0A 3CD5A 5ETOA 2FXUA 3OYBA 3GE9A 4X65F 5HVHA 2HS3A 2GUIA 3SSSA 1YRUA 2M52A 8ICCA 2XMAA 3ZSQA 5MLCQ 3OA9A 5ALSA 3JQMA 2A40A 2O01C 5DLFA 3MEKA 1ATSA 2LEAA 1HUXA 2KTQA 1WYGA 2LQ9A 1MWKA 2BXJA 2QMUB 3F0NA 1KAZA 2J8SA 1GLBG 1TK5A 3QUBA 3B4DA 5J2DA 4LFCF 1U2VA 3CMES 3THYA 2MQ8A 2PMZD 1ZQMA 2FVSA 4DPOA 4DHVA 2KRRA 1U8WA 3SMSA 3V6DA 2XHCA 3HI0A 1YTUA 1VHXA 2ZWOA 4H5RA 4HACA 4BGAA 3TA2A 1BL3A 2HNZB 4P9SA 4ISEA 2BQRA 1RT5B 4ILJA 4EI2A 1YJWS 1N32J 2YWWA 3DLBA 4LVNP 3Q8UA 3WNHA 1HFEL 2RAQA 5IV4A 3FFIA 2QRRA 4OIXA 3ZT2A 1SIZA 2HMPA 1HR0J 9ICMA 3VEZA 1IM6A 3GJRB 1HQEA 4A8MP 3SQ0A 2KHDA 1XMOJ 3QIPB 3MMVA 5AKLA 5DDQC 2BJEA 1FK9B 3ZD9A 2WSEC 1Q78A 2MQNA 1AYEA 1FRXA 3CC4S 1QE1A 5J8YC 3BGUA 5JMVA 3TWZA 1JLQA 3VAHA 2QX0A 1WSJA 2ASPA 4Q0BA 4YY3F 3AUOA 4OI3A 2GO8A 5L1KA 2I1RA 1B99A 4NE9C 2BJ1A 1W2BR 3AXMA 3PX4A 2HRYA 1Z19A 3M6WA 4ZJQA 4FSVA 5KFRA 2GZOA 3MOJB 5ALLA 2GUPA 1H6KX 3SMVA 1IKXA 2VBYA 4LSLA 3CCZA 5D6GA 1MW7A 5H9EK 2DWQA 1NGAA 1RAOA 2DY9A 2NYIA 3GZ7A 5ALTA 1RBOB 2SXLA 4OJHA 8ATCB 2JDJA 2BCSA 4MFAA 3QFHA 2V68A 4ZIWA 2R7UA 4C8NA 2W43A 4GVLA 3ENWA 5B7WA 3ULDA 5D3GB 2Z2MA 4M7XA 3IA0A 4QR2A 2AQ0A 4B3TK 3ZX2A 1OQ6A 5J0UA 1ZZFA 3PYDA 3LGMA 2CNOB 4O3PA 3K8VA 8ICEA 3T41A 5ALMA 2G0JA 9ICXA 5AJ3J 1QHAA 3AT1B 2I38A 2WVEA 2YB4A 1E3MA 4O23A 3V1RA 2ALZA 3CCMS 4OLAA 1Q16B 3OTBA 2NNWA 3F73A 2Q97A 4PXEA 3W8GA 1WUAA 4JS5A 2XNQA 5CQGA 4IOAL 2F9DA 2LA4A 2P6UA 2B3TB 2BGWA 2JRZA 3NMAA 1PK3A 2N4DA 2ZHAA 2HHHJ 4TUQA 2FBVA 4I2HA 2H1YA 3KLGB 5LJ5Y 1NOZA 1KSPA 4NJ8A 4C1NI 3O1BA 4RNNA 2Z56B 1LXNA 4O8UA 1CI4A 3L2WA 3ISCA 1HUOA 7ICQA 1BCMA 2PAVA 1VQ9N 1HQUA 5C24B 1L7OA 4USHA 1HW9A 1ZETA 5ADZA 4LH5A 4DFMA 1N48A 3VA3A 