3PV8A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddttp-da in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3pv8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3pv8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pv8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3pv8A01
1IXRA 1WSHA 5FRNA 4IFYA 3KIOA 5J0TA 4R5PA 4DLEA 2PYLA 4UAWA 4I2HA 4I2IA 1A76A 3MFHA 1TK5A 3MXMA 5HROA 4FJIA 2V4QA 4W5TA 3C6TA 3PO5A 3LALA 4RQ6A 4DQPA 4C8KA 2PI5A 2BGWA 4GXJA 4CJEA 4PUOA 3PX6A 1ITGA 3HVRA 4I2AA 3V9XA 4P4PA 4DU3A 1XI1A 4DOAA 3CG7A 4DSIA 4K8ZA 3TAFA 5KG4A 4M3UA 2PFQA 1SKWA 1VK0A 1JXBA 3QEIA 4KTQA 2P51A 3QETA 3SUPA 3ZDBA 4XUSA 4KPYA 3RH4A 3EPGA 5EOZA 3QEBZ 4CEZA 4EBDA 1FK9A 1TV6A 5HRNA 4KB1A 5DG9A 4DFMA 1ZQIA 3SNNA 1TGOA 3RBEA 5DQGA 1I39A 1SL0A 3LWMA 4Z6CA 4ECQA 4QWAA 8ICYA 4M42A 4YG2A 2F1IA 4RNOA 2ZQBA 4CEEA 4E89A 2D5RA 3OYGA 3IRXA 3RR7A 4DTUA 4F4KA 4M3RA 4F93B 3V7JA 4RQ1A 1S1TA 2E6LA 2Q3SA 1JMSA 4YD2A 1ASUA 3NH2A 4LD0A 3I8DA 4FK4A 2DY4A 7ICIA 2KFNA 1UA1A 5KG1A 2YKNA 2G8IA 5KFJA 7ICUA 4FS1A 3V9WA 4M3ZA 1K6YA 4MFBA 5HLFA 3K59A 4CJ3A 1S0VA 3C6UA 3D45A 5DB9A 1BI4A 1YVUA 2WTFA 2FPLA 2HW3A 1VSMA 1U47A 2MUTB 1ZQNA 1AROP 3JSMA 4CERA 3ULDA 4JWNA 1ZQJA 2XC9A 2W42A 3VQEA 1XSPA 3LAKA 4CIGA 3M8SA 3AVNA 4R8UA 4DTOA 5J0YA 1ZQTA 3PO4A 2PFOA 2QXFA 4F5PA 2OPPA 4PGYA 4QZIA 1S0OA 2BGGA 2F8TA 3ETLA 4Q44A 5J0SA 1A5WA 3RMDA 3OJSA 1KTQA 4NCBA 4RQ0A 5KT6A 1JLCA 5DBAA 4FBTA 5EWGA 1BQMA 4KLLA 4KB0A 4CJVA 3K75D 4RNMA 3PW7A 2BQRA 4YD1A 4JWMA 1X2IA 4LY7A 4RQ8A 1NKCA 3H08A 1QE1A 1WSGA 1IKVA 3HPGA 2X6SA 1NJWA 1HQEA 2FBVA 4CGHA 3JPSA 3ZSXA 4DF4A 4DTMA 1TAQA 4QWBA 1BIUA 2ZTDA 5DLGA 1Z00A 4M9HA 4KLGA 2R7YA 3UXPA 1VSIA 4E7KA 2G8HA 3Q8PB 3NAEA 1SV5A 5KFMA 1J54A 2KW4A 3SUOA 3V7KA 1Y97A 1ZQGA 4PGXA 3SZ2A 4DTPA 3P1GA 2NRXA 2ZTEA 2G8WA 2AJQA 4JV1A 3KLEA 9ICUA 1U4BA 2JZBA 4BXOA 4J9PA 8ICPA 1B9DA 3JPPA 1MQ3A 1KVBA 4CF0A 1JIHA 4ZH4A 3P83D 2JEIA 1ZQZA 4Z6DA 1L3UA 3AVCA 3AVFA 3OGUA 3DRSA 4FLZA 4N41A 4KKOA 4FJNA 4CJUA 4YFUA 3NTUA 2B6AA 4AHUA 4QZ8A 7ICRA 2LYHA 4EYIB 4I9QA 4K4IA 3VQ9A 4DS5A 4QZGA 3OYJA 8ICLA 3C1ZA 2UVVA 5J2AA 1CXUA 1JL2A 5KG0A 4C8LA 1BCMA 1GOBA 1ZQEA 4ECSA 4FLYA 4DSLA 4ED0A 4P2HA 4YR0A 2RKIA 1BL3A 3KK1A 4E19A 3C5GA 1T8EA 1EETA 4B8AB 1ZQCA 3L8BA 4LSNA 4HHTA 7ICLA 4MFAA 1TFRA 3BDPA 5DB6A 3AVGA 4CGJA 5T7BA 3MAQA 4FJJA 2ZTCA 4O5CA 3C2MA 4DQSA 3K4GA 5F9NA 3RJHA 4ED1A 3EPIA 4R64A 4O4GA 4KHSA 1SZPA 3DRPA 4CF9A 2D0AA 2P5GA 3CFPA 1S1XA 3MDCA 4DFKA 8ICSA 2UVUA 4CEDA 2HHTA 5SWMA 2KZZA 4IG3A 3V9SA 1NJXA 4EBEA 3TR8A 3H8WA 3QINA 2A1RA 5K14A 4CE9A 2YNFA 3LWLA 4JRPA 8ICHA 3LP1A 1LW2A 9ICBA 4GLXA 2BANA 2P6UA 4ELTA 3MEGA 1ZETA 3TI0A 1QTMA 1BPDA 5CJ7A 5J2BA 8ICTA 4DU4A 5KRTA 3HXMA 4M41A 2GUIA 8ICCA 2J6UA 4N5SA 4Q0BA 1BI4B 3HO1A 1V9PA 4ECWA 2KZ3A 4DL3A 3RB6A 1N6QA 1RTIA 4QZ9A 1D9DA 2AQ0A 2V9WA 3RRGA 5HRPA 2W9MA 4Y1DA 2ASJA 4FYDA 1D8LA 4KLTA 4DOCA 4C8OA 7ICVA 4Q45A 4OGEA 3KLGA 4Z6EA 4IQTA 3QNNA 3VQ5A 5EWEA 4DL2A 5DG8A 4RW8A 3AO3A 5FRMA 1UT5A 2ASLA 3PR4A 4QZCA 4CK1A 4Z4GA 4YR2A 3RJKA 3RR8A 5CYQA 3Q8KA 4B08A 3OVNA 3S3MA 7ICTA 1T4GA 5IIOA 1UAXA 5KFBA 3I0SA 4EEYA 4FBUA 3CM6A 3OYIA 1TKXA 4UQGA 5F9LA 5CZ1A 3UQ0A 4N47A 4ZTFA 3L3UA 1WSFA 4E7IA 2G8KA 2BCQA 5L1IA 1Y88A 4LZGA 3UXOA 4IFVA 1RT7A 4CHYA 5L1LA 8ICKA 5J0QA 5BPCA 5KT5A 4RUAA 4UBCA 2DPIA 3ZDDA 1RT1A 1ZQOA 2W9BA 3AA5X 4RG8A 7ICQA 1ZQAA 4CEQA 3N4MB 4KHWA 4RUCA 3NDKA 4B9MA 5HMLA 1ZBFA 4O3QA 1Q9XA 3G6XA 4B9UA 8ICQA 1ZQKA 2HHUA 1RDDA 2I9GA 1C0UA 2HHQA 1U04A 2BE2A 1W0HA 3HT3A 3RJGA 3AO4A 3G10A 2DFEA 3SQ4A 5IINA 2YHAA 1D9FA 4FM0A 3SV3A 1N48A 4EYHB 1X9WA 4TQSA 5L1JA 4J9KA 4M9GA 5JS2A 4AHRA 3G6VA 2GBZA 1VRTA 5KTQA 1ZQPA 1BCOA 1IKYA 4CJQA 4NM2A 4GC6A 3OYLA 2A1SA 8ICRA 3CFOA 4O3RA 1BPYA 1KLNA 1W9HA 1BPEA 4JV0A 3RH5A 1T03A 2KZMA 4RQ5A 2PFPA 3IG1A 3AVIA 3ZSOA 3L2UA 2I1QA 4DG1A 1SL2A 1VSFA 4FO6A 3OYFA 8ICGA 1QLNA 1ASWA 2W9BB 4CJPA 5KFHA 1VSLA 4FXDA 2BQUA 3AUOA 1FXXA 4ID1A 5FDLA 4KAZA 2BKEA 4CFAA 3UQ2A 3T1AA 1S97A 5KFTA 3T5KA 5EU7A 4MEXA 3RAXA 3EYZA 1BIZA 5J2GA 2R8GA 5KT3A 4FK2A 4DO9A 4CJFA 1RDBA 1C0TA 2G8UA 1ZQUA 3MR2A 4CIFA 4J9RA 3MBYA 2JEFA 1C0MA 5KG6A 2ZJAA 5IIMA 2BR0A 3GILA 3ZSRA 3NH0A 1SUQA 3THVA 3GFKB 3ZT0A 3CYMA 5KG7A 1ZQQA 1K1SA 9ICXA 4PHDA 4RW4A 3V9UA 2DPJA 8ICIA 4M45A 3GQCA 2ASDA 3Q8QB 1SL1A 1WAFA 4CHNA 1XHXA 7ICKA 4Z0UA 1TKZA 1QSSA 5KFOA 5KG3A 1COOA 4Q43A 1JX4A 3RRHA 4BDYA 4TURA 3HSTB 1S9GA 4J2AA 2VANA 3K57A 2ZJ5A 2R8HA 2OZSA 1S5JA 3OYMA 3CM5A 2IDOA 3WNFA 3MGHA 2YNHA 4ZTJA 1EXQA 1HNVA 4AHSA 2Q0ZX 1MSWD 3DLHA 3C94A 5J2HA 4CECA 3AVKA 1KFSA 1CEZA 5KG5A 5KFKA 4ECXA 3KLHA 2R8KA 1NKBA 2FLLA 1XC9A 1VSDA 5DMRA 3JPTA 3KLFA 4KLFA 5KFLA 1DOQA 8ICZA 5J0RA 1S6PA 1ZQYA 3RH6A 3VQBA 4B9LA 5C42A 3K58A 4K4HA 2FMPA 2FPKA 4YMMA 1IKWA 2BPCA 3TARA 3LDAA 5TZVA 2KQ2A 4CESA 2G8FA 4IRKA 3ZD9A 2ZUCA 1DTTA 3V1RA 4KFBA 2OA8A 3C5FA 5KFCA 3MFIA 3HW8A 2YHBA 1RILA 4GMJB 4QOZB 3MDAA 3CFRA 1KSPA 3O4QA 3DMJA 3PVXA 2JZBB 8ICXA 4DSKA 1HJRA 2BHNA 3OS0A 1L5UA 4DSEA 4DWIA 4CJTA 1CZBA 1XWLA 3NH1A 1JXEA 4M47A 1KFDA 1LB2B 3MXIA 