3PV8A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddttp-da in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3pv8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3pv8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pv8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3pv8A01
4J9QA 4I2GA 3NFAA 1C0UA 2DFEA 1ZQRA 1XSPA 4KFBA 5J2QA 4YR3A 4PGXA 1SL2A 3L2WA 1MC8A 1TAQA 4J2AA 3ZDCA 2XRIA 4F4ZA 4FJMA 3GV7B 3MXIA 2AGOA 1C0TA 5L9XA 3BGRA 1HRHA 4FLYA 5J0WA 5KFCA 1BI4A 1S1VA 3JPNA 3PX0A 1JX4A 2G8KA 5J2GA 1U48A 2RDJA 2I5JA 4DTPA 5JS1A 5KFLA 4YXJA 4TUPA 4O0IA 4G3IA 3C6UA 1TK0A 4EYHB 2LSNA 3HT3A 3LAMA 3C1YA 4RU9A 5IIOA 1SV5A 4C8OA 1Y88A 2EHGA 3P5JA 4EP5A 1X9MA 2ZTDA 5KG7A 2OZSA 4Q5VA 1T4GA 3VQPA 4DU1A 5CYQA 3AO3A 2BCQA 4CJ3A 4RQ8A 4I9QA 3UQ2A 9ICIA 4RNNA 3RJJA 4BACA 4TUSA 5IINA 1RBTA 1ZQVA 3Q8LA 3HPOA 4UAYA 3C2KA 4N47A 3BQTA 5CZ2A 5KFVA 3MR2A 5KFXA 1RT6A 4IG0A 2KN7A 5KFIA 4EYIB 4IDKA 2XCAA 2VA3A 3ITHA 4Q43A 4M3UA 1RT2A 4JS5A 4BE2A 3JPTA 2QKKA 3KD1E 2P5OA 1KDHA 3PMNA 4KLOA 1RYSA 5J2JA 1TGOA 2YNIA 1RCHA 1NK6A 9ICXA 4IFYA 2F8SA 2RF2A 5DG8A 3VQ5A 1RBUA 3ZSQA 9ICJA 4NLNA 4LD0A 4I2FA 4JRQA 5L1JA 5J2CA 1A77A 4ELTA 1VSMA 9ICEA 4RQ0A 4E1NA 4RZRA 2QXFA 3GQCA 7ICQA 1NOYA 1Z3EB 4PHPA 5DG7A 3RH4A 4W5OA 3GIMA 3KTQA 3HJFA 8ICXA 2C2EA 1UT5A 4GLXA 1HQEA 4B9SA 1NOZA 2VG6A 7ICFA 4LH4A 4UQGA 3OHAA 4KLSA 5J0UA 1JLGA 5EWEA 5HP4A 4DTXA 4M0AA 3CFOA 3ZT2A 3VQ6A 2X78A 4CE9A 1XSLA 8ICAA 1QE1A 4MF2A 2ZJ5A 4JWNA 4M47A 3DOLA 4GMJB 3NCIA 2C22A 3PX4A 2HNZA 4NYFA 3SQ1A 1CUKA 4F3TA 4W5QA 4R8UA 3ZT3A 2VG7A 4M3WA 2Y1JA 2HHSA 2MUTB 1SUQA 1Q9YA 1GOAA 3ALYA 5DQIA 2PXIA 1LV5A 5KFQA 4KLMA 4F2RA 1T7PA 3CM6A 3RTVA 3DLKA 3ISCA 4EEYA 5CR0A 2ZE2A 2YNFA 1JL2A 5DB7A 3TI0A 4FLTA 2XY8A 4Y1CA 4DOAA 9ICAA 4DTJA 4RUAA 4UBBA 1RT5A 8ICMA 3DLGA 3AVHA 1Y97A 3WNFA 1O1WA 5J2PA 1VSHA 4CJLA 3S3NA 3ZSZA 5KG2A 3RBDA 3L3UA 4OLBA 1WSFA 4Q45A 4DU3A 3NF8A 4P4OA 3V6JA 4QAGA 2FMSA 2NRTA 4CEQA 1KVBA 2HHUA 4I2AA 3RB0A 2P6RA 1LWEA 5IIIA 3ISDA 2KTQA 3HP9A 5J0QA 4I7FA 4F92B 1J53A 3FYHA 2V4RA 2KFZA 2XGQA 3OY9A 1JLBA 4CJUA 4IR9A 2E6LA 1KFTA 4LSLA 4YD2A 1RBRA 3GIIA 1XI1A 1BI4B 1WSJA 2R8HA 4AHSA 4HCCA 1RDAA 4CGJA 2ZJAA 3D0PA 4I2JA 4PPXA 3UXNA 1AROP 4QZFA 1JXLA 3VQ8A 4QWDA 4CEDA 1HUZA 1RBVA 3K5MA 8ICNA 2JZBB 1UAXA 5KFGA 3U6FA 5DBCA 5F9NA 4B9VA 3F73A 3B6PA 5KT5A 4F5QA 2ZUBA 4RQ1A 2NRZA 1BVSA 3PW0A 3ZSXA 1IKYA 4TQSA 3GDXA 3CFRA 5FRNA 4RT2A 1MSWD 1TL1A 4XQ8A 2YNGA 3HSTB 1RDBA 4H4OA 4F91B 1BIUA 1HYZA 3V72A 4PUOA 4UAWA 2VA8A 2G8WA 3ZCMA 4ZHRA 2G8IA 4CHOA 1RXVA 2Q3SA 3EY1A 3L2QA 3H08A 5BPCA 8ICEA 5L1KA 3DRRA 5KRTA 3O3HA 2KZZA 3L3VA 1VRTA 4K8ZA 5CJ7A 4ED8A 4W5NA 8ICFA 3IHQB 3RJIA 4BDZA 1W0HA 4J9LA 3FFIA 1BISA 2E4LA 4DU4A 3QETA 1U4BA 4AILC 4FJXA 3KD5E 4DFKA 2X6SA 1RTDA 3HL8A 4F3OA 8ICJA 2WONA 3LANA 4YR0A 4BE0A 4DSFA 3O3FA 5EWGA 3B6OA 2IS3A 4RW7A 2ZUCA 1MQ3A 3HXMA 2FBTA 3VQ9A 4HVJA 4K4GA 1KCFA 4LY7A 4DEZA 3ASMA 3OS0A 4Z6DA 4I29A 4E0DA 1T3NA 3AA4A 9ICKA 1XO1A 4KN7A 1S0VA 5CB1A 3Q8RB 3QINA 3S3OA 2W9BB 4Z4EA 3LDAA 1SKWA 1J54A 4KHYA 1C7YA 1SL1A 3BJYA 2R8IA 3ZDBA 5C25A 4QZEA 3ZD8A 2PZSA 1MU2A 4CEBA 4ID5A 4LH5A 3OHBA 3ZSOA 4PGYA 3KLHA 1D8LA 3AVJA 4QZAA 5HLFA 3V7LA 3RMBA 2RPIA 3UXPA 4F50A 4C8LA 5KG6A 2DFLA 1ZQYA 4ED6A 4ELVA 3DOKA 7ICJA 2FC0A 4F4WA 4CERA 1S97A 3L8BA 4L8RB 1ZQBA 3OYGA 3T19A 4FJJA 3TQ1A 4IQVA 1XC9A 4O3PA 4DWIA 1ZQLA 4C8NA 3EWAA 4CJEA 1NK5A 3AA2A 1ZETA 3DLEA 9ICOA 4NM2A 3KK3A 2ZTEA 4J2BA 4CGDA 3SUPA 4CK1A 4M3XA 1Q9XA 7ICGA 4KAZA 3RJGA 4I2EA 1FKPA 1XHXA 2BQUA 1SL0A 3HYFA 2FBYA 4DG1A 4EP4A 1JIHA 4ECUA 1JLEA 1S6PA 4I2IA 7ICTA 4KHWA 2ZQBA 3K58A 4C8MA 3KHRA 1GOCA 4EZ9A 5KT6A 1I3AA 3G10A 3SJJA 1D8YA 3RJKA 3TAFA 4ED0A 1BPYA 3GIKA 2HW3A 4CF2A 3KIOA 5HRSA 2XCPA 3TAMA 4J9NA 4KLJA 3OGUA 3KLGA 3K5NA 4KI4A 3SPZA 3AVMA 3V81A 1ZBLA 1S77D 3CQ8A 3AA5X 1ZQDA 3QO9A 4PHEA 3UIQA 2PI5A 3SV4A 2OPSA 3QLHA 3DLBA 1WCLA 4BWJA 5DQHA 4G1QA 4OKJA 3LDSA 1NK8A 4P2HA 4IFVA 4DFJA 2JLEA 1NJYA 3MEEA 1ZQOA 3VQEA 4FBUA 1VSDA 4GXKA 4KMUA 4YR2A 3TFRA 1KLMA 2F8TA 4KTZA 9ICTA 2IHNA 4MF8A 2Z1IA 4M41A 1NK0A 2BPCA 2MAXA 1KTQA 1HQUA 3LAKA 9ICCA 1ZQNA 4QCLA 1X2IA 3JPRA 4QZDA 2HNDA 4Z4IA 4AHUA 3HW8A 3T5HA 4IQUA 3PW2A 4KTQA 3RAQA 2DY4A 4IRDA 1B9FA 7ICHA 4AHTA 1NK4A 1S1WA 3BQ0A 2F96A 2W8KA 4KI6A 8ICPA 3K5LA 3KHHA 3OYMA 1ASVA 5J0SA 2D0BA 4R63A 3LK9A 8ICKA 2C2DA 5DDMA 4DL2A 3QEXA 4KHQA 1A5WA 4YCXA 4ECQA 3NGZA 1ZQPA 4FJGA 2G8VA 4B9LA 1JMSA 4BXOA 1WN7A 2PYJA 1YVUA 4Q44A 1RZTA 1SZPA 3PR5B 3TR8A 2VWKA 3JYTA 2M9NA 1A76A 3M8SA 2ISPA 4B9UA 3DM2A 4LZDA 2BE2A 1KRPA 8ICLA 4CF8A 1ZQZA 5IIJA 1IKWA 1ZBIA 3TFSA 3JPSA 2E6MA 1S1UA 3QESA 3B0XA 4MEYA 3PVXA 3VQQA 5KFSA 4O5BA 4CJQA 3GFKB 2DPJA 4FYDA 3O4NA 1GOBA 4E1MA 3M8PA 3GILA 4QZBA 3P1GA 3SZ2A 4NM1A 4I2PA 1K1QA 4YNQA 3SYZA 4PHDA 3RRHA 9ICBA 2HMIA 2RDIA 5FDLA 1CZBA 4CFDA 4KLGA 3KHGA 2R8GA 2OA8A 1CEZA 5KFDA 4CJPA 5KFAA 2PY5A 3G6XA 5DBBA 4NCBA 2BHNA 1ZQAA 1VRUA 2RKIA 3O4QA 4FLWA 2W9BA 4M9NA 5KFRA 3AVLA 2G8HA 3HPHA 4TSXA 1HNVA 1LWFA 1ZQXA 3TAQA 1L3TA 1QQCA 3NGYA 4ZH4A 4PA1A 3ETLA 