3EPIA 4W90B 4I6WA 2IJNA 5C5JA 1B0VA 5IT4A 3QRQA 4CZIA 4DR4F 4OV1A 3THWB 1WSEA 2KB2A 5DS7A 3FZMA 5B5EU 4H4KA 4DFKA 3I87A 1WACA 3UCGA 5AE3A 1ZXIA 1UA1A 2M8HA 3MMBB 4LBPA 1S4EA 4KGVB 4ED1A 4KI4A 4CM0A 2M9KA 2D3ZA 1S6OA 2I5JB 1V4SA 2LMIA 1S5JA 3FGVA 3SYZA 1SI9A 3FYHA 3NBPB 4EP4A 1BISA 1RBRA 5TKWA 3U1MA 1KVAA 4C4RA 4P72A 2XRIA 1ZQHA 5ALFA 4W5RA 1Z3EB 3QJLA 2Y9TA 2MXYA 4KV8A 1FJ7A 4DR5K 5BPLA 3CJ0A 2I0XA 3UB5A 1V5VA 2VKZG 1S72S 1SIJA 2FLNA 2JLFA 4X62F 2JWNA 1RAHB 3HCXA 1WC6A 4ECXA 3EEQA 4JKCA 4CZHA 3DHXA 1REVB 5T7LB 3VV2B 3AJ2A 2EK6A 3VF4A 3MABA 1NGDA 8ICKA 2L41A 4CBUA 3C2LA 4JK8A 1BY9A 1CZBA 3PW2A 4I2IA 2V8HA 3ADAC 3AO4A 4FLTA 3MAQA 2DR8A 3TADC 2BCUA 3V4IA 2V63A 4GKJJ 3NUQA 3R5CA 2OHDA 1U04A 4R63A 1ZQAA 2NYVA 1NZBA 2GFFA 3QU4A 2XGPA 1GXTA 4XA5A 4F5PA 2P6TA 3WKAA 2K06A 2GMLA 4NLWA 1DOQA 3HILA 2Y0SF 4F5OA 5BXIA 4CHQA 1Y0HA 1B70B 9ICRA 3ZSOA 3DLGB 3EZUA 4F5QA 3D45A 4ZVTB 5J2JA 3L8BA 4C0BA 2XEXA 4KGMA 3F53A 2LI6A 2KRBA 1T8EA 2ZM6F 5KG3A 4EX7A 1U09A 2HURA 3I0RA 4RG8A 5E41A 3PYEA 5CYQA 4ZVOB 4KLHA 4USVA 2CJBA 2Z57B 5J2AA 2WHOA 2IVNA 4MFCA 2YN4A 5CJ7A 2QW9A 2DH8A 4IZ9A 2FY1A 2MKJA 1Z4UA 3IWLA 3FMBA 4RL1A 2G08A 2UXBF 4H5NA 3JTOA 3K89A 5JJBA 1WHWA 2BBEA 2W9AA 3OYFA 3UD5A 3CJ2A 4TUSA 3I56N 4YXJA 1ZQIA 3RB0A 3N28A 3ICLA 3M05A 4ISFA 2RPIA 4MQ3A 2IOFK 3SAFA 4BQZA 3F9MA 3KIOA 3BBBA 2X3DA 1S97A 2CQHA 2GQCA 1MLAA 3HM9A 3GFYA 4QWDA 3PEJA 1S1XA 4CZJA 1C0TA 3Q7BA 1R31A 2AJ2A 7ICJA 2FGOA 4PUOB 2EKYA 1Y9OA 3SENA 1RT6A 3SMPA 3H6EA 4DSEA 3DYAA 3NCIA 1WNEA 3KJNB 4RUCA 2W42A 3S8SA 4X4SA 4C6AA 1KOOA 2HOFA 3N4WA 3JYTA 2ZDPA 2D0AA 4RQMA 2WF9A 5ALGA 4EBEA 1JLEB 2RRBA 4I27A 4QW9A 4A47A 1IBKF 2Q31A 4QOTA 