3PV8A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddttp-da in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3pv8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3pv8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pv8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3pv8A01
2JEFA 1TAUA 1UOCA 4MFBA 5DQHA 2PI4A 3K5NA 3EPGA 3CM6A 3SQ1A 4YG2A 4ICLA 4CEQA 2BGGA 4ZHRA 1CXQA 2MUTA 1N48A 4BXOA 4OJRA 2LYHA 4CFBA 4KHUA 4CEFA 4M9NA 1VRTA 3H8SA 4ECXA 1X9WA 4M3YA 4J2DA 3OHAA 1KLMA 2QKKA 4IRCA 4QW9A 3RH6A 2Y1IA 4OKEA 2ITGA 4LVSA 1QQCA 4CECA 4YFUA 4W5OA 1BISA 3O4NA 8ICZA 3TFSA 2JEJA 3VQDA 4UAZA 1S9EA 3LWLA 3C2KA 7ICJA 2XC9A 1C6VA 5J29A 4KREA 4DQQA 5KT4A 4EYIB 4W5TA 3AU6A 3TANA 2MUTB 4BXOB 1NK9A 1LV5A 4E89A 4OPKA 4NM2A 1CXUA 4MFCA 4RQ8A 2F96A 3NGIA 1NOMA 8ICKA 2J6UA 3HL8A 4FJ5A 4QZAA 4TSXA 3HVRA 9ICBA 2AGPA 2XY8A 2ASJA 3ZSYA 1NKCA 3OJUA 3HO1A 4PGQA 2BHNA 4NXZA 3MEDA 3RBEA 3LZIA 4C8LA 2E6MA 2IHNA 2I1QA 3PVXA 3U3YA 3M8SA 1IKVA 4KLEA 1ZQBA 4KLGA 3NF6A 4DWIA 4DOAA 2KN7A 4CEBA 4CHQA 4FK4A 3B6OA 4R64A 1BQNA 4CJLA 3S3MA 4DSLA 4CERA 4B9NA 8ICTA 3AVAA 1Y97A 3C5FA 4UB3A 3SZ2A 1ASVA 4QZHA 1QE1A 3JPPA 1TV6A 4ECQA 1KEJA 1HUZA 3VQPA 3V7LA 2I9GA 4I2BA 3KHGA 8ICLA 3UIQA 3OSNA 3OYIA 3QINA 9ICWA 4ECSA 5CYMA 1XSNA 1MU2A 3RWUA 4CK3A 3LK9A 4MEYA 1BPYA 4CGDA 1L3TA 3KLIA 1JL2A 2BPCA 3TR8A 4KTWA 5KRTA 1BI4A 4DL7A 1WSGA 3NBPA 3OJSA 3RMBA 5KFUA 4ECYA 7ICHA 4E3SA 2AQ0A 2IMWP 5FRMA 4NLGA 4O3RA 3JPOA 1CUKA 1TVRA 3RB0A 2VG5A 1NK6A 1BPEA 4YCXA 4DL4A 4CEAA 4K4GA 3MEGA 3GIIA 1HQUA 2RN2A 4YR0A 4DSJA 4KHWA 4OVLA 2X74A 5DGAA 1RT1A 3OS0A 4IRKA 1T8EA 2PYJA 3JPSA 4QOZB 1BI4B 1QHTA 9ICPA 4O55A 1RBTA 2FBTA 3QEIA 4P4MA 5KT2A 4M3UA 4J9QA 5KT7A 4EZ9A 3ZDCA 3SUNA 3LP0A 4QAGA 2R7YA 4O3SA 8ICSA 3UPQA 8ICYA 3O4QA 4B9LA 1LW0A 3CYMA 4FJJA 1RT4A 3ZSVA 3B0YA 1ASWA 3WNHA 4CHYA 1T3NA 2VWKA 1VSKA 8ICGA 3FFIA 4FJXA 3I0RA 1ZYQA 4JV0A 2FLLA 3ITHA 4P4OA 1AROP 5EWFA 3AO3A 4KLQA 4CJKA 3LDSA 3NF8A 4UBCA 4AILC 7ICFA 1BHLA 3BJYA 1HNVA 3ZDDA 