3PV8A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddttp-da in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3pv8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3pv8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pv8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3pv8A01
3SZ2A 3D45A 4QWEA 1BPZA 4IQWA 4R5PA 1BPDA 3BQTA 4F92B 3EY1A 8ICZA 3GIJA 4C8KA 4CJKA 4ECZA 3RH5A 4Z4CA 2BCUA 4JV1A 3RB4A 3RMBA 1B9FA 5IINA 5CJ7A 3DRSA 4FJMA 2W42A 1KVAA 3LWMA 4RQ1A 3O3GA 3AUOA 1HJRA 2IA6A 3PX0A 3TI0A 3OJSA 4Q8EA 2JLEA 2E4LA 4B8CA 4AILC 4DTMA 3T19A 2C22A 4E7LA 4GXIA 3P5JA 1X2IA 8ICSA 3HW8A 2IHMA 4M3RA 2HHWA 4M9HA 1JMSA 4BE0A 1XWLA 4IG0A 5CP2A 5C5JA 4CE9A 3ZSYA 5BOMA 1NJXA 2ITGA 5IILA 5DKWA 4Z4FA 2JEGA 4AHTA 4FS1A 3B6PA 3OYIA 1Z00A 5L1KA 1EP4A 4Y1DA 3RJIA 2IHNA 1ZQNA 2BR0A 1ZQFA 2P1JA 5J2QA 3CM6A 4PWDA 1HYZA 4FM2A 4OJRA 1UT8A 4EBCA 4DL7A 5J2MA 5KG0A 1C0UA 4ELTA 4AHRA 3UXNA 2FMQA 2FLPA 4YQWA 1RTDA 4DTNA 1LW2A 1L3TA 3E01A 3C23A 4DS5A 3RJEA 4ECRA 3TANA 4I2EA 1B9DA 3CFPA 4AHUA 4PH5A 2GV9A 5CYQA 4DQIA 3LK9A 1NK9A 2YKNA 4KI6A 2BANA 1HYVA 5KFHA 3MXMA 3AU6A 4B8AB 4W5TA 2I1QA 2I5JA 1RDDA 4CEZA 5J2BA 5HBMA 1SL0A 4JWMA 1S1TA 5J2HA 4RQ6A 5J2FA 4GC6A 4DSIA 2IBKA 4H8KA 1RBVA 4R64A 3TFRA 3HPGA 4W5QA 3LWLA 1TVRA 4F8RA 8ICFA 1NKEA 1U48A 3IAYA 3AVKA 3KIOA 1JX4A 4N76A 2F96A 3M8SA 2HVHA 4W5OA 4I9QA 9ICCA 2G8FA 4M3TA 2GWSA 2MUTB 4EYHB 1JXEA 3NF8A 3CFRA 5CZ2A 4GC7A 5TZVA 1FKOA 4B9UA 3G6YA 4J9NA 4I2HA 1CZBA 1BCOA 2BKEA 2YKMA 4OKJA 4KTQA 4KREA 2DY4A 3VQ8A 4W5NA 4FJKA 4ZH4A 5J2JA 3HT3A 3AVNA 5IIJA 1NK4A 1LV5A 1ZQDA 3K58A 1NOYA 1PZNA 3QO9A 2B21A 1QSSA 2VWJA 3G0ZA 2G8KA 2D5RA 4J9MA 1QHTA 3ZT0A 3L2UA 2OPQA 4ECTA 3KKSA 3ZSXA 2BQRA 1ZJNA 1COOA 1S1VA 3K75D 4J9LA 4ED8A 4J9SA 1CUKA 4ED2A 2DFHA 4BDYA 3PV8A 1RTHA 1HQUA 4M9GA 2KZMA 3ISBA 1S9EA 3OHBA 2BGWA 5DG9A 3O4NA 1L3UA 7ICJA 5DG8A 4CF1A 1RBSA 2OA8A 1F21A 4OVLA 1A5WA 2B5JA 3JPRA 4Z4GA 4Z6DA 1MQ2A 2AQ4A 2WONA 2Z1IA 2VA2A 5IIOA 2M9NA 3AVGA 2O4IA 3VQ6A 4QZDA 4F4YA 4KN4A 5DLFA 1XSPA 3RBDA 4QWAA 3NF7A 2ZD1A 1REVA 1JL2A 3QEXA 4FLWA 3Q8RB 1TK0A 3QLHA 3OYAA 3Q8PB 5D4BA 1V9PA 4TSXA 3L2VA 3H08A 8ICVA 5KG7A 3RRGA 4DQRA 4O3SA 3MR5A 3C2MA 5EU7A 4Q44A 5J0OA 2W8LA 1RDAA 1QLNA 4IFVA 1U49A 4CK1A 5J0WA 4FW1A 1TAUA 1ZQRA 1ZBFA 3RMAA 2ETJA 4FJ7A 2ISPA 3SPYA 8ICTA 3JPQA 3NBPA 3MEEA 5KG2A 3V6HA 1ZBLA 1VSDA 1KFTA 2XRIA 5FDLA 4QZGA 3FDSA 4I2PA 4I27A 1BPBA 1ZQUA 4Z4EA 4R8UA 5EWFA 1T4GA 4O3PA 4F4WA 5CY4A 1QS4A 2BCSA 4QZ8A 4R65A 2ZJAA 4IRCA 3UXOA 5DGAA 1RTJA 3RAQA 3KHRA 5HRRA 4J2BA 1BPEA 3LP2A 5J0SA 3VQDA 4DL6A 2GUIA 1ASUA 3KLIA 3TAPA 4B9LA 2R8KA 4C8MA 5KGXA 3ZSRA 4CFAA 3AV9A 4FYDA 2OPSA 3L2QA 3S3NA 4PHAA 4RUCA 4F93B 2ASDA 1VSMA 1DTQA 4UAWA 1TGOA 1RDCA 3C1YA 1NK8A 4FLTA 1BPYA 4NY8A 3RB3A 3OS2A 1HRHA 1DTTA 3IM1A 7ICEA 2IC3A 5KG5A 5KFRA 3QZ8A 1S9FA 4CK3A 1A77A 3MBYA 2AGOA 8ICYA 4BGDA 4PGYA 4M45A 1T7PA 1S6PA 8ICPA 3BGRA 3ZSOA 4G3IA 4J2AA 8ICCA 1A5XA 2ZE2A 3ZT3A 3LP3A 4F5PA 1JLFA 4H4OA 4PQUA 4YR3A 3K5MA 4CK2A 1XU4A 3KHLA 3RB0A 4O5EA 4QWBA 2ZUCA 1GOBA 4I2BA 3NF9A 1Z25A 1IH7A 3LP0A 3SYZA 3HM9A 4K4IA 4CF9A 2A1JB 1IKYA 3KD5E 3V72A 4CJUA 1RPLA 4NCBA 4L8RB 3AO4A 4EZ6A 3ZDCA 4CEBA 1VSJA 3RAXA 3OYCA 1NK5A 3KD1E 3V9XA 4CJVA 9ICVA 9ICRA 5J2DA 1Y88A 3N97B 4UB5A 1MSWD 3KHHA 3ZD8A 4E7IA 3AO5A 1ZQVA 3ULDA 3MFIA 2V9WA 2AJQA 2RDIA 3GV5B 3PO5A 4W5RA 5DQIA 4E89A 1GOCA 2UVVA 4I29A 4CHNA 2LSNA 4ECWA 5CYMA 5DDMA 4N41A 4FLZA 3GQCA 3VN5A 3DOLA 4I2CA 4J9KA 4KLMA 2MUTA 2H5XA 4YFUA 4IG3A 2NRXA 4KTWA 5KFJA 4RNOA 5DB6A 1S1WA 2RN2A 8ICRA 3O4QA 2ZJ8A 4QWDA 3PX4A 4O3QA 2VANA 4M3UA 9ICTA 9ICHA 3MAQA 4RW6A 3QERA 4BACA 4ED6A 1RT5A 4FJJA 8ICUA 3MXIA 5J1EA 1XI1A 4ELVA 1KTQA 2R8GA 4PA1A 5FRMA 3ZDEA 3ASMA 4DSKA 3TAGA 3MXJA 7ICSA 1LWFA 2AGPA 4UAZA 4DG1A 2A1SA 4Q8FA 5L1JA 3V7LA 3LZJA 4Z6EA 2ZTEA 4KRFA 4FZZA 3ZSVA 2BPFA 4GVMA 1C1BA 3HSTB 4QW8A 4KB0A 2XY7A 3QEAZ 1BI4B 4F5RA 3JYTA 4FCYA 1XSNA 3Q8LA 3LPTA 5J2EA 4DO9A 1ZQZA 4F3OA 3V6JA 1SKRA 3AVMA 3OYLA 3MEDA 1LW0A 5KFWA 4YCXA 1SKWA 1TL3A 3KK2A 5J2NA 3OS0A 4KHYA 3DLGA 7ICRA 4C8OA 2D0AA 1HUOA 4HUFA 4XA5A 4KLGA 3C6TA 4FJXA 1W9HA 4EEYA 3DRPA 1WCLA 8ICOA 9ICNA 1S6QA 4DL4A 3QETA 4ECQA 2C2DA 1XO1A 1MU2A 3RJKA 4CGFA 4F91B 4M04A 1BHLA 2FBYA 4E7HA 4RG8A 3DLRA 2WOMA 1UWBA 1NJZA 2YHAA 3I0RA 2YNIA 9ICGA 5I42A 7ICLA 1S10A 5JS1A 1FXXA 5E41A 4RZRA 1EXNA 1BIUA 1HJPA 1D5AA 3ZSQA 4JK1A 4Z4IA 4NXZA 4MQ3A 4YVZA 4F50A 4FLUA 3OHAA 4KI4A 5DBCA 3OVNA 4FJNA 4FJHA 2X78A 1B22A 2XGPA 1A5VA 4PPXA 1WSHA 3AVFA 2FBXA 3OYJA 4FZXC 4IRDA 8ICNA 1KFSA 4IQVA 4IKFA 3O3FA 4DTUA 4F5NA 2G8IA 3AVIA 4OLAA 4FO6A 4LSLA 7ICHA 1BL3A 4M3XA 4YR2A 3WNHA 3QIPA 4NM2A 4BWJA 5CB1A 3OS1A 7ICUA 3EYZA 3TARA 3OYMA 5KFOA 4DQSA 4CEDA 3OJUA 1IKXA 2C28A 3KK1A 4DTPA 1TKDA 3PX6A 1IKWA 2FC0A 3GIKA 3HPHA 4KLHA 5KFEA 3C2LA 4Y1CA 3HJFA 1BCMA 2JEJA 1NOMA 4CGIA 2PYJA 3NH0A 5J0PA 1ZQOA 9ICSA 3JPSA 1ZQJA 3HO1A 2G8VA 1XSLA 4O3OA 3NH1A 2DFLA 1U9LA 1NKCA 2Z1HA 4BDPA 1K1SA 1RBRA 5KG3A 4DSEA 4FW2A 3GIMA 2W9BA 4Q5VA 4TURA 3QE9Y 1ZQMA 2OPRA 4Q43A 2V4RA 1YVUA 2JZBA 