1CXUA 1EX4A 4QWAA 3CFPA 3SPYA 4CFBA 4N5SA 5SZTA 4Z6CA 4O5KA 5CY4A 4ZTFA 2IBKA 4K8XA 5HHIA 1S9FA 4YVZA 4F5RA 3C23A 4OPJA 3T5JA 4DQIA 3PNCA 3PMLA 2C2RA 1EP4A 4O5EA 3OYCA 4PGQA 3RWUA 5KFMA 3EPGA 4M9JA 1RTHA 4RW9A 4DS4A 5J2FA 3QZ8A 9ICRA 4DTMA 5KFTA 3SQ2A 2D5RA 5KG3A 4UB3A 4J9SA 1QSYA 2YHAA 4KV8A 4ECYA 9ICSA 2ASDA 5KGWA 3V6HA 2W9MA 4Z4CA 1L3SA 2JEFA 4F5OA 1DGSA 4KLHA 3RBEA 4FLVA 4HYKA 4E19A 2P51A 1YTUA 9ICNA 2HB5A 4MFFA 4M9GA 5KFJA 2QK9A 9ICLA 4RQ6A 2AGQA 2VWJA 1NKEA 9ICUA 4NYNA 4CJFA 4YFKA 1QTMA 5KG0A 3LWLA 2HHVA 1RYRA 4ECVA 4KLUA 2F1IA 1KVAA 5J2HA 4CHQA 3I8DA 4RQ2A 4AHCA 2HVIA 3K4GA 2VG5A 4HCBA 3RH6A 4BXOB 3OVNA 3WNGA 4O5CA 1ZBUA 1REVA 1JLAA 4B08A 1TKZA 5KFBA 3JPPA 2I9GA 4DL4A 2JEIA 3N4MB 2XY7A 3H40A 4QWBA 3S3MA 2IA6A 2OWOA 4FJ8A 4DFPA 2B6AA 4JLHA 4QZCA 3PW7A 1QSSA 3OS1A 4YD1A 3NF6A 4XRHA 4FK2A 4UBCA 4FVMA 3MFHA 2B21A 4N41A 3ZT0A 4RQ4A 1TKTA 4FK0A 4DL6A 4KPYA 3FDSA 4QZHA 4DSKA 1RNHA 2P66A 2FPLA 1VSJA 4M9LA 3OJSA 3RJFA 3PW5A 3VQBA 2HVHA 4JWMA 1XSNA 2I1QA 3Q8KA 1Q8IA 4P4MA 2FLNA 8ICCA 3QEVA 1I39A 2R8JA 3PY8A 1U49A 1ZQTA 2JZBA 4YP3A 4ECZA 4ED2A 2IAJA 4XA5A 5IIMA 8ICHA 4UB5A 4JRPA 3C1ZA 4O3NA 2BCRA 2FPKA 3AV9A 9ICMA 1BPXA 1LB2B 3T5KA 2X74A 2OPRA 3KKSA 3RJHA 4N76A 4XIUA 2BCUA 4CESA 4CCHA 3V7KA 1IKXA 3G6YA 2DTUA 4QZGA 3C95A 3QZ7A 4ICLA 4BGDA 1NJZA 1X1PA 3HX0A 3DRSA 1YTAA 4CFAA 1R0AA 3M8RA 1BHLA 4CJ5A 4E7JA 1A5XA 4CHNA 4KN4A 2UVRA 4M2YA 2XHBA 3H4DA 3ZT1A 1J9AA 8ICBA 1WNSA 3MGHA 1QLNA 3OYFA 3OYLA 3SUNA 4RPYA 2YNHA 3ISNC 3N97B 1N6QA 3T3FA 4O0JA 4E7KA 2PFQA 4FLXA 1BPBA 3HP6A 3SCXA 4BDPA 3MEDA 1CXQA 1RT7A 4LVSA 4IQWA 1VSLA 4R65A 7ICEA 2O4GA 5D49A 8ICOA 3LP3A 1LW0A 4IR1A 3DMJA 4FZZA 1IO2A 1CLQA 3K59A 3KLIA 1C1CA 4M3TA 1ZJMA 3RR7A 3L2RA 1UOCA 1WSHA 8ICYA 4DL3A 3IG1A 4OGEA 3ZDEA 4FJ5A 3RRGA 2ASLA 4CJWA 3C94A 2DPIA 4CHZA 1BQMA 3RMDA 4B9MA 1RT4A 2MUTA 4CK3A 7ICRA 1S0MA 3VA3A 4RNMA 4OJRA 9ICPA 4OKKA 5KFPA 2R7YA 1XU4A 4AHVA 3IS9A 3V6KA 4CECA 1HJRA 3L2UA 5KFFA 4CJKA 3MDCA 1SKSA 5J0OA 4FZXC 1TVRA 3ISBA 3PX6A 5DQGA 4YMOA 3ZT4A 3ZDAA 1QSLA 4CEOA 3V4IA 3LWMA 4DLGA 3K57A 3AVBA 5DKWA 4QW9A 2UVUA 5HNKA 4YMNA 4KLLA 5T7BA 4CF0A 4JV0A 2KZ3A 4EBEA 8ICVA 3OYKA 2WTFA 7ICPA 4XUSA 4RUCA 4NLZA 4ED7A 5KG1A 2JGUA 4RG8A 2BCVA 3GIJA 3MECA 3K75D 1S1XA 1C1BA 5CWRA 1TV6A 3C2MA 1NKBA 4NLKA 1C6VA 5EOZA 4DLEA 2PFOA 4F93B 5SWMA 3TARA 5DG9A 3ZDDA 1WSEA 5D4BA 4DTRA 4B8AB 3AU2A 3C2LA 4DTSA 1COOA 3LP2A 5J2EA 4J9RA 4ECSA 3MDAA 2J6UA 4FO6A 1NJWA 4TQRA 3NH1A 2FPMA 3KK1A 1ZQCA 2ATQA 3T1AA 1ZQIA 1ZQMA 4MEXA 4FLUA 3JPQA 1DLOA 2AJQA 4I2BA 2A1RA 1T05A 3NBPA 4RW4A 5KFKA 3NAEA 4BE1A 4FK4A 3QEAZ 2GBZA 2YHBA 2BQ3A 4M3RA 3P83D 5IILA 4FLZA 7ICMA 5KGXA 3ZD9A 4DSJA 2Q0ZX 4QOZB 1ZQSA 3I0RA 4I9LA 3NGIA 5KFUA 2KZMA 5C42A 4E7IA 4CK2A 2WOMA 2BKEA 3H4BA 3RMAA 3BQ2A 4JV2A 1RBSA 3QIPA 3TABA 4Q0BA 3H8JA 5HRPA 3LP1A 2NRWA 1ZBFA 3KJVA 4R5PA 4KREA 5I3UA 4GC7A 3NE6A 4FM1A 4DL7A 2XY5A 4HHTA 4M6WB 4YQWA 5E41A 5KT2A 4J2EA 3C21A 5K14A 4HUEA 1QHTA 4FJ9A 2R8KA 4N56A 4FXDA 4QW8A 3MR5A 4EBCA 4CEZA 2ZJ8A 4B3OA 4OVLA 3PO4A 1EKEA 1V9PA 3VQCA 3HM9A 3NF9A 4F4YA 3NHGA 1IXRA 1BPDA 1WSGA 3MBYA 3VQ4A 4GXIA 1D9DA 4UB2A 1N56A 4M9HA 5BOLA 4LZGA 4HUFA 3THVA 1Z00B 1T8EA 4O3SA 9ICVA 1TKXA 1D9FA 3RB6A 2H5XA 1RDCA 4J9PA 3AO1A 2BGGA 2ATLA 2NRXA 2P1JA 1BQNA 4RPZA 4FS2A 2W9CA 1WLJA 3AVNA 3SI8A 4I2DA 4RT3A 1ASWA 3IAYA 5DLFA 5J2BA 3DI6A 5HRRA 1S5JA 3C6TA 5HMMA 4DOCA 5DBAA 2HNYA 4CEAA 5KFWA 4ECTA 4MFCA 4LSNA 1UA0A 3SQ4A 4RW8A 4EBDA 3IM1A 5JS2A 3VN5A 3V9WA 4CIGA 5J2MA 2ALZA 2UVWA 4PY5A 3O3GA 1DTTA 3DLRA 1KEJA 3ZSRA 2A1JB 4CHYA 1JLCA 1KLNA 5KG4A 1CZ9A 2NRVA 1BCMA 5BOMA 1ZYQA 1ZBHA 8ICUA 5IIKA 1H38A 4O55A 4CHPA 3LALA 4MQ3A 4GC6A 3PV8A 2IDOA 2A1JA 5KT3A 3QEBZ 4KB1A 3HVTA 4OPKA 1JL1A 2FLLA 1L3UA 8ICWA 2OYQA 3MXMA 1HYSA 7ICNA 1JXEA 1ITGA 1U47A 1RTJA 2ASJA 5KFEA 3TWHA 1U45A 1VSEA 4AH9A 4FM0A 3WNHA 3QEPA 5D3GA 4FCYA 2V9WA 4DMNA 2W42A 1Z00A 3MEGA 3CM5A 4KTWA 1WAFA 2BR0A 4H4MA 1K6YA 4KHUA 3GV5B 3NGDA 2B4JA 3ZSWA 5CZ1A 2BCSA 2OZMA 4KHNA 5HBMA 5DLGA 1KFDA 4IRCA 4OLAA 4ECWA 3CYMA 1TL3A 4QZ9A 4DQSA 4E7LA 4R64A 1TFRA 1RT1A 4CJSA 2AGPA 1IG9A 3U3GA 3RB3A 4RQ5A 5KFZA 4DF4A 4M3ZA 3HPGA 2Y1IA 5KT4A 9ICGA 3QNOA 1RXWA 2XGPA 4KLEA 1S0NA 1NJXA 2LYHA 1QS4A 3OYDA 2J6TA 3AVGA 4RQ7A 4B9NA 3I0SA 3M9MB 1WSIA 4O3QA 4Q8EA 3Q8SB 1BIZA 2KW4A 4Z6FA 1TV9A 3PR4A 5DMRA 1ASUA 1UT8A 3NH0A 3ORYA 2QKBA 9ICFA 2FMQA 1XWLA 3SUQA 3AO2A 3QNNA 1JLFA 4DQRA 2UVVA 3K5OA 1L5UA 4O44A 4ED3A 4UAZA 3WNEA 5J1EA 4CJRA 1G15A 1Z26A 4I2HA 5J2DA 1VSFA 1B9DA 3QEWA 4DTOA 1Z25A 4RW6A 4E7HA 2BPFA 8ICTA 5J0XA 1S1TA 3DLHA 3DYAA 3OSPA 2PFPA 3MR6A 2FLPA 5J0TA 3LPUA 3G6VA 3OYNA 4CJVA 2W9AA 1ZQKA 3JSMA 1RDDA 2OPQA 4FJHA 3MFIA 2ZUDA 4X5VA 4O9MA 4CEEA 1ZQJA 1EXQA 4FJLA 1S10A 4FJNA 3MR3A 3NTUA 5DB8A 3Q8PB 1TAUA 1ZQHA 4P4PA 4H8KA 2ZD1A 4DTNA 2FBVA 2D0AA 2JEGA 4ZTJA 2IOCA 5J29A 5KFYA 2KQ2A 2AQ4A 4QWEA 4DS5A 5EU7A 3JPOA 3TAEA 4KO0A 4DTUA 1RT3A 4E89A 3OYEA 1HJPA 5TZVA 5I42A 9ICWA 5DK5A 1PZNA 3RAXA 5DB9A 1S6QA 1JN3A 3SI6A 4M42A 4FJIA 5CA7A 2DFFA 2BPGA 4CGGA 3TAPA 2J6SA 3AVCA 