4KLEA 1GOAA 2XHBA 4UBBA 8ICVA 2QKKA 3AU2A 4I2DA 4YMOA 2ZJ8A 4DTNA 2ETJA 2OZMA 1X1PA 1U48A 3QIPA 1RBRA 4PQUA 3PV8A 9ICWA 4BACA 4JS5A 5J2FA 2HVIA 1C1BA 1H38A 2P1JA 4ED8A 3KK3A 3FFIA 1JLEA 5SZTA 3PMLA 4ECUA 4CEBA 1ZQBA 4KHNA 3K5LA 1NOMA 3OYEA 3KHRA 5KI6A 2XCPA 1RT5A 4F3TA 3F73A 1ZQDA 1IKXA 1S1VA 1WNSA 3AVAA 4IRCA 3O3FA 5L9XA 5CA7A 3QIOA 3ZSWA 4UB4A 1Z26A 4CEAA 4UB2A 4BDPA 2Z1IA 2JLEA 4I28A 4O9MA 4BE1A 1VRUA 4X5VA 4CHQA 1HPZA 3L2WA 2JEGA 3GIIA 3RB0A 3PW2A 8ICFA 2HHXA 1Z25A 4AILC 1HQUA 3OSPA 1N5YA 3IS9A 4KI6A 3DLBA 1D8YA 1LAVA 3VQ4A 3QO9A 4R8UB 2HNYA 3QEPA 4NXZA 4J9OA 3NF7A 4RPYA 3OHBA 1S1UA 1RZTA 3M8RA 3ZCMA 4H4OA 4OKJA 5I3UA 3ITHA 8ICBA 4CF1A 4PHEA 2Y1JA 4KTWA 3LP2A 3ASMA 3AVHA 4K8XA 1JLFA 4FJ8A 1XU4A 3S9HA 3KHLA 1S1WA 4ELUA 2C22A 3V9ZA 2X78A 3DLEA 3KHHA 4G1QA 3HVTA 2B4JA 4OLBA 2ZUBA 3BJYA 4KHYA 2ZD1A 1LW0A 2C2RA 4MF2A 4DQIA 1RPLA 4YCXA 7ICNA 3GV7B 4PA1A 4QCLA 5KFGA 5C24A 4ED2A 1WCLA 4J9MA 4JUZA 2W9CA 1WCNA 3AV9A 3RWUA 4FLUA 4EZ6A 1JLAA 5DDMA 2F1HA 4ICLA 2RF2A 3DM2A 4RT2A 4B9TA 4IR1A 4J9NA 3QESA 1ZQWA 2XY8A 2ISPA 4KLUA 1B22A 4C8NA 4UAZA 5J29A 4PY5A 3U3YA 3MABA 1RNHA 3SCXA 3OYBA 4KN7A 1HYSA 2RDJA 4GW6A 1JLGA 1LWEA 4RZRA 4JK1A 1TK0A 2P5OA 1BVSA 5CZ2A 3M8PA 3RJJA 4YNQA 1S77D 2C2EA 4DTJA 4Z4IA 2I5JA 2WONA 9ICEA 4YN4A 1UA0A 4QZDA 5J1EA 4F5OA 2W9AA 4CK2A 3PY8A 1ASVA 8ICMA 3VQQA 1NJYA 2P66A 4CGIA 2BCRA 9ICSA 3SJJA 3H4DA 1L3VA 4IQVA 3KD5E 1RDCA 5I42A 3DRRA 1ZBLA 2A1JA 5J2EA 2IC3A 3T5HA 3U3GA 3SYZA 4DTXA 1VSKA 3TAQA 2GWSA 5JS1A 1TL3A 3AA2A 3ALYA 4I7FA 3ORYA 5KFAA 5HRRA 3KD1E 2RDIA 2PFNA 1ZJMA 3H4BA 4QW8A 1A5XA 1ZQXA 5DQHA 3U6FA 2IBKA 5HRSA 3HP6A 4BE0A 2HHSA 4DU1A 9ICMA 1S9EA 1QHTA 1LWCA 4J2BA 7ICHA 9ICIA 4Z4CA 2O4GA 3QZ8A 3UPQA 3NHGA 5KFZA 1B92A 5J2IA 2ATQA 2DFHA 1HUZA 1J5OA 2M9NA 4LVSA 1VSEA 4IQUA 7ICMA 3OYKA 1NK0A 3G0ZA 4NLGA 4QW9A 2W8KA 9ICPA 4OKEA 4B9NA 1BHLA 4RQ3A 2BCSA 1FKOA 4I2GA 4E7JA 7ICSA 3BQ2A 4ECYA 1TV9A 3ZSVA 3V6KA 2Z1HA 1TKDA 4PGQA 3LANA 5DK5A 2NRTA 4IRDA 3B0XA 3BQ1A 4J2EA 4FJKA 1ZQMA 4ECTA 4FZZA 5DDYA 4E3SA 1Z00B 4R65A 2PI4A 2VG6A 2XO7A 4CJ4A 4F3OA 4R63A 5C25A 3NCIA 3AU6A 1C1AA 1NK7A 3AVBA 3PW5A 3I0RA 4E1NA 4FJHA 5CB1A 1XHZA 2VA2A 1RYSA 3NGDA 3TANA 5E41A 1XS9D 3HK2A 4XA5A 1T05A 1JN3A 5KGWA 1RTJA 5DB8A 4KMUA 2FBXA 4HUEA 3V4IA 3NGIA 2QKBA 3SV4A 3QE9Y 5DGAA 2Z1GA 1F21A 1HRHA 4NYNA 2IAJA 3OJUA 1RTDA 4XQ8A 4O5EA 4DL6A 3ZSYA 3RTVA 4QWCA 3RJEA 4QZHA 2Z1JA 4W5OA 4CJWA 4B9SA 4CGFA 3L3VA 3NE6A 4W5RA 4JLHA 3VA0A 2R8JA 1X9SA 9ICKA 4F4YA 3B6OA 3PMNA 2NRWA 4YVZA 4GXKA 1ZBIA 5J0UA 1KEJA 3OY9A 9ICTA 1JLBA 3GIJA 3ZT1A 4O5KA 4FLWA 2NRZA 3CQ8A 1HYVA 2HMIA 2HHVA 3QEVA 4KI4A 3AVLA 4CF2A 3SQ1A 2GV9A 4H4MA 3HL8A 4B9VA 4DEZA 4AHCA 4CCHA 3HP9A 4DL4A 1CUKA 2KTQA 4CJSA 4Z4FA 2KN7A 3NGZA 1ZJNA 3QERA 3M9MB 3M9OB 1L3TA 1RT3A 4MQ3A 4M6WB 4DL5A 5HBMA 1ZQVA 1C7YA 8ICWA 2W8LA 1HJPA 3EY1A 2XCAA 1HYZA 3QZ7A 5KFIA 4I29A 4GC7A 1RBTA 4DSJA 3JPOA 2OPQA 7ICOA 5J2MA 2EX3A 3AA3A 4ELVA 3VQAA 4EP4A 4LZDA 1XSLA 2PY5A 3O4NA 4PWDA 1YT3A 5HHIA 3PNCA 5J2QA 4TQRA 7ICJA 2IOCA 9ICGA 1RYRA 4CFBA 4CJKA 3HWTA 4IR9A 3BQ0A 4BE2A 5KFRA 2VG5A 4PH5A 4I2BA 4F5NA 2IMWP 4F5RA 3PUFA 4JS4A 4BDZA 1WAJA 3GIKA 4F92B 1WN7A 3Q8MA 4DTRA 1WLJA 5J2NA 4FCYA 3N97B 1S0MA 1NK4A 4FM1A 3V81A 2HNZA 3TABA 4KTZA 1U9LA 1RDAA 1RXWA 3HYFA 4FJ9A 3G6YA 2AGPA 4HVJA 3MR5A 2XY7A 8ICNA 4DTSA 3OYCA 1WSJA 3B0YA 3S3OA 1DTQA 7ICFA 4CJLA 3T5JA 5HMMA 2YV0X 2XGPA 4M9LA 3H8SA 8ICOA 4KRFA 5D3GA 4O3NA 2J6TA 1HNIA 5KFQA 3PW4A 2NRVA 3OYHA 3Q8RB 3QEAZ 4JRQA 3ISDA 4M9JA 5J2CA 5KG2A 1VSHA 4KLOA 4AH9A 4NLZA 3L2QA 1D5AA 4I9LA 3QEXA 5KFUA 1BPZA 9ICHA 5CWRA 4FJGA 1X9MA 3VQ6A 1KVAA 4HUFA 4DLGA 4KLIA 5KFDA 2C28A 5CHGA 1XSNA 3C95A 5HHHA 4Z4HA 4YXMA 3HX0A 4M3YA 2UVWA 3KKRA 4CK3A 4NCGA 4O0JA 4F91B 1RCHA 1G15A 9ICAA 3LPTA 4CHOA 4Q5VA 3GDXA 3SPYA 2XY6A 3LZJA 4F5QA 1ZQFA 5J2JA 4MFFA 2OPRA 3ISNC 4O3OA 2OWOA 5J2PA 3V7LA 5KFPA 4RU9A 1RBUA 2KFZA 4TUPA 1KDHA 4OPKA 4OKKA 2LSNA 5CYMA 1KFTA 1UT8A 3LZIA 5DQIA 4RPXA 5KFFA 3AVJA 3BQTA 4E7HA 2F1JA 2IS3A 3LDSA 4UAYA 2O4IA 4CEOA 2BDPA 4BXOB 3DOLA 2VWJA 4YFKA 4HCBA 1C6VA 4RQ7A 2J6SA 4W5QA 3F9KA 3JPNA 3WNGA 4CJRA 3ISBA 3H8JA 5KT4A 4KHUA 1BPBA 5HP4A 5C5JA 4CHZA 5HP1A 3M8QA 4CF8A 2PZSA 4IQWA 4O3SA 2HB5A 4MF8A 2JGUA 3DLGA 2H5XA 3NF9A 7ICEA 3NF6A 3SUQA 4L8RB 3V6HA 3MGIA 4O55A 1A77A 1K1QA 3L2RA 1LAWA 1RTHA 5DLFA 3TFSA 4KLDA 4FJMA 1ZQLA 3ISCA 5BOLA 1JL1A 3A2FA 4H8KA 2P6RA 4FLTA 4IBNA 4OLAA 1NK8A 5JUMA 3TWHA 2G8VA 1PZNA 4E0DA 4YMNA 1YTUA 4XRHA 2YNIA 4AHVA 4FJ7A 4LSLA 1IO2A 2IGIA 3VQDA 2HVHA 3C21A 3PX0A 5IIJA 2BCVA 4E1MA 3V6JA 3VQPA 4DFPA 4K4GA 2YNGA 3OYDA 3KJVA 1KVCA 5DB7A 4B3OA 3EWAA 4QAGA 3TAEA 2EHGA 2UVRA 2PYJA 1TK8A 3OS2A 4Y1CA 3UXNA 3K5NA 4YR3A 3K5OA 1HMVA 3RB4A 4CIEA 1RT6A 3VA3A 2ZUDA 1QSYA 3FYHA 1FKPA 4ECRA 3TAGA 5J0XA 3LP3A 4ED3A 3M9NB 4YP3A 4TUQA 1DGSA 1T3NA 1L3SA 1JLQA 3DLKA 4HCCA 5FROA 4XIUA 5D46A 3RMBA 3OS1A 9ICFA 1JXLA 4CFDA 4J9LA 2ITGA 3O3GA 2XY5A 4FLXA 2AQ4A 4O3PA 3RMCA 5L1KA 4QWDA 2A1JB 4TUSA 1MQ2A 3DOKA 4NM1A 3SQ2A 4KLQA 3K2PA 2X6NA 4B8CA 1CLQA 4RQ2A 3MEDA 