3MCNA 4JBCA 2YKNA 1R8PA 4CO4A 4PHPA 5ETTA 3OYKA 1D09B 8ICVA 4FJ5A 4P4PA 3SAHA 3MCMA 2MB0B 3HHLD 1VHFA 2LMRA 3LYSA 1PC5A 3RMBA 3AAQA 4OX9J 3EDQB 4C11B 3R7BB 3M6ZA 1G2EA 3OR1A 1T9VA 5BJRA 4TU8A 3CJQA 1HNXJ 2OLWA 3GCXP 2EG2A 1T05B 2ZUAA 3M7VA 3OGUA 4KLQA 3QFUA 4F4YA 1NGHA 4HLBA 3HP6A 2LXUA 4I6MA 3WZ0A 2GV1A 3BSNA 4FM1A 2YB1A 4DV6F 2CQPA 1LW2A 3ZC4A 3W61A 2K89A 4PXCA 2DUYA 1Q9XA 2QB1A 3KJFB 1PK1B 1WELA 4AYBC 2EZXA 1RDFA 4WP9A 5CAAA 1ZQZA 4CFDA 2E44A 2K7KA 4KHNA 2YQEA 3ETLA 4LFAK 1SWVA 5D77A 3M30B 4WJBA 2AYMA 4GO5X 4W5OA 3QU5A 5ALNA 2JVOA 3FKBA 3NVYA 3DLLL 1EXQA 1WSGA 1S1TB 2WF6A 4FLWA 1PYTA 9ICSA 3OY9A 4DL2A 4O3MA 1N32K 3HD2A 4M3RA 2I9SA 1FF2A 3X1LB 4QZCA 4KHUA 3JQKA 2E1RA 3MPWA 4CZMA 4PG6A 2F4VF 4IO1A 5CHCB 1HR0K 5M2RA 4DXLA 3ZSXA 3D1HA 4J9RA 2VJ4A 3HSZA 3TJAA 2GVZA 3B78A 4E98A 1F2HA 4CVNE 2KM8C 2P9PB 1XMOK 3PZPA 1Q4RA 4IG3B 2OSRA 1YTAA 4CJFA 2G8KA 2D74B 5DMRA 1UW9A 1T9XA 5I42A 5RUBA 3QINA 4CK1A 1NK4A 2IOHA 4Q2LA 5AXNA 1TQLA 3TVKA 3MHYA 3LGNA 3R97A 5HSPA 2D0BA 1X5OA 4OKKA 2C28A 4Y2KA 1QAIA 2ZVIA 1Q7YT 4O3NA 2VA8A 4C1NK 2PEHA 2QMWA 3I0SB 3MAAA 2EBEA 1WSFA 3DN9A 1GXUA 3MXIA 3H8YA 3K2PA 1UJ4A 4R0JA 4CYUA 1BE4A 4FZNA 1ULRA 3L9ZA 3S3OA 2DFHA 1RYUA 4F3TA 2OD6A 1ZM2A 5F8HA 1WORA 3D1QA 4NPOA 3ZYYX 1SV4A 2YV0X 4AD6A 3RJKA 2CZ4A 3QGGA 1WAJA 3SPYA 3BQ2A 3G2XA 3WKCA 4CF8A 2W40A 2VB6A 1VLBA 2X1FA 1SQFA 2GAHC 4XIUA 4BR4A 1ZXOA 3AOCA 2PN6A 4AL5A 5L1JA 1RWXB 2OEJA 4DR6J 1LXJA 4P0PB 3PR5B 3D2NA 4NLBA 4YP3A 1UVKA 2D0PA 1KD1O 1MWYA 1VSFA 4DQPA 1W25A 3OV7A 3TUIC 1SS6A 4E1MA 2GGPB 2JH3A 2Y0BB 3HHLB 1UFKA 3PRVA 4RW4A 1HD0A 1K1SA 1HNWJ 3ISND 4JI3F 2Z2LA 2G0CA 9ICFA 2B8QA 2FZKB 3LQVA 5EOZA 3U4LA 3O9RA 