3VQAA 5J2KA 4DO9A 2FMPA 1LAVA 9ICQA 4CEFA 4DQQA 4KLIA 5J2NA 3LZJA 5KT7A 3H8WA 3AU6A 5J0YA 3MGIA 4CFCA 4FZYA 4ECRA 2HHTA 4DOBA 5D46A 4QZIA 3OJUA 5F9LA 1UWBA 4CF9A 1A5VA 1LAWA 4NLGA 4Z4FA 4PQUA 3B0YA 8ICSA 3AVIA 1W9HA 4MFAA 2XC9A 4GXJA 1MQ2A 4J9MA 1TVAA 1S9EA 2RN2A 1EXNA 3IRXA 3S9HA 3U3YA 3V9XA 3BDPA 5KFHA 3C5FA 4DQPA 2GWSA 2Z1JA 5CYMA 4JK1A 4CGIA 3SQ0A 4IKFA 2IHMA 4KRFA 3V1QA 1XHZA 2YKMA 4WE1A 1X9WA 3EZ5A 4ECXA 1C1AA 4I28A 3NH2A 4BDYA 1RPLA 4J9OA 1VSIA 3AA3A 3VQDA 3RMCA 5DGBA 5HP1A 7ICOA 1BPEA 2XY6A 5DGAA 4O3RA 7ICUA 1L3VA 5J0RA 5KFNA 5L1LA 5DDYA 3V9SA 1U04A 5KG5A 4Z4GA 1ZQEA 3ULDA 5C5JA 1HPZA 2IGIA 2JEJA 3M9NB 4C8KA 3PUFA 1ZJNA 3KK2A 1DTQA 4TUQA 1BGXT 7ICKA 4CGFA 8ICGA 3VA0A 2GUIA 4CJTA 1B43A 4I27A 2VA2A 1RILA 4YXMA 1FXXA 2AU0A 4I2QA 1RTIA 1ZQUA 2GV9A 5L1IA 5JUMA 1X9SA 1JKHA 4M45A 2VANA 5C24A 4O3OA 5HHHA 4F5NA 3CG7A 3QE9Y 4I2CA 2Z1HA 3OYIA 3RJEA 2O4IA 3OSNA 8ICIA 5EWFA 1XS9D 1ZQGA 3V6DA 3OYJA 3NDKA 1KFSA 1LWCA 4DL5A 4FJ7A 3HO1A 1WCNA 3MABA 3T5LA 4J2DA 5HMLA 1NK7A 4YFUA 1IH7A 2YV0X 1IKVA 2P5GA 1TKDA 3L2VA 1S76D 7ICSA 3SNNA 3VQ7A 1J5OA 4JUZA 7ICLA 1HYVA 3NF7A 3V1OA 3SUOA 1S9GA 4QWCA 1FK9A 4KB0A 3LP0A 1F21A 4IBNA 3AUOA 3M9OB 2ITGA 4HUGA 3QEIA 3HK2A 4FJKA 3UQ0A 3EPIA 3EYZA 5FRMA 3OYHA 3LZIA 5J2AA 1B22A 5KTQA 4FS1A 1K1SA 4KITB 3KLFA 3AO4A 2ZTCA 5J2IA 5J0PA 1YT3A 1VSKA 4FW1A 4CIEA 1ZQQA 5KFOA 2IC3A 4DFMA 2AQ0A 2BGWA 2BDPA 4KLDA 3LPTA 1ZQFA 4FW2A 1BPZA 3GV8B 4CF1A 4W5RA 2G8FA 4HTUA 3DRPA 4YG2A 4MFBA 3M8QA 4OKEA 2HHWA 3RB4A 5CHGA 3ZSYA 4Z6EA 1NK9A 4K4IA 2P6UA 3RR8A 4DSEA 4R8UB 2NUBA 2X6NA 3KLEA 2B5JA 1EETA 1DOQA 4DF8A 4ID1A 3OYBA 9ICHA 4B8CA 3TAGA 4KLTA 4OGCA 2V4QA 2F1HA 3V7JA 2YKNA 1T03A 8ICRA 1JXBA 3TANA 4F8RA 3UXOA 2HHQA 3AVAA 4NXZA 3PW4A 1TK5A 4NCGA 3OYAA 1NKCA 3RH5A 3V1RA 3A2FA 4RQ3A 5FROA 1WAJA 1HUOA 2ISOA 1BL3A 2F1JA 5CP2A 2D0CA 4KLQA 3H7IA 3BQ1A 3EW9A 3SV3A 2HHXA 8ICZA 4KHSA 4UB1A 1N5YA 1NOMA 3K2PA 3E01A 4F4XA 2PYLA 1IM4A 2BANA 4NY8A 3F9KA 1JLQA 3V9ZA 3D45A 1HNIA 4UB4A 4PHAA 4B9TA 4Z0UA 2OPPA 3Q8QB 3QERA 4YN4A 2EX3A 4PWDA 4F5PA 2FBXA 4KLFA 1C0MA 4GVMA 3C5GA 4ELUA 1B92A 4Y1DA 1HMVA 4M6WA 4J9KA 4KKOA 4E3SA 3AVKA 4BWMA 4RNOA 4CJ4A 5KRSA 3H8SA 1FKOA 1S0OA 4FBTA 2PFNA 3OS2A 4DSLA 4IG3A 5KI6A 2ETJA 4CIFA 4IRKA 3MAQA 2XO7A 4NCAA 1SKRA 4YMMA 3AO5A 2W8LA 1VK0A 4JS4A 3V9UA 4TURA 4Q8FA 7ICIA 1KSPA 3ZSVA 4GW6A 4O4GA 4JV1A 3Q8MA 1LW2A 5HRNA 4IQTA 3UPQA 4R66A 2BQRA 3HVRA 4K4HA 4EZ6A 4QZ8A 3AVFA 2C28A 4F2SA 3G0ZA 5DB6A 2A1SA 4F4KA 2IMWP 2Z1GA 1U9LA 1D5AA 3HWTA 2G8UA 5HROA 4CGHA 1UA1A 1N48A 3KHLA 2W9CB 3KKRA 4M3YA 3MXJA 1BCOA 4FM2A 3E2EA 4W5TA 4M04A 4PH5A 3QIOA 2KFNA 2PI4A 4DSIA 3PO5A 1ZQWA 4Z4HA 1KVCA 4AHRA 8ICQA 7ICVA 4ED1A 1TK8A 4RPXA 2DFHA
chains in the Genus database with same CATH superfamily
4X84A 3TA0A 4PWWA 1C0UA 1U2VB 1ZQRA 5CD4A 2ZC4A 4Y2MA 1XSPA 3BGFA 3THYB 2K1RA 2GGPB 4FL9A 4YR3A 4PG4A 1RAFB 5AM4A 1SL2A 1MC8A 2YTCA 5IC4B 3CDUA 1TAQA 4A8FA 4J2AA 2NZTA 1YIJS 2YQ0A 3BGRA 2ITMA 4FYXB 2FC8A 4LJXA 5KFCA 2HBKA 1VQ9N 4Y2VA 3IM9A 3JPNA 1JX4A 2V6AA 4WCEL 1ZA1B 2DIUA 4QIVA 2RDJA 1ECWA 3PEHA 2ZF5O 4BC5A 3QRQA 3I4HX 3TAMB 4G3IA 4O0IA 5F3XB 1HL6A 3CCEN 4EYHB 2ZKTA 3TR5A 3LAMA 3C1YA 3O4WA 2W54A 2OHDA 5HJXA 5F8GA 5AQJA 2XYPB 4C8OA 3RJMB 4IZ9A 2CAJA 2EHGA 1EHWA 4EP5A 1ZS6A 1Y00A 3CCLN 2W7OA 5H1SQ 5KG7A 1TV6B 2OZSA 3O1WA 5CYQA 4NWBA 1JJ2M 1PK3A 2A42A 4CJ3A 2KYZA 4BRCA 4I9QA 3UQ2A 3B6BA 1G3OA 4RNNA 2VFTA 4BACA 1IBLF 1GXTA 2QX0A 2Y9UA 4CW7B 4NL5A 3HPOA 3C2KA 1M0SA 3C16A 3MR2A 1UJ6A 4FPAA 5JVGQ 4HDHA 2KEYA 2HRUA 3LUYA 2ZOMA 4RWTA 1WSRA 4JKAA 4BRNA 1KLMB 4US8A 1RT2A 1T02A 3QT8A 2LEBA 4JS5A 1ZTWA 4BE2A 1URRA 4WP9A 2HK2A 2IM1A 1PGZA 5J2JA 1UVNA 2YNIA 1M5OC 3EE9A 1RCHA 1RTIB 2RF2A 3KK7A 4ATNA 5DG8A 1LFPA 1RBUA 3ZSQA 2EFVA 5L1JA 1E6YA 2E5LF 3KMQA 1N5VA 1A77A 4QIGA 2PEBA 4ELTA 3S8SA 1RTHB 4RZRA 2Z2ZA 1N33F 3TACB 3QYYA 1FJCA 1S6OA 1RAIB 5DG7A 4WYLA 1WWVA 2V67A 3U1NA 4DHVA 1RA6A 3GIMA 3MZIA 5AQPA 2N4DA 2C2EA 4GLXA 2ACMA 4WYBA 4FSVA 2VBXA 3PYFA 5AI8A 4LF7J 4UQGA 4KLSA 1JLEB 5J0UA 3W62A 2XWXA 1JLGA 4LF6J 1Y5NB 4BR7A 5A8RA 4M0AA 1N34K 1VQ6N 2DNYA 1T03B 2WB1D 5LOQA 1T0TV 4Z2XA 5E3PA 2MZ1A 3CMES 4M47A 4CF3A 1TL7B 2K06A 4HEA9 2YNIB 2RDDA 3ZT3A 2AYEA 1MWKA 2VG7A 2QYGA 3N4PA 4FZVA 2MUTB 3GWCA 2GQQA 4DJBA 2HZVA 4GKJF 4RUBA 5DQIA 1S5LU 1NSAA 1WG1A 3RTVA 4EEYA 4PR6A 5CR0A 2EZXA 2HVEA 2ZE2A 2YNFA 3T1YJ 1JL2A 5DB7A 4FLTA 2XY8A 4Y1CA 1LWXA 5BN8A 1Y97A 1AZSB 1N34J 2E2QA 1VSHA 2AWZA 2WAQF 3S3NA 4YOEA 3ZSZA 3RBDA 2DH8A 1M5KC 1GX5A 3KWMA 4OLBA 3JTPA 1RAJA 3DLLQ 2H4WB 3V6JA 4JD2B 4F67A 3MMAB 2E44A 2OGUA 3BN4A 3ISDA 4LF5J 3A8IA 2CGJA 2VGMA 2MKHA 2ZXIA 5F0WA 3FYHA 4HWIA 1LKZA 3JQMA 4UOHA 1P8GA 3T6BA 5GAGP 1QDUB 2D0OA 4JKEA 2CG4A 4QIWC 2ZNZA 4DFDA 4GV9A 3CJSA 2APOA 4HCCA 4CGJA 2ZJAA 4I2JA 4PPXA 1SJQA 3MF5A 1JXLA 4NXMF 4MJKA 4HACA 4QWDA 1NSKL 4LMZA 2IPOB 2DR5A 1O13A 8ICNA 4PUOB 2JZBB 4Y2QA 1VLYA 4A46A 2CNKB 1KR4A 1UAXA 1T9TA 3U6FA 1TMMA 3B6PA 4NLXA 3WK7A 2R7OA 4V1Ak 2HHHJ 3NOCA 4H5NA 4RQ1A 2Y3YA 1PBUA 3BYRA 3CFRA 5J2QB 1MSWD 3D2SA 3TUJC 5MLCV 