3WNHA 2JEJA 2IHMA 1IG9A 4Z4EA 4HYKA 1EP4A 4HTUA 3AA4A 2VA3A 1RT4A 1Z3EB 4EZ9A 1XO1A 3ZSZA 4DFJA 4I2EA 3OYAA 4N56A 4W5NA 1KCFA 1IH7A 4RW9A 5KFVA 4J9QA 1R0AA 1REVA 1NJZA 3LAMA 2FBYA 2RPIA 4FZYA 1NKEA 4KLMA 5J0PA 3KHGA 3TFRA 4DMNA 4FW2A 4F4ZA 4EP5A 5KRSA 3VQ8A 4MEYA 1NOZA 3T19A 4DQQA 4E7LA 3H7IA 4DF8A 4OVLA 3AO2A 3V1QA 3HJFA 3GV8B 1QS4A 2FLPA 1BQNA 4N76A 1QQCA 4CGDA 5DBBA 1UOCA 3B6PA 1VSJA 2BPFA 1KLMA 4PPXA 4IG0A 3MR3A 5J0OA 4Q8FA 1ZBHA 3FDSA 3RJIA 3K5MA 2ALZA 1QSLA 4NLNA 4QZFA 1TVRA 1Q8IA 4C8MA 1IM4A 3E2EA 1ZQSA 3IM1A 4KN4A 4CHPA 1O1WA 4BWJA 3C23A 4KO0A 1RBSA 5CR0A 2OYQA 3IHQB 4RT3A 3KLIA 2WOMA 2F8SA 3MXJA 1S9FA 4LH5A 4ECVA 1LWFA 4NY8A 2E6MA 2NUBA 2V4RA 5KT7A 3S3NA 4P4MA 8ICUA 1S76D 1JKHA 1LV5A 3SI6A 4BWMA 4F8RA 8ICJA 2AGQA 4UB3A 3EZ5A 2X74A 3LP0A 3RB3A 4KV8A 4I2FA 2MAXA 3OYNA 3AO5A 4FM2A 4FK0A 2FLNA 5HNKA 2DFFA 3OSNA 2B5JA 4OPJA 1NOYA 3JPRA 4HUGA 3SPZA 3H40A 3PX4A 1U49A 3ZSQA 4RW6A 1N56A 3GIMA 1S0NA 2XGQA 2FC0A 5IIIA 4P4OA 9ICJA 1RXVA 1TKTA 4M3XA 4R66A 8ICAA 5J0WA 2BCUA 4MFCA 4CEFA 4I2PA 4O0IA 5CP2A 1UWBA 4TSXA 2OPSA 4M9NA 3ZT2A 4DL7A 3EW9A 1TVAA 3E01A 4UB5A 1T7PA 1EXNA 2IA6A 4PHAA 4YQWA 4DOBA 5EWFA 1NK9A 9ICLA 3NF8A 4J2DA 3VN5A 4F4WA 2B21A 9ICRA 5DKWA 3MEEA 1SKSA 3WNEA 3RBDA 3T5LA 1J9AA 3D0PA 1YTAA 4OJRA 1J53A 2XRIA 3IAYA 3HPOA 2BPGA 2RN2A 4FZXC 3C1YA 2VWKA 4AHTA 4I2QA 4DQRA 5KGXA 5J2DA 1U45A 7ICGA 9ICQA 1BPXA 3ZDCA 4KLSA 1I3AA 1RBVA 1TL1A 3V1OA 2D0CA 1CZ9A 3AO1A 2D0BA 4IDKA 2E4LA 3V6DA 4PHPA 5KT2A 1ZQRA 4ED6A 4J9SA 3RMAA 1BGXT 3L2VA 5J2KA 2ATLA 3NBPA 1ZQHA 4BGDA 1Q9YA 5D49A 4M04A 4WE1A 1WSIA 4Q8EA 5D4BA 1NK6A 2W9CB 3AVMA 1GOCA 7ICPA 3KK2A 3UIQA 4GVMA 4QWEA 3DYAA 3Q8SB 4KLHA 3OHAA 1MC8A 2MUTA 4M6WA 3RJFA 4NCAA 5KFWA 4CGGA 2AU0A 3ZD8A 1NK5A 4F2SA 3DI6A 4CJ5A 1EX4A 3SI8A 1WSEA 4KREA 3QEWA 5CY4A 3PW0A 3TAPA 2QK9A 1B43A 1S10A 1ZYQA 3BGRA 4ZHRA 4G3IA 3HPHA 4RQ4A 4RW7A 4M3WA 9ICOA 3P5JA 4FJXA 3KTQA 4RNNA 1MU2A 3MR6A 1BISA 2FPMA 3Q8LA 4I2CA 2DTUA 4IKFA 4I2JA 5KFNA 1CXQA 3ZDEA 2R8IA 5IILA 4KHQA 3VQ7A 3ZDAA 3VQCA 4DSFA 2IHNA 4I27A 4DS4A 4FLVA 4FW1A 4F4XA 3O3HA 4KITB 1B9FA 2AGOA 3RAQA 4O44A 3MECA 4YXJA 1TAUA 2HHWA 3GV5B 4OGCA 2C2DA 4KLJA 4QZBA 4RPZA 3QLHA 5BOMA 2BQ3A 2VA8A 4ED7A 9ICCA 1C1CA 4FVMA 4LH4A 4CFCA 8ICEA 3ZT3A 3HM9A 3SUNA 2FMSA 3DLRA 3KKSA 3V72A 4O5BA 4GXIA 1S6QA 1ZBUA 9ICNA 2YKMA 5DG7A 2ZE2A 1A5VA 2F96A 4Z6FA 4M2YA 5KFEA 4NLKA 3ZT4A 1DLOA 2Y1IA 2FBTA 2HNDA 4UB1A 5DBCA 3JPQA 3PR5B 3C2LA 4FJLA 3TAMA 3NFAA 4F2RA 2FMQA 5KFXA 5DGBA 5KFYA 3LK9A 4ID5A 4M3TA 2PXIA 3C2KA 4FJ5A 3T3FA 1RT2A 3JYTA 1EKEA 5IIKA 1SKRA 4ECZA 3SQ0A 2ISOA 4F50A 4M0AA 1KRPA 5KFSA 4QZEA 9ICVA 4FS2A 3TQ1A 1HUOA 3NGYA 3QNOA 4JV2A 2DFLA 3LPUA 4NYFA 4QZAA 2VG7A 4EBCA
chains in the Genus database with same CATH superfamily
4ANEA 1Z1ZA 4URGA 5CD4A 3FRZA 3BO3A 1WSHA 2Q0UA 5FRNA 3MM6A 4YOEA 1U25A 3GTYX 2F4VK 2XWYA 4IUFA 2WF8A 4I2HA 1A76A 1ED1A 2XTJP 3CCJN 3MFHA 1K8KA 2BZFA 1F3FA 3HHLA 1ZD2P 3MXMA 5HROA 4FJIA 2V4QA 3BZQA 3NASA 1VQPN 3WX8A 2D7SA 4OI6A 2OTJS 4GFJA 2EBGA 5D4PA 2GGPA 1FKAF 2Y8YA 3MEKA 4RCHA 2BGWA 2V5HG 2W6KA 5ETVA 3S41A 4LF8K 2GNKA 1V5IB 4I2AA 2QLFB 4U7BA 1CBKA 4JKCA 5AR0A 3VF2A 2IJNA 1BHNA 1D0EA 3H1VX 2GTDA 4BR0A 1COKA 4DSIA 4K8ZA 4M3UA 1V3ZA 3TJ9A 4B1XB 3MMAA 3BUZB 5E79U 3QEIA 1NU4A 4KTQA 2P51A 4ETXA 1PC4A 1FERA 3ZDBA 3PSIA 2IY5B 4KPYA 3QWUA 3F9MA 4WCEL 2GIQA 3G9CA 4IOAQ 3MMBB 4OYXA 3TW0A 2OTLS 1ZQIA 1ZOTA 2LQ8A 4DPXA 3RBEA 2G9OA 3DU6A 2B51A 3UE5A 3R3TA 4A4JA 4Z6CA 4KYZA 8ICYA 4PXCA 4CWBA 4YG2A 2GJFA 1C1BB 3K8WA 4NLCA 2UXBF 4CEEA 2LA4A 4JI2K 3V2UC 2WZ1A 1CJVB 4B3TJ 4JI6J 4BC7A 3OYGA 3IRXA 3RR7A 3V7JA 2FJDB 1JMSA 1CJKA 5D15A 2J4RA 4LD0A 4EAHD 1PILA 1H2TZ 2KFNA 2VDHA 2DIVA 3UMCA 3SEIA 1UZHA 4BJQA 5KFJA 7ICUA 3PJ9A 2UUTA 2ZG6A 2ZDOA 1TKTB 4CJ3A 3W5YA 2VOPA 5DB9A 5M1FA 4YY3F 4LF5K 1HNWF 2NR0A 3C7NB 2HW3A 1VSMA 2OPQB 2ZIXB 4H03B 1U47A 2IM2A 4I0WA 2MUTB 1ZQNA 1KP6A 2NYVA 4JWNA 3E8OA 2FJVA 2XC9A 3U9DA 1LKYB 4V1Ak 2FQQB 3DWLA 4L74A 3VQEA 3SCKE 3M8SA 2PAVA 3D6JA 2CUYA 4IH6A 2CJKA 3FCVA 3S1TA 2F8MA 3PO4A 2HFSA 2OPPA 4F5PA 2OHDA 3N4PA 4QZIA 1S0OA 2ZH7A 2F8TA 5G0RA 1H7WA 1OIAA 3N6LA 1RWWB 1FK9B 2O1PA 1I51B 2AA4A 3HKWA 1P90A 3M2RB 5GAHU 5KT6A 1VFJA 1TL1B 1YI2S 4K0KK 4EO6A 3BKTA 5EWGA 1BQMA 1FTRA 4KLLA 4WYLA 2DIUA 1T3VA 5BRDA 4RNMA 3TR5A 3U1NA 4JWMA 1X2IA 4LY7A 1VQ6N 4JI3J 3JXOA 1HBNB 3JSMB 3H08A 1QE1A 3ZLJA 1WORA 3GCXP 4LBPA 1Z19A 3N9UC 1FE4A 4UATA 2DNLA 2GH1A 5F8IA 1VCTA 1TAQA 5U47A 3AOCA 5AQVA 1NPKA 1GXUA 4OZ1A 1X0PA 1FXLA 4EU0A 3VAHA 1SIZA 3C19A 4E7KA 2HG4A 3NAEA 5KFMA 4U9RA 4OYIA 3SUOA 3V7KA 3CJCA 1H2UX 1L7NA 5AQMA 5F0WA 2GWJA 4DTPA 3PIPQ 2R7WA 5E2QA 2ZTEA 3KVGA 2G8WA 2AJQA 2ROEA 2X1GA 4FPRA 4NCGB 4I6AA 1GEHA 3KLEA 5T14A 3AD8C 3AMZA 2QARA 5HMYA 4JI8F 4J9PA 3LPEA 2Q2RA 1KVBA 1JIHA 3M8YA 3P83D 2DHSA 3CJQA 1ZQZA 4PL1A 2GVDA 4JP8A 3AVFA 2ZBQA 3OL7A 3C16A 2ZNYA 1N36F 3DRSA 4CJUA 1Q1KA 3VGUA 3NTUA 4YB7A 1X6IA 4QZ8A 5BYSA 1B4FA 3VQ9A 1Z4OA 3OYJA 2EZXA 4OMFG 8ICLA 2UVVA 5J2AA 3GFYA 4DBQA 1JL2A 1BCMA 1ZQEA 1T95A 3J80O 3NS1A 4DSLA 3ZNJ1 