3RB6A 1ZQWA 4Q0BA 5HNKA 3LPUA 2D0BA 3ISNC 4CJLA 1CLQA 1NJWA 3ZT2A 4KLTA 1DLOA 3V4IA 4YMNA 3MGHA 4DTXA 5J0QA 4B9MA 4PGXA 1BIZA 3L3UA 1X1PA 1C6VA 1JXLA 2ASJA 4FM1A 4NLGA 4QOZB 4N5SA 4FBTA 1RDBA 3NCIA 4MFCA 3SI6A 4ID5A 1WLJA 4ECYA 4QZBA 5JUMA 5KG1A 1WSJA 4MEXA 4ED1A 3PNCA 1KCFA 4M3ZA 3HK2A 4K4GA 3RWUA 2FPLA 4CCHA 4LH5A 3VQ7A 3OYDA 4RW8A 3EZ5A 4YD2A 9ICBA 2QKBA 3NFAA 1VSHA 3PR5B 1LAWA 1TKXA 3KLGA 4RT3A 3SQ2A 4OPKA 4RNNA 2FPKA 3QESA 4MF2A 4KHWA 4R63A 5KFBA 3QIOA 4M3YA 3MR3A 4RW4A 4OPJA 5KFFA 4DSJA 2P66A 1RT4A 4FS2A 3K57A 2R7YA 3V6DA 4IR1A 5KRTA 4ED0A 2FLLA 3MFHA 2UVWA 4CGGA 3IS9A 2VA8A 4IFYA 4DU1A 4N56A 3M9NB 3I8DA 3V1OA 3M9OB 4YR0A 3C5FA 1J53A 5SZTA 3MDAA 3OYEA 2E6LA 5IIMA 2P5OA 5HMMA 1UT5A 5DDYA 2BHNA 3HXMA 3B0XA 1RT3A 4M6WB 4UBBA 1NK6A 2HHSA 5DB8A 2PFQA 4FJ8A 2NRTA 3TR8A 2W9CB 3ZDBA 1ASWA 9ICJA 4AHVA 4CHPA 3LZIA 4X5VA 2FMSA 4OLBA 4DLEA 3QEBZ 1RXWA 1WSIA 3TAMA 4M41A 4YXJA 2J6SA 2Z1GA 2NRVA 3JPPA 1JLCA 2AGQA 4RU9A 3C6UA 4DEZA 1LWEA 5L1IA 2AU0A 4M9JA 3IRXA 2OPPA 4CIFA 4ELUA 2FMPA 4DS4A 5DQHA 3SPZA 2XGQA 4UB2A 7ICNA 1N56A 2FPMA 2XY6A 5I3UA 3PMLA 1WSGA 4KLUA 4OKEA 3RJJA 4C8NA 3RJFA 5EWGA 1KEJA 4FVMA 3C5GA 3SUNA 2QXFA 4XIUA 3P1GA 4MFBA 1Z26A 4B9SA 1IM4A 9ICPA 3RJGA 2DTUA 4NYNA 4LZGA 9ICIA 4O0JA 1EXQA 1CXQA 4LD0A 5J0RA 1IKVA 1XHXA 2WTFA 2JEFA 3BQ0A 3H4DA 4M9LA 4DWIA 1BQMA 4DF8A 4NLNA 2FLNA 2GBZA 3HL8A 4CF2A 3NHGA 4YNQA 4K8ZA 4UB1A 2UVUA 2KZ3A 2NRZA 3ZCMA 2HNYA 4RQ8A 9ICAA 4CF8A 1ZBUA 3MR2A 4RT2A 3JPNA 4K8XA 1HUZA 3RTVA 4FK0A 4RNMA 3WNFA 2ALZA 1R0AA 2BDPA 3AVJA 4IR9A 4GMJB 3QEWA 2XC9A 3AU2A 3G6VA 4I2IA 3EPGA 4FLVA 5K14A 7ICGA 4PHEA 1RT2A 4YMOA 3SQ1A 2ZTDA 3B6OA 4M2YA 3RH4A 5KFAA 4GW6A 3OGUA 1IO2A 8ICMA 8ICWA 1XS9D 4DL3A 1ZQIA 4P4MA 1QSLA 2HB5A 2BE2A 3DLKA 5KFKA 5C42A 3THVA 4BXOA 3V1QA 3QEVA 4DFMA 5DG7A 4CF0A 1QSYA 3EPIA 2ASLA 1NJYA 5KFUA 2X6SA 2W9CA 3ZD9A 3VQ9A 7ICKA 1WSFA 4RQ2A 5KG6A 4DOAA 5J0TA 3PO4A 2ISOA 2G8WA 4KAZA 4DTSA 3KKRA 2J6TA 2J6UA 2KFNA 4QAGA 1D9FA 3CG7A 4O3RA 4HUEA 5FROA 4M9NA 3ZT4A 4CJRA 2F8TA 4RW7A 1RBUA 4CESA 3AA5X 4DFPA 4JS5A 1S76D 5CZ1A 3RBEA 4YFKA 4FZYA 4PHPA 4B3OA 5DQGA 3ISCA 4R66A 1ZQEA 3V9SA 3TWHA 4DTOA 3RH6A 7ICMA 4QZHA 2P6RA 4FJGA 3KLHA 5JS2A 4RQ3A 5KFXA 2PXIA 4DTRA 4ID1A 3RR8A 4J2DA 5J2KA 3L2RA 3QNOA 3NTUA 1UA0A 1A76A 3ETLA 4EP4A 4KN7A 1UAXA 5KT4A 2NRWA 3DLEA 4DSFA 3GV8B 1SL1A 3MABA 3ZSZA 3PW0A 2HVIA 4BE2A 2RF2A 4LVSA 3V9WA 4P4OA 3V7KA 3OSPA 4UAYA 4M3WA 8ICLA 4LZDA 4ECXA 1U04A 3M8QA 1HMVA 3LAKA 9ICQA 3PW2A 2OYQA 1ITGA 1ZQQA 3B0YA 4Z6FA 3OYKA 4UQGA 4KV8A 4DTJA 3Q8MA 2VWKA 3AA2A 5KFZA 3K5NA 3NAEA 1RT1A 4YP3A 4I2DA 2I9GA 4O5KA 8ICAA 2BGGA 2AQ0A 5KFLA 5KFNA 2B6AA 4DLGA 1TFRA 4QZEA 1JL1A 5HLFA 4LH4A 2BQ3A 2PFPA 3AO2A 9ICKA 3I0SA 4JRQA 5KT6A 1HPZA 4M42A 4J9QA 3O3HA 4Z4HA 4KKOA 1T8EA 2YNHA 1Q9XA 1S1XA 1WSEA 2HNZA 1VSIA 5HRPA 5HP4A 4O4GA 4NLZA 1RT6A 2X74A 4KHQA 1Q9YA 2P5GA 4K4HA 5J29A 2ATQA 2IOCA 2R8JA 3VQEA 2R8HA 3JPTA 1Y97A 4YMMA 3CFOA 3SNNA 2ZUDA 2BQUA 4FBUA 3PY8A 3QINA 3HX0A 3C94A 1TVAA 3SUPA 3ZT1A 2DFFA 2ATLA 5KTQA 1J9AA 5KFTA 4KLQA 1RTIA 2ZTCA 1L3VA 3NGYA 8ICIA 2KQ2A 3HYFA 1DGSA 1U47A 4DFKA 3T3FA 7ICFA 1ZQPA 4BXOB 4QWCA 3Q8SB 5HMLA 4RUAA 3NGDA 3DMJA 4KLIA 1RZTA 4KHSA 2HHUA 2F8SA 3H4BA 2VG6A 4KLOA 1S5JA 8ICEA 3HP9A 3QEIA 4NLKA 5KFIA 2XY8A 3K4GA 2OZMA 8ICGA 4LSNA 5DMRA 3EWAA 2C2EA 3IG1A 2HHTA 4CJ4A 3LDAA 7ICQA 2BCQA 1SKSA 4KLJA 1RT7A 2IAJA 2PY5A 4PGQA 3K5OA 3K5LA 1EKEA 5DBBA 2Q0ZX 2W9AA 1HQEA 4DU3A 9ICWA 4CECA 3Q8KA 5D3GA 2YNFA 4RPYA 3N4MB 5DGBA 3LAMA 4E0DA 1U4BA 8ICXA 5DK5A 5J0YA 4TQSA 1RXVA 3ZDAA 3PW4A 1KVCA 2XHBA 4R8UB 3IHQB 5KRSA 3QNNA 2DPJA 4CJFA 9ICMA 3JSMA 4KPYA 4CJSA 4HCBA 5DB7A 3UQ0A 3BDPA 3VQBA 3RMCA 5HP1A 3E2EA 2G8HA 1BVSA 5HROA 2HMIA 3ZDDA 3H8JA 3M8RA 1BQNA 4O44A 3SCXA 3HP6A 4KITB 3VQPA 4EZ9A 4DL2A 3GILA 1S0NA 5J2AA 2HHXA 3DM2A 3OYBA 3KLEA 4GXKA 1ZQAA 3S9HA 4YXMA 1SZPA 2JZBB 4F4XA 5KFSA 1KDHA 3H40A 1TAQA 1QQCA 3DYAA 4CEQA 2FBTA 2F1IA 1SL2A 1HYSA 5L9XA 2KN7A 7ICTA 2G8UA 4F5OA 1KVBA 1S77D 3TAQA 5KFMA 4P4PA 1JKHA 2P51A 3AA3A 2PYLA 3H8WA 2QKKA 3S3MA 1O1WA 1JLQA 4B08A 4M47A 4O5CA 3A2FA 3NGZA 1T05A 4NCGA 1LAVA 1EX4A 4CFDA 4F2RA 4RQ4A 1I39A 1BPXA 2EX3A 4DMNA 3AVAA 1K1QA 3U6FA 1UOCA 4FK4A 3TABA 5IIIA 1RBTA 3GFKB 3V6KA 5CHGA 4DOBA 3D0PA 4IQTA 1CZ9A 3K59A 1S1UA 2HHQA 2DPIA 4UB3A 3QEPA 1KSPA 5CA7A 4CERA 4DF4A 3UQ2A 3CYMA 4E7KA 4IBNA 1ZBIA 1TV6A 3PR4A 5KFGA 3CM5A 4TUQA 4PUOA 1Z3EB 1KFDA 3V7JA 3SI8A 2D0CA 1ZJMA 4J9RA 4I9LA 4JLHA 8ICBA 4KLFA 4MFFA 4F3TA 3F73A 2PI5A 3S3OA 4PHDA 4CEAA 9ICUA 5J0UA 1N6QA 4FJ9A 2JEIA 3KJVA 2XCPA 4NCAA 1LB2B 1W0HA 1X9WA 1VSLA 1NK7A 3VQCA 4UB4A 4QZCA 2XCAA 3WNGA 4J9PA 3OYFA 1T3NA 5J0XA 4IRKA 1I3AA 2HNDA 3NDKA 4O5BA 4OGCA 3JPOA 3SV3A 4CIEA 3TAEA 4P2HA 4KLSA 1TKTA 3V9ZA 3VA3A 1G15A 2MAXA 4RQ0A 2BPGA 2PFNA 5J2IA 4MFAA 2O4GA 2NUBA 4MF8A 1BISA 8ICKA 4TQRA 1KLNA 4HYKA 3CQ8A 3G6XA 4CFBA 4H4MA 3HVTA 4GXJA 4ED3A 4ED7A 2EHGA 4JUZA 2OZSA 5HHHA 4FLXA 4HHTA 1MQ3A 3RRHA 4CJEA 4CJWA 3DLHA 5KFYA 4BDZA 1RNHA 7ICPA 4QCLA 3MDCA 3TFSA 1Z00B 1ZQBA 3OSNA 4CJ3A 3MECA 2A1JA 