4OJOA 3DYAB 2R7WA 1WD6A 1CJUA 3V72A 1ZD5A 4CRXA 4PUOA 2RAQA 1FDAA 1RAHB 1JB0C 2QGFB 2HIYA 2BOAA 3MURP 3UDEA 2ZIVB 3L2QA 3H08A 5GTIU 3TVYA 1BNOA 1HHQA 4TU8A 3VETA 5KRTA 2KV2A 3KK3B 2GA7A 2KJ5A 4K8ZA 1L8LA 5CJ7A 2AJ4A 1VBXA 2Q3PA 1RWPB 4C8YA 3CCMN 3R5AA 4BRDA 5ALUA 1OPIA 4WFBL 3WXJA 4BR9A 3U9DA 3AA8A 2E4LA 4DU4A 2UUTA 3QETA 4DV5K 4AILC 4FJXA 2LFVA 4DFKA 4DV6K 2D8CA 2YI1A 3MCPA 1JUDA 2HHHK 8ICJA 1G7CB 2WONA 2LM4A 2P6SA 4HL9A 3O3FA 5EWGA 1WC4A 3HULA 2E2NA 2CZ9A 5KPRA 3NVMA 2IA0A 2V5HG 2YNHB 1KCFA 1Y3KA 3CC4N 2G0JA 1GQEA 3N28A 3TUIC 1NGHA 4I29A 3AA4A 1T3NA 1GTEA 3GFYA 4RCHA 3HVWA 2NCKL 4KN7A 4EELA 4TYAA 1HQEB 3QINA 3S3OA 2W9BB 3HBTA 5AKGA 1NB7A 1UWAA 2HG4A 1CG2A 2YKQA 2R8IA 3ZDBA 1ZM2A 3ZD8A 4ID5A 4V19J 4YOTA 1DHMA 3KLHA 2UU9K 1D8LA 4QZAA 2AKWB 4DV6J 3RMBA 2OP5A 4ZPDA 1RT3B 2DK2A 5AQYA 3O8WA 3C6TB 2ZIVA 2ZOGA 4UOCA 3ELHA 1J2MA 3DOKA 1R6YA 4L8RB 1ZPVA 2I6WA 5J2MB 1XC9A 2W4PA 3DOMB 1MWYA 3VTIA 2XM3A 4WFYA 1D9AA 1O03A 4NLPA 4HTJA 1ZETA 5DDRC 4BUGA 4CYUA 4IL6U 1K8AO 3R6LB 4CK1A 2H54B 1RWMB 4M3XA 1TKTB 1Q9XA 1UQVA 3RJGA 3VV2B 4P0PA 2JXJA 1HNZJ 1H0HB 2F4VK 1A0PA 3IRWP 1U1MA 2WSCC 4B3MK 4IOBA 1SL0A 3HYFA 2FBYA 1P9QC 2DGSA 1JIHA 2WSFC 1HIWA 4ZIVA 2ZQBA 3K58A 2VFSA 4JBCA 3J7AP 3KHRA 2GNKA 2CRLA 3MCSA 3R2CJ 2ZGYA 4EZ9A 3LH2S 4NX9A 3SJJA 3RJKA 1O8BA 1ZD4A 2O8DA 3SMVA 1UMJA 3C15A 1M5PC 1ZZNA 2V7YA 1HARA 4J9NA 5AZJA 2GAHC 3TEHB 2VDIA 3KLGA 3OTOK 2CZ4A 1HNXF 3CCSN 3AA5X 1Y5LB 2ZXHA 2DXDA 1ZQDA 3G2XA 3NNCA 2LMRA 2Q2RA 4JYAJ 3H0LB 3SQGA 2WW8A 3UIQA 3SV4A 4HAIA 3LDSA 1NK8A 1NJYA 3MEEA 3TA2A 5L39A 4C7ZA 3IM8A 2QA4G 3CJCA 4YR2A 2ASYA 1NRKA 2HWIA 3MX5A 4EEKA 2RQCA 3M2RA 4KTZA 2F8TA 2V51B 3GTYX 3FEXB 4M1KA 3VVUA 3PSFA 2KJ9A 2BPCA 3UVJB 1KTQA 4QU7A 1XEZA 4JI6K 3AB4B 2F8MA 1NDLA 3R6GB 1COKA 4AHUA 3HW8A 4IQUA 3PW2A 4KTQA 2DY4A 1S22A 1YJVA 4OD0A 1B9FA 2HVZA 1NK4A 3OR1B 2HS0A 4JKFA 1NEEA 4A8SA 2E8OA 2KJVA 4KI6A 3GCWP 1KQFB 3K5LA 2ILYA 3M5RA 1ASVA 1TL7A 2D0BA 2F8KA 4R0EA 2C3PA 1LWCB 3AB2B 1VLOA 1A5WA 5BJRA 4PZNA 4BXOA 1R7IA 2IM2A 3P3DA 1C0FA 2KVSA 1WN7A 1YVUA 1TL5A 4Q44A 1QQOA 1RZTA 3P49B 3DGVA 1J5OB 5K4LA 1SCJB 1A76A 3D6HB 1RHUB 1WEXA 3OD2A 2W41A 5FLXO 5BRFA 1KC8O 5IIJA 2YNFB 1IKWA 2RHQB 4NI2B 1VFJA 2DEIA 3VQQA 4K5RA 2KG1A 5IWAJ 1V3ZA 2F7TA 2DPJA 3O4NA 1GOBA 4RNHA 4LJMA 4E1MA 1S5ZA 4ZPVR 4X65K 4QZBA 4NL9C 1X6JA 4LFBJ 4LR7A 1B70B 4ITSA 3SEIA 1LWEB 3H7HB 3O1BA 1FFSB 1XMOF 1WKLA 2Q43A 2M0GB 4EK2A 4PHDA 3W63A 2RDIA 5FDLA 1HLWA 4CFDA 1ROFA 3ZEUB 2LQBA 2MQ8A 2QMWA 4P0PB 2OA8A 2YKPA 1NGDA 5KFAA 1IKWB 1D3WA 2C2KB 1E4FT 4NCBA 1ZQAA 2IOHA 1WOPA 2XI2A 1CPZA 2CDQA 3QGPA 3AVLA 1DXSA 3UCUP 4A48A 4W90B 2G8HA 3MN6A 2V94A 4TSXA 1HNVA 2KM8B 2D4WA 2P9NA 3DOMA 1WI8A 1L3TA 2VBYA 2B4UA 5IT4A 4OI4A 1P6TA 1TUUA 2P9SB 4F3MA 3M1YA 4Y2TA 1BD6A 5HI7A 2P2CB 4CFBA 3CCQN 2BEFA 4BRIA 1B0PA 1HNXK 3F2CA 3VHQA 3JAMU 5ADZA 5KPTA 5HHIA 2HS3A 2LYVA 4YVZA 3DLEB 3C23A 4DPXA 2KFYA 5ETNA 4DQIA 1WF1A 3PACA 2HWTA 1N5XA 4JI5J 1QQ6A 2O8FB 4ID5B 9ICRA 4X66J 2L08A 4C97A 5KG3A 4JI8F 4JI0F 4UB3A 3MI7X 2VPZB 5LSLA 3IG1B 2Z2MA 1IIPA 3FZFA 2W3SA 4H0OA 1DGJA 1OKJA 2JEFA 3TOQA 4F5OA 4FLVA 2RIJA 4Y2SA 4HYKA 2ABYA 1SJ3P 4CD3A 9ICNA 2V0NA 4OHXA 1K0VA 4FZNA 3PJ9A 2JH3A 2AEFA 2AGQA 1URJA 1NKEA 3I6PA 2ZIUA 2CIMA 3A1YG 2OTJS 2HQIA 1NM2A 3JTOA 4KJIA 4IFYB 1RT7B 3LWLA 2E20A 3T79A 3W9JA 4ECVA 4HT7A 2F1IA 1KVAA 1R0AB 4FP9A 3N4QA 5JVGL 4HCBA 3RH6A 4BCAA 1VQOS 3WNGA 1VQKS 2ZG6A 2A6OA 2MZSA 4B08A 4YMEA 2GEMA 1YI2N 1MROB 2BJ1A 1K44A 4DL4A 2X7IA 2XY7A 1V5IB 3H40A 3S3MA 4FJ8A 3MGVA 3UMCA 4OI0A 1LCUA 2KVIA 3KK2B 2B5JB 4MYTA 1H74A 3WQPA 3EZWA 2RUSA 3NF6A 3LF0A 4FK2A 3VGMA 4I7FB 2ZH4A 4L74A 1TKTA 4FK0A 4DL6A 1GK8A 3ILLA 3DAWA 2FD2A 4QZHA 3A8KA 1VQNN 1RNHA 1TYQA 1VSJA 3GFHA 2QWMA 4QIFA 3OJSA 4BR5A 3KK1B 1VIOA 3I28A 1HI0P 3EMTA 1HKBA 2I1QA 3Q8KA 1N5WA 3A8YA 3GYXB 8ICCA 2R18A 4ZDNA 2JZBA 5JU5A 3UR0A 2R7QA 4IFEA 4ZJOA 3Q7BA 2BCRA 2XIDA 3AV9A 1LB2B 4BC3A 4CLPA 4WJBA 2WVFA 3PZPA 1FFVA 1K5OA 2ZC3A 3TNVA 4XIUA 2BCUA 3QU4A 1IKXA 4ZJQA 4QZGA 3C95A 3VMFB 4BGDA 3QRRA 2OJ3A 5GVQA 1R0AA 3ZZUA 3M8RA 2D9PA 1A5XA 2QEXS 2ZBRA 4CHNA 4KN4A 1XR7A 4M2YA 1VQYA 3UCGA 1FFUA 4JKHA 2K60A 2ZIUB 3J81j 3V81B 3W0LA 3CMEN 1AFIA 1J9AA 3MGHA 4LF5K 1QLNA 1FNOA 2YWHA 1EQ0A 3OYLA 3SUNA 2YNHA 3HF5A 1G6BA 2X3DA 5LMUJ 2HMPA 3N97B 3CJ8A 4WZMA 2PFQA 1HD1A 3HP6A 4HH0A 1F1BB 3DLJA 2BKNA 4IQWA 5D49A 4RUHA 3LP3A 2EXUA 2XMAA 1LW0A 4L3NA 4DU8A 1SBRA 3AODA 1CLQA 3KLIA 4DR5F 2XEXA 1C1CA 2GW8A 2ZHOA 4JK9A 3WUHA 3TX8A 4RR5A 2N82B 3DC2A 2MPUA 1F5AA 3G8TA 4JKDA 2MQNA 3DI6B 1JRPA 4WCEQ 3EXCX 4WFNL 3N0VA 3EUB2 5AJ3F 1RQ0A 4FJ5A 2ASLA 3DRXA 2M4MA 5CD4H 5A8WA 4ZP9A 5ALFA 3RMDA 1BE4A 2GCFA 1WG4A 3SBMA 2L5YA 4CK3A 3KXDA 1S0MA 3SMSA 1J6ZA 4K0KJ 4OJRA 3UD3P 9ICPA 2QL9B 4WP3A 4CNZA 4OKKA 2B4PA 5KFPA 4CLKA 5FPMA 1U6FA 4CBUA 1WOSA 3IS9A 4CECA 1HJRA 1OUQA 2J7UA 1P8ZA 1JQGA 3I5CA 4FN5A 5FDLB 1SKSA 4C2MA 2FXUA 1F5SA 2WB1C 1S4EA 1ZAVA 1DLOB 4YMOA 4CEOA 4YOUA 2FF6A 1SWVA 3OBIA 2ZITA 3TSPA 5CXTA 3MUVP 5ALJA 5T7BA 3RSEA 2KXFA 4USMA 2O5DA 4X64J 4HLBA 1WHYA 3OYKA 