2VBWA 2RKIA 1BL3A 3ZZPA 3KK1A 1Y3KA 3AQFA 4LSNA 7ICLA 1TFRA 5DB6A 1HNXJ 5T7BA 2NUUG 4FJJA 4CLWA 3KUHA 5GVQA 1F2HA 3EPIA 2G1HA 4R64A 5ALWA 4EI2A 4KHSA 4CLZA 5A8RB 3VV2B 2HS0A 4B6JA 5HROB 4AP9A 3MX5A 2BOPA 1S1XA 2J0QD 4CNYA 2HHTA 3GG1A 1J5EK 2KYXA 3KOAA 4A8QA 1REVB 2Y0SD 4PWUA 4OJ5A 2P9KB 3KK2B 1WC0A 2RUSA 4RW7B 4FPBA 3QUCA 2A10A 4JKGA 2YKPA 3LWLA 2HFOA 3GU3A 8ICHA 3LP1A 9ICBA 5FLXY 4NRUA 3ITHB 1S1UB 4QR1A 1NZBA 4OX6A 4CO5A 5EGYA 4V19J 3U1MA 1QVFM 1BPDA 4LRBA 2RRDA 3M05A 8ICTA 5BPNA 5KRTA 1RT7B 1B70B 2C3OA 8ICCA 1ZM3A 3C14A 3IRXB 3QNWB 2QM1A 3KJVB 1F60B 2AQ0A 4F0MA 5GTIU 1J27A 3KLHB 2Q79A 1PJ6A 1N5SA 3C65A 2YKMB 5F8JA 4CD1A 1FESA 4OGEA 3AGRA 4IQTA 2DNZA 4L6V3 1KQKA 3QNNA 3VQ5A 1B0TA 2ZBRA 4OZ5A 3N7RC 3PR4A 4K4ZA 3LDQA 2QYGA 3T1HK 4QR0A 1RCOB 2IM0A 2AYBA 4YR2A 1CQNA 1LKYA 2CQ2A 3QO9B 2LBOA 4B08A 2EK1A 3OVNA 5L38A 1RHRB 2Z8QA 1ATRA 5AKGA 3OFEA 4FBUA 4K5RA 3CCLS 2PMWA 3HI0A 5CA5A 3UQ0A 3CIZA 2W55A 3OQ2A 1OQ3A 3KJQB 1WSFA 4E7IA 1A0PA 3TO8A 3EE8A 8ICKA 2P9LB 1WYGA 5BPCA 4UBCA 2JR5A 4GMKA 4A2BA 1J6ZA 1A7GE 5F8MA 2W9BA 1N34F 4DG1B 3ZETB 4KHWA 1TFYA 5HMLA 5IQQA 4ZIVA 2IRYA 1Q9XA 3LGHA 1FEZA 3RBZA 4OYMA 1FKPB 2D3DA 3SJHA 4RNHA 3HOTA 1U04A 3FSYA 4MYTA 4Y2MA 3KXDA 2QA4G 1PYTA 2GO9A 3G10A 1NB2A 2YN4A 3MM7B 2DFEA 2MJNA 3GWCA 1BNPA 3WXLA 1VBZA 2Y9UA 1RHMB 3BGUA 5L1JA 2R2UA 5ETTA 4AHRA 3G71N 1BCOA 1IKYA 4NE9C 2VFUA 2R7UA 3LDOA 1KWMA 2FZKB 4CZEA 3RJMB 3MDFA 3CFOA 4JV0A 3HULA 4FF3A 3ZXWA 1F9HA 3IG1A 3QUTA 3VEYA 2YNHB 2X3GA 2I1QA 1FX2A 4PZOA 2ESEA 2HI0A 3BYPA 4FYYB 3DGPB 1I94J 4OJLA 2NS1B 3AUOA 4ZA1A 1YJUA 3SLCA 3WIVA 4L3NA 4JI0J 4H5TA 3UQ2A 4RUHA 4OLOA 4P0PA 3K7RA 1KQQA 4KH1B 3BF4A 4MEXA 3RAXA 3QBXA 5F3TA 5GAHP 4CLPA 2XULA 5KT3A 3D1HA 1VC6A 2LEPA 1C0TA 3ZI4A 3EICA 2FJAB 5ALJA 4CIFA 3IG5A 2DKXA 4YDUA 2JEFA 4DV6F 5KG6A 2E1RA 1K73O 1D9AA 2BR0A 1TYQA 1P27B 5ALIA 1FEEA 3GFKB 1S6OA 5BPLA 1VQOS 5K20B 4BC4A 4JKEA 1FWKA 1ZQQA 5AQGA 4RW4A 5BR9A 2P9EA 4AQYF 2V68A 1PGZA 2FHMA 5M1PA 8ICIA 4M45A 1SL1A 1WAFA 2CPDA 1ZD4A 1PAEX 1Q7LB 1XMQJ 1RWPB 3KUGA 5KG3A 4Q43A 4A47A 1JLEB 3EXYA 2HVDA 3F44A 2NLWA 3KK3B 1S9GA 1HD1A 3CMES 2R8HA 2J0WA 3GG0A 4MKYA 1LXJA 4ZTJA 1C0GA 2Q0ZX 2MZJA 3RW6A 5KAIU 3C94A 2J5AA 3JB9k 3TU5A 2DGZA 4CECA 5KG5A 3KLHA 3OPKA 3DDNA 1U1LA 1VSDA 5K9FA 2P9KA 1WUUA 3M8PB 3JPTA 3KLFA 5KFLA 1RTJB 3D7SB 2OPSB 4OYZA 4USHA 1XBWA 2OCEA 4B9LA 2F8LA 1RJJA 2B9WA 3TWZA 2OEMA 2FMPA 1IKWA 1V5VA 2MTLA 3TARA 3C15B 1BD6A 5B0DA 5LL6Z 4GKJK 4CRJA 4F26A 2NQPA 1ILYA 1HBOB 3TVKA 1FA0A 1X42A 2UXDF 4KFBA 1S8OA 1QQ5A 4ZCMA 3HW8A 4CDIA 2GELA 3BS7A 4U67Q 1PSDA 2B4VA 3MC1A 3D2EA 1S4FA 3POTB 4X65F 2MXYA 3DMJA 1LWFB 1QQ6A 3A8IA 1SV0C 3OS0A 1AUDA 4DSEA 4DWIA 2GFFA 4M47A 1PUZA 1ZAVA 3MXIA 4PHTX 4UBBA 3AU2A 4YMOA 2ZJ8A 2DBYA 2XMUA 3SQIA 5AE3A 3THPA 3BBBA 3HKZD 2D3OR 2KM8C 3PV8A 4EMDA 4EUVA 2JGAA 1H38A 2KXFA 2P1JA 1SQEA 3IG8A 3NWGA 1MWYA 2FJEB 4I2PB 1VJ5A 3CD5A 4KAIA 4ECUA 3RFAA 1NGEA 5BR8F 1ZQBA 3GFZA 4PG6A 3K5LA 1NOMA 5KI6A 2XCPA 4F3TA 1N2XA 4HLBA 3BM7A 1KDNA 4GKKF 5L9XA 3Q22A 4QPXA 2XYHB 3ZSWA 3DRPB 1Z26A 1X4AA 4QR2A 4BS2A 4UB2A 3QFPA 2B9XA 1ITPA 4A8EA 2KXNB 1EB0A 3JYTB 4I28A 4QIEA 4X5VA 2DNRA 3GIIA 3RB0A 1DJ0A 3QU5A 2A1AA 4KY3A 1BE4A 1X31C 3QRQA 1Y11A 1TUWA 3CF5L 9ATCB 1LAVA 4C97A 3QGPA 4K4UA 1F1BB 3QGGA 2EXUA 3CDBA 2HNYA 4BQLA 3IGVA 4X4UA 1NRKA 4KH0B 4OO1J 4F0KA 2KVCA 4X65K 3BV8A 3MMAB 1JLFA 3S9HA 5AE2A 1URJA 2X78A 2ZZMA 3DLEA 2VL1A 4G1QA 3FBEA 3AJ1A 2B4JA 2F3NA 3VENA 3W9JA 2ZUBA 4BRHA 2C2RA 2ZUGA 3BPDA 1K9MT 1RPLA 4YCXA 1LNQA 2O6KA 3R9PA 2G1DA 2DQNB 2XB2D 4ED2A 4ZHRB 3KJFB 4JUZA 3UCUP 1F5BA 3VALA 2VGNA 4X4RA 3RWUA 4FLUA 5J2MB 4DV1F 4PKIA 2RF2A 4RT2A 4B9TA 2VZ9A 4IR1A 2XMJA 3QT5A 2O3DA 2ITMA 2FVQA 5BYRA 4IOBA 1DK3A 2HWTA 3MDQA 3O8MA 1B22A 4I4BA 2XBPA 2LXUA 5J29A 3NP5A 1RNHA 5F1XA 4F0HA 2XI9A 3DXBA 1IV0A 5ADXA 4RZRA 3NCQA 4JK1A 3W61A 5CZ2A 3M8PA 2K8BB 3QYYA 3U1LA 3G25A 1X4HA 2PD1A 2MKCA 4CK2A 1CLFA 4LVOP 3VQQA 3KZBA 3MMCA 2ADBA 4CYUA 4X4PA 2BCRA 2MB0B 2QEXN 2YI1A 2WHEA 2VJ5A 3EGNA 3HFKA 3UCZP 4X66K 5LXYA 4LUBA 4Y2PA 1TUGB 1T9VA 2OPPB 1MU2B 3BDEA 3TAQA 3ILOA 1TL3A 1S5LU 2LEBA 1M5PC 4DV6K 2FXUA 3JTNA 2RDIA 2F4FA 2W41A 3KD1E 5ETQA 3RW7A 3HZ6A 3LP2B 2F9WA 1HBOA 4JI8K 4QW8A 2DNGA 1W26A 1ZQXA 5DQHA 2O8FB 4FKXA 1Y5LB 1UVJA 2LHTA 2W24A 5HRSA 4DU1A 1IM6A 4USKA 3T1YK 1K73T 1UVLA 4NXNJ 2WTUA 2IMOA 5J1EB 1B92A 5J2IA 2XQCA 1R3NA 3UN2A 2DFHA 1N33K 1J5OA 1FE0A 4LVSA 2YMMA 4IQUA 3JAMU 4NYZA 9ICPA 4QZVB 3DXMB 2KK0A 2OEHA 3NXZA 1XJWB 3T9ZA 2GC8A 2R2RA 7ICSA 4ECYA 4R0EA 3V6KA 2Z1HA 2DR6A 5G0RB 1TKDA 4PGQA 1H74A 5AQQA 1ZQMA 4RR5A 1N6QB 4ETZA 4R65A 4A8OA 1SPBP 5ALOA 5C25A 5D8HB 4WK1A 1U02A 3H20A 4FDFA 1S22A 2LQBA 3N5BA 2OM6A 2W4PA 2ZH1A 1T05A 2VPXB 3I1YA 4IWVA 4KMUA 3V4IA 4LF4K 3SV4A 1GLJO 5DGAA 4NYNA 3M6WA 4IXCA 3NAHA 4XQ8A 2YVSA 1XNQK 2O8BB 1MNEA 3UO0A 4JI2J 4KQZA 1IWGA 3RJEA 2ZOMA 4P2XA 3M30B 3L3VA 3NE6A 2FB0A 3DDKA 1X9SA 2D3O1 2NZ4A 2E5IA 3CJTA 2E44A 4O5FA 2CPJA 5GADU 4YVZA 4GXKA 3ENVA 1RE1B 3ZT1A 4CBUA 4FLWA 2LU1A 2DKZA 5LMUK 3QB0A 1MN9A 1NPRA 3O9RA 1Q0NA 