3AO3A 4B9NA 3Q8QB 1NOZA 3LDSA 3PW5A 2YNGA 4YG2A 4F5QA 3T5LA 4IQUA 2HW3A 1ZQGA 2FBVA 1GOAA 4CGJA 3MGIA 4UBCA 2OWOA 4CHQA 3AVBA 2BPCA 4J2EA 1N5YA 3OYNA 4E19A 5BPCA 2W9MA 3VQAA 3VA0A 4JWNA 4AHCA 2KTQA 1UA1A 1JLAA 1T03A 5KFCA 4B9TA 3V9UA 4EP5A 1WAFA 8ICJA 2YV0X 3VQ5A 5KI6A 4F4ZA 1C0TA 3PMNA 4DQQA 3F9KA 4CJQA 5KT5A 3PUFA 1IXRA 1N48A 1AROP 1L3SA 1TK5A 3T1AA 5KG4A 4TUSA 4KHNA 5KFQA 1KLMA 4OKKA 5KFDA 1NK0A 4JRPA 3L2WA 7ICVA 4ICLA 4I2QA 3VQ4A 4QZ9A 5C24A 1ZYQA 1JLGA 1XC9A 3SUQA 3AVCA 1VSKA 4BWMA 4ECVA 5EOZA 3SV4A 1TL1A 3LALA 9ICXA 3BJYA 2P6UA 4QZIA 2IGIA 1ZQXA 2BCRA 4XQ8A 4RPZA 3KK3A 2VG5A 4I2JA 4NM1A 1VRUA 1HNVA 1NKBA 1U45A 4CJ5A 2Q3SA 1HNIA 1C1CA 3UIQA 1SUQA 1JLEA 3EW9A 4Z0UA 1XHZA 4JS4A 4MEYA 2IMWP 1TK8A 4ECUA 3AVLA 2DFEA 4ECSA 1D8LA 2KW4A 4JV2A 7ICIA 9ICEA 4RQ7A 4CHZA 5HRNA 5F9LA 5DLGA 1Q8IA 5CWRA 2KFZA 1CXUA 4FM0A 3DI6A 2Y1JA 1SV5A 1YTAA 3NE6A 4KLEA 4KFBA 2ZQBA 4KTZA 2UVRA 1RILA 2X6NA 4EBDA 1VK0A 3OY9A 3DRRA 3PVXA 2PFOA 4CGHA 3HVRA 1WN7A 8ICHA 1D8YA 3ALYA 5EWEA 4F2SA 3GV7B 3U3GA 4E1NA 1ZETA 4I7FA 4LY7A 1S0OA 1YT3A 4OGEA 1IG9A 4QZFA 5DB9A 2IDOA 5D49A 1QE1A 1JIHA 3AVHA 4O0IA 4KLLA 3RR7A 1DOQA 9ICOA 3TAFA 3SUOA 4CEEA 5IIKA 4F4KA 2V4QA 3BQ1A 3PW7A 5C25A 3GIIA 4FLYA 4KLDA 4O3NA 1ZQSA 2W9BB 5KFPA 4KMUA 4GLXA 3K2PA 4FJLA 1LWCA 3BQ2A 4HUGA 3VQQA 4O55A 1YTUA 2IS3A 3M8PA 4BE1A 4ZTFA 2HHVA 4KB1A 2Y1IA 1FKPA 4KO0A 1TKZA 4WE1A 3KTQA 4DL5A 1QTMA 1WCNA 3FFIA 2B4JA 1ZQCA 4FXDA 5D46A 4TUPA 8ICQA 4ZTJA 2VG7A 2ZJ5A 1ZQTA 4IDKA 1ZQYA 1ZQKA 5SWMA 3NF6A 1X9MA 3C2KA 5KFVA 1KRPA 4B9VA 3LANA 5HHIA 3ORYA 1BGXT 2F1HA 2W8KA 3SJJA 3NH2A 4DOCA 3C1ZA 4I28A 3AO1A 5J2GA 4C8LA 4DSLA 4HVJA 1VSFA 9ICFA 4I2GA 3OYHA 4N47A 1MC8A 4YN4A 3WNEA 4EBEA 4RQ5A 2YHBA 1RCHA 4EYIB 4CJTA 2ZUBA 2Z1JA 2A1RA 1C1AA 5J2PA 2PZSA 3AA4A 2KZZA 5HRSA 4XUSA 1ASVA 3DLBA 4O9MA 1ZBHA 4HTUA 3G10A 3M9MB 1K6YA 4CJPA 3T5KA 5KT7A 1WNSA 1L5UA 4I2AA 2VA3A 4E1MA 4CGDA 3DOKA 2E6MA 1JN3A 4CFCA 1RYSA 4JV0A 4Q45A 3HPOA 5KT3A 2XO7A 1EETA 3ZSWA 3MEGA 3C21A 9ICLA 4M6WA 3KHGA 1S0VA 7ICOA 3P83D 4CEOA 3KLFA 3TQ1A 3ISDA 4E7JA 3OYGA 1JLBA 1X9SA 2C2RA 3HWTA 3UXPA 1J54A 1D9DA 1B92A 4KHUA 2R8IA 2LYHA 4CHYA 3LP1A 4QW9A 3MR6A 3L8BA 1S97A 1ZQHA 4NYFA 4ZHRA 5CR0A 3GDXA 4RPXA 3V1RA 5BOLA 4XRHA 4HCCA 1B43A 5DBAA 1WAJA 5L1LA 1ZQLA 5FRNA 4DFJA 1S9GA 1CEZA 4M0AA 4CEFA 3RMDA 1FK9A 4AHSA 4CIGA 3NGIA 1C7YA 3SQ0A 1S0MA 2QK9A 2BCVA 1C0MA 5KT2A 3ITHA 2JGUA 4Z6CA 4FJ5A 1JXBA 3V81A 4G1QA 2RPIA 3H7IA 4DQPA 2XY5A 3SQ4A 4FK2A 1TV9A 3U3YA 5KGWA 5T7BA 1VRTA 4PY5A 1RYRA 4FJIA 4DU4A 4RW9A 5J2CA 5F9NA 1H38A 3T5JA 2RKIA 3H8SA 1VSEA 2PI4A 3FYHA 4E3SA 3T5HA 3L3VA 3C95A 1BI4A 3UPQA 1J5OA 3RJHA 4YD1A 2F1JA 4CHOA 4I2FA 4J9OA 4AH9A 2RDJA 4QZAA 3QZ7A
chains in the Genus database with same CATH superfamily
3SZ2A 2YXLA 3JTOA 3FZBA 3QUCA 3I6PA 2OEJA 2JFKA 4DPXA 1SJ3P 2XMJA 1FX4A 2JL9A 4ENOA 4F92B 2R3VA 3GIJA 4CJKA 4ECZA 3RH5A 2BCUA 4JV1A 2CRLA 5IINA 1VJWA 1KVAA 3VC8A 3LWMA 1H6KX 2OD6A 5IWAK 1XEZA 3DLEB 1FRKA 4HT7A 3AUOA 1HNZF 2YKOA 3EZOA 5DDQC 2GQQA 4Q8EA 1BXNA 2DB1A 2B56A 1Z05A 4AUKA 3B8AX 8ICSA 2DRBA 1JB0C 5ETSA 3U9ZA 3H20A 1LNQA 2QB0B 1X4EA 2UUTA 5A8RB 4E98A 2HI0A 4IG0A 3RRKA 1G7CB 3ZETA 1NJXA 5D0RA 4P0PA 5HATA 5IILA 5DKWA 3C15B 1RDFA 2DGWA 2BVZA 1Y11A 4C4RA 5KOWA 4AHTA 4C9DA 4EAHD 3B6PA 4X4RA 3CCVS 5U47A 1KONA 4BR2A 5T41A 2IHNA 2MJNA 2MLXA 2H3QA 1KOHA 3SCLE 2BR0A 1NDCA 1J2VA 2ILZA 3GZFA 3CXCR 4FM2A 3CD5A 1UT8A 4EBCA 4XH4A 1KQQA 5J2MA 2VODA 1C0UA 1VQNN 4AHRA 4NRTA 2FMQA 1N6QB 1EWQA 1L3TA 3ENOA 2GQCA 3C23A 4XK8C 4ECRA 5B7WA 3CJAA 2GV9A 1Q82O 5CYQA 2GMHA 2CJYB 4RKUC 4DV4J 1Y10A 3R1LA 3MAAA 5AT1B 4AD6A 3AU6A 1LFWA 4W5TA 2COLA 4JWMA 1QHAA 3HBTA 4MIWA 5J2FA 4OPHA 2F7VA 4X4SA 4GC6A 2IBKA 1RBVA 3HPGA 2LKYA 5CZVA 1TVRA 2DYAA 8ICFA 1RP5A 2FXUA 3AVKA 3TEGA 3LDQA 4N76A 2P9NB 2CPEA 2PT0A 1X8DA 2G8FA 4LR7A 4TY8B 3NUQA 4M94A 4DPUA 3R6MA 3I28A 3CFRA 4NASA 4PXCA 1PYSB 2XHWA 3MN6A 3VF4A 3G6YA 3LDPA 3BR8A 2VYPA 3U26A 4FKXA 1CJUA 4FXWA 2E1EA 4KREA 2DY4A 4C0OC 3H90A 2V8HA 4KQZA 5ADZA 3HKZD 4ZH4A 2KRBA 2P9LA 5J2JA 2RU9A 4OZ1A 1N33J 4YORA 5IIJA 1NK4A 5JXSA 5BN8A 2EEYA 4K2XA 3UD3P 1PZNA 3P5BP 3GCXP 2CJXB 1VQON 3QO9A 4JNEA 1WHYA 2G8KA 3DDKA 2ZH3A 4KJIA 1QHTA 3AY9A 4LIRA 1X4CA 2CWKA 2KT2A 2GS8A 1TKTB 3IWNC 3ZSXA 2VDIA 1T03B 4J9LA 1YITN 4ED8A 2C3UA 1CUKA 2KJ8A 1NZBA 1X60A 1JNRB 4QS9A 1NDKA 3FEXB 5DG9A 1L3UA 3L09A 1ATRA 1YRUA 5DG8A 2EBGA 1ITPA 4HACA 4RW8B 2WB1C 3T1HF 1BQNB 5H1SV 4H0OA 4BRPA 2YQ1A 3MWPA 4OVLA 2QLBB 1G6BA 2QSWA 4Z4GA 1MQ2A 2WONA 5FLXU 2VA2A 1GEHA 5HO4A 2IMOA 4QZDA 4F4YA 1S6PB 5DLFA 3ZZTA 3GLJA 3RBDA 3ENHA 3KXDA 3QEXA 4H5TA 4FLWA 2WBNA 2W4CA 5AKZA 1TK0A 3OYAA 3Q8PB 4TSXA 2JRZA 3FJ2A 3H08A 3OQ2A 4DR7K 3RRGA 2H5EA 4O3SA 3V2UC 3BB5A 3MR5A 4P75A 4BX9C 2G2OA 3A3OB 5J0OA 2FC9A 4X64F 5CR4A 1QLNA 1EP4B 4IFVA 3LL3A 1ZQRA 2CFXA 3RMAA 5IQ6A 2J9CA 3J7Z5 3NBPA 1VSDA 3ONQA 3P38A 4PXBA 2XI3A 2P9IA 2WSCC 3UO0A 4QPXA 1UCVA 2GJFA 4I27A 1BPBA 2GX9A 1ZQUA 4K50A 4Z4EA 2B9WA 3SMSA 3VGTA 1YF5L 4NXNK 5EWFA 4O3PA 3O5BA 4CE6A 5GINA 2WFAA 4FPIA 3NWRA 