4DV7K 2WTFA 4NEZA 2A41A 3KZIU 3EKSA 1EAYC 2GHVC 4CO0A 4ED7A 1W7AA 2DISA 4BQZA 1OO0B 2W6LA 3K75D 1S1XA 4OX7A 1U0SA 3ZFVA 1IBKF 3WKCA 2CGKA 4D3GA 3ATUA 2OPQB 3L95X 3C19A 3GFXA 2HSEB 4AXIA 1IR1A 1SJFA 4IO1A 1F44A 2YN4A 2PFOA 3H42A 3TARA 3ZDDA 4Z94A 4B8AB 1OWXA 1YBUA 3WK9A 1AZSA 1COOA 3OHRA 2UV8A 1NB2A 2WC9A 4LFAK 1NJWA 4TQRA 2I1RA 3AD7C 3IG5A 4DKWA 3ENQA 1WTFA 2V8PA 3GG1A 3IMXA 3BF3A 3A3OB 1RU2A 1U2CA 2CADA 2X3GA 1VQ8S 1ZQMA 2W55A 2NUUG 4C0BA 2WFBA 5HQLA 4CO1A 1IVZA 2AJQA 4WQ5C 4DV7J 4HVZA 4RW4A 2NXEA 3RZAA 1N5TA 3CUNA 4DR4F 4KBIA 3MN5A 2WF5A 3GSIA 5B0CA 1HHTP 5CYMB 2VC0A 4DSJA 1ZQSA 3I0RA 3CC2N 2E5SA 3HX9A 3NGIA 3D9BA 2QARA 2Z58B 1FX2A 2BKEA 3H4BA 1D8ZA 1PCAA 4JB8B 5HRPA 4FWSA 1ZBFA 3H3OB 4R5PA 5KT2A 1VMBA 4B3MF 2FC9A 1SVDA 2HFNA 3C21A 5HMYA 3JXOA 4WK1A 1HBOA 2AF6A 4XDDA 2CJ9A 3MR5A 2PMWA 2ZNYA 5HBMB 1O6XA 1X4BA 2DCLA 2RS8A 3FEZA 4LFBK 3VQCA 1IXRA 1VQMN 1WSGA 3MBYA 4K7QA 2EKNA 3NNHA 1R8BA 5FJ4A 3EVMA 2JRSA 2IVOA 2I8EA 3BZKA 3Q8UA 2RF2B 5BXIA 1DFDA 4P2MA 5IWAK 2EEYA 1Z00B 4XEIA 3LYSA 3DGPA 1QAJA 2R9LA 1IWAA 4H4KA 4RU2A 2NQPA 3RB6A 3SQIA 2F9DA 3NVZA 2KB2A 4OHWA 2P1JA 2KHCA 2KRRA 4RPZA 5ALPA 4CZIA 4KHMA 2MA1A 2Q66A 3L3FX 2UU9F 2J0XA 4L75A 1Y0HA 1RADB 1ASWA 3IAYA 3O1LA 3NVVA 2VL1A 2X1BA 1T3QA 3MM8B 4QJFB 5HOOA 2JHEA 3DEEA 5DBAA 1VHFA 2I0XA 3HJEA 3EWGA 2NSCA 4K59A 1OVQA 3N5FA 5KOWA 4UARA 5JS2A 3VN5A 2V34A 4IQXA 5J2MA 3MUMP 2X1FA 4UZBA 3O3GA 1KEJA 3D28A 2KVCA 4JB3A 4KMOB 4BY9C 5BOMA 1PC4A 1I3OB 3LALA 3SXLA 4MQ3A 3CCZA 4C0OC 4X66K 4OZ3A 3HVTA 1D8BA 2K4HA 2D3OR 2RB7A 2H3FA 1L3UA 3F2KA 8ICWA 1JLQB 5M2UA 1HYSA 1JXEA 2O67A 2JL9A 1PVPA 4Q0BB 1N32K 1BQXA 4L73A 1YITN 3CJRA 1Q81O 2W42A 1AXQA 4DR7K 2J9DE 4KTWA 2PMZD 2BR0A 2WCXA 4C4RA 4CGZA 4ZVPB 4OLAA 3CYMA 4MFBB 3FSYA 4DQSA 4E7LA 1TFRA 5AKLA 4DV0K 2PFUA 4U67L 2ROPA 1IG9A 2P9CA 4NLDA 5KFZA 2OSRA 2PD1A 3HHEA 1YVFA 1SQGA 3HPGA 1MN7A 1WC5A 2QFIA 1R43A 5EOYA 1X0FA 1RXWA 2XGPA 3EJMA 1NDCA 4EGLA 1QS4A 2U1AA 4TVAB 3OYDA 4LBIA 3I0SA 7AT1B 2J76E 1WSIA 1X4CA 1EIYB 2PC6A 5KL8B 4NLBA 4Z6FA 3KG0A 4HHJA 3HILA 5M1QA 3AAPA 2GQCA 1I94K 4JEPA 2YHYA 2QKBA 5G4DA 3H90A 2E1RA 3SUQA 1XNRF 3O8MA 3QNNA 3C7NB 4J9UE 2LU1A 2UVVA 3SMZA 4O44A 5CAAA 2AHOB 4DV0J 1L8OA 4UAZA 1Z26A 5J2DA 1VSFA 4FF4A 1RSCA 3QEWA 3R7SB 1HBNA 3OUYA 4DTOA 5DM6L 5AQSA 1UFKA 3VEXA 1U1RA 2MZRA 2Y0SD 1SS6A 4QS8A 3UFCX 5J0XA 1PK1B 2E5GA 2PFPA 2IVNA 1NCLA 2Q1NA 3LPUA 3G6VA 1NMEB 4CJVA 1Q82T 1JLCB 4LUBA 1RLCL 2LQJA 4FE3A 2XSJB 4YDDB 4CEEA 4K2XA 2VOOA 1ZQJA 2MHNA 1EXQA 4FJLA 2MGZA 5B08A 4FJNA 4QOTA 5DB8A 2VIHA 4P4PA 1RUSA 4DV1K 5HMXA 4DTNA 3VAJA 4H4MB 2CQPA 4RKUC 4RBTA 2C3MA 1CS4B 8ATCB 3BZCA 2IOCA 4OLOA 1SIJA 1WJ9A 3H5XA 4EHTA 2VQEK 4DTUA 5TZVA 3WK6A 3RF9A 2IM3A 5DB9A 4M42A 5CA7A 1S72S 4U95A 3VQAA 3HZGA 5J2KA 4DO9A 3B8HA 2BUNA 5J2NA 2GQ2A 3H8WA 4H03B 3MMJA 3MGIA 4UAVA 4FOIA 2NLXA 4CF9A 2JV3A 1N36K 3M32A 3IAS9 2AXTU 8ICSA 3TPQA 1HW9A 4IOAL 1W9HA 2XC9A 3QIPB 2IBOA 3NP5A 4USWA 4WXWA 3PFEA 4XPCA 4DR3J 3HHNB 3D2QA 3U3YA 1UETA 2NO5A 1T44A 5KFHA 3C5FA 2VQEJ 5C10A 2GUPA 1WNEA 3FBCA 2YHWA 4CGIA 3MWTA 4IKFA 3Q2SC 4OYZA 4K41A 3V1QA 5HLFB 1XHZA 3JTNA 2RHFA 5EX0A 3EZ5A 3MX2A 4ECXA 4I28A 4BDYA 4WE1B 3VQDA 5DGBA 5HATA 7ICOA 1BPEA 3UKUA 3MD1A 5J0RA 2BW2A 5KFNA 1B0TA 4OI6A 3OL6A 2LM1A 5KG5A 5KL1B 3HDSA 3SAFA 5E3CA 2IGIA 2PBDA 2UU9J 3BBFA 2KT2A 3ZX2A 3M9NB 3KK2A 2HNDB 1S3XA 1BGXT 1IBLJ 2NXUA 5LMNK 2DBBA 1ZH5A 1B43A 1U1OA 3C29A 2Z57B 1PYSB 3UCZP 1YAGA 3TJ8A 3PM9A 2AU0A 4C1NK 1RTIA 3OPKA 1JKHA 2ZM6K 2BBEA 3Q2TC 2W2PP 4ZVUB 1X4DA 2IC3B 2L9DA 2Z1HA 1X5TA 1UPMB 1R8PA 1FIQA 2ERRA 3K9JA 4GVEA 4G1QB 3HVAA 3V6DA 3QSYB 1WG8A 3BSCA 3KNGA 1SI9A 3FFKB 4FJ7A 3GJTB 3MABA 5AE1A 2O66A 4J2DA 5HMLA 2QEXN 4YFUA 1IH7A 2YV0X 5IT9U 2E5LJ 1IKVA 1DTQB 2HFOA 4OZ0A 4IJAA 4CQ1A 5BR8K 3SNNA 5ALIA 4B9QA 4C3MA 3OR2A 1J5OA 4J8FA 3DFEA 4P2SA 2QN6B 3V1OA 5ETOA 5AKHA 3TQEA 2OAUA 3LP0A 4BR4A 1F21A 4IBNA 1G2EA 2QARB 2ITGA 3R9KA 1RBLA 2RQ5A 4LRDA 3UQ0A 3EDRB 4FWLA 1UVKA 5FRMA 4JMUA 4QJVA 5BN9A 3OYHA 4O4RA 3LZIA 1UJ4A 2K8GA 1K1SA 3IMQJ 3UDLA 2YVSA 4JI2F 2ZIWB 4FW1A 3RG6A 3C6AA 3VQTA 2P6TA 3PRDA 1PKUA 2ILZA 2XULA 2BDPA 3D2EA 4FW2A 2FF3B 4W5RA 2HPUA 3M8QA 4OKEA 1MWZA 1U09A 2HHWA 2E5JA 3ED5A 4JI8K 2BOPA 3ZSYA 5CHGA 2HCFA 4ZN3A 4Z6EA 1FKOB 2VC1A 2RRDA 2KIWA 4ZS6A 2WK4A 3J7AN 2NUBA 1DOQA 5AI5A 4DF8A 3THPA 1EWQA 4ID1A 1ATSA 2GFFA 2YX4A 4CLSA 1AW0A 3KOAA 4M7YA 1N88A 1RWXB 1RLDA 5AXKA 4A8OA 4CZGA 2CRXA 2V4QA 8ICRA 1FRLA 2CJAA 3OL9A 2HHQA 4NXZA 2P9EA 4IH7A 3ICLA 1TK5A 4NCGA 2YWGA 5AFUA 4RQ3A 1VK3A 4X4RA 3RSEB 5C15A 2V8HA 2F1JA 1FJ7A 3ENAA 4NYZA 2AA4A 3BQ1A 3PYGA 3LM9A 3MMCB 2E9RX 1YJ9S 1BQMB 1RT2B 4JKCA 3K2PA 3E01A 2PYLA 4NY8A 3F9KA 3D45A 1HD0A 4YY3J 4Z0UA 3Q8QB 4KBOA 3ZO7A 4X62J 3A0IX 4KLFA 1C0MA 3PKMA 4OX6A 2MKYA 2NREA 3GJQB 4CZEA 4AXJA 4J9KA 1HIYA 4BWMA 4JI7K 4RNOA 5KRSA 3NLCA 2MQOA 3H8SA 1FKOA 4X65F 3K1ZA 4DSLA 4IG3A 2GVDA 2ETJA 4CIFA 2FGOA 1X4GA 3MAQA 3AO5A 3SCJE 1VK0A 4TURA 3QATA 4LF6K 3MR7A 3PNIA 1LOTB 4GVLA 5E3RA 3ZSVA 2IDEA 3Q8MA 1LW2A 2FPHX 4Q2MA 1NMDA 1EO1A 2BJ9A 4QIWF 