3SQ1A 4DR4K 5FJ4A 2HZAA 3TA2A 4PPDA 4ACOA 5AQFA 1NNLA 4CCHA 4OHVA 3HP9A 3CCZA 2CN1A 3CD0A 2BW2A 3BSNA 4Z4FA 3FUYA 3T1HF 3QERA 3M9OB 4U6PA 1L3TA 2FJ6A 1RT3A 2KB2A 1C4CA 3M6KA 4O4GB 2VQEK 4M6WB 1C7YA 2RB7A 4WK3A 1RDRA 3RBXA 8ICWA 2W8LA 2KHVA 2EFVA 4KGXB 3HSDA 1HYZA 1DAXA 3QZ7A 2HSEB 5KFIA 1RTDB 3I0RB 4C80A 1RBTA 5KPRA 4C7QA 1Q7YO 3CJ3A 1WBDA 4M5DA 5FPEA 3WU2U 5J2MA 1QAIA 4ZVFA 5KL1B 3VQAA 1HUXA 4EP4A 1FJGJ 1S7IA 3O4NA 1N60A 3MCAB 2V2KA 3ZEUA 1U2VB 4R5PB 3GYGA 2E7WA 3PNCA 3A0IX 4Z2XA 3JSBA 4TQRA 3J7YU 2IOCA 3FMWA 1RYRA 2ZH4A 4IR9A 2QL7B 1NM1A 4BE2A 3TZXA 3WKBA 4F5NA 3HDSA 2B0CA 2EAMA 4HHHA 2YMPA 2LEAA 2W2QP 4QS8A 3PUFA 4CT8A 1C4AA 1AT1B 4DCJB 4DL0C 2HYIB 5GTHU 1IXKA 5B0EA 1WAJA 3Q8MA 3JQMA 4DTRA 4YB6A 1WLJA 3AN1A 3PXGa 4JK7A 2R7XA 3TABA 2NYHA 1TTHB 1RT4B 3RF9A 1B99A 4DOZA 2XY7A 8ICNA 4DTSA 3I9ZA 4K41A 3PRBA 1OPIA 3SR6A 1DTQA 4U7CA 4FP9A 1IJJA 2QWQA 5BR8K 5KFQA 1HBMB 3OYHA 3QEAZ 3FK4A 1S99A 2CRXA 4JRQA 4F36A 3CC4N 1FRIA 4USVA 3UVJA 4IDKB 1VISA 2G2ZA 3S7RA 4NLZA 1BA1A 4K43A 2E2OA 1XQSC 2F9TA 2BJ3A 1R8CA 4FJGA 3O0FA 3OBIA 3VQ6A 4H54A 1KVAA 2DISA 4DLGA 4OV6A 2POKA 5BPMA 2BMBA 3CRXA 1IJFB 4JV5K 2DHXA 4M3YA 4CK3A 2WF7A 2QWMA 3ENBA 2O8EA 1RCHA 1YGYA 2MQQA 1UTAA 2D74B 4ERDA 1VYAA 2WB4A 4P52A 4RQMA 1IBLJ 3M1VA 4OZ0A 5AM5A 1OQ6A 1VQYA 4RNFA 3VEWA 2A19A 4RU9A 2H51B 2YNIB 3KMSA 4DZ6A 1KDHA 4DCOB 2E9ZA 1VQNS 1RQLA 5H9FJ 3LZIA 4RPXA 2EKNA 4MKBA 1FJCA 1XMOK 2IS3A 4D3HA 2BDPA 2VWJA 3SEOA 4H4OB 1I94K 4HCBA 3SENA 2ZOGA 4AF1A 3WNGA 2AF6A 4A5BA 2YJFA 3M6XA 1JNRB 1WC3A 2VBXA 3H8JA 5KT4A 4QIFA 4KHUA 1FVSA 2EWSA 5HP4A 2RILA 1RWUA 3M8QA 2KG1A 2CJ9A 3PCOB 3NEKA 4ILHA 2GX8A 1S79A 4MF8A 1MWQA 1EAYC 4Q2MA 2ZHAA 3SUQA 4ISGA 3QNMA 3D28A 1SJFA 4O55A 3L2RA 4DX5A 2MSNA 2QJ3A 3CCRN 2MSSA 4H8KA 2DNHA 1LEOA 3DGVA 5LMNJ 5A8WB 2AIRB 4OX9K 4OLAA 1NK8A 1G6BA 4B3RJ 4E2FB 1Z6RA 1AB8A 1K0TA 2N4CA 5HK4A 4YMNA 2XWXA 4RPFA 4AL7A 1YTUA 3NVWA 3MCNA 4AHVA 1S4EA 3FZHA 1U1OA 1NMDA 2HVHA 4DR5J 1HPZB 5IIJA 4ED4A 2CG4A 3VQPA 2KO1A 3SIPB 4K4GA 4DUZF 3LDLA 4K4SA 3OYDA 3OUYA 1LOTB 5H2FU 1DFDA 3GJTB 2MKYA 3QFUA 4CGZA 1IBLK 4PAAA 2DGTA 4FOEA 4Y1CA 3UXNA 3UI3A 2DNQA 1WHXA 1CRXA 3CD7A 2H5IB 4AL6A 2K4PA 4XEIA 3Q24A 1QSYA 2AJ4A 3EJMA 4BCAA 2BJ7A 3R6MA 3PG9A 1S9EB 3FRYA 5CYQB 2J8AA 2VJ4A 3VAKA 1DGSA 3O9SA 3DLKA 2OJ3A 5D77A 2N3LA 2HHHK 2KG0A 1N63A 4CBWA 2DNYA 3ZFVA 5F0UA 2F2AB 4J9LA 1EWQA 4BUGA 3DOMA 5HQLA 4F72A 3VWSA 1MQ2A 1W2BM 4YOVA 4CF5A 3LVVA 3BYRA 2YJEA 2JEJA 1IIPA 2CDQA 2KLAA 4Z4EA 2RMLA 1EP4A 4QNLA 3KG0A 2MRLA 1EO1A 3UM9A 4DV7J 1HIYA 2KIVA 5GADP 2VA3A 1RT4A 4DR4F 4EZ9A 1HKAA 4O23A 4GO7X 3ZSZA 3L6QA 3PJWA 5KAFU 1R7IA 4DFJA 4E1JA 1WOOA 2DY1A 4W5NA 4V19X 5IM0A 1IH7A 3RU0A 2MLZA 1R0AA 1S1WB 4ZPWR 2KYZA 3IAS9 2GV1A 4KHPF 4DR3K 2WVBA 1FDAA 2K4HA 3KHGA 5BR8J 4FW2A 1UPHA 4PKHA 4Y2YA 1VK3A 2P9PA 3CJ5A 5AQHA 3MM5A 4MEYA 2Q4TA 4DF8A 5CHCB 4OVLA 2C3MA 3CJSA 1QS4A 1H73A 2B3TB 1QQCA 1WBBA 5DBBA 1UOCA 1VSJA 2BPFA 4NL9C 4P9SA 1UP1A 2W7AA 2PO4A 5AZJA 3X3UA 4LRCA 3RJIA 4P0QB 1A0OB 2ALZA 1QSLA 2B7BB 3FCWA 1FNMA 3OVAA 1KW4A 3E2EA 4O8UA 1EQMA 3IM1A 1CJKB 4KN4A 4M1KA 1RBSA 1H2VZ 2YNFB 4ILRA 2LQ5A 1JLBB 4FE3A 1YBTA 2EPIA 2OMOA 1S72S 1HX1A 3EZWA 4LH5A 1LWFA 2NUBA 4EWTA 3S3NA 4P4MA 2KXHA 1VQ8N 1S76D 3NNAA 3SI6A 4DI6A 2J9DA 2R42A 3C3LA 4K0KF 2HK2A 4UB3A 2X74A 3NVKA 2BACA 3IM9A 1VQNN 3OYNA 2KRBA 1VS3A 1TUVA 4FM2A 4FK0A 1KKHA 4Y2CA 2Z2YB 1Z05A 2WBMA 1DK2A 4PQAA 4GKJF 4BY9C 1N56A 4P2MA 2KG5A 3B8AX 2XGQA 2FC0A 3C2PA 1UL3A 1L8OA 1RXVA 4JI0K 3GL1A 4BRLA 1IN0A 1HARA 4I2PA 2F1FA 2QE5A 1GH8A 4ZVGA 3HSZA 4WP9A 2CNLB 2P2CB 3E01A 2DEJA 4UB5A 1YVFA 4GNIA 3CCEN 2NSCA 3U9ZA 5GINA 5GAEP 3VEZA 3VN5A 1Q82O 4NXMJ 3L9ZA 4GVLA 3QT6A 3MEEA 3CHWA 3ZX2A 4QIWC 3C16B 1SKSA 2MZTA 3RBDA 3T5LA 1J9AA 1IV8A 2C3UA 4OJRA 4BR2A 1VQ9N 5HN0A 4FZXC 2VWKA 2K8CB 4AHTA 3ZTPA 5FPMA 2HFVA 3LPYA 3O6QA 5KGXA 8RUCA 5J2DA 5L9NA 3KLIB 4TY8B 1ZZNA 4BHQA 1RBVA 2JFKA 3V6DA 3MPDA 2E4LA 4PHPA 3KHYA 5KT2A 2KDOA 1VJWA 1UVMA 4ED6A 1BXNA 4J9SA 4AQYJ 1BGXT 2P9UB 2RKIB 2FHJD 5J2KA 2ATLA 3NBPA 2I38A 3CO9A 1UVIA 4BGDA 5BN8A 5D49A 1URRA 2CQPA 4M04A 1WSIA 5BN9A 3UD3P 5D4BA 4GVMA 5C7PA 3VVTA 3Q8SB 2Y1LB 4IFYB 1YVNA 2HGLA 4ZLNA 2WBNA 1PG5B 2EC2A 1N32J 3RJFA 3MCSA 5DM7L 4CGGA 2AU0A 2XEXA 2BE2B 1FFSB 3DI6A 4KH6A 3NAIA 4KREA 1MA9B 5CEHA 2QGFB 4FWMA 1CSJA 4CDGA 4ZHRA 3ETRA 2B9EA 3ZZOA 3UB5A 4RW7A 4M3WA 1MU2A 2GO8A 5GAGP 4H0VB 2MA1A 4I2CA 4UASA 3B9JA 1TL3B 1I94F 4IKFA 1HEKA 2BJDA 4ZVUB 2XICA 1YJWN 4Y2AA 1WKLA 3FBBA 3VQCA 3ZDAA 1UW4A 1WEYA 2GZOA 1GLCG 3RSEA 2AGOA 3QT8A 2CKWA 1HI1A 2HHWA 4OQJA 5DDRC 2C2DA 4KLJA 3QLHA 2ZBCA 5BOMA 2BQ3A 3HHLC 2P9PB 4BRNA 2E1PA 3KLVA 2ZJPL 4LR8A 3HM9A 3DLRA 3V72A 4O5BA 1NDKA 3NMAA 2UUAJ 9ICNA 2M7SA 2YKMA 4H0YB 2IVYA 2F96A 5KFEA 3A5NC 1RI7A 3D1OA 3ZT4A 1DLOA 4JK9A 1WG8A 4UB1A 5DBCA 2RHSB 2ZIWB 1X7VA 4FZMA 4CQ1A 3SQGB 4YUDA 1SV0A 2OFHX 2VBYA 2RSQA 4FJ5A 1EKEA 3QPIA 2YWKA 3O80A 4O4RA 4FS2A 1QQOA 2QLWA 1WEZA 3QNOA 1AXQA 2DFLA 3WZ0A 4NYFA 2CPHA 2PFDA 2VG7A 1SZHA 2LM4A 1IXRA 3ICXA 3IDHA 2RDDA 3KIOA 2HQIA 1Q95G 4M63C 