4FJGA 4OLAA 5J0PA 1S0MA 4FLXA 2Z1IA 3SUQA 4KLDA 2DFEA 3EZ5A 5CY4A 3K4GA 3PMLA 5IIOA 1WSFA 1RZTA 4RW8A 1WNSA 3QEXA 8ICQA 3FYHA 5DG9A 1HUOA 4PPXA 2XY7A 1EETA 4F5PA 1XS9D 8ICXA 3AO2A 1J5OA 5CP2A 2IA6A 4CGGA 7ICLA 2W9CA 2BR0A 4UAYA 1D9DA 9ICOA 5J2HA 5DDMA 2ZJ5A 5HMMA 4J9SA 4KFBA 4Z4CA 1VSLA 4Q5VA 3K2PA 4TQSA 1BL3A 1RTDA 2JZBA 3Q8KA 2P1JA 4CFCA 5IILA 2DTUA 5KT6A 1B9FA 1RDAA 1SL2A 1WAJA 3E2EA 3LP3A 1S6PA 4IR9A 5KTQA 3OYNA 4QWBA 5EWEA 4UB4A 7ICEA 3UXPA 5EU7A 4AHRA 2W9CB 3JSMA 1ZQIA 4BDPA 2NRWA 2HHUA 4UQGA 4CJQA 4K4IA 1S1UA 3VQ9A 1KVAA 1HYSA 3LDAA 2FLNA 2PYLA 3MXJA 1S9GA 4GXKA 1LWCA 3WNFA 8ICVA 3N4MB 1DTTA 2IS3A 3S3NA 2C2RA 3EPIA 2B6AA 4NLZA 2D5RA 4DU1A 4DU3A 2JZBB 1C1BA 8ICWA 1QTMA 9ICHA 2VA3A 2H5XA 4WE1A 2P51A 1JXLA 3ZT0A 4K8ZA 3NGYA 1TKTA 1HPZA 4CEDA 1X9MA 1N5YA 4JK1A 1KRPA 2A1SA 4RPXA 1YTUA 3TAQA 2P5GA 2KFNA 2IGIA 1B43A 1HJPA 4DFKA 3CFPA 4TURA 1JLEA 2HW3A 2ALZA 3G0ZA 3GQCA 4I7FA 4F5OA 4GC6A 1Q8IA 3H08A 2OZMA 5KFYA 3JYTA 5KGXA 2PZSA 1EX4A 3CG7A 1SKWA 3OY9A 4M47A 3V9ZA 5KGWA 4KITB 4IDKA 5TZVA 2WOMA 3ZDBA 1ZQPA 1WSHA 1YVUA 1RDBA 2OPPA 3OGUA 3SCXA 4PHPA 4FLWA 5KFPA 2YNIA 5D3GA 3H4BA 3PW0A 4FCYA 9ICXA 4KI6A 2I5JA 8ICEA 2B21A 5DBBA 4OLBA 3QO9A 4CCHA 9ICJA 3DRSA 4PH5A 1NJYA 2ISPA 3CM5A 1ZQVA 5DB8A 4KLLA 4M3RA 1CZBA 3QEBZ 5KFXA 4KLHA 3DOLA 5KFGA 3RRGA 1S0VA 3OYAA 3TFRA 4W5QA 4KN4A 1BPBA 1COOA 3NE6A 5J2CA 1UAXA 4DS4A 4LSNA 3UXOA 4FVMA 1U04A 4JRQA 2ZQBA 4N5SA 4B9SA 3RMAA 4DQIA 3OSPA 4ECRA 4M3TA 4CFAA 4MEXA 3P83D 1TAQA 4RQ1A 1WSJA 1BPXA 3SI6A 2G8HA 1EP4A 4FK2A 5J0OA 2UVWA 3AO1A 1GOAA 4RPYA 1A5WA 1FK9A 3M9MB 4BE2A 1EXNA 4DTPA 3ISBA 1MQ3A 3MFIA 3AVCA 1B92A 9ICFA 3PMNA 1RBUA 5F9NA 4I28A 3MR5A 3BDPA 5KG7A 3OVNA 2G8FA 1XSPA 4O0JA 1TVAA 2VANA 3MFHA 2QK9A 1Y88A 4M9JA 4R5PA 4DFPA 4UAWA 4HUFA 1FXXA 2HNZA 4ZTFA 1RBRA 2B5JA 1ZQCA 1C0TA 3GDXA 4UB5A 1QS4A 2IOCA 4J9KA 5CJ7A 4GC7A 3TQ1A 2JGUA 4IQUA 3ZD8A 5HNKA 4FM1A 1RBVA 4FM2A 5F9LA 1O1WA 4OKJA 8ICFA 2RPIA 4F4XA 4M6WA 2NRXA 1NOYA 4J9RA 2C2DA 4Z4GA 2RDIA 4O3PA 