2OFGX 2IM2A 4KE5A 5CZXA 1BY9A 2G1DA 4OZ3A 1HFEL 5KNIA 3WBZA 2F7TA 3LA0A 1DURA 4M5NA 3ZNUA 3CCES 4QIWD 1HARA 2R8KA 3O5TB 5A0YB 2IVYA 4W92B 1JLCB 2LLZA 3CCSN 2OPSA 3S3NA 4PHAA 1OVQA 3HSJA 2FJWA 1F9HA 1N33F 3PCOB 3PDNA 3I0RB 3I56N 4UAWA 1TGOA 2IDLA 3SBGA 2H3GX 2P6SA 4FLTA 3CW2C 4DR2F 2RVJA 4BC4A 1DTTA 1JNZB 3IM1A 1EHWA 2IC3A 5DM7Q 1S9FA 2HHHJ 2LYVA 3W2WA 1TUWA 2CG4A 8ICYA 3I5BA 2WHOA 1SB6A 4IH6A 4JKAA 5AKKA 4C4TA 4KT0C 2OAUA 2WF9A 4G3IA 3KKAC 1K0TA 3QIPB 1ZRMA 3AOCA 1UVLA 3ATUA 3ET6A 2ZE2A 2QW9A 3LP3A 3DLKB 3CCWA 2LU1A 1JLFA 4PQUA 1NWKA 2YHWA 4BR7A 3MI7X 1OYEA 1F3VA 3KHLA 3RB0A 4UUWA 5K4LA 1BUPA 2Z58B 2P9CA 2W6LA 2CPXA 3ISND 4L3QA 4DV2K 1IH7A 1Q78A 2GGPA 3HM9A 3W3SA 3WHIA 3LVVA 2ZIUA 3KJVB 1NNDA 1HL6A 3OVSA 4NCBA 3AO4A 2GMJA 4KH6A 4EZ6A 1VSJA 3KD1E 2MHEA 4X64J 1JXVA 4CJVA 1F6TA 2WOMB 4DUZF 2YWHA 2E5JA 3C7NA 3KHHA 2EXUA 4OZ2A 1N52B 1ZQVA 2HOFA 3UI3A 4P7TA 1VK8A 5F8LA 2RDIA 2NO4A 1GOCA 4I29A 2B7CB 4K5SA 4M8LA 3H45C 4C7YA 2NLWA 5F41A 2DEIA 4LFBK 4IEEA 3G86A 5CYMA 2BRKA 2EZYA 2LI6A 3MMCB 4N41A 3NASA 3GQCA 3CIZA 3DOLA 4ES2A 5TKWA 2H9ZA 4F25A 4J9KA 5AR0A 4NI2A 2MZQA 2H5XA 1FRXA 2NRXA 5KFJA 3GB0A 8ICRA 2ZJ8A 3PX4A 1TL4A 2F44A 4LSLB 4O3QA 2AX1A 3M6XA 1PVRA 3CDWA 2NXEA 5ITHA 5ALFA 1O13A 4LF1A 3IC1A 4CZKA 1XR5A 4JV5K 3QERA 4BACA 4ED6A 3CCLN 2AMCB 1RWXB 4DR6F 1YRXA 3KLFB 4LQ3A 2KOBA 3E9PA 3OL6A 1AQ6A 1X3NA 4CBWA 1LWFA 4DX8H 3SAGA 3L5KA 5L1JA 2P8IA 3V7LA 1HLWA 1YJWS 4OV6A 4DCOB 3THYA 2ZTEA 4KRFA 3WKEA 1U2RA 2HLUA 4NXMF 4BVPA 1DRZA 3O9UA 2XY7A 3QEAZ 3JYTA 3LPTA 3CC4S 2C3YA 4Y2KA 1ZQZA 3FR0A 4P0PB 4F3OA 3V6JA 4BRHA 4DR5J 3KZIU 3M1YA 2XWXA 3AVMA 5ETOA 2C3OA 7ICRA 4C8OA 4HUFA 4ILLA 4WF9L 3SFUA 1L7MA 4W98A 3TWZA 1W9HA 2A6OA 3GFYA 1ZM3A 1U6FA 3SBMA 2FJBB 1RWPB 5B0GA 1MU2A 3U1LA 1FJEB 4CLLA 3GJRB 4KHPK 4RG8A 2YHAA 1S48A 7ICLA 2AEMA 2R2SA 2IVPA 1D9AA 4JI6K 1GXTA 1OSCA 2YX6A 3T79A 2ZDPA 5AJ3K 1B7YB 2E2QA 1D5AA 1OH8A 3I55N 4Z4IA 4O23A 4YB1P 4UT4A 4YVZA 5AKLA 1HUXA 3OHAA 1IQTA 3O9QA 4A8QA 1EARA 1OSDA 2OIHA 5DBCA 2HNZB 1OH6A 3IXQA 2X78A 2CG8A 2XGPA 5I3QA 4DUZJ 2ZC4A 1Q16B 4PPXA 1KFSA 4A8FA 5C2CA 2DISA 4DB3A 1XUPO 1IBLF 4HTLA 4BWJA 2VBYA 3OS1A 3EYZA 1NSKL 2QL9B 4MYUA 3TARA 4LFAK 4Z2XA 4CEDA 3OJUA 3VTHA 4DTPA 2E1FA 1JMTA 2QL7B 4NLYA 3PX6A 1IKWA 3F5AA 1JLAB 3ILLA 4TU7A 1WDDA 3ZTRA 4Y1CA 2WMMA 5H2FU 2EFNA 2ZIVA 2ZDOA 4NLTA 1NOMA 4CGIA 4LVNP 1ZQOA 4AYBC 2AT1B 1FJGF 3JPSA 1VBZA 3NRZA 3A5NC 4MFBB 2NYHA 2QN6B 3NH1A 1U9LA 4B3RF 1C0UB 3NNCA 2HQIA 3M6ZA 4FW2A 4DPTA 1GMWA 1ZQMA 2OPRA 1JKHB 2ZH8A 5HNKA 3BO4A 1R43A 4CJLA 1JALA 4Y2MA 2OPPB 3V4IA 3UKUA 4EFHA 1HEKA 2QZ8A 4NXMJ 4DR6K 3MMJA 1BIZA 4S0MA 1KP6A 1YIJS 2BM0A 2E88A 1RBLA 2ASJA 2ESEA 4FM1A 2V0NA 4FBTA 1RDBA 1U1RA 1DFDA 1JLEB 3NCIA 2DIUA 3SI6A 3KBBA 2D41A 4ED1A 4QIWC 4M3ZA 2IRXA 2EWSA 2WF5A 2P9GA 5B0DA 3JSBA 1XQSC 3W0LA 4ZVEA 3VQ7A 3AT1B 3G6EN 4JV5F 3I9V9 1X42A 5E7OB 2DGZA 9ICBA 2DNGA 3PR5B 3E58A 3IBWA 3J7YP 1UHUA 4J37A 4PL8A 5BR8F 4RNNA 3J80Y 2QTDA 1VQKN 5M1FA 3LO3A 1YQHA 3GFZA 4RW4A 4JEPA 4J91A 3B9JA 2P9LB 3VEYA 5KFFA 2DQNB 3EWGA 2F40A 2X1AA 2DCLA 3P4UB 4IR1A 4TYAA 2ZH1A 2J0QD 3ZC4A 3CCLS 4IFYA 3M9NB 3CQXA 2F5GA 3M9OB 3V1OA 3H46O 4ZVTB 2RQMA 5JMVA 3L3CA 3KNAA 2KSOA 3MDAA 2CGKA 3GWCA 3UE2A 3OYEA 1IIPA 5IIMA 3R5DA 4YOXA 4JI6F 1UT5A 2ZITA 2BHNA 4WK3A 3B0XA 1SQFA 2FVQA 2HHSA 2PFQA 4KHPF 2Q66A 3NOCA 5HL7Q 1EQYA 2YHXA 5CHCB 3LZIA 1MWMA 4OYBA 4C0ZA 4FF3A 5ADXH 4BC5A 2CXYA 2G5HB 2W1BA 1X3MA 5AQRA 3TAMA 2Z1GA 1C0FA 3JPPA 1QQNA 5GADI 1CC7A 4USMA 4RU9A 3HSZA 5K9FA 3PSTA 1DLOB 4IH7A 2AU0A 2FJXA 3GSIA 2D69A 1WG1A 2P9UB 2MU2A 3AOBA 3RU0A 1R89A 3KJFB 2XGQA 7ICNA 1N56A 4I1TA 4K4SA 5GADP 1Y5LB 2OANA 5C24B 3PMLA 1C1BB 1WSGA 2HIYA 1YKWA 2RE1A 3KYLA 2IRUA 5AQNA 1FTRA 4XIUA 3CO9A 3OR2A 2Q1LA 3QYYA 1T9YA 1IM4A 2M0NA 3DEEA 1KQSM 4NLBA 2OCEA 3N6LA 4LD0A 2YH1A 1XHXA 1VQYA 3F2KA 4GO5X 1ZD3A 3H4DA 3E51A 1UPMB 4DWIA 5A8RA 4DF8A 4TNOA 4DR2J 4CF2A 4YNQA 4K8ZA 2VG5B 5KL1B 3P49B 2Q2RA 2KZ3A 4B3SF 2AJ2A 4CIOA 4V1Ak 4CF8A 1ZC6A 1ZBUA 3OVAA 1FDDA 2DH9A 3MDFA 3OLBA 4F0MA 1HUZA 3RTVA 3WK4A 2MQQA 1SQEA 4UQTA 2Q31A 2M52A 1ZOLA 3WNFA 5C0YA 3AVJA 2IJNA 2JC1A 2PMZF 2XC9A 5CABA 4CF3A 1HNXJ 2I2YA 4WCEL 5C2GA 1X4AA 3F2DA 4I2IA 5D4PA 2I7NA 3HDSA 2DR6A 2MZJA 1RT2A 4LBIA 1Y9OA 4F7VA 5JVHQ 3QU2A 3LPYA 1AFIA 3RH4A 4WKRA 1K8KA 1K9MO 4ZS6A 4NJ8A 2IM3A 3Q7BA 3OGUA 1IO2A 8ICMA 8ICWA 2BE7D 1WSVA 4DL3A 2SXLA 4FYVB 2D0PA 4P4MA 2BE2A 3DLKA 1RTDB 3BYPA 2DY9A 4BXOA 4JI2F 4X66K 1TU0B 2VKQA 5K8PA 4QR0A 4MKVA 4MDBA 1QSYA 3HX9A 3EPIA 1XN9A 4GKJK 2ASLA 1Y7PA 4DHYA 4KHPJ 1Y3KA 4LF9J 1VJQA 1KC8O 1F5CA 3H59A 1WC3A 3BGFA 1NGBA 3PO4A 2ISOA 3ILJA 4Z7YA 4DTSA 1SIJA 5THWA 2Y1RI 3MDQA 3ZEUB 4A8OA 2KMDA 4DUZK 5ALQA 2ATCB 4BRGA 4CESA 1IG8A 4DFPA 2ZBRA 4JS5A 3BKUA 3QT8A 5CZ1A 3RBEA 1E6VA 3B6BA 1NDLA 2GGPB 4OYZA 1D0EA 1H2VZ 1WHWA 4F36A 4R66A 1ZS6A 3V9SA 3TWHA 2LQBA 4DTOA 2M8DB 4QZHA 2KT5A 2J7KA 5JS2A 5KFXA 5DZ7A 2ZUAA 3RR8A 2K8GA 3DDIA 1UA0A 5CD4H 1A76A 3LM2A 1S59A 1UAXA 2NRWA 3WKBA 5HQ8A 3QNMA 2ZIWA 2O8EB 3MABA 1YXQA 3SMZA 3SD7A 2HKEA 4LREA 3FC4A 