4IJAA 1GT8A 4UAWA 1TK5A 5LSLA 2E7XA 1YWXA 4I64A 3C6TA 1J2VA 2BJ9A 3LALA 2MHNA 4RQ6A 3MPYA 4DQPA 3H6EA 5AM4A 4NI2A 4EX7A 3FZLA 2YX7A 1X0FA 2PI5A 1HW8A 4LFBF 3H98A 3TNVA 4JI5J 4ZLJA 3PX6A 1ITGA 2B8QA 2ROPA 4UZCA 3NOGA 2KJWA 1PVPA 4IO8A 3V9XA 3NOCA 4ZVPB 2H3QA 3K1ZA 3EGZA 3W3DA 4KJIA 3P4UB 4YORA 2PFQA 4B1UB 1SKWA 4LF7K 1GFWB 2WMMA 3QETA 4TLRA 3SUPA 1YTYA 2JWKA 2H65B 3A0HU 4XUSA 2HNDB 3RH4A 3E01B 2I7NA 2HHPA 2ZIUA 4IQMA 3AODA 2KHOA 1NGCA 1PVRA 3WKDA 5HRNA 5T7LA 4CO2A 4KB1A 5DG9A 2HLUA 3SNNA 1X3MA 3TP2A 1T9UA 1YUWA 1WJ9A 4M42A 3OTOF 4E89A 3PDNA 5D78A 2D5RA 3IFRA 5HR6A 4IO9Q 2LXFA 3KKAC 4F4KA 1VQ8S 4JI5F 4DV1K 2Q3SA 2WUSA 3AA9A 3H42A 4OHXA 2IVOA 3NH2A 1D1UA 3TYTA 3DV9A 3GZFA 5IT0A 7ICIA 4CO0A 2K2PA 3ENHA 3CCTA 1AFIA 2MY8A 5A2QY 4IH5A 4FS1A 4DDFA 1NMNA 4BVPA 3K59A 3ONQA 1S0VA 1E6VB 5AQXA 1BI4A 1DURA 4NB4A 3B6BA 5K4LA 5ALQA 4ISEA 1NSPA 5DJBA 2W7OA 1R0BG 4OI0A 1EKRA 3B82A 1ZQJA 3FMBA 5AQJA 2W42A 4X4OA 3MN6A 2AJ2A 2Y9HA 3VZIA 3RG6A 1CJTB 1XSPA 1MMLA 2O8CA 2YB4A 1N33J 4R8UA 3AVNA 5J0YA 3HHLB 3PNIA 1ZQTA 2ZWOA 5AI0A 3D54A 2CQ3A 2MPUA 2QXFA 2VODA 3IM8A 3R97A 5JLHA 3OFFA 4RQNA 2Z30B 3UKUB 2FTRA 2KVSA 2O5DA 3OJSA 5B0FA 1KTQA 1PK3A 1U6BA 3TZWA 7AT1B 1G3OA 1HQ2A 5HOOA 4JI8J 3OV7A 3PW7A 2W2NP 2HBJA 1RHKB 3S01A 1PIEA 3F2DA 2MEWA 1ZXIA 4RQ8A 3FE1A 1NKCA 4AD6A 4D3GA 3E9OA 1SXLA 1XR6A 1NJWA 1WG5A 4TLQA 3R1LA 2P9GA 2FBVA 4KV8B 4CGHA 2DT9A 4DF4A 4DTMA 1RU2A 2DR9A 2ZTDA 1Z00A 1ULRA 2PFUA 4KLGA 2R7YA 2UXBJ 3K9KA 2MZ1A 3AAQA 3DI6B 2RVJA 2DWQA 2UU9K 3TA0A 3CD6N 4HH0A 3CGIA 1ZQGA 1ZBTA 1GLLO 1WC5A 2B6AB 5C24B 3EDQB 2QN6B 3OFHA 3SZ2A 1IBKF 1QZ6A 3FAHA 2JVRA 2NXNA 4LFBJ 4MLHA 1AFJA 1GMVA 3TEHB 5D0EA 3O5TB 4H0PA 1XR7A 3P6YC 2XNQA 8ICPA 2QL5B 1B9DA 3GONA 2JEIA 4Z6DA 1L3UA 5KPTA 2ZGZA 2DHGA 3BN4A 2LYBA 1KBUA 2IM1A 4KKOA 3DOKB 4YFUA 3HZGA 2AXTU 2MMYA 3CCQS 3J7AP 7ICRA 1SIJA 3PFEA 1T44A 4DS5A 4AUKA 3AJDA 1GMUA 5SUHA 5KG0A 5AZIB 3ALRA 4C7ZA 4I1TA 2C2MB 3CIPA 4ED0A 4UB8U 5FDLB 4P2HA 4M5IA 2Y9TA 4YR0A 3O9TA 3D0IE 2KE7A 4W92B 2CQBA 4DPUA 3HM8A 2R7RA 3K9JA 4IO9L 3AVGA 2E2PA 3MAQA 4CLKA 2ZTCA 4O5CA 2HAIA 5F9NA 3RJHA 2IA0A 4ED1A 4WIQA 3DMJB 2V8PA 5IT4A 2XLJA 1SZPA 3H0RB 3DRPA 3D3BJ 4CF9A 1YAGA 3D3CJ 1UMJA 1NJIT 2UUAF 2D0AA 2VKRA 4NXMF 1MWKA 8ICSA 2UVUA 3CXCR 5SWMA 1QE1B 4IG3A 1FI4A 1NJXA 2J9CA 4Q7AA 1U1MA 1IBMJ 4I6YA 2XLIA 3TR8A 2VQFF 2A1RA 5LJVA 5K14A 2GHPA 1RAGB 2V63A 5G5HA 2H3GX 1JMTA 4JRPA 2N7YA 2BUNA 2XZTB 3TZYA 4UF4A 2HGNA 4FZNA 2G08A 2P6UA 3OTBA 1ZETA 1QTMA 2D0OA 3HXMA 2VQFJ 2QFJA 3CPWR 2J6UA 4LF9F 3GYNA 4UOGA 4N5SA 1FFGB 3MCOA 1IBMF 3WUHA 4CZIA 3HO1A 1BI4B 4FNIA 3MX2A 3RB6A 4QZ9A 3A5MC 1D9DA 1V3RA 4K0KJ 2O8DA 4FN5A 3MN7A 2A6AA 1JXVA 4FXVA 4USJC 4Y1DA 1H7XA 5BXIA 2ASJA 3O1WA 2HPUA 4FYDA 3DOMB 4KLTA 1RGVA 4C8OA 2BKOA 1RAEB 4Q45A 4UY8T 5LOQA 4IS7A 1D8BA 3SMVA 3KLGA 3ZTOA 4Z6EA 5EWEA 3AO3A 5EVZA 4NLDA 5FRMA 1UT5A 2ASLA 3CPWM 4ZN1A 1SJ4P 1OVYA 3UR3C 4QZCA 4CK1A 2B43A 3H5YA 4Z4GA 3SK3A 4J9VA 1YRXA 2A40A 3S3MA 1HFEL 1ECWA 7ICTA 1RT1B 4OI1A 5IIOA 1UAXA 3I55N 1AUSL 5AKJA 4EEYA 1FHTA 2IDEA 2O8CB 1TKXA 3CJKA 3ET6B 4UQGA 5F9LA 4N47A 4QPTA 3TJ8A 2GEMA 3L3UA 2P6SA 3HSGA 2G5HB 2GS8A 3G4SN 2BCQA 1Y88A 1NB7A 3LGNA 4IFVA 1RT7A 5L1LA 2OANA 1MN8A 1M5VC 4RUAA 2DPIA 2D41A 3MI7X 1RAIB 5A76A 2ABYA 7ICQA 2HMIB 1FD8A 1ZQAA 4YY3K 4E8UA 4HHUA 3N4MB 4B02A 1SGGA 4O3QA 4B9UA 3EL2A 5JLFA 2HHUA 4NLYA 2KEYA 3OXFA 2I9GA 1RDDA 3H2VE 2Q3PA 4X64F 3IAM9 2V8HA 2YQ0A 3K8VA 4DV0F 1IBKJ 2MU2A 4C2MA 1T9WA 1U09A 3LP1B 1MMNA 2N7CA 4FM0A 3DDHA 1FRMA 2M3DA 3SV3A 2QC3A 2IIRA 1N48A 4EYHB 5JS2A 2CADA 3G6VA 3AEVA 3SMSA 2EDUA 3WC0A 4A8SA 4NM2A 1RACB 4GC6A 3W2VB 2YH1A 5A0LA 2HFUA 3OYLA 3LF0A 1VQLS 1Y7PA 8ICRA 2W2OP 3M32B 1S59A 4O3RA 2HQ3A 1BPYA 3CDAA 1BPEA 3MGVA 2KZMA 1T9YA 4RQ5A 3SAGA 4DR7J 1VOMA 3BSCA 5F41A 4CRXA 4DG1A 1ZTTA 1SL2A 1VSFA 3ZETA 1RUSA 1JCFA 2XMTA 8ICGA 2JLFA 1QLNA 2W9BB 1H98A 1REGX 4FOIA 4CW7B 5B0CA 5D4LA 3NNHA 1RTHB 5FDLA 2BKEA 4AFFA 4CFAA 3WX4A 1DTTB 3CP8A 5KFTA 5EU7A 5AKYA 5EY4A 1S72N 3MM5B 2WFAA 1FDDA 1QAYA 1R0CB 1U0SA 2HS4A 2AZ1A 4FK2A 3N7SC 2OO4A 3HRGA 4DO9A 1UFLA 4WP8A 1C1CB 3IUCA 5AJ3F 5F2RA 5JVHQ 1CS4B 1HMVB 2A6OA 1KS2A 3MR2A 4BX9C 3HSJA 2DO4A 1HI0P 3MBYA 2ZJAA 2L08A 2VYPA 3ZSRA 3NH0A 1SUQA 4B3OB 3CYMA 1TU0B 4OYPA 4ALZA 2MZSA 4PHDA 3IP4B 4ZP9A 2L9NA 1X6JA 2PDAA 3PIOQ 5M1NA 2C2ZB 2KSOA 1XHXA 2ODGA 4Z0UA 1TKZA 3I33A 1COOA 3H2UB 3QICA 5BYQA 2VKZG 3UR0A 3CT9A 4TURA 3IBCB 1PO6A 3F41A 1DEJA 2OZSA 2CPXA 3O5BA 2IJFA 1S5JA 2K60A 2WB1C 1NZPA 4JV5J 3WNFA 5AKZA 3H46O 5JMVA 4U95A 3T6BA 3DGPA 2E8MA 2H5JB 5J2HA 3AVKA 4ZS6A 2UU9F 1GTHA 2VC1A 1XC9A 5DMRA 4DR7K 3WIUA 3K2YA 2QKQA 3CCJS 5E3RA 2CQCA 1ZQYA 4NLBA 5C42A 3K58A 4BC9A 3AA8A 4YMMA 2RD5C 4YOUA 5M1OA 2VCPA 3DJCA 3B8HA 3UNYA 5TZVA 2KQ2A 4LMZA 3PKYA 3G8QA 1Y64A 2ZUCA 1NHVA 2P6TA 2WRMA 2AEJA 3PJXA 3V1RA 4X4QA 3N5FA 4FKYA 5KFCA 5AKKA 3MFIA 4KH4A 2MQLA 1F0XA 3H8YA 3J81U 4Y34A 2EFQA 1KSPA 1U2VA 4DR5F 2OUGA 2JZBB 8ICXA 5RUBA 3PZPA 2E1FA 2WOMB 1KLMB 3BO4A 1TYQB 2APOA 1F5CA 2YWGA 2FC8A 5LMNF 1WELA 1VC5A 8ICVA 1M5KC 2XHBA 2QKKA 