4PL1A 4A47A 4QZ8A 3DHXA 3KG4A 1OY9A 2DNHA 2W6KA 5AQIA 5DB6A 2R2SA 2LYBA 3BB5A 4USHA 3BGRB 1OYEA 1HMVB 2CJBA 5AIBA 2OSQA 3J81O 2FLOA 2Z1GA 1U9LA 1D5AA 3W65A 3D66A 2NYIA 2E1MC 1S4FA 1KAXA 5HR6A 1SV5B 2IVPA 2RJZA 1MN8A 2M88A 3HZEA 5CH7B 3KHLA 2W9CB 2VF3A 3WK5A 3KKRA 4JI2K 1BCOA 4CJ7A 1VQ5S 1HR0F 2PI4A 2KP7A 1ZQWA 4Z4HA 4FVCA 1KVCA 3VENA 5DRKA 1RAAB 4KR0B 4X4NA 3MGJA 1MNEA 1X7VA 2HS4A 4J9QA 3M1VA 4I2GA 4OJ3A 2GLEA 4FPIA 4IJNA 2KSOB 2HQGA 2HQ3A 3M3ZA 2MGZB 2AIRB 3A12A 1LVHA 1S79A 4IKAA 4F4ZA 1KP6A 4LRFA 4OYWA 2R7SA 3MXIA 4YOVA 1C0TA 2F9TA 4FLYA 5J0WA 3BR9A 1BI4A 3AM9A 3DM2B 5AM0A 4DTPA 2I5JA 1UVIA 5EE3A 3Q83A 1NGFA 4ZPAA 3C6UA 3ZZTA 4IWVA 3HHDA 2XBPA 4IXCA 3KKFA 4LRBA 1EQYA 3JS9A 2DNRA 2DTJA 1HBMA 1Y88A 4EUVA 3SSQA 1GXLA 1X9MA 2WAQC 5AM5A 4Q5VA 1CJKA 2H5JB 5D6GA 3VQPA 2XNQA 4CZKA 4EENA 1YJNN 1LWFB 5IINA 1KN5A 1ZQVA 3Q8LA 1RT5B 2LBOA 3S6JA 4FF1A 1T3OA 3BQTA 2E1FA 3ALRA 5KAFU 4OYIA 3M2UA 1UKUA 5GAEI 3AFGA 1VDHA 2F65A 3MM9A 4IG0A 2KN7A 2VQFK 2VA3A 4O23A 4FZLA 2DY1A 1M5VC 1FWKA 3JPTA 3KD1E 2P5OA 2AD9A 3MM6B 1I6JA 5DM7Q 4IFVB 4KLOA 3GYGA 4CH7A 2EC0A 4BRPA 4A5AA 3H2UB 1GLBG 1JNRB 1TGOA 3BF4A 4I2PB 4IFYA 1AUDA 2F8SA 3VQ5A 4F04B 3CB4A 3K5PA 1IG8A 4TY9A 4RW9B 4RQ0A 4E1NA 3KHYA 2QXFA 2UXCJ 1EKRA 4YOYA 3AT1B 7ICQA 3SR6A 1Z3EB 4PHPA 1S59A 2DL0A 2V68A 3P4IA 5AQOA 4CZJA 8ICXA 5K14B 1KAZA 3OFEA 5E84A 5A6PA 3OHAA 3CDAA 2FJVA 5HP4A 4DTXA 4IUFA 5CHIA 4AP9A 3CFOA 4LF1A 4YOWA 3ZT2A 3VQ6A 4CE9A 1XSLA 1QE1A 1BQNB 3QX7A 1VQLS 1VQKN 5CQGA 3FJ2A 4M5MA 2M5YA 2MKCA 3HVTB 4O8KA 3DOLA 5BRHA 2UUAJ 3O08A 3OW2M 3NCIA 5K8PA 3OTOF 1QUVA 4FWPA 1B0XA 3EL2A 2ZBQA 4R8UA 1F6TA 1Q4RA 1WWHA 3N01A 4M5JA 5HSPA 4M3WA 2HHSA 1DRGA 4EAHD 2XMKA 2ZVSA 3J7YU 3HRGA 2ZWOA 4ISFA 2G07A 3IR6B 2VZ9A 1OSDA 5E26A 3CM6A 3DLKA 3ISCA 4UZCA 3D0GE 1S7HA 3MUTP 1RZMA 5KAIU 1QD1A 3R1HA 4DOAA 9ICAA 4WPAA 4UBBA 3I4PA 4YHHJ 8ICMA 2ZHBA 3WNFA 5AK4A 1PO6A 1O1WA 4DI6A 3CCUN 4CJLA 5KG2A 4H4OB 1YJTA 1QVGM 5GMDA 1H1VA 1WSFA 3NF8A 3CDBA 4P4OA 3CCWA 2EAOA 2YMPA 2ASMA 2FMSA 1E6VB 3MDFA 1ESVA 4DV5J 4NPOA 1LWEA 3AQEA 1O08A 2GOLA 3HP9A 1N8RO 5J0QA 5AZIA 5EGYA 3HOTA 4B6JA 5IOLA 4F92B 1S1WB 4B3SF 1J53A 2WVBA 3VF6A 1WF0A 3LOUA 2G0CA 1JLBA 2E6LA 4LSLA 2X1GA 1RBRA 2D3UA 3V4MA 2LU2A 2Q4TA 2G06A 1P1TA 2ACYA 2HSZA 1NGEA 3J8AA 4QZFA 3QFHA 3VQ8A 5F1XA 4DR4K 1Q7YT 5C12A 1RTDB 4EIAA 1RBVA 3K5MA 1H73A 1P9YA 2J5AA 4TXSA 2Q6CA 4DB3A 3P6YC 4ZPTR 2MXYA 2Y1RI 2CVIA 1FHTA 1SXEA 5C24B 2XWYA 2C3YA 5BR8J 1M5HA 2NRZA 1RTZA 1YHQS 3SFUA 5GAHP 2FVCA 3BO2A 3UNYA 2GX9A 2RT3A 1BLUA 4RT2A 4XQ8A 1RP5A 2DNQA 2HFSA 2HGNA 2LEPA 3O9TA 4DQ8A 1BIUA 1RKJA 4NOHA 2N1RA 2G8WA 3ZCMA 2CH5A 1QTNB 3TEGA 4CHOA 1KTVA 1NNDA 1IXKA 2Q3SA 2GJFA 4FWKA 1KBUA 3EY1A 5BPCA 8ICEA 4WJ3B 1WUUA 4LIRA 2NXNA 3O3HA 2QL7B 4DR6F 4LQ3A 3L3VA 2WVDA 1BU6O 1SV4A 2Q0RA 5LXRA 3NRBA 1K0TA 1HWJA 3DMJB 3CPEA 2DO0A 4J9LA 5IQQA 3BEXA 2QW9A 4ED4A 4W4MA 1U4BA 5M2RA 5A0YA 3MCNA 3KD5E 1RTDA 4F3OA 4LFCJ 3R97A 3LANA 2DITA 2J0SD 5AXMA 3K8VA 4DSFA 5THWA 3B6OA 4BC4A 2RU9A 4A8WA 3AOAA 2ZUCA 2AW0A 4UTGA 3HXMA 2FBTA 4Y2CA 4HVJA 3LM2A 4USVA 4LY7A 4FKXA 4DEZA 1KS2A 1SIZA 4CNQA 2GIQA 3OS0A 2XZDB 3Q8RB 1RU1A 3CHWA 3LDAA 1J54A 2AP6A 1YX2A 1D1UA 2KICA 3O2IA 4QZEA 3FFIB 1MU2A 1NUEA 3O9UA 4CEBA 3DRSB 4DCHA 3ZSOA 4RW8B 3MPVA 2CJYB 2VBWA 1J5EJ 5EE1A 1WBDA 4MIWA 2I7PA 2MHEA 4F50A 4H0VB 3CPWM 4LF8J 4K4XA 1VC0A 2DFLA 4JI7J 4ANCA 4ED6A 2H3ZA 7ICJA 3QAUA 2FC0A 5IWAF 1IBMJ 3U26A 3LDPA 4BRKA 1ZQBA 1GLJO 3OYGA 4ETXA 5J8YA 4O3PA 4DWIA 5CZVA 2ZJPL 1ZQLA 2VPYB 5ELZA 3R5CA 2VGNA 5GAEP 4DR2F 1F9FA 4LFBF 3CJ1A 1X42A 3NASA 3DDHA 2V69A 1NAQA 2UUBJ 3VESA 3SUPA 2QTDA 1U2RA 3QICA 2DF4B 7ICGA 5AQWA 4UB6U 3U27A 4I2EA 1FKPA 4IEIA 1Q7YO 3BQ7A 3AQPA 2Y1LB 3NG8A 2OHFA 2W11A 4FWQA 5AE3A 2PE8A 4FYWB 4RW4B 1V3RA 3G87A 1X4FA 2Y9TA 1S6PA 7ICTA 3U8XA 3ZTOA 2MZJA 4C8MA 3TO8A 2A0FB 2YQ3A 2DRAA 2JR5A 4CE6A 5FPDA 3M2RB 3G10A 2G13A 4ZVHA 3A5OC 4EHUA 3AXMA 2IFXA 3QB0A 3ZYYX 1X5SA 2C2NA 3L7UA 3OGUA 3MM5B 4J7CA 3K5NA 3D6JA 1FXDA 3OL7A 3SPZA 4KI4A 3V81A 4EX7A 3OTOJ 4KHPK 2KG0A 1S77D 3D1QA 3PIPQ 3QO9A 4PHEA 2OTJN 2CPFA 5T41A 3KMSA 5EE0A 4BVPA 2OPSA 3QLHA 3M30A 4G1QA 4OKJA 1FEEA 3ZZOA 4IFVA 2JLEA 2LYAA 3VQEA 4GXKA 2WSEC 4CDIA 3TFRA 2RHKA 1VQSA 5EHHA 2IHNA 4FZMA 4OYAA 4X4TA 2Z1IA 4M41A 1TAMA 1NK0A 2G2ZA 1KQGB 1N0UA 4RTFD 4JV5K 4C4TA 3ENBA 3LAKA 1ZQNA 4QCLA 3JPRA 3WU2U 2A6MA 3CF5Q 1BC6A 2HNDA 1PYTA 3ISZA 1VQLN 2OIHA 4Z4IA 2JFKA 3R8EA 3POTA 4OHZA 4ZLJA 4AHTA 2E5IA 3BQ0A 1QUPA 3QNWB 3VF4A 1GMWD 2KH9A 2HSTA 4Y0FA 2DGUA 2VV5A 5J0SA 2CPYA 2LKZA 4R63A 2HEKA 1MA9B 2BZ2A 2C2DA 4KPCA 4X64F 4WF9Q 5GAGU 4QYZK 5DDMA 3ZNJ1 3AY9A 4KHQA 4YCXA 4ECQA 4B3SJ 4DOZA 2MY8A 3MWPA 1SXDA 2GVZA 2EPIA 4WQ4C 3CW2C 1XMQF 2VWKA 4TKTA 3PJXA 3CC4S 4XDCA 3ZTPA 5D4PA 2VQFJ 4B3RJ 3M8SA 1X66A 2ISPA 5KNIA 4B9UA 3DM2A 4WKRA 5CR4A 4US9A 1KRPA 8ICLA 1ZQZA 1C0TB 2B43A 1WC0A 3TFSA 5I3QA 4DUYK 3JPSA 4NZ6A 5AHXA 2YQ1A 4NYOA 4MEYA 3PVXA 3CCRN 2XI3A 1Z19A 3UI3A 4O5BA 5CE3A 1WSVA 1N36J 5A6WA 1FKPB 2Q0UA 3M8PA 3MPWA 3C8YA 5AQUA 2U2FA 2BZFA 1HWLA 2OXOA 3SZ2A 3FCWA 