3Q8PB 1S6QA 4XA5A 4CF9A 4HUGA 3EW9A 5J2AA 1XWLA 4RQ2A 2R8JA 3VQQA 4KLUA 4RU9A 1DTQA 2XHBA 3SPYA 4HCCA 9ICRA 4ID1A 4J9PA 4I2PA 4Y1DA 3HW8A 4DTNA 3SQ4A 2BE2A 4DEZA 1RNHA 1HYVA 5J0RA 4ED6A 4LD0A 3B0XA 1UWBA 4O5EA 1XSLA 3GV5B 2VA2A 3L2VA 4EBEA 4YXMA 1RYSA 4FK0A 4N41A 3KKSA 3NH0A 3QEVA 1TKZA 3PR4A 9ICAA 7ICNA 5KFBA 4FBUA 4M6WB 1TKXA 5KFQA 2BCQA 2OPSA 3NHGA 2OA8A 4J2AA 1JIHA 4BDZA 7ICSA 3MR3A 4CJ3A 3V7JA 3NGZA 1IKXA 4I2CA 4F4KA 4F3TA 4CJPA 3KLGA 3KK1A 7ICTA 1YTAA 3PV8A 4CJRA 4FJIA 4FJLA 3AO4A 2Y1JA 3TABA 2F1IA 3ZT2A 5SWMA 1TK8A 3C1ZA 4MQ3A 2HHQA 1WLJA 1XHXA 4LH5A 3WNGA 5IIIA 4M3XA 2E4LA 4CJFA 4F2RA 2WONA 3OYCA 3MAQA 2FLPA 5KFMA 1K1QA 8ICBA 2W8KA 4O0IA 1ZQTA 1TFRA 2AGOA 3QNOA 1GOBA 3SI8A 3V9WA 3RJIA 1PZNA 1WAFA 4RNMA 5KG2A 5DB6A 1ASUA 3PW4A 3ZSQA 1X1PA 1C1CA 3AVBA 3KHRA 2FC0A 4DSKA 3DRRA 4RPZA 1FKPA 4F92B 4FZZA 4G3IA 3QESA 1XHZA 1ZQJA 4O9MA 1T05A 4TQRA 3QZ8A 4IRDA 1RBSA 3JPTA 3I0SA 4TUQA 5IINA 7ICVA 5CR0A 4RNOA 3G6YA 1BVSA 4MFAA 7ICQA 8ICMA 3PW7A 2ATLA 3V1QA 4HHTA 2Q0ZX 3C21A 1JKHA 4E1MA 3KK2A 2KW4A 2YKMA 1SL1A 1S1WA 2IHMA 3GV7B 3LP1A 4TUPA 1JLCA 3ASMA 3RRHA 4I2GA 3AA5X 5KFJA 7ICOA 5EWGA 2RKIA 4F50A 2JEIA 4XRHA 4GXJA 3NDKA 1RTIA 3JPRA 3KIOA 4CJ4A 2A1JA 4Y1CA 1ZJNA 4JRPA 1IKWA 5T7BA 3RMDA 1T4GA 3H40A 4J9MA 4DQPA 1SL0A 4PA1A 4PHDA 4Z4IA 3AVFA 1Z3EB 3C2LA 5BOMA 4B3OA 3C94A 1J53A 3VQEA 3P5JA 3O3HA 4RUAA 1VSIA 3RMCA 2Z1GA 4PUOA 3LALA 3OYLA 1RDCA 4FM0A 1ZQOA 4EYHB 4IFVA 4KV8A 5JS2A 3MR6A 2A1JB 2PI5A 3OYFA 4HVJA 4FS1A 3V72A 2JLEA 4EP4A 3ETLA 3V1OA 2ZJ8A 2OYQA 2ASDA 4YFKA 1U47A 2YKNA 1GOCA 2ASLA 3VQ6A 1KFSA 3AVHA 2OPQA 1KLNA 4ID5A 3SJJA 1NK7A 4YMNA 4J9LA 4IKFA 2PFPA 4DU4A 3S3OA 3HPHA 1QSLA 3Q8QB 3KHHA 4CK2A 4Q45A 4UB1A 2HHXA 3ZSOA 7ICUA 3OYHA 5J0UA 3H7IA 3T3FA 4B08A 3OYMA 4QZ9A 4E1NA 2EX3A 4ED1A 4KPYA 1I39A 3BQ0A 4X5VA 2NRZA 3RJEA 3MXMA 2D0CA 2R8HA 4Q43A 1JLAA 1WN7A 4RQ3A 3GIKA 8ICJA 9ICQA 4OGEA 2YHAA 5KT5A 1BPDA 4QZGA 4JWNA 3A2FA 3VQ5A 2YV0X 3OYEA 5KG1A 4CHOA 4Z4FA 3DOKA 4N47A 5KFDA 4E7KA 3LAKA 3ZT3A 