4J91A 4U67L 4I2DA 1N5QA 4DTNA 5JVGQ 1PC5A 2OZMA 1G1XA 1U48A 3QIPA 1XC3A 1B64A 1RBRA 2LI6A 4OX9J 2J0XA 9ICWA 4NZ6A 2L41A 3TX0A 3QSYB 2Q97A 2WFBA 4HI2A 2ROGA 1C1BA 1KC8T 4ED8A 4HDGA 3KK3A 2HOQA 1E6YB 3G8SA 4H4KA 1JLEA 3M32A 4C98A 1RT5A 2FY1A 4KHPK 3H1QA 3F73A 1ZQDA 1IKXA 3AVAA 4IRCA 3RGIA 1X4CA 1DGJA 1N5VA 4TXSA 1QDUB 1RTIB 2HBLA 4BDPA 2Z1IA 5DDQC 1Q3VA 4ZDNA 1CC8A 2JLEA 1RT2B 5E33A 1DT9A 4CHQA 8ICFA 2HHXA 1Z25A 2XLKA 3MXHP 5GAGI 4AILC 1YRTA 1VQKN 1HBNA 1HQUA 1OY9A 2YQEA 5ETRA 3OSPA 2EKYA 1YZ7A 5DO2A 3Q23A 2E5GA 2B8PA 1SC3B 1X4BA 3QYPA 4NXZA 5AFUH 1AQ6A 2M0NA 5A8KB 3OPXA 2AEMA 3QJLA 1RZTA 2HQCA 1NSAA 2QB0B 4OKJA 2SXLA 1U2FA 3AB2B 3L4IA 2K7JA 2JH7A 5D0RA 1N5WA 3AVHA 2M52A 2VFRA 2ASMA 1BDGA 3AAWB 1R89A 4WFNQ 2IVFB 3U4LA 3T1HJ 2HOIA 1Q8LA 1NSKL 3SMZA 2OIHA 3JS9A 1YLXA 1JB0C 2CJQA 4OYAA 3POTA 3BJYA 2M5YA 4KHYA 3BGFA 3NCRA 1LW0A 5FPNA 2N4DA 5E84A 3DC2A 2GHVC 4Q2LA 2XS7A 3NWRA 4L75A 3FFIB 3ISND 7ICNA 4QCLA 4PL7A 4XPCA 2W9CA 1O5JA 1JALA 4EZ6A 1T9TA 2G0JA 2D9OA 2LXIA 3A12A 4FWRA 4J9NA 1ZQWA 3L95X 3D2FB 1Q78A 4X66F 2XY8A 2J7KA 2I7PA 2Q66A 2FF6A 3U3YA 3MABA 1KAYA 3DRRB 2KSOB 2CXYA 5AKIA 4KN7A 3BEGB 3DXSX 3CI5A 3MM8B 2QA4N 4ZLLA 1LWEA 1TK0A 2P5OA 4G9ZA 2OGUA 2EC0A 3RJJA 3FZMA 4YNQA 1S77D 2I5JA 4AE5A 3KYLA 4QZDA 4QS7A 2K4IA 5HATA 1U26A 3ENAA 3J80Y 2BRKA 1CJTA 1ASVA 4CGIA 9ICSA 2WBRA 3L0QA 3SJJA 4NLOA 2CZVC 2Y0BB 5ALGA 4ZVRB 3Q0AA 1RDCA 5I42A 1YJTA 4XAKA 1FFVA 4QIWF 1X5OA 3LP0B 4L3QA 3PRVA 1RYUA 4DTXA 4JYAJ 1S5ZA 1UEUA 4DV3K 4Y6IA 4F67A 5JS1A 4FWOA 4JD2B 4AXJA 5T41A 1OVQA 4Y65A 5EX5A 4MKAA 2ZH8A 4GKJJ 5IT9O 3QSIA 1A5XA 2VQEF 3KWMA 1DZ5A 3DLKB 4BE0A 2HHSA 9ICMA 2FHJA 4XDCA 1S9EA 2HZVA 3EM1A 4G1QB 1LWCA 4Z4CA 3NHGA 2I5HA 5IFMA 1M90T 2ATQA 2E29A 5AQYA 2M9NA 1BQMB 2AP6A 1VSEA 4RBUA 2YWEA 4LR7A 5J8YC 5AQIA 1BLUA 1VQ6S 3G0ZA 4QW9A 2W8KA 3ZNUA 1Z4UA 1R8HA 1FKOA 3VR1A 4I2GA 1WEXA 1TV9A 1G4CA 3JSRA 4JNEA 3G96A 2NRTA 4DCPB 2CZ9A 3B0XA 2OI2A 1JCEA 1NDLA 2MKIA 4FJKA 1CI4A 2IRXA 3N28A 1ZM9A 2HBQB 4OHZA 2V8VA 1Z00B 3J8AA 2PI4A 2GIFA 4YOXA 4F3OA 2XNRA 4R63A 1CJUB 2PMZF 3A3NB 2DR5A 3AU6A 1EKSA 3ZZUA 4Y00A 4ER8A 4OIXA 2R7OA 2HLTA 1UVNA 3J7YI 5I9EB 4DR2F 1XS9D 3HK2A 4KHPJ 4WYWA 3IDWA 2F63A 4OX7A 2RJZA 2FBXA 2DRAA 1S6PB 2J9DE 2QKBA 2DR8A 4KGMA 1HRHA 2H9ZA 2IAJA 3OJUA 4LRAA 3US5A 2KHQA 2BM1A 3MN5A 2H48B 5C12A 4CZKA 5D6GA 3ELHA 3RTVA 2MGZB 3FQKA 4DR6J 4QZHA 1RSCA 3A3PB 2HOEA 1GX6A 3TOQA 1P8GA 4C8YA 4CGFA 3L4BC 3HD2A 3VA0A 4JLHA 4DV1J 4XH4A 1EQ0A 9ICKA 2A2CA 3I31A 2NRWA 1EZZB 5A6WA 1ZBIA 2NNWA 1KEJA 1JLBA 2F9DA 3GIJA 3GFXA 1ZS6A 3SBTA 4WFAQ 2W11A 3CQYA 1HYVA 2K06A 1WF2A 4KI4A 1P7DA 4UAUA 4B9VA 3CCRS 5AQOA 3T1YF 2P9LA 4DL4A 5AM2A 2B7CB 2KTQA 3MWPA 3ED5A 4ZMMA 4R79A 3NGZA 2ZXIA 3T69A 3VGLA 6FD1A 1G7CB 2ALYB 5K5MA 3CJ7A 1E4GT 4US8A 5HBMA 2EAOA 2ZZNA 4LFAK 5AZJB 1Q5VA 4ICAA 3KFUF 2XCAA 1XK8A 1SIWB 2EFPA 4TYBA 4GC7A 5AK4A 5ALUA 2VQFK 2KJ8A 2D1KA 2I0XA 2AHOB 7ICOA 3OL8A 3BGRB 4LZDA 1QUVA 4HT5A 2PY5A 3VAIA 2A3ZA 4LF8F 4PWDA 1YIJS 3WK8A 2A18A 1WWVA 2HQGA 2KJVA 3E3XA 1DQ8A 4PXDA 3GMGA 4CJKA 3HWTA 3BQ0A 4RBVA 5KFRA 1F9EB 1HNZK 5ALHA 2IMWP 2VU5A 4F5RA 2RE2A 3PSTA 4JS4A 3F2CA 3OT9A 5M1KA 2FSKA 2F44A 2QG9B 2AYGA 5AIBA 4HH1A 1S0MA 4OJ1A 4CZLA 1NK4A 4FYXB 1SJRA 1NHUA 1T05B 4ZPBA 5EUHA 1NDCA 1TQLA 1L7PA 4LF7F 1FEHA 3N4QA 2WW4A 2V7ZA 2ZVSA 4OPHA 4WQ5A 4DR6K 4CVNE 3B0YA 2VD3A 2F4VF 3S3OA 7ICFA 4GRSA 2IRUA 2YV0X 1N5XA 2FLOA 3WXKA 4KRFA 1ZA2B 2IDLA 5D3GA 4LF8J 4O3NA 2J6TA 1HNIA 1OS5A 2NRVA 2BJEA 1L7OA 3HHEA 4KPCA 5AQSA 2O8DB 1KKXA 2MKJA 4WQ5C 2D8CA 5J2CA 1NGHA 1VSHA 1ELOA 4KLOA 3V6DB 2QWPA 1D5AA 2G2OA 4I9LA 4OFZA 2CPYA 3QEXA 3HILA 4B3MK 1BPZA 4CM2A 5CWRA 2QV6A 1X9MA 4RU2A 2KVIA 4M5DB 1NZ8A 2DNMA 3E58A 1XSNA 3C95A 5HHHA 4X65J 2XG8A 3QU7A 4H0OA 2UVWA 4EELA 3KKRA 4BGBA 3T1YJ 3FSIA 2GLEA 4WJBA 3UKRA 2OYYA 9ICAA 3LPTA 4CHOA 1FNOA 3SPYA 3LZJA 1K8KB 4F5QA 1HJOA 2ZH5A 1WOQA 1SB3C 2DH9A 4AYBF 5J2PA 1FXDA 5IXUA 5AM3A 3KLGB 4LQ3A 4B3MF 3C6UB 4TUPA 1LQ9A 2YKAA 2LSNA 3LYSA 1KFTA 3ZTRA 5DQIA 1JLQB 4WYBA 3BQTA 5ELZA 4ZCIA 3D6MB 5IS2A 1MN7A 3ID8A 2F1JA 1RBLA 2ZDPA 2MLYA 4UOHA 1X5PA 3LDSA 4ATNA 1XNRK 4BXOB 3DOLA 2PA8D 3CWJA 5JVHL 3BR8A 4Y3CA 1EARA 4TU8A 2GMJA 4DUYK 1Q86O 5B5EU 1T11A 4CJRA 3QFHA 3KMQA 3AD7C 3W8PA 3A1YG 3ZC4A 1BPBA 2E5HA 3MEDB 5C5JA 2NUHA 2ASPA 5BRFA 2KN4A 3ONNA 5EN1A 4Y0FA 2JGUA 3AJ2A 2MYFA 2DGVA 3D2NA 2P9NB 3DLGA 3NF9A 7ICEA 4LFAF 1QVGM 2BOAA 4X4VA 3NF6A 4L8RB 2LDYA 1ROFA 3M8ZA 1A77A 1K1QA 2X1BA 4ZOHC 1RTHA 3U7JA 1LAWA 3MEGB 4KLDA 4CI0B 1U24A 1FKOB 4EK2A 3ISCA 1DHMA 5LXRA 5BOLA 1JL1A 1GLEG 2KT2A 4FLTA 4OJGA 3O9QA 4MAKA 1X3NA 3ZZYA 4LF2A 1HKBA 1U0HA 1PZNA 4DV4F 2EFOA 1NUEA 4URQU 5AQKA 4DV6J 4MDAA 2XHWA 1N36K 4CIOA 2P9IB 4XRHA 1KOOA 1TL4A 4Y2XA 1IO2A 3WEEB 3VQDA 5IV3A 3UMBA 2X3DA 3C6TB 3GR0A 3V6JA 1SV5B 2W2PP 3MUVP 5ETPA 3M8QB 3O8WA 4DPYA 2RE1A 3ZX3A 3VVUA 2UXDJ 3NS5A 3TAEA 4DHYA 2Q1NA 2VQEJ 3LDPA 3K5NA 1ZD5A 1HMVA 2IVMA 1YQHA 1VQ7S 3F5TA 4V19S 1RISA 3G4SS 3FLCO 4TN2A 3LTOA 1QD1A 4ECRA 1DQ9A 3EE3A 2ZBPA 3LP3A 4ED3A 3M9NB 1PVQA 1T3NA 2RNEA 3LH2S 