3WUHA 2R7QA 4RUBA 2RF2A 4LVSA 4P4OA 4J7CA 4X62K 3V7KA 1HPZB 3M6WA 2J76E 3FAHA 3OSPA 4JI5F 4WBFA 1GH8A 3UD4P 1U04A 4JHDB 1UTAA 1VQ6N 3M8QA 1HMVA 3LAKA 3M30B 3N7RC 2HBYB 1ZQQA 1Y3JA 1FDBA 4KH1B 2M4MA 4Z6FA 3DXBA 1ZBTA 4KV8A 4DTJA 3Q8MA 2E9TA 4GIBA 3K5NA 3D2EB 3K9KA 3PYFA 3NAEA 1RT1A 2VQFJ 4YP3A 2I9GA 3LDLA 2Y3YA 2OH2A 5KFNA 4WE1B 1XMBA 2B6AA 4K4UA 4DLGA 3BS7A 5K14B 4C8YA 2L9DA 5HLFA 2I6WA 2FQQB 1Q79A 4EX7A 2BQ3A 3AO2A 9ICKA 3O0FA 2R18A 5KT6A 1XNRF 4J9QA 3G8QA 3PFOA 1BUXA 3BF1A 3O3HA 4JB3A 4Z4HA 2YI1A 2R7WA 2OHDA 3CO0P 4DCPB 4CO2A 5AXMA 1HKGA 1Q9YA 5LMNK 1QQMA 5AHXA 3M05A 3R2CJ 1EO1A 2R8HA 1Y97A 3N5FA 3SNNA 2ZUDA 2Q0UA 5LOQA 2QYGA 2NV3A 2DFFA 2F9TA 1MMDA 2CQHA 4LVOP 1IQZA 2H3ZA 1CJKA 5ALXA 4B6JA 4KLQA 1SCJB 3KWGA 5AQSA 2HF4A 1RABB 2CPZA 2XTJP 2KQ2A 3HYFA 5AZJB 4OI4A 1DGSA 1U47A 2F9DA 1VFJA 3T3FA 4ZVPB 3SSRA 4BXOB 3Q8SB 3NGDA 3NLCA 3QRRA 1YIJN 3VZIA 4QR2A 2F8SA 4ID8A 4KLOA 1S5JA 3KZXA 1DY3A 8ICEA 2XY8A 2OZMA 5DMRA 3AL0B 4NRUA 2C2EA 3FQKA 3QMLA 1WWVA 1HD0A 2GVDB 4HT5A 1W2IA 4EI2A 2LYBA 4MO4A 4CJ4A 2FHMA 7ICQA 2BCQA 4CBXA 3PNIA 4YOUA 1RAHB 3K5LA 3A8YA 3QBWA 4KIAA 3IBPA 5BYQA 1NGJA 3VF0B 4I4BA 4KY3A 5A8WB 3H1QA 1U4BA 2PKEA 4LF5K 4C4WA 1RISA 4TQSA 2ZD1B 1FCAA 3PW4A 1MWZA 3Q8UA 3AXMA 1F3FA 4CJFA 1R6YA 2VQFK 4R0EA 3R6LB 4PG8A 3DXKA 3UQ0A 3K7RA 5ALWA 4QS7A 3RMCA 4CGZA 1Q1KA 4HTIA 2G8HA 1BVSA 1RTJB 2BJ9A 2YX4A 4NLPA 3H8JA 2JV3A 5GAEP 3WK8A 4O44A 1O6XA 8RUCA 4XTTA 2W41A 4B3TK 5IV3A 3H0PA 5ALVA 4DL2A 4YHHF 4NV0A 2P9PA 5AQUA 1NXIA 1QTNB 1R8PA 1HQUB 1KBUA 1UKUA 2HHXA 5AFUA 1RTZA 4IO8A 4C3KA 2BRLA 1ZQAA 3S9HA 5D4LA 5M2RA 1RCXB 1SZPA 2JZBB 4F4XA 1N5VA 5KFSA 1KDHA 3H40A 5J8YA 1QAXA 2MGZB 2FBTA 3KG0A 4H54A 4CM0A 4BRNA 3OFFA 4MDAA 5F2RA 1RWUA 1W7WA 2JH7A 3QDKA 3F44A 2E20A 4F5OA 1KVBA 4Z37A 2HFOA 1JKHA 2P51A 3NWGA 3LQVA 3K89A 1O1WA 2WFBA 2L48A 4BC3A 3BV8A 3NGZA 1LAVA 3CVKA 3FUYA 1EX4A 1NM2A 3TW0A 3LUYA 4IOAQ 3IV6A 3NAIA 4CM2A 4RQ4A 1BPXA 2EFOA 4DMNA 3GE1A 3AVAA 3D54A 1T9XA 1UOCA 4FK4A 3DGVA 3TABA 2O6KA 5B09A 5IIIA 5HOOA 4FN5A 5AM3A 4DOBA 3D0PA 2YKNB 2FD2A 1CZ9A 5IT0A 4ES3A 2XS5A 2DPIA 3BS9A 4NLCA 4CERA 3DMJB 4DCJB 4DV5J 3FFKB 2YWFA 2ZJQQ 2B0GA 4XAKA 1VQ5S 4ZIWA 1TV6A 1ZBIA 3PR4A 1C20A 1VQ9S 2DH8A 1JRPA 4OJOA 1FFSB 3ZZOA 2JOQA 2D0CA 5D3GB 5KAFU 4C97A 2A40A 8ICBA 1FJ7A 5L8RC 2FPHX 1RLDA 2ZH6A 5B0BA 1X40A 3HJVA 4Q2LA 4WXOA 2B9YA 2WVBA 2PI5A 1Z19A 1N6QA 2B4OA 3W9IA 3IG1B 4MK8A 3KJVA 2BZ2A 5A8WA 4IUFA 2LQ5A 2CWXA 4JI0F 3VQCA 3JS9A 1TTHB 2XCAA 5F3TA 2K1RA 3WNGA 1VQ8N 3OYFA 4E2FB 5ETKA 5GTIU 2PIIA 1N61A 2WVEA 2E5LK 1QVGR 3CPWR 4PG4A 5FPDA 3TVKA 3R7SB 3QFWA 4KLSA 4DBQA 1SC4B 3K0SA 3RFAA 2F63A 2VV5A 2N4CA 5J2IA 4MFAA 4MF8A 5AXNA 5BN9A 8ICKA 5HBMB 1X5TA 2JC0A 3J7AN 3CQ8A 2CRXA 2GEMA 2AA4A 4H4MA 4AE5A 2KN4A 5D15A 3DXMB 5GAHP 3T6BA 1NJIT 3O1LA 4YY3K 1WACA 2EHGA 2KKPA 4K4ZA 5HHHA 4FLXA 4RW9B 4ZP7A 1MQ3A 3RRHA 2E5GA 1IJEB 2V8PA 3DLHA 3I8BA 3QJLA 3LVWA 1WOQA 4BDZA 1X9JA 2QC3A 3R5JB 2R42A 3MDCA 1Z00B 1ZQBA 3OSNA 1FDAA 4CJ3A 2HVEA 1I94J 3MECA 3THPA 1IKYB 3VCDA 5C2DA 3PW5A 3LPEA 3RBZA 4K0KJ 3T5LA 4IQUA 2E44A 3I5AA 2RHQB 2NUHA 4U67L 1GOAA 2W2MP 3E01B 1S79A 4PCQA 2OWOA 4IKAA 3BSCA 5A8KB 3M1FA 1N5YA 4U96A 3K2YA 3IM9A 5CYJA 3VQAA 4DHVA 4GFJA 2Q97A 4JWNA 1LWEB 4AHCA 3AB2B 1ZZNA 4P2SA 1T03A 1NJIO 3WXKA 3V9UA 1XR6A 4EP5A 2YV0X 1N2XA 2V7YA 2A18A 4HHJA 1RAEB 3F9KA 1F60B 4FOEA 1WKJA 3OTOK 1UMJA 1Z1BA 2UXCJ 2AV5A 4DMZA 9RUBA 5BRDA 3H5UA 1FKAF 2P9SB 1XTZA 4QIGA 4H5NA 4TUSA 2MRLA 5HMZA 1S99A 3F53A 2DHHA 1WF0A 2RILA 1U09A 4JRPA 3L2WA 1OPZA 1H73A 4UOCA 2E1ZA 3O8MA 4RWTA 4FPRA 1ACMB 2E3TA 3FBEA 1K73T 3AVCA 2KL8A 1VAZA 1OO0B 4OZ5A 3U8XA 5EOZA 1TL1A 1MMLA 3A8KA 3ED5A 1ZQXA 4XQ8A 4RPZA 4I2JA 4OJ3A 2XQCA 2MQ8A 1D1UA 1HNIA 4LFCF 1C1CA 3UIQA 2EH9A 1NZ8A 3FQLA 1RWMB 1SUQA 2IDEA 3MURP 3EW9A 1XHZA 4JS4A 3CCUS 1U8WA 1HBMA 1TK8A 3G8SA 5FD1A 1PILA 1OWXA 1TFWA 7ICIA 4P2XA 4U7UK 1WC5A 2BOAA 3HVAA 5HRNA 2KK0A 3D5MA 3CJBA 2KFZA 5IS2A 4ZPBA 1RA6A 1GMWD 4OX6A 1ZTWA 3GG1A 3MK6A 2HS4A 1YSJA 1RILA 2IIHA 3CP8A 1PSDA 3KDOA 4CDIA 1IKXB 4RBTA 2BEFA 4CGHA 3HVRA 2VC1A 3UB5A 1SXDA 3M8WA 8ICHA 1D8YA 3DHWC 3LYSA 4DU8A 3GV7B 2LU2A 3U3GA 4E1NA 4C11B 3SCIE 3HVWA 4WXWA 1YT3A 3EE8A 2ZH7A 1WORA 2H3IA 3FSIA 4QZFA 5DB9A 2WVFA 4XH1A 2IDOA 4KLLA 1Y4ZB 3TAFA 3EGVA 5AK4A 3SUOA 3HZEA 4USKA 2Z8QA 1OKJA 3PW7A 4JK9A 3H5YA 4KLDA 3FEYB 3ULEA 3X3UA 4OI2A 1ZQSA 2D3ZA 4ETZA 2ACMA 4KMUA 3T6JA 3K2PA 2V6AA 3I96A 2YH0A 4OJ5A 5A76A 4HUGA 2KH9A 1CJKB 1VQ8S 3VQQA 1CI4A 3CJKA 1BA1A 1YTUA 2IS3A 3H42A 2R7OA 1WHVA 3M8PA 1PO6A 4BE1A 3LGMA 5ALRA 1TFYA 1DXSA 2E1MC 3CD6N 4GKKK 1TKZA 3IMQJ 2FZGB 2JNJA 5A0LA 3FMWA 1QTMA 3FVYA 2B4JA 2MZRA 5F8MA 2AJFE 2DL0A 3CC2S 1MG7A 2QSFA 1YITS 2DGUA 8ICQA 2VG7A 1RT4B 4A5BA 4HTJA 3NF6A 3BSOA 1NGEA 5KFVA 3G96A 3ORYA 3SJJA 3H3OB 3NH2A 4WFBL 4DOCA 3C1ZA 2GCFA 4I28A 4KB7A 2YX1A 4OYAA 5J2GA 3M6VA 2VC0A 4ZPCA 4HVJA 2F9JA 1H3DA 1VSFA 3OYHA 1K5OA 4YN4A 2NYIA 1IBMF 4EBEA 1NPRA 5ALSA 2YHBA 1HIWA 4LIWA 4Y3CA 4CJTA 2MKYA 2M88A 1Z1VA 1NG9A 5HRSA 2CZ4A 3DLBA 1N4LA 3DXSX 4HTUA 3G10A 2GZOA 