5J2MA 2BPFA 1NOZA 4B9VA 8ICHA 5KG3A 5DBCA 3LANA 1IKYA 2PY5A 5J1EA 1U45A 3MDAA 5KFEA 1U4BA 1SKSA 2KZZA 3V6JA 2ZTEA 2DPJA 5L9XA 2ZUBA 4XIUA 4CFDA 1XU4A 4CF8A 5DG8A 2DFHA 3VQ4A 3QLHA 5J0YA 4H4MA 4BDYA 3U6FA 3NTUA 3RJFA 1S1TA 3HWTA 1ZQYA 5HBMA 4J2EA 4KAZA 3HP9A 3V9XA 1LWFA 1S76D 2Z1JA 3L3VA 4E7LA 3MGIA 9ICUA 3L8BA 3V9UA 4R65A 1NK4A 5FRNA 1L5UA 4F93B 2KZ3A 4DTRA 1D5AA 4PQUA 1VSHA 4JS5A 5DK5A 1F21A 5KG0A 2NRTA 1ZQWA 1C0UA 5FROA 3K58A 3BQ2A 5J0XA 5L1KA 3VA3A 3T5KA 3JPQA 1ZQNA 3RH4A 3EY1A 1SUQA 4DG1A 4CGHA 4EBCA 4E19A 4I2AA 1QSYA 3GV8B 3ULDA 2F1HA 3SV4A 4ELVA 2P6UA 7ICKA 1KVBA 4C8MA 4Z6FA 3CQ8A 2W9AA 5JS1A 5IIKA 4M04A 4K4HA 5DLFA 3VQBA 4H8KA 2W9BA 4F5RA 2IBKA 1IM4A 4F5QA 3AVIA 4CEOA 5KI6A 3QNNA 1ZQMA 4KLIA 3M8RA 1MQ2A 3IS9A 9ICIA 3UQ2A 5L1JA 5CWRA 5CB1A 4CJ5A 1QLNA 3ORYA 2KTQA 5J2EA 4KLJA 3SPZA 4G1QA 3KKRA 1TGOA 1KCFA 4HYKA 3QERA 2R8GA 4IBNA 4RT2A 2IC3A 3NH2A 4NYFA 1RXVA 1JX4A 3SNNA 3KD5E 5HROA 1CLQA 3L2QA 1RTJA 1YT3A 1DGSA 4QZCA 2W9BB 3RJHA 2XCAA 4DSIA 4KHYA 3Q8RB 3TARA 1DLOA 5KFNA 5KFAA 2UVUA 3PR5B 1VSEA 3F9KA 1H38A 4ECZA 3DMJA 4BGDA 4YP3A 1HJRA 2VWJA 3T1AA 5KFKA 3TWHA 5HHHA 1MSWD 2MAXA 4O44A 4DLEA 2QKBA 2GUIA 5KFLA 5KG5A 1WSEA 4UB2A 2YNFA 5DG7A 4ZTJA 2XGQA 2DY4A 3VA0A 1S0NA 4BWJA 3H8JA 1S10A 1VSJA 5J2BA 4QZIA 5CZ2A 2G8UA 3ALYA 3CFOA 5KT3A 1Z00A 9ICSA 1J54A 4CE9A 4M9HA 4QWCA 4IG3A 2BKEA 2UVRA 2FMPA 3K75D 4CJWA 3TAMA 4KO0A 3C5GA 4YQWA 4RZRA 1TK5A 2HNDA 4FLYA 5J0TA 2C2EA 2KFZA 3HM9A 1KSPA 4F91B 2FBYA 3T5HA 2F8SA 4YVZA 4KB0A 3GIMA 4FYDA 4KTQA 3KLEA 5J2NA 1S77D 1C0MA 2ZUDA 2W8LA 4E7IA 4DO9A 1L3UA 8ICRA 1UT8A 3SYZA 3L2WA 5C24A 3C23A 3NFAA 3PW2A 2HMIA 2OZSA 4ZH4A 4O5BA 1XI1A 3RB4A 1U48A 1ZJMA 1RILA 1UA0A 3HX0A 5J0SA 3AA3A 4CJVA 1ZQDA 5IIMA 7ICIA 3S9HA 4Q8FA 4DSFA 1ZBUA 1ZQUA 4ELTA 4QWDA 3SUPA 3QEPA 1RT2A 2X6NA 3LPTA 4HUEA 4RW9A 3H4DA 3DI6A 1ZQHA 4R8UA 4Z4EA 3VQ7A 4ECWA 4RQ5A 4FZYA 3TAEA 4CGFA 3L2RA 1KFTA 1EXQA 1ZQAA 4DS5A 1N56A 4M3ZA 4CF2A 2BQ3A 4DF8A 3G10A 2F1JA 2FPMA 1LWEA 2P5OA 5KFSA 7ICPA 4