3X3UA 4NM1A 2A18A 2MZQA 2FDRA 4DR3K 3R27A 2YX1A 3TA1A 2P9LB 1K8KA 1YUWA 3D2FB 3WKBA 1CVJA 2VJUA 4OJPA 3EGZA 2OD4A 3AL0B 4CT8A 3FZKA 4DR1K 5BRDA 2CPEA 1N62A 3OXGA 1C2PA 1U6ZA 2R8GA 5DJBA 3DWLA 3GE9A 2FVRA 3SDEA 1XERA 5HVHA 4CZLA 3BM7A 2VFUA 3KUGA 3CF5L 2RKIA 2O3DA 1OQ6A 4CLYA 2DR6A 1JMTA 4GKJJ 4RNFA 2OMOA 3HPHA 2FVPA 2ZVIA 4X62F 4C48A 2B6GA 5H9FK 3GDQA 4ZCMA 3SPYA 3CC2S 3F53A 2J9CA 3EM1A 4ZMMA 1A0OB 3TTCA 2CQGA 1HX1A 2IBKA 1VJ5A 2UXDF 2C2OB 4K8XA 1S9FA 4KAIA 4OPJA 4IH5A 2YMMA 3PNCA 3PMLA 3BZQA 1NNEA 5KFMA 2MZTA 4M9JA 2ADCA 1RI7A 5GAHU 1KW4A 3C2PA 1U1PA 3QZ8A 2DNMA 4ANEA 4DTMA 1RDFA 4Y2YA 3IP4B 4KV8A 5AM3A 1XMBA 1LKYA 2V8VA 3CMAN 5F0XA 3GCXP 1M5SA 1NSPA 5KGWA 5A0YB 3ZLJA 4Z4CA 1T95A 4DV2K 1RHQB 1L3SA 2JNJA 3UQSA 2KHQA 3W8GA 3OV7A 2ZH2A 5AQNA 3JYTB 2QL5B 2RVJA 1HNWK 1OIAA 4P0QA 2ZWHA 1RISA 1NDPA 5KFJA 2QK9A 2AZ1A 2ZH7A 2P9UA 1RT6B 5E0OA 2JHDA 1RQLA 1NZAA 4U7UK 1EZZB 3PJWA 5A8KA 2AJFE 3TX0A 2ZJPQ 3L0QA 1QTMA 2PO4A 2NXJA 4KGXB 3FCHA 4R25A 3AD9C 1RYRA 1OJ4A 4JK8A 2Q31A 4ZVTB 2XNRA 2KJ8A 4KLUA 3RYLA 3LDQA 3LGMA 4AHCA 2VWBA 4P75A 3K4GA 2VG5A 4PYDA 5KQ8A 3QQCD 1S8OA 4G65A 3UKRA 4NL9A 5KFBA 1Y9OA 2JEIA 1T9YA 3VEVA 5ALSA 4QWBA 1N4LA 1PIEA 3VEOA 4J9VA 4JLHA 3PW7A 2F4VJ 3OS1A 4MH8A 3MM7B 5GAHI 3KLFB 5HR7A 3ZT0A 1VC5A 4BHQA 3T1HJ 3EE8A 5CYQB 5B0BA 1H3DA 3NWGA 1KWMA 2HOIA 2XMWA 4KPYA 1RAEB 3F44A 2ZM6F 3PW5A 2J9EA 3FBEA 4JWMA 3A0HU 3HKZC 4LF7F 4FWMA 1XSNA 1Q8IA 4AUKA 2YWKA 4UY8T 2YX8A 2R8JA 2IOFA 1U49A 2JRZA 4IDHA 4KB7A 4UB5A 3C1ZA 4JI4J 3Q22A 4ES1A 1VQMS 2OPRA 2X74A 3KKSA 1ATRA 4CZHA 5B0FA 4Y2KA 4CESA 3C65A 4CCHA 2OYYA 1REVB 3J81U 4C9DA 3G6YA 1I51B 2DTUA 4WXOA 3EICA 4ICLA 1NJZA 3THYA 4IO9L 5ETVA 3HX0A 2CKWA 5ALTA 1N33J 4ZIWA 3R3LA 4YY3K 4DBQA 1W25A 1MWQA 2H5EA 1U2FA 1DTTB 3SBTA 3ZT1A 2CQBA 1SJRA 2QE5A 2A6AA 3J7ZT 3OYFA 3HI9A 2D74B 3ISNC 4F25A 3T3FA 2FSKA 2N3LA 2Q36A 4GO7X 4O4GB 1BPBA 3VTHA 3CCVN 5IV4A 4BDPA 2B4VA 3CIZA 2V52B 1NZBA 5AQKA 1VSLA 4AYBD 4TY8A 1QE1B 2WF9A 8ICOA 2ZZMA 1NLKL 1GMUA 2VBZA 4P52A 4F0MA 5AK5A 4ACOA 3W3DA 4JI1K 1Z4OA 3THXB 1SPBP 2H9ZA 3MCMA 1UVLA 3RR7A 2HLTA 3V5RA 1CJVA 3B8AX 2Y0SC 2A19A 2YWEA 2RSQA 2JZ5A 4ZPWR 3HMJG 5M1PA 5JLFA 2H1YA 3E1YA 4OGEA 2IAJB 3ZDEA 3CMAS 4DV7F 4UAUA 4ES3A 1AFJA 2A3JA 4RW6B 1YBTA 4M5DB 1XBWA 3ONNA 1N5YB 1XN9A 1KVJA 9ATCB 1HPMA 1B64A 4TLQA 3VA3A 1J97A 1K8KB 1H7XA 2ZZNA 2WFAA 2E7XA 4MLHA 3I8BA 1S7IA 3NVKA 3W2VB 3CCQS 1QAXA 1XU4A 3V6KA 2XLIA 5AQVA 3L2UA 2H48B 4KY3A 3IFRA 4BROA 4FZXC 2RQKA 3FVYA 2FYXA 3ZDAA 1F3FA 1CBKA 1LEOA 1B7YB 3LWMA 4DLGA 4NWIA 4MIAA 2UVUA 1GMVA 3O44A 4KLLA 4LFCK 4W98A 3SDEB 5E3AA 1OMSA 4A8EA 2VB6A 4XUSA 4RUCA 4AL5A 2DNOA 5KG1A 3M2VB 3M6VA 4CNYA 3CJ7A 3DKDA 2BCVA 2OLWA 4DV4F 3MECA 2IIRA 3OTCA 1C1BA 5FLXY 4JI3F 2Z2YB 4WFBQ 3C2MA 3ILOA 1RYUA 3A4TA 3DDKA 4I64A 1TUGB 4F0HA 2UUBF 3AHPA 2Y8WA 3T7ZA 4BRQA 1FJGK 5EOZA 4DLEA 3DN9A 2KI2A 2IVYA 4JI6J 2R2RA 3NL0A 4F93B 3TRGA 5D0RA 2EAPA 4EO6A 1JLBB 3M6KA 1VS3A 2ZOFA 3G82B 2QA4S 4A61A 5J2EA 4J9RA 1F9HA 3L4QA 2CXYA 3NH1A 3D0IE 2FJBB 2ATQA 3KVGA 4FLUA 2ZJQL 2O8BB 3JPQA 2P9UB 1U0HA 5L8RC 1DLOA 3CCRS 2P9KA 1T05A 2A1RA 1AUSL 5KFKA 3NAEA 4QR0A 1XIQA 1GH8A 2XMJA 5AFUH 4G9BA 2HF3A 1N54B 1P1LA 4FLZA 5M2PA 7ICMA 5KGXA 2HNZB 2JFDA 3OFFA 1UVMA 1CJTB 2Q0ZX 4OZNA 4CYUB 1RQNA 4I9LA 2Z4PA 5KFUA 5C42A 4O44B 2WOMA 1Q95G 3RMAA 3BQ2A 3W61A 1RBSA 3TABA 4CLFA 1JXVA 4DR6J 2NRWA 3FZHA 3W66A 4GC7A 3NE6A 4FM1A 4M6WB 4DPWA 1XMOJ 2HMXA 5IM0A 1WEYA 1UVJA 5DZ7A 3IGVA 1EX8A 1ZD2P 1QHTA 2R8KA 4N56A 4CEZA 4ZVQB 4F36A 3H0PA 3PO4A 1EKEA 5CEHA 1XNQK 3UN5A 1RE1B 1VQ4S 3VQ4A 4GXIA 2UP1A 3CNHA 1D9DA 4UB2A 4P7VA 2EFOA 5BYSA 4CLWA 1A7GE 4FOEA 3EE3A 3H5UA 3HHKA 2QXLA 3QAEA 5ALKA 4RX6A 9ICVA 1TKXA 2O8EB 3ZTSA 3AO1A 3IDHA 2ATLA 2NRXA 3M6XA 2RILA 3R9PA 3SAGA 2GVDB 2HYIB 3QDKA 3MM5A 2KHOA 2YKNB 2W9CA 2E88A 4I2DA 2BUPA 1UJ5A 3S1TA 2FVQA 5J2BA 5HRRA 1G4CA 1OPZA 3QMLA 1S5JA 3WX8A 4CO3A 1WKKA 5DZ6A 1HI8A 4J90A 4F26A 3FGVA 4C0ZA 4ECTA 4AYBC 3GJRB 1HUXA 4RW8A 1VQ7S 3TP2A 2AMCB 3V9WA 4CIGA 2B0GA 5DS7A 4U9RA 4LFAF 2Q97A 1IBMF 3US5A 2UVWA 2XZWA 3MMBA 4PY5A 4DHYA 1QAIA 2K8BB 4TYBA 1MDUB 4TLRA 2ATCB 1JLCA 1KLNA 3ZX3A 5KG4A 3G25A 2XS5A 3CD6S 2NRVA 3ZI4A 8ICUA 5IIKA 2LA6A 5H9FJ 2BYCA 3M8WA 1K9MO 3AJ1A 3PV8A 5KT3A 2N4CA 4FWOA 3CGIA 4OPKA 2QIFA 4LF5F 2UXCK 4C0HA 4OPHA 3H1QA 7ICNA 1WEZA 1ITGA 5A8RB 1U47A 2HMIB 3ICXA 1HBNB 3CI5A 5ALNA 4JI0K 5KFEA 3MCAB 3UDCA 4MO4A 4AH9A 3LDLA 2CPIA 4DMNA 1FO1A 1ZAWA 3R5GA 2CQ3A 1KVKA 1XR6A 4A8YA 1FKAF 1WAFA 3E3XA 3QFPA 2DGOA 2ZD1B 1JWWA 2B4JA 3ZSWA 3SJHA 2YKAA 4C6AA 2OZMA 5DLGA 3UO0A 1MU2B 2BX6A 1TL3A 4MYUA 3WEEA 4JHDA 1YVNA 5AKJA 2YBVA 3ID8A 3AA9A 1YJWN 3U3GA 1FK9B 1DEJA 5K8NA 3RB3A 2D3ZA 4RQ5A 3F5TA 5IS2A 4NCGB 4FNIA 2WF8A 2Y1IA 3P4UB 5KT4A 4B02A 3WQTA 3OVSA 1S0NA 2RQMA 2LYHA 5IXUA 1QQMA 2B6AB 2J6TA 4L6V3 3QBCA 3EVWA 2YCHA 3NOGA 4MT1A 2G09A 4Q8EA 1PC5A 4WKYA 3CJ9A 1TV9A 3MTKA 3U1MA 2BMBA 1ASUA 5FP0A 3ORYA 1YTYA 3BEGB 2FMQA 1U8SA 5F8JA 1BWFO 3AO2A 4E8UA 2F77X 4XK8C 3M1FA 1L5UA 1ZBTA 2E3TA 3M8QB 2E8PA 2W3RA 4ILRA 2Z2LA 2YHXA 1ZD3A 