3DRXA 1FRIA 1UVJA 5ETKA 3NVKA 3H90A 2CRXA 3ZTQA 4U7UD 2E2NA 4JKGA 3H2UB 5G4DA 4C0HA 4CT9A 2E66A 4MMOA 1IJEB 4V19S 4HHJA 1Q5VA 4J91A 4X4PA 3VOVA 1X7VA 2H4WB 2KLAA 3RAXA 2O8DA 1H7WA 2LHTA 1ZD3A 3NCQA 5KT5A 4F92B 1CLQA 4K4UA 7FD1A 4F0MA 1ZPWX 2XLJA 1DHMA 4CF3A 4QIGA 1UPMB 2V8GA 3CCTA 4GMKA 3H7HB 4HCCA 2MJNA 2VG7A 4UB5A 2B9YA 3R2DJ 1ZD2P 3G8QA 2H5JB 1MN8A 3GCWP 4DCHA 2RQCA 3QEBZ 1XNSA 1REGX 3K5LA 1XTZA 1B64A 4FOIA 4A46A 4C2MA 2P6SA 3NGIA 1M1HA 4ZPWR 3VAMA 1RSCA 1VQON 2XMTA 1TELA 2O6KA 1TUUA 3BSOA 1D9DA 1UPPA 1X9MA 5E2QA 3TZXA 5AI9A 1YX2A 2XO6A 2KH9A 1EJ7L 4E0DA 2XZTB 3HVWA 2VHGA 2H51B 2BM0A 1RPLA 3GR1A 2NLXA 1NPPA 2V50A 4USWA 1NLKL 4AL7A 1PAEX 3GIIA 4KPYA 2LKYA 2Q2RA 2MSSA 5C2DA 3GFZA 1TL3A 1H3DA 2UXCJ 5F8IA 2IDOA 3BBCA 2ZIVA 5D49A 3M3ZA 4DTNA 4C7ZA 3IP4B 1S6QB 3ENQA 1YI2S 2CZ9A 3UDCA 3T1YF 5IC4B 2LEPA 1WC5A 4CD3A 4RBUA 3E3XA 3P5JA 1XWLA 4C8OA 4QZGA 3HVAA 4Z4GA 5A0LA 5FP0A 2K7JA 1FI4A 2AEJA 2VFRA 3K0JA 4RNOA 5AKJA 1WHXA 2FJBB 3G4SS 2GJFA 3HULA 4KH0B 1RDCA 2A41A 3K9JA 2DNZA 4ZPTR 1H73A 4YMMA 3H46O 4RTFD 2QA1A 5KAKA 3IRXA 5JMNA 4DQSA 2KV2A 3W5XA 2YBVA 4OZJA 5IQ6A 2QLBB 1EO1A 2ZFHA 1G6BA 3TANA 3SXLA 1P90A 1KQFB 1RTHA 4EIAA 1Q9YA 4R79A 1ZD4A 1SL0A 1V3SA 3KZIU 3SJJA 1TP7A 3VF0B 2CPRA 4QJFB 4GVBB 5B0EA 1TKDA 4BRGA 4JI8F 3CWJA 3BM7A 5E7OB 1BPDA 3RB3A 4GVMA 4FLXA 4WIIA 3FC9A 2R7YA 1RM6C 1SKRA 1KVBA 2FDRA 1CXQA 4JI4J 2JSXA 2IS3A 1RFQA 1NPRA 3KDNA 1TAQA 1HWUA 3PO4A 1JJ2M 3Q8LA 3JXOA 3KNGA 2JEGA 4K2JA 8ICZA 4CBXA 4OCZA 2C3YA 4ZN1A 3N6NA 1CRXA 1ITGA 1WOSA 4RQ3A 3WX8A 2KKZA 2KW4A 4XUSA 3OXGA 3GV8B 1C2PA 1S9FA 2KP7A 4QCLA 3KK3A 1O03A 2NUHA 2RRDA 3OBWA 3E01A 2IOFA 2ZXIA 2B6AB 5AM1A 5LMNJ 