2KL8A 3I56S 5FROA 1SUQB 3VETA 3G6ES 3A5LC 1FX4A 4JKHA 3RMBA 4OLPA 1JXLA 2Q36A 2ITGA 1JJCB 1CS4A 3P45B 3RMCA 4FYVB 2A1JB 4CH7A 2GVDB 3AXKA 4YB1P 5E3AA 4TUSA 2Y0SC 3LO3A 4NM1A 3MPVA 1CLQA 1A6SA 3WNHA 3WC2A 2R2SA 1IG9A 3OUYB 3GIRA 1VQ4N 2W4DA 3NS7B 4ES1A 3VQSA 2X1FA 3TSPA 2BBEA 5CCLA 2DRDA 2GJIA 1NWKA 5IV4A 3M2UB 1VJQA 4IL6U 4XK8C 4I2EA 1HWJA 1RZMA 4MMOA 2OH2A 1EX8A 2DR7A 2KRRA 1KCFA 4DX8H 1NHKL 4GKKK 1FO4A 4KGVB 2GO7A 4NWBA 1NJZA 3LAMA 2K4EA 1N34J 2FBYA 2ZIUB 4FZYA 1NKEA 1YDLA 4W4MA 1Z2ZA 2LQJA 3ILIA 5F8GA 5KRSA 3IRUA 3KOOA 3J7AN 4E7LA 5AE1A 3GJSB 3HJFA 3AO2A 4IQXA 4PXBA 1BQNA 4CLFA 4N76A 1H72C 4CGDA 1VRTB 3Q86A 4P71A 4X62K 2ZBIA 5AJ3K 1KLMA 5ETSA 3ZTQA 2WC9A 4IG0A 3UPFA 3MR3A 4DHVA 5J0OA 4Q8FA 2B56A 3K5MA 4YDDB 1OH8A 1RLCL 1IM4A 3MK6A 3VEVA 3M2VA 4BWJA 1ZTWA 1X5TA 3C23A 4UTGA 2OYQA 4M95A 3IHQB 1KL9A 1Q79A 3HHNB 1E3MA 2U1AA 4Y2RA 4KR0B 2WOMA 2F8SA 3VHQA 5AK3A 2XMVA 2E6MA 3ENOA 4UT4A 3VQTA 4WKRA 3G87A 4K4WA 1M1HA 3IWXA 4ZITA 3HMJG 4PZVA 4NXNF 4F04B 5AKLA 4DXLA 1JKHA 4BWMA 4F8RA 8ICJA 3VC8A 2AGQA 2AMCB 4KV8A 3PYDA 5LMNK 1Q4RA 2XMMA 2DY9A 4UZBA 2KKHA 1KQSM 1NOYA 1R6VA 3DOLB 5J2PB 2CQDA 2IOHA 1YBAA 4RW6A 4O8KA 3GBTA 4LR9A 3ICLA 4OHYA 4HAIA 1S0NA 4Y2KA 2ZIVB 5IIIA 3VERA 4P4OA 1UW9A 4M3XA 8ICAA 2V4JB 4MFCA 2BCUA 4C48A 4CEFA 1JK9B 4TSXA 3N6NA 3NVMA 4M9NA 1S12A 4ANDA 5GMDA 4PUOB 4WFNL 3DRXA 1EWRA 2QL9B 2UUWA 5ALKA 5AXNA 2IA6A 2JMGA 5K8NA 4BR9A 3MF5A 5EWFA 5EE0A 3IBFB 1U1RA 4F4WA 3W5XA 2NLXA 4KKOB 3MOZA 2B21A 2DGOA 3GG4A 9ICRA 5DKWA 3G2XA 2IYGA 2BJ1A 3CIMA 3D0PA 4K25A 1ATSA 1J53A 3HPOA 2BPGA 2RN2A 1HQUB 3CCWA 1UAWA 1BWEA 3BSOA 4DPWA 1VGYA 1BPXA 3ZDCA 3S6EA 2Q0RA 4FL9A 2QO3A 5A2QU 2D0CA 2WB1F 3R6GB 3WBZA 1ZQRA 3NGKA 1JJHA 2HRYA 4QJFB 3L2VA 3QU2A 5ALEA 1FVQA 4WBFA 4JI7F 1Q9YA 3MZIA 4WE1A 3W2WA 5DM6L 2EFGA 1GOCA 2W9CB 3ATUA 3R7NB 3KK2A 2Z58B 3DYAA 5THWA 1ZH5A 1MC8A 2FE9A 4NASA 3CC2S 1RCXB 2MHEA 4J9UE 4PL8A 3TPQA 2ZOFA 3W8GA 1LW0B 4KH5A 1CULB 3CB4A 1P1LA 2EZZA 1WSEA 5JTIA 3DLJA 3PW0A 1B43A 1S10A 1ZYQA 3P49B 5I3QA 3FEXB 1RHQB 2DYAA 3E0FA 2HBZB 3BGLA 3MR6A 4FXWA 4DR1F 2FPMA 3N79A 1FWLA 2EG1A 3D6FB 5JICA 2DTUA 4FWLA 5J2QB 4I2JA 3TVYA 4NPOA 1J5EJ 3HOSA 1NLKL 3FEZA 4KX5A 3M6UA 3H0PA 1LCUA 4FW1A 4WXOA 4KITB 1ZPWX 3MECA 5TISU 4YXJA 2ZM6K 2VFTA 2KT3A 1R27B 4QYZK 1M5HA 4OGCA 4LVNP 4RPZA 3TUIC 4JD2A 3NS6A 5AI6A 4FSVA 3I56N 2VA8A 2YQ3A 3MURP 3BZCA 4CFCA 1JUDA 4CZJA 3SUNA 2FMSA 3CDWA 1S6QA 1YI2N 1G2EA 1A5VA 4Z6FA 4NLKA 4GKKJ 3AAPA 2FBTA 5HQ8A 1XMOF 3MTKA 3AGKA 3JTPA 4BRFA 3JPQA 3M2VB 3AH6A 2E8AA 3M2UA 4F2RA 4MHVA 4CD3A 3QFWA 1MWMA 3O08A 3LK9A 1OO0B 3DLLL 4LFCK 4DKWA 1SKRA 2ISOA 4F50A 4M0AA 2QZ8A 2OAUA 5AJ3J 9ICVA 3W9IA 3P5BP 2VWBA 2XMKA 1ZQ1C 3LPUA 2YHYA 4EO8A 1JJ4A 2OLWA 2V69A 4A57A 1JKHB 4BRMA 4IFYA 3X1LB 5HMXA 1N32K 5J0TA 3VMFB 1UQVA 1V9OA 4R5PA 3J7YP 4DLEA 1K44A 2LYAA 3EGWB 2CPRA 4DMZA 1HNWJ 3AQPA 2LLZA 1VBXA 1S49A 2Z2MA 2DNPA 3R9LA 4X4SA 2Q1LA 4W5TA 3PO5A 4I6WA 1Y5NB 4WIIA 2QMWA 3KKAA 2YX6A 1VMBA 4IOAL 1KVIA 4NMXA 4C4SA 1APSA 3LA0A 3ILJA 4FPIA 3SSSA 1TMMA 4CJEA 4PUOA 1VDVA 3HVTB 1TR0A 4DU3A 4JI6F 1WOSA 3V4IB 4DOAA 3CG7A 2AZ3A 3TAFA 5KG4A 4OD0A 2NYIA 2YKNB 4GV9A 1DRGA 2VHGA 2VDIA 3P96A 1T3OA 1S9GB 4AL5A 3ZZRA 1AW0A 3PSFA 3KDOA 5EOZA 3QEBZ 4CEZA 4EBDA 4X64J 4JI1K 1VLYA 4DFMA 3Q89A 1TGOA 1VDHA 1I39A 3LWMA 2LKZA 4ECQA 2BZ2A 5I3PA 1X4EA 3F53A 2F1IA 4RNOA 2KI2A 2ZQBA 2MGZA 1B0VA 4MKVA 1V97A 3NVZA 4WZQA 1ZBSA 2ZJRL 3DXKB 4DTUA 4M3RA 4F93B 3ULEB 3DYAB 4RQ1A 1JJ2M 1ASUA 2DNOA 2JX2A 4IDHA 5ALMA 4C7YA 1HKCA 3UD4P 3VESA 5KOXA 3V9WA 3GPAA 1K9MO 3THYA 1K6YA 1NLVA 5HLFA 4PPZA 2BW7A 1YVUA 1UZDA 4KFBB 2AP1A 2FPLA 1M5OC 3NNCA 2QIFA 3PACA 3MWBA 3OVSA 3ADAC 1Q81T 5DZ6A 3ULDA 4RJVA 1YK9A 4AXIA 4TU7A 5CXTA 1UCVA 2LQ9A 4KGZB 3CMQA 3KBBA 1HWIA 4PG5A 2BUPA 1NAQA 4WFZA 2COLA 2I1RA 5AQWA 1DARA 5H1SV 1VQMS 3ETLA 4RO0A 4Q44A 3FGUA 5J0SA 1T03B 4LF9J 5DBAA 2R9LA 1F3VA 1WI8A 4GV6A 3DKDA 3BBCA 5C15A 4KB0A 2FJBB 2DH7A 2BQRA 5C2GA 2E1EA 2MLXA 1DTQB 3BKUA 4LSLB 3WXMB 3VGKA 4GVBA 3Q2SC 1IKVA 3HPGA 1HQEA 3HKZF 4WFBL 2VG6B 4C0ZA 3VGTA 4LF4J 1BIUA 5DLGA 2CNOB 1U1QA 4WP3A 1OSCA 3UXPA 1VSIA 3GZ7A 3U26A 1CULA 3Q8PB 1J54A 1E6VA 4RW9B 2VPZB 3SXLA 1WTBA 4PGXA 2XSFA 2MY7A 1KOHA 3P1GA 4RWTA 4USMA 1XO0A 1K8AO 3P38A 3T9NA 3UKRB 3I55S 4JV1A 2EG2A 3VAJA 5C2FA 1U4BA 2JZBA 4BXOA 2RQMA 3JPPA 3OR1A 3LDNA 1MQ3A 4ZH4A 2V2ZA 3CEDA 4L76A 5LMUJ 3OGUA 1F0MA 2W7PA 1URNA 4FJNA 2FJWA 2OD6A 3PTWA 1N4LA 2JFDA 3E1YA 4K4IA 4M94A 2FSJA 4C23A 4HTLA 1CXUA 1H3DA 1KHWA 2BKPA 4RLEA 1GOBA 1ATNA 2QARB 4ECSA 4FLYA 2GAGC 3NVYA 1SZ2A 2VB6A 3C5GA 1T8EA 1EETA 4B8AB 4ZK7M 4DU7A 3L8BA 3TKAA 4HHTA 1RA7A 3UDVA 4MFAA 1F5AA 2FGOA 4JBCA 4Q0BB 4TKTA 4DQSA 3THXB 4CF3A 5HVGA 2UUCJ 3T41A 3IV6A 2I2YA 1GLAG 3FZ2A 2K1RB 2F7TA 2CVEA 3HFZB 2HWIA 4MT1A 2NV3A 1R0AB 2CJXB 3MDCA 4DFKA 3K17A 4CEDA 5IM0B 3OTOK 2H3FA 1SI9A 3V9SA 4QIGA 2ZEJA 4G9BA 5E0OA 3ZX0A 1Y10A 5AICA 1P6TA 2KM8B 4CLUA 5HANA 2ZJRQ 4EBEA 4WF9Q 3H8WA 5AI9A 3QINA 2PMZC 2MDAA 3FC4A 4IOXA 3UD5A 3OR2B 1TFWA 3I0SB 2JHDA 5JJBA 3QAEA 1RWMB 5C2DA 3MEGA