4MMOA 2BM1A 2HBQB 4NXNF 3CCVS 5BPLA 3Q23A 4BR0A 4E7HA 2A2DA 1T94A 2BPFA 8ICTA 3CTRA 3T9NA 2Y9HA 2YX6A 2QWRA 2FLPA 2QSFA 5J0TA 4WYWA 1EQMA 2W9AA 2EFPA 1K47A 4JHDB 1IG6A 1E6VA 3ENWA 4FJHA 5HP1B 4O9MA 1ZZFA 2WAQD 2ESEA 1MG7A 2E7WA 4QIEA 3M6WA 4CF5A 2ZBPA 1TAUA 4ERDA 2ZD1A 2KL8A 5C25B 4JNEA 3NVYA 3G4SN 1RHKB 2QWLA 5B5EU 3CJAA 3J7A1 3EDQB 3Q89A 2KQ2A 2CZVC 4QWEA 3GBTA 5D0GA 3JPOA 3WC0A 3G8SA 3IR7B 1DQAA 5DK5A 1S1XB 1PZNA 2PT0A 2J0QD 3CCJS 2KJWA 4P71A 3QGHA 4CO5A 4UUXA 4CGGA 5I42B 1WBBA 2K3IA 4OJLA 5ALWA 9ICQA 4ALZA 3SBGA 3CO9A 2XS2A 4KLIA 2IJNA 3LZJA 1SKUB 2OI2A 1FW6A 1FXRA 3BGOP 1S72N 4DX8H 5J0YA 3O5TB 4ECRA 4CLTA 4DOBA 4LBHA 5D46A 1CULB 5D3GB 5F9LA 4PXCA 4NLGA 4PQUA 3D1HA 3ZZRA 4ZJLA 1MQ2A 1T9UA 4J9MA 2M52A 2YJEA 3N7RC 1EXNA 4ZA1A 2E1PA 3V9XA 1R59O 2Z1JA 4NLYA 3OT9A 1FRKA 3OVBA 1VBYA 1TELA 2G0AA 4KRFA 5CHCB 2YKMA 4WE1A 1X9WA 3WT0A 4PG5A 1I1GA 1KHVA 1T9VA 4KKOB 1VSIA 2XG8A 5L46A 5HP1A 3JQJA 2XY6A 4HI2A 3WIUA 4O3RA 4EFHA 2DGTA 3F0NA 4OJHA 4CH1A 5L1LA 3HD2A 4M63C 4Y34A 2UUCF 1TTHB 2G4BA 1N8RT 3ULDA 5C5JA 1KN6A 4CM0A 4CVNE 2HQFA 3PUFA 1ZJNA 2WBNA 4TUQA 4KHRA 2I9SA 7ICKA 4ZVRB 8ICGA 3W9IA 1U6BA 4I27A 4CI0B 2VA2A 1RILA 4YXMA 1FXXA 4URSA 3A13A 3HSZA 1Q0NA 4N7TA 4TNOA 1UHUA 2VANA 4JI5K 4F72A 5D4NA 3TJ9A 5C24A 4R79A 4O3OA 3HJVA 3QE9Y 2R2TA 3OYIA 1FEHA 3IR5B 3HSCA 1JROA 4LFAJ 3NNAA 3HOSA 3E0FA 3OUYB 2J8SA 1ZQGA 3OTBA 4UY8O 1KFSA 3NWRA 4LF2A 1FFGB 4PAAA 4OJ5A 3DHWC 1XJWB 1HBMB 5KQDA 1NMNA 3KKAA 5H9EK 2CG8A 2M7SA 2LQ5A 5H1SV 3VQ7A 4JUZA 3SUOA 1FK9A 2F4FA 1Q8LA 4KB0A 4K8RA 3D6RA 3K7RA 3HK2A 4GRSA 1Y3JA 3BF1A 3EPIA 3QGGA 2N7YA 1FCAA 1RTJB 5J2AA 1B22A 4OQJA 5KTQA 3VALA 4FS1A 5L1MA 4CT9A 4P0QB 3CCSS 1FVSA 1GLFO 4KITB 5DO2A 1KQSM 1ZQQA 1GEHA 5KFOA 4OYOA 3M8ZA 4DR5J 4NO7A 1VQ5N 2BGWA 1HQUB 4KLDA 3LPTA 1ZQFA 2R3VA 1Z2LA 4JI3K 3MOJB 2CA9A 4MFBA 4YG2A 2RP5A 1LXJA 1XMOK 3P38A 5AJ3J 2GX8A 1OSCA 1NK9A 1IJEB 4K4IA 3RR8A 2FIUA 4DSEA 2Z0GA 1V97A 4JI5F 1RFQA 4R8UB 2B5JA 2VG6B 4HACB 5HVGA 3VAHA 2UXBK 3MEDB 4K0KF 3ONQA 4A4JA 4K25A 1R89A 2FJEB 3CCMS 2GJ2A 2FUG9 3HKZD 3V7JA 3TANA 4B1VA 3UXOA 2PFFB 5AKZA 2E9TA 2D3O1 4HTIA 4A57A 3RH5A 4K5SA 1Q3UA 1LW2B 1IUJA 4UT4A 5FROA 1WAJA 1YJ9N 2AT1B 3R6MA 2G0IA 2FJWA 2H4YB 4C11A 4JD2A 3EW9A 4KHSA 1GNKA 2DGVA 2DNKA 2DYAA 1N5YA 3SSRA 2ZH5A 1KC8T 1NOMA 5ETTA 2ZEJA 3D7EO 3V9ZA 2JOQA 1HNIA 1AB8A 4OMFG 1RBAA 4BR2A 1TE2A 4GVBA 5F8LA 2CQ1A 3QUQA 1B92A 1HMVA 4K4SA 4HDGA 2Q1LA 1OYDA 4CIOA 2VPWB 4KQZA 1QCKA 2JLGA 3OS2A 4ER8A 2MSNA 3ISND 4OFZA 2XO7A 5LXYA 3DDIA 2D41A 5GAEU 4JS4A 3TTDA 4Q8FA 2VJ5A 4RL1A 3WZ0A 4BC2A 1QH9A 4O4GA 4JV1A 3PRBA 4ISEA 2VD3A 3I9ZA 2BQRA 4EZ6A 1CJUB 3AVFA 1PILA 3DDNA 5EXWA 3G0ZA 4AD6A 1N5QA 5D4LA 3JAMO 4BJQA 3PTWA 1UFWA 2W7AA 2K4PA 4E1JA 2HGLA 1CC8A 3NS6A 4DV3J 2MTLA 3MM8A 3C7NA 5HROA 1CSJA 3P39A 2XS7A 1REGX 4PEOA 1N48A 3WKAA 3ET6A 1VQ8N 4M3YA 1M1HA 1SB3C 3MPYA 3UD4P 5EDWA 1U8WA 3QUCA 3E2EA 2DRBA 4M04A 2KFNA 4QNLA 2O8BA 3BPDA 3CD5A 3IN5A 4W92B 4AHRA 5U47A 3DGPB 1N34F 2XVTA 2HKEA 1DQ8A 1HFEL 4U7UD 2HDOA 2DNNA 2LKYA 3NFAA 2DFEA 2VH7A 5AQGA 3G82A 1NNLA 3UB5A 3BY5A 3L2WA 1D09B 3W8PA 2ZGZA 2XMMA 2XLJA 3NRZA 4PXDA 5L9XA 1HRHA 3KOOA 4U7CA 5AXNA 4CLUA 1S1VA 3PX0A 2AX0A 2M70A 5J2GA 3HFVA 3U7JA 2LEAA 4DPOA 3L6QA 3R1XA 5KFLA 2XSFA 3KDNA 3MM7A 1YXQA 4OZ5A 1J5EF 2OEJA 4RU9A 5IIOA 1SV5A 3QGIA 3KYLA 1QQNA 4URGA 3P5JA 1WC3A 1FT8A 2UUAF 1ULRA 2E8MA 3GU0A 3UPFA 2F5GA 1UL3A 2VASA 3VOVA 2VU5A 1ZM4A 4DU1A 1TFWA 2FSJA 3AO3A 1KDNA 4YORA 3KZXA 1TUYA 2ZJRL 2ES6A 2OFHX 3A3NB 3RW7A 4GY2B 3RJJA 2C3UA 3KNAA 4TUSA 1RBTA 1ZM9A 4K42A 3LDNA 4UAYA 2XYHB 5CZ2A 1VRUB 5KFVA 5JVHQ 4B3TF 5KFXA 1RT6A 3TSQA 4X2BA 4M63A 5KFIA 4M95A 2XCAA 3UMBA 2GHPA 2COLA 4M3UA 3MN9A 5E5NA 2FTRA 1C0UB 2ZH8A 3T9ZA 4LF4F 3PMNA 3VEWA 3NMAA 1XC3A 5LSOA 3FC4A 1RYSA 2YPZA 1N60A 1QHAA 1NK6A 9ICXA 3L09A 2D1CA 4UOFA 2IDLA 2KVQE 1WG5A 1I94F 4OO1J 2CPZA 4CTAA 1ZAXA 9ICJA 4NLNA 4LD0A 4JRQA 4Y2XA 2FGCA 4K4WA 3VAIA 1OH7A 9ICEA 2JC0A 3GQCA 2LI6A 2OEHA 1NOYA 2PMZC 1NJIO 1RWUA 2XHWA 4FDFA 3UR3C 2EQYA 4A62A 2F1FA 2MSTA 2MMYA 3EGNA 4B9SA 4LH4A 3MMBB 3H5YA 2VOPA 3OVAA 1DAXA 4MF2A 4JWNA 2F3JA 3CD0A 1U1QA 3IP0A 4CTAB 1DK3A 5BR8F 2HAIA 3SQ1A 3CEDA 2F8HA 4Y0WA 3EX7B 4F3TA 5EX5A 8RUCA 1XQSC 4O3MA 3TZXA 1S9EB 5HO4A 3AGRA 4DV6F 2BJDA 3IKMA 5BPNA 5J8YC 2QWPA 1WB9A 1GOAA 2EG2A 2A5XA 3ALYA 2P8IA 3ETOA 3O9QA 2PXIA 1LV5A 5KFQA 4KLMA 2EH9A 4LSNB 2MY7A 1T7PA 4FPRA 2FHKA 4ILHA 5ADXH 2I5HA 3IXQA 2ZJQQ 1FNXH 4ZP7A 2LQ8A 4WQ4A 2E5HA 2HZCA 4RUAA 2LHTA 4AQYJ 5J2PA 2HOFA 1KAYA 4LBPA 3B78A 2PSZA 1FD2A 3I87A 3C0BA 2OTLS 2VQFF 1U02A 4Q45A 4DU3A 4QAGA 3UVJA 3CCUS 1FERA 4O5FA 2HWHA 4I2AA 2P6RA 1TKZB 1RBOB 3BUZB 5LJ3Y 5J2NB 5IM0B 3EKUA 4WK3A 2QSWA 1NU0A 2V4RA 5ALXA 2CQ4A 3OY9A 4MN4C 4CJUA 4IR9A 2PAVA 4YD2A 4BRLA 1S1VB 1VQON 2KIVA 1WSJA 5ETMA 2R8HA 4AHSA 3D0PA 1AROP 3BKTA 4EI2A 1P7DA 3AJDA 3V6DB 2OUGA 4CEDA 3NAHA 1HPZB 4USUA 2MLYA 3ETRA 5D77A 3N5BA 5KFGA 1KXPA 5F9NA 3QFWA 4TN2A 5FD1A 3F73A 4PKHA 2M3DA 4IOCL 1OXJA 2ZIXB 3MEGB 2J7WA 3BS5A 5KT5A 4AF1A 4F5QA 4B3MJ 1K8AT 4L76A 3G6ES