5LJVA 1EZZB 1X9XA 1RHJB 1WNSA 4JKFA 2APOA 4H0XB 4CGDA 3D1QA 3M8ZA 2K06A 4WFZA 1HKAA 3CIPA 1GLJO 1P90A 1RYSA 5DDPC 4JV0A 4Q45A 1XMQK 3HPOA 5D0EA 3EO3A 5BYRA 3UVJB 5LSLA 1Z4UA 1OS5A 1S0VA 2QFJA 3P83D 3ISDA 2DHAA 2Y8YA 3OYGA 1TMMA 3ZI4A 3OTDA 3UXPA 1TL1B 4X62F 3LGHA 2LYHA 1RWOB 1FWLA 1HD1A 3LP1A 3E1YA 4JI1K 1EAYC 3B78A 4NYFA 2ZHBA 2BJ8A 5CR0A 3GDXA 4HWIA 1B43A 5DBAA 3K8VA 4FF1A 1WAJA 5FRNA 2X7IA 4QYZK 4CEFA 4M0AA 3RMDA 7FD1A 3NGIA 4AHSA 1WEXA 1S0MA 2BCVA 1MROA 4FJ5A 3ZZZA 5CD4A 3V81A 1T3VA 1KC8T 4W90B 3SQ4A 2MTLA 1T0TV 1F2HA 4NLVA 2D9OA 4B17A 1NH7A 3BF3A 2GLEA 1NRKA 1WDTA 2HOIA 4NMXA 3AJ1A 4ZVRB 3VEVA 4W4MA 2OD4A 2PI4A 3FYHA 3T5HA 4HDHA 3W2VB 3LH2S 4YB7A 3W1YC 3L7OA 4YB6A 3HRDD 2PAVA 2E29A 2Q6BA 3UPQA 2GOLA 3RJHA 3AAWB 4PRFA 4YD1A 2E5IA 1SIWB 3V4MA 4I2FA 4K41A 1QCKA 2B8PA 4C2MA 5ETPA 1IM6A 4DR4J 1NMDA 4YN3B 3W7BA 3IRUA 1VRQC 2XSJA 2KIWA 4DV2J 2L9NA 4C3LA 4IQWA 5E3QA 1N5XA 1GX6A 3BQTA 3EY1A 8ICZA 3BGUA 4Z4CA 1SV5B 2FYXA 3RB4A 4FP9A 2KM8C 4OX9K 4HACB 1OY9A 2GJIA 5CJ7A 2KB2A 4OD0A 5BPLA 1S6UA 2W42A 4FF4A 4ZLNA 4G65A 4RQ1A 5CAAA 2E8NA 3AMZA 3PX0A 2XMVA 3TI0A 1S57A 1DJ0A 1PYOB 4B8CA 4IH5A 4AILC 4DTMA 4E7LA 3P5JA 1FNXH 1FD2A 3MN5A 1BQMB 2IHMA 4M9HA 3U02A 1VC6A 5C5JA 5BOMA 2ITGA 2JEGA 4IFEA 3TTCA 2DTJA 4LT6A 1W25A 3OYIA 1Z00A 2WF7A 4USUA 5ALLA 4BR9A 3U4LA 3WEEA 3MEKA 4IQMA 2VONA 1HHSA 3H98A 1APSA 1ZQNA 2OSQA 4BBYA 5LSRA 3KK3B 1UJ4A 2ZWHA 3EL2A 1TELA 4Z7CA 4C7QA 1HYZA 4KYZA 1XBWA 3QGIA 2W25A 1U2VB 3EDRB 4DTNA 1LW2A 2UV8G 4IEIA 1HHQA 2VJUA 5AQXA 2XG8A 2MKSA 4ZN3A 4DS5A 5M2PA 3NVVA 3WK5A 3CC7S 1B9DA 1M0SA 1L7NA 2KHQA 5ALZA 3LK9A 2ZOGA 3DU6A 1NK9A 2YKNA 1VQLS 1HBOB 3OD2A 3W3DA 1A6SA 1V38A 3MCPA 4QS8A 4ISFA 4PKHA 3MXMA 1YBAA 4YDUA 2V67A 3VMFB 2YQ0A 4DOZA 4CEZA 2JWNA 3H2VE 3M3ZA 1DQ9A 1G1XA 3SFGA 3G82A 1MMNA 4DX5A 2XS2A 3KJNB 5TKYA 2C2MB 3FGUA 4W5QA 3CCUN 3CJCA 2G5IB 4WK1A 2OTJS 1NKEA 2F8LA 2A3JA 1FWKA 2OMLA 4NYPA 1JX4A 5LSOA 3MCOA 3VQSA 1I94K 4HHHA 3M8SA 5EUHA 2HVHA 4CI0B 1M90T 4U7CA 4C8ZA 2GHVC 2X3DA 4RW4B 2BXJA 1XC3A 3MXHP 2MSSA 2N1RA 3QMQA 1GXLA 4I6MB 1UP1A 2L41A 2QI2A 1CZBA 3WXJA 2YKMA 4UTGA 2GH1A 2UXCF 2ASMA 1SV0C 2ZG6A 1FEEA 1QQ6A 5LL6Z 4FJKA 3QRQA 1U7LA 3CMES 1REGX 4JI8K 4GVEA 3O9TA 1MWKA 2Z7JA 3KLGB 4ZVOB 1TL5A 2D5RA 1IR0A 5ALTA 2W01A 3VGLA 4K59A 3Q24A 4ECTA 3KKSA 1O8BA 3CJTA 4WIQA 3K75D 4EWTA 4ED2A 1QQOA 2DFHA 4BDYA 2HS3A 1NPPA 4IL6U 4M9GA 3BM7A 1S9EA 4LFCJ 2CVEA 3O4NA 3TR5A 3GG0A 4KC5A 2AIRB 5BJRA 1YTYA 4ZJQA 2D7SA 4JKBA 3JPRA 4ALZA 3TZYA 1V5VA 4Z6DA 4C11A 2AQ4A 2Z1IA 2XSJB 2AXTU 3NF7A 4KX3A 2GVDA 2DNQA 2DR5A 3OBYA 3BR9A 4X4PA 5AM0A 1T11A 2EANA 1MA7A 3L2VA 4RL1A 3C14A 1WC4A 1KVKA 3UNYA 4CO0A 4G6VB 1S1TB 1RDAA 1ZA1B 3R9PA 1U49A 4KGZB 1JLGB 2YTCA 4CK1A 2AZ3A 5AQQA 1ZBFA 4CZJA 4N77A 8ICTA 4U8VA 1BOTO 1C0TB 2VFUA 1NAQA 4KX5A 3FZKA 2E9ZA 1YWXA 2ZNZA 2HK3A 2Q36A 3PRBA 1Q8BA 2LMIA 1VLYA 4JYAK 3RSEB 4DR4K 3PHEA 4F4WA 1T4GA 1JLBB 2B4VA 4U7UD 1O51A 3UFCX 1QS4A 3ADAC 1M5OC 4K4XA 4QZ8A 4CDGA 2LFVA 2PMZC 3D6HB 4QOTA 3IMXA 1S7HA 1TE2A 3ATVA 5HRRA 1BPEA 5J0SA 2DO4A 4FNIA 4X65K 1LKYA 1SJ1A 2CPRA 2QLWA 4WYWA 5JLFA 2EC0A 5AM5A 2QLTA 1OMSA 3TAPA 4DR5K 4BROA 1NNEA 4UW9A 1T9WA 4CFAA 3HHKA 1U02A 3EZUA 1X4GA 4TY9A 1UZDA 1C4CA 1UW9A 1NGFA 5AKEA 3ZTPA 4BGAA 4A8WA 1TKZB 1QVFR 3L6QA 1DTQA 2ZBPA 4LF4J 2PBDA 2CNNB 1SXLA 1Q18A 1QE1B 4ITSA 3RB3A 2YCHA 3S6EA 5D0HA 5ALJA 3U27A 2G2ZA 1CJUB 5KFRA 2IVMA 2LXIA 2XVTA 3QZ8A 1FFWB 5HQLA 2FF3B 1A77A 2PE8A 2G4BA 5AI4A 2AGOA 4MKYA 4B1VA 3IA0A 1T7PA 4TYBA 4USWA 1S6PA 3UR3C 2IOFK 2IVOA 3BGRA 4IDHA 2O66A 3SQIA 2FHJA 1WWUA 4BUGA 5F0WA 4H4OA 2PGCA 2D3DA 4O5EA 1FXLA 4QWBA 2XLKA 2KVSA 3WXIA 2ZUCA 2AEFA 4I2BA 4DR3J 4ZPWR 5FLXO 3NF9A 1Z25A 5LMNF 3S41A 2QWRA 3ITHB 4K4IA 1BD6A 2O8EA 1SB3C 5LMUK 4DJBA 1IKYA 1KAXA 4CJUA 1RPLA 2CJQA 3VGUA 4O4GB 3J7ZT 2JGAA 4CO3A 4Y2PA 3OYCA 2AF6A 3W64A 1ATSA 2FE9A 1NK5A 1WF1A 3DLGB 3M2UB 5J2DA 1Y88A 3N97B 3VAFA 3OL9A 4UB5A 3OTOF 3GIRA 1R59O 3PKMA 3C6HA 4C1NK 4E7IA 3M30A 4L72B 3AO5A 3MFIA 2JX2A 3EXYA 1H2UX 2V9WA 2AJQA 1M1GA 2GNKA 4ZJLA 2VQEJ 3PO5A 4E89A 4CHNA 4M95A 5AIBA 5AM1A 2RRNA 1ZAWA 3OR2B 5DDMA 1DK2A 3QAEA 3ZLJA 3VN5A 1S1UB 2GO7A 5FLXY 4KLMA 5AI6A 1EJ7L 1RBAA 2WVCA 3NNAA 1MN8A 5HLFB 1UVKA 3IO1A 4IG3A 3WXMB 3AHPA 5DB6A 1S1WA 3ZX3A 2RN2A 4PXDA 4BVOA 2FHJD 3AFGA 2Q79A 3N28A 2VANA 2BE2B 4B3TF 1EWRA 5GAGU 3IGVA 3EDQB 9ICTA 2AWZA 9ICHA 3MAQA 5ETNA 2LPEA 3D67A 4FJJA 3J7ZO 3CWJA 4ELVA 1KTQA 2R2RA 1XNSA 1E4FT 3ASMA 4R79A 3MXJA 7ICSA 2AJ4A 2AGPA 1YJNS 2HNDB 4DG1A 3E9LA 2A1SA 4Q8FA 2DBYA 4K4TA 3A5LC 2UV8A 4JD2A 4DR4F 4CLTA 3R1HA 3T9NA 4FZZA 3ETMA 3ZSVA 4ER8A 4GVMA 5D77A 4B1UB 3HSTB 2RD5C 3AB4B 4QW8A 5AK5A 3VV2B 3VESA 4WPAA 1XSNA 3RF9A 4FYWB 2UUCJ 3H0LB 4WFNL 4A2BA 4KSEB 2ZVSA 2NXJA 1AUSL 4X66J 2OYYA 5KFWA 4YOVA 2K3IA 3KK2A 3SR6A 5HANA 4EX6A 4O3MA 1HWKA 1GK8A 4FXVA 2PFUA 1FO1A 9ICNA 4CLSA 3HVTB 4DL4A 4TU9A 3NCPA 5AE3A 2KFYA 2A2CA 1LKZA 2DR9A 3JAMY 1X4FA 4M04A 3SSSA 2A2DA 1WTBA 1UWBA 1SPBP 9ICGA 2HQGA 1XR7A 3QFPA 5E41A 1YUWA 1FE4A 4A2AA 3ETRA 1EXNA 1BIUA 1PK3A 4MKAA 4DV6J 4JK1A 