5AHXA 3MMCA 4F9OA 3VETA 3VGKA 3SUPA 2VKQA 2WBRA 1X4HA 3MN7A 1BQXA 1EWQA 2E2OA 5HMZA 3W1YC 4UOGA 3MUMP 2O8FB 3Q8RB 4JV5J 2V4QA 3VWSA 3LL3A 3TAQA 5HJXA 3K5MA 3OYEA 2DL0A 1KXPA 1Q86T 1Q79A 4K59A 4DLGA 3T6JA 3AH6A 2J9DA 5JVGL 1IG9A 4MAKA 2FSJA 1VSEA 3H20A 1E6VA 1S79A 5E79U 1TKXA 3SEOA 4LF8K 1B9DA 2HS4A 2OHFA 3TUZC 2Y0SD 1QQNA 2E1FA 5KFIA 3W9IA 3DWLA 3LP2B 3LM2A 2NSBA 3MEGB 5B0DA 3BS5B 1PVQA 3N7RC 1QJHA 1VBYA 4UW9A 4K4GA 8ICPA 3K75D 5KI6A 1EKSA 4MTPA 1RT1A 4K4XA 3ET6A 3L3CA 5CCLA 4RUAA 2XWXA 2KOBA 3WX4A 3EE3A 2DXEA 4LBHA 1P6TA 1FNOA 2XLKA 1RA6A 1N62A 3C15A 1KLMB 2PYJA 4DUYJ 3ILJA 1OW5A 1J5EJ 4LR7A 4FE3A 4OX9K 2P51A 5KFAA 2ZBCA 3PYGA 3V81B 4C4TA 4ER8A 3I32A 2F1FA 2KI2A 4YHHJ 1HNXK 3HFZB 5F0WA 3QE9Y 3H2LA 3ITHB 4JKAA 2C2MB 3ATUA 4PL8A 2GOLA 4B9UA 5L38A 5A8RB 3UKRA 4NMLA 2B4VA 4DX8H 1NKCA 2OEMA 2BCQA 5J8YA 3HHDA 1LKYA 4EUVA 2A3VA 2FZGB 4KYZA 8ICMA 1XMQJ 2NXNA 4JOUA 3DMJB 1HEKA 3SCLE 3FR0A 3KJVB 2J5AA 3BN7A 2QGFB 2YWGA 1LNQA 3W3DA 2KYXA 1RGVA 1WTFA 1S0OA 1LWFA 2F1HA 3VERA 1VISA 4B1XB 3C7NB 4FM0A 2IAJB 1OUQA 1L3SA 1FFUA 1S0VA 2OD4A 2K4PA 2HMIA 2P9LA 1RTJA 4B9NA 5EVZA 1JLBB 3TJ8A 4I2AA 1HYVA 2N1RA 1UW4A 2CXEA 2KVSA 4DLEA 3IM8A 3H3OB 2OPPA 1FFVA 4CDGA 3I55N 5ETSA 2B8PA 5HHHA 4LMZA 5IIIA 1UWBB 2NXEA 1SJ3P 3BF3A 2OH2A 4LY7A 2HFSA 4UBCA 3FSIA 3Q8YA 3QYPA 2RUGA 4BC7A 3RRKA 4X4QA 1N36F 3GZFA 2XS5A 2YQ3A 2FHJD 4KFBA 5FLXU 4BS2A 3H7IA 3TSPA 2N7YA 3G10A 1PUZA 3LK9A 4CFCA 4JI6F 2RILA 1SBRA 3QMQA 5JUMA 3UVJB 3JTPA 2QYGA 3UD4P 1TE2A 2HZVA 2A1JB 5HRSA 1GNKA 2F65A 1BO5O 4GVEA 3Q8VA 3IV6A 1XO0A 2QWOA 1ZRMA 3LP1A 2RKIA 2XY8A 3NEKA 4IWVA 3D3CJ 1X2IA 3QZ8A 4RT3A 4HI1A 3PSIA 2E4LA 5HAOA 2EFNA 1AUSL 3WEEA 4ZVGA 2MPUA 2W11A 1VRQC 1Q3VA 3FRYA 4JYAF 4YB5A 1RT3B 3BKUA 5EN1A 3C6UB 2IPOB 4A8KA 3D2EB 7ICSA 3QIDA 4XTTA 5FIIA 2QEXN 2ZBRA 2NRWA 3TARA 4ZP7A 3CQXA 3H25A 2J8AA 3V7LA 3MXHP 3MM9B 3KMQA 4MDAA 5J2QB 1SC6A 1CBKA 3FVYA 1IR1A 3ZZYA 4MEXA 4CO2A 1HNWK 4UOFA 4AM6A 2GA7A 4Z37A 5CB1A 1YHQN 2Z0GA 1SJFA 3G6YA 2N3OA 4M3UA 4BRAA 2I2YA 4AHVA 2DB1A 3KVGA 3P3DA 2ZJQQ 1FEEA 4RCHA 3UO0A 2F8SA 1YF5L 3E8OA 4XH1A 4LZDA 2A3ZA 4FPAA 4KBIA 5DRKA 3MDAA 4FS2A 4HR2A 4ILHA 4J9SA 1T9YA 3KWMA 2B0GA 4N8OA 2E88A 2KFNA 4FJHA 2IIRA 2UP1A 5LJVA 5IIMA 2DEIA 1SVDA 5D15A 3KFUF 2QLFB 4CEQA 4B3OA 2BDPA 4YEAA 2ISOA 3ZTPA 4LR9A 1SH2A 3HT0A 1VSHA 4EENA 2XG8A 4NLQA 2DFEA 3ULEA 2QWNA 2G06A 5AK4A 2LXIA 2DHAA 1U1MA 1SQGA 2W9CB 3IGNA 1NBWA 3CJRA 4CCHA 3AQFA 4FK0A 3KYLA 2VIXA 4RPFA 3MBYA 2IJRA 1JKHB 2DHGA 2E1PA 2MU2A 4KBOA 4H0XB 1ZQTA 1QSLA 4A2AA 4PXDA 4TUPA 3TR8A 4NASA 2CIMA 3NTUA 2YNFB 3L3UA 3MDCA 4H5TA 5BR8J 4I2PB 4O5EA 4BRMA 5KFQA 3IXQA 2I6WA 1V5IB 2HG4A 5L46A 5AM0A 2HDOA 4B3TF 2W3RA 1VQMN 3FSXA 2CQBA 7ICOA 1IXKA 4MN4C 1C0UA 4OYZA 3C3LA 4YOTA 1R0BG 1RILA 4DR7J 2OANA 3LGHA 3R3LA 3JSMA 3H1VX 2VDHA 1RTDB 5BRDA 3FM9A 1S0MA 1WD6A 2D69A 1KHWA 3HKZF 3R9LA 4PG4A 2IHMA 4QNLA 2C1EB 4M3TA 3BPSP 4AHTA 3KK2A 1G99A 1R89A 3FCWA 3RMCA 2WB1C 2YY3A 1ZBLA 2E5IA 1Z05A 4YB7A 4MYUA 4M6WA 3ZT0A 4DG1A 3DDIA 3GILA 4P73A 4E3SA 2HAFA 2F7TA 2B0CA 1ZA1B 1ZBUA 1FHTA 2ZNZA 2HBRB 1KFSA 1RAEB 4O3RA 2HQFA 1CXUA 5CRXA 3QPIA 4CGIA 3SV3A 2E8NA 5CHIA 4LF1A 3KHRA 4E7LA 4CLKA 1AZSA 4ID5A 3FZFA 2Y1LB 3PFEA 5DB9A 3W65A 5HL7L 2D7SA 1OIAA 5CE3A 3RMAA 2W55A 4Y2IA 1NLVA 2ZZTA 3FZHA 3KKRA 4R8UB 5J2FA 3PJXA 5K9FA 1WUUA 3OL8A 4BXOB 3HM8A 4KLOA 4KN4A 4UBBA 3UWTA