1SVDA 4NXZA 1A7GE 4B02A 1VQ5N 3C16B 2V63A 1Q0NA 2MY7A 1VQMN 3M2UA 4FJNA 3WIVA 1WSHA 3AVFA 2FBXA 1JCEA 3M7DA 4YB5A 4ED4A 4DTUA 4F5NA 3CMAN 4OFZA 1WNEA 4OLAA 2C2ZB 4FO6A 2RUGA 3C66A 7ICHA 2ZIUB 4M3XA 1Y0HA 6AT1B 4A8YA 5M2UA 3DXKB 2QWOA 5KFOA 2BMBA 4DQSA 1NEEA 1IKXA 1LXJA 4ZPVR 4X4UA 3ENBA 4WFAL 2FZCB 5ALUA 3MPWA 3W9HA 1HBUA 1KL9A 4A48A 1HKBA 2DGXA 1WBBA 1BCMA 4XPEA 7FDRA 2UUAF 3G4SN 3NH0A 1NI3A 3D9BA 3HFKA 9ICSA 3HO1A 4NOHA 4X4NA 3PEJA 1KAYA 4UOHA 2YJFA 1XSLA 2DFLA 2CQCA 2YKQA 4N8NA 3BP8A 4B1WB 3NMUA 3IWXA 3FBFA 3W66A 1T3QA 3QE9Y 1HNVB 4J9VA 3LOUA 4Q43A 3CTRA 4FWOA 2XMUA 2IAJB 5AM4A 2MZ1A 1NU0A 1M1KO 5DETA 3Q83A 3WZ0A 4UY85 1S72S 1K9MT 3MGHA 4DTXA 1SH3A 4B9MA 4PGXA 3M6KA 2JWLA 1SI9A 1JXLA 4NLGA 4QOZB 3CNQP 3CDAA 4MFCA 5JU5A 2DPNA 4ID5A 2QEXN 1KXPA 1WLJA 3PSIA 5JUMA 3KLEB 3AXKA 4NO7A 4X66F 3VALA 5D0GA 3NAHA 4N8OA 1KCFA 3WKAA 5AKXA 5I9EB 4CCHA 1LWCB 1RGVA 1PAUB 2HZVA 2XSFA 4JK8A 3EZ5A 4YD2A 2QKBA 3MAHA 3QICA 4YOTA 4OPKA 3SQ2A 2FPKA 3R5CA 4MF2A 2BUNA 4OL8A 3FE1A 2MA1A 4C4SA 5KFBA 2H1YA 1F9EB 4UB8U 2VKZG 5B0FA 3ELHA 4EU0A 2R7YA 1SWVA 3ISZA 3V6DA 1Z2LA 2ADBA 4ED0A 2K8BB 4F9OA 3MFHA 4BJQA 2UVWA 4UUXA 4CGGA 3EE3A 3IBCB 4WYLA 4IQXA 4N56A 4DU1A 3I8DA 3T1YF 5A2QO 5AQPA 4YR0A 1J53A 3JTNA 5C12A 1FFUA 5SZTA 2E6LA 2VCPA 2H3VA 4C48A 1HA1A 4QIEA 1HNZJ 4CTAB 5DDYA 3HXMA 1RT3A 3C6TB 2HBRB 1NK6A 3FFIB 5ETMA 4JKCA 3MWTA 1MLAA 3TR8A 2W9CB 2WBMA 2WAQC 1ASWA 5J2PB 2A5XA 2BE9B 2HGMA 1NMNA 3CDEA 4X5VA 4F04B 3WKCA 2ZOMA 2E8AA 2K7KA 1H98A 2MKCA 2J6SA 1XNQF 4CYUA 3MMVA 3MTJA 3KD3A 3L4PA 1YJRA 3SBTA 2NCKL 4ZOHC 4DEZA 1LWEA 3C6UA 3OL8A 4A61A 3FNNA 5L1IA 4M9JA 2Q0RA 3IRXA 4FE3A 3NVMA 2O3DA 3SPZA 5DQHA 5JVGL 1RKJA 4WU3A 2CNKB 3FK4A 3IP4B 1FVQA 4KLUA 2EZZA 4ICLB 3RJJA 4ZCKA 3DNCA 3UCZP 4UARA 2W4DA 1NSAA 2EQYA 2QGFB 2QXFA 5IZHA 3P1GA 4J03A 3IR5B 9ICPA 2CXEA 3RJGA 3AQOA 4RW7B 2AYEA 5AFUH 3EVMA 1EXQA 2E5SA 1CXQA 1IKVA 4K7QA 3RBXA 3BN7A 2DGVA 1YZ7A 4RLEA 3NHGA 5AQOA 1ZPVA 1U1PA 2UVUA 2WBRA 3BDEA 2DR7A 1H72C 3HILA 2HNYA 2RHSB 4RQ8A 1FT8A 3MR2A 5E3AA 2DITA 4KFBB 5C42B 2QMWA 2RT3A 4MHVA 2MQOA 3JPNA 4ZPDA 2ZJPQ 2ROGA 1S1XB 4FK0A 4RNMA 5D6GA 3HKZC 1B64A 3IKMA 2MPUA 3AJDA 5F8HA 1VQ9N 3M2RB 2AEJA 5E33A 4OZNA 4GMJB 1SBRA 4PQAA 3JSYA 3GR1A 1D8BA 1URJA 2AYBA 3MX2A 5K14A 3SQ1A 4ZP9A 3B6OA 4M2YA 3M1VB 2XMKA 4CLZA 4GW6A 5LMNJ 4PWDB 3UDCA 2UXBJ 1UVNA 3T1YJ 4DUYF 2BA9A 2OJ3A 3BS5A 1NPKA 1ZQIA 1JLQB 1WC6A 4Q2MA 1G2EA 1GTHA 3QEVA 1IXKA 2DEJA 4HI1A 3P39A 2QMXA 3CRXA 2UP1A 1URRA 5F8IA 1UEVA 3UDLA 5T14A 2ZJPL 3ZD9A 5AKGA 4BY9C 3O8WA 3VQ9A 7ICKA 1WSFA 1Z4OA 4Y0WA 2HRTA 4OJHA 2YQ3A 3KKRA 3QGPA 4EFAC 4QAGA 1D9FA 3I1YA 1X4HA 3CG7A 4HUEA 2E1CA 5FROA 3ZT4A 1N5TA 1BO5O 1UFKA 2D3UA 3U1NA 4ZLJA 1BG3A 4DV3F 3CJ2A 4U7BA 1XNQJ 3R8YA 3ALRA 2IM1A 2H65B 1SH2A 2YMPA 2DK2A 2QB0A 4PHPA 4B3OA 3D2WA 2YKMB 1HNWF 4L74A 2P6RA 4FJGA 4OIXA 4DTRA 2PXIA 2Q3PA 2EDUA 4ID1A 4F0HA 1RZMA 3NTUA 4P2FA 3BBBA 1QQ7A 4OV1A 4KN7A 1R0BG 4HHUA 5KT4A 3DLEA 4DSFA 2KG0A 2KV2A 1TZ0A 1SL1A 1U24A 2KKHA 3PW0A 3OLAA 2A6AA 3WQTA 2HVIA 1T95A 3QBXA 3ZTOA 3SDEA 4J8FA 2ADCA 1ZXIA 2RSQA 5JRTA 2HWIA 5HMXA 1NGGA 4ECXA 1M5SA 5K8OA 2JDJA 3UDVA 3KNGA 1ITGA 3MPDA 5G4DA 5AI5A 1U1NA 1JK9B 3MEDB 2VWKA 4WFNQ 4EENA 3IN5A 3CUNA 1BDGA 5KFZA 4NCGB 5AIAA 3BUZB 1CQNA 4I2DA 4O5KA 1NNLA 2AQ0A 1ZTTA 2YWWA 5LJ5Y 2XYGB 3S1TA 2HNYB 1JL1A 3BBFA 2KSOB 3MF5A 2PFPA 2E2PA 4AQYF 2MXYA 8ATCB 2F65A 2P35A 2OFHX 2FJDB 1OY6A 2YNHA 1Q9XA 2CQ4A 1QM9A 3C3LA 4LUBA 3CI5A 1RT6A 2X74A 5H9EJ 2P5GA 3L4IA 4TVAB 1RHRB 1Z4NA 1RFQA 2R8JA 3CD7A 2H4YB 3TO8A 1ZRNA 1IBMK 4YMMA 4H5VA 1K44A 3EZWA 2BQUA 4ZA1A 3QINA 2EZXA 3C94A 2ATLA 4BG8A 1B7FA 1CS4A 2ROEA 1J9AA 5KFTA 3IFEA 2MGZA 3GSDA 4NB4A 2ZZMA 5EN1A 3LDOA 3FC9A 4DFKA 7ICFA 1ZQPA 5IXUA 2DNLA 2J4RA 5JICA 3DRPB 4RUAA 2B9EA 4DV1K 2PFFB 1GT8A 4KLIA 4CYUB 4IC9A 3UPFA 3GJTB 2VG6A 3L95X 1YDLA 3QEIA 4ZP8A 5KFIA 2E1PA 4M5MA 2E2NA 1UVIA 3K4GA 8ICGA 4LSNA 4DZ6A 3I31A 1SKSA 1HNWJ 2F8KA 3H2UB 4Q0BB 2P9KA 2RMLA 1PC4A 1EKEA 4GNIA 2KYXA 2CQBA 2W9AA 3O1WA 2WC9A 2HSEB 4CECA 5E26A 3Q8KA 3G71N 1NZPA 1R8BA 5DK5A 1NSPA 5J0YA 1RXVA 5LJWA 2A1AA 2Z0GA 1YVFA 3IHQB 2PSZA 3W62A 1Y64A 4NPOA 1MDUB 3SQGB 1RAGB 1I1GA 3CD6S 4FFDA 2KDOA 4BQZA 2HOEA 3E2EA 2O8CA 1BQNA 2VOPA 1U2FA 3VQPA 4EZ9A 4AYBF 5JTIA 3GILA 1S0NA 3BZCA 5J2AA 4QJVA 5AKHA 1XQIA 3KHYA 2D8CA 1P1TA 3TUIC 4GY2B 3QUTA 1HHTP 3QFHA 1SL2A 2DGQA 1RHUB 5L9XA 7ICTA 4C80A 2G8UA 1XO0A 4A8EA 3J81U 3RSEA 1S4EA 4DR6J 4NXMK 5DM6L 5ALGA 1XERA 3C6AA 4IFYB 3AA3A 2PYLA 2QKKA 2F9WA 3JB9k 3PJWA 4OO1J 3DOMB 4XDDA 4GKKF 4AM6A 4K0KK 4NCGA 2N3OA 1HJOA 5J1PA 2DHSA 3JQJA 3TEHB 5GAHU 3VETA 4C98A 1K47A 1I39A 3KLIB 4KMOB 2EX3A 3L3FX 2WK4A 1FI4A 4AP9A 4RJVA 4OZJA 3VENA 3PIOL 1RBTA 3GFKB 5CA5A 3V6KA 1RT1B 1VQPN 2VGNA 4USHA 5EE0A 1WEZA 4BRKA 4JI8F 2J9DE 1KSPA 2J0SD 1N34K 4DF4A 3CYMA 2GAGC 2UUWA 2MDAA 4IBNA 5KFGA 3CM5A 3GJQB 1Z3EB 2Y9TA 2HQCA 1K8AT 3P8BB 3MM7A 4U67Q 4J9RA 2B8QA 3VGVA 4I9LA 4JLHA 1CS4B 3QJPA 3WK6A 2M5YA 2MQMA 4KLFA 3VPZA 2XLIA 3NS1A 1KLMB 2JFDA 3OBWA 1J2NA 3D2FB 1N32K 1LW2B 5J0UA 4CNQA 4ATNA 1N5YB 2P2CB 2JEIA 1YGYA 3DGPB 4NCAA 2DT9A 2YNFB 1BMQB 4MN4C 1NK7A 3LGNA 5HMWA 3THTA 5ALOA 4A4JA 4A62A 5H1SQ 3K1RB 2IJRA 4ZMMA 3NDKA 1VQ7S 2QO3A 2ZZNA 4DV6K 4DUTA 5AQTA 4OJGA 4CIEA 1NSQA 4FVUA 2D6FC 1IBLJ 2HWHA 3KUGA 1U1MA 2V5HG 1PK1A 4P2HA 4LF6K 4CT9A 2MAXA 2LP4A 3DOLB 5IT4A 2NUBA 1SWWA 4Z94A 1BISA 3DKDA 4C23A 1WF2A 1KLNA 3R7BB 3J7AP 2KU7A 4CFBA 4GXJA 2DNZA 2F8EX 4GV6A 3TJAA 5EX0A 4P6QA 3DDNA 2D4WA 4P10A 4CJEA 2B43A 2XEXA 1U1KA 2QT7A 2DXFA 1K8KB 1WOPA 5I3UB 4M5HA 1DZ5A 5D78A 3M32A 4JI1F 1UETA 1DQ8A 4GKKJ 2A1JA 3AO3A 4HL9A 1P9YA 2IVFB 3Q8QB 2FHOB 4ANCA 1NOZA 4JB8B 3TSUA 1YZ6A 2YNGA 2PMHA 2VKRA 3CNHA 5HSPA 3F5EA 2HBLA 4RW6B 1ZQGA 4DR7F 4DV0F 4IXCA 3IGNA 2DHGA 1KHWA 4CD3A 1E6VB 2QB1A 4J2EA 3OYNA 4MYTA 4DU7A 1WUDA 2W9MA 4DUYJ 1SQKA 3VA0A 2YX8A 4FWMA 4IS7A 3ZZYA 5J2NB 2MMYA 1WAFA 5CYMB 4RCHA 4B3MJ 4JI0K 3TYTA 5KI6A 5ALKA 1H7WA 2QARB 3PMNA 1NGDA 1Q86O 4WP9A 2E8OA 5KT5A 1IXRA 1L3SA 3T1AA 2VPWB 2H3FA 5KG4A 3D0GE 5BR8J 2BOPA 2NZTA 4FSVA 1KLMA 3E9OA 4OKKA 3KK2B 2NS1B 5F3ZA 3TKAA 2HLTA 3TJ8A 5EE9A 3D6RA 2O8BB 4ICLA 3J80U 4I2QA 5C24A 1Y5NB 3SAHA 1FEHA 4M5IA 3K17A 1VSKA 4BWMA 4ECVA 4MK7A 9ICXA 2YB1A 5ALNA 2P6UA 4QZIA 2HURA 2VG5A 2ZBIA 1HYSB 3H0RB 2BKOA 1BWVA 1ZQ1C 4Z0UA 3AD9C 5HK4A 5IT9U 2IMWP 4ECUA 2DFEA 2LA4A 4ECSA 4RWWA 3GFXA 4RQ7A 4WJBA 3N0VA 4P52A 2LQJA 1PGZA 5FPNA 4I2PB 1GMUA 4KH4A 1YTAA 2ZQBA 4KTZA 2UXBK 3E0FA 4ZLLA 3FRZA 1RAAB 3DGPA 4ZVGA 1X6IA 5EWEA 5L46A 2DH7A 4WIIA 3AD8C 4LY7A 3ZX0A 4ZHRB 5AJ3F 3NXZA 3EM1A 1J5OB 5GIOA 2KVCA 1SC3B 3M8YA 2BJ3A 4LF6F 2PD1A 4YEAA 1QE1A 1IR1A 1JIHA 3MX5A 5DS7A 4O0IA 2Y1LB 2QWMA 2C2KB 4EMDA 5IV4A 4CEEA 4DV0J 3MR7A 3BQ1A 3CEDA 5C25A 4DV7J 1G99A 1G4CA 3NGUA 3J7YU 2ZNYA 4I0WA 2O8BA 5KFPA 4GLXA 2IYIA 5IC6B 2QL5B 3P5TL 3MCSA 1KVIA 1GXUA 4O55A 4FKYA 2AJ1A 2G0JA 1HNZK 1FKPA 2B6AB 3O4WA 2RS2A 3SEOA 4G9ZA 2QARA 1U26A 1OVYA 3GJSB 1WCNA 3FFIA 3AJ2A 1S3XA 3TZXA 5D46A 4TUPA 3A0IX 4ZTJA 2GO9A 5AQVA 1BHNA 4IDKA 4M63A 3SQOP 4F67A 2G0IA 2KICA 5SWMA 4GMKA 1X9MA 2GAHC 3MPUB 4G1IA 3T1HJ 4H5RA 5LM7E 3J7A1 2LECA 1VC5A 5AZJA 5IWAF 3ETOA 2QWQA 5F8NA 4BRCA 2PC6A 3BBCA 3NRBA 4CQ1A 1KQKA 4C8LA 4H5WA 1RHKB 1VJ5A 9ICFA 4N47A 3L7PA 4WP8A 2EKYA 4RQ5A 1WTFA 5K20B 1K8AO 1SQGA 2LKZA 2W7AA 1P27B 3VAKA 3H25A 1WUUA 1C1AA 5J2PA 4NEZA 4URQU 2PZSA 2KZZA 5KQDA 1RWNB 2VG7B 2KP7A 1ZBHA 2RRBA 1NGHA 3TAMB 3T5KA 5BPMA 2MKKA 1L5UA 3HZ6A 2ASOA 4E1MA 2BTFA 3GE9A 4Y2IA 1S1VB 5IFMA 3CT9A 2CADA 2XO7A 3MEGA 2ALYB 2FGCA 3C21A 9ICLA 3VAIA 2V7ZA 4I56A 4FWRA 2QRRA 1PJ7A 4UASA 2RH3A 1JLBA 2YHYA 2C2RA 3CMAS 3HWTA 3M8PB 3R6GB 1J54A 1D9DA 1B92A 1OXJA 4C7ZA 3MM6A 3D6FB 2KEYA 3BN4A 1TUYA 4CHYA 3O08A 4KGMA 4QW9A 4QU6A 4CH7A 1SUQB 4LF6J 4ZHRA 3W5YA 1YAGA 4XRHA 5EGYA 5JLHA 4HCCA 2UXDJ 4RNHA 1OQ6A 5L1LA 3CPWM 1CEZA 3D4JA 3CCVN 3D66A 1NUEA 2ZC3A 2A10A 2FJ6A 4EUVA 4LJXA 1C7YA 1B4SA 2Y0BB 5KT2A 3MAAB 4Z6CA 2CQPA 1JXBA 4G1QA 2AP6A 4DQPA 5C10A 2CYYA 2XY5A 1TV9A 3DHXA 4PY5A 3NP5A 4FJIA 2YMLA 4RW9A 4DDFA 2F4FA 5J2CA 4GRSA 4HAIA 5EE1A 2BH1A 2RKIA 3H8SA 1GFWB 2ZH4A 1FFVA 1L6NA 2M2BA 1NCLA 3C95A 1NB7A 2FZKB 3B8HA 3T7ZA 3HFZB 4DR2K 3K1ZA 1VQSA 1J2MA 5T7LA 3CC7N 1IN0A 5K8NA 2J8AA 2KI2A 2F1JA 1VS3A 1EB0A 4CHOA 1RDWX 4QIVA 4U6PA 3S6JA 4CBUA 2R9LA 2CQ2A 5JVHL 1U0HB 2A0FB 4EIAA 3C16A 1VBXA 1BPZA 4NEYA 2NR0A 2KNJA 2P9NA 3J81j 3D6TB 2CPJA 1UAWA 2ILYA 3T69A 3BEXA 1B9FA 2RUSA 4LRDA 4UB6U 2ZH9A 2CA9A 3DRSA 2OPSB 4WTOB 3VAHA 2ASYA 2G0CA 4WWSA 4OHZA 2VOOA 3MC1A 2HAFA 1T9TA 2N7CA 2K8AA 2JLEA 1CVJA 3T19A 2O8FB 3CCSS 1N34F 1O08A 1X2IA 4F26A 3CGIA 4M3RA 3CMQA 3CJ9A 4BE0A 1XWLA 5AK3A 4FWPA 3ZSYA 2NXCA 3UDEA 4CJ7A 3P96A 1PYTA 4Z4FA 5AQKA 4FS1A 1TL7A 2F4VJ 4ZN1A 3D3BJ 5L1KA 4Y1DA 3MM9B 1DHMA 3RJIA 4EELA 1RAJA 5ETVA 3AODA 5B0AA 3RJMB 4CLKA 3CM6A 3BSAA 2XZTB 1RQNA 2YX7A 3POTA 1H2TZ 1RTDA 5TISU 4CF4A 3QX7A 3E01A 2NPIA 4JBCA 2QWNA 2YNHB 4F72A 3TANA 2F1FA 2VPXB 1UEUA 2OMOA 1J27A 4WTYA 4KV8B 3CFPA 3CC2N 5KPZA 4AHUA 4DQIA 1P7DA 4JI2K 5CH7B 4Y00A 2H54B 4FZLA 4TLRA 1HYVA 3QU7A 5KFHA 3B82A 3MM6B 2ZIXB 3SIPB 4TN2A 4IO1A 4DR7J 2I5JA 5A2QY 4YHHJ 3Q86A 3QNWB 5E3RA 5J2HA 4PYAA 4DSIA 5JVGQ 3CJ7A 3TFRA 5D4OA 3LWLA 4J9UE 2NRHA 1U48A 2HIQA 4CTAA 4O4RA 3IM8A 3GYGA 4UAUA 4W5OA 9ICCA 1N33K 4M3TA 2GWSA 2MUTB 4EYHB 1JXEA 3NF8A 4GC7A 5TZVA 4B3MF 5LMUJ 5AQYA 2DGOA 2WW4A 2R4FA 4I2HA 2O1PA 1BCOA 4YS2A 4LJMA 1M1KT 5E0OA 4OKJA 3RW7A 4KTQA 3AOAA 3VQ8A 1Y5IB 2B51A 3CCQS 4X4VA 3AVNA 3HI0A 3V4IB 1YJ9S 1LV5A 1ZQDA 2CJAA 3K58A 1NOYA 1H74A 1MWYA 3D68A 2KVQE 1QSSA 3PIOQ 3G0ZA 3Q0AA 3NOGA 1NB2A 4DN0A 3ZT0A 2AZ1A 2OPQA 3BSNA 5AQWA 2HFUA 4OZLA 4GVLA 5HN0A 3CCRN 1COOA 1S1VA 2KXNB 4USVA 4J9SA 3W8PA 2E9RX 1RTHA 1YBTA 2MZSA 3LP0B 1R3NA 1VK3A 2HBQB 3ISBA 2K4PA 2BGWA 4BR4A 4NWBA 1DEJA 3EVOA 3NS5A 2NO5A 4JMUA 4CF1A 1RBSA 2O8CB 4IWVA 1TQLA 1F21A 2IHR1 1A5WA 2B5JA 4GVBA 4ED5A 1WD6A 3HOSA 2XI2A 2NYVA 3KG4A 2VD3A 1UQVA 2WAQF 4DPOA 5IIOA 3AVGA 1S9GB 3D6MB 4KN4A 4QWAA 5AZIA 2I1RA 4NLRA 1S4FA 2WB4A 1JL2A 5KAKA 4ZITA 2F3JA 3ID6A 4JOUA 3WDOA 3Q8RB 1S72N 4M5DB 4YDDB 3C46A 1VHFA 2P6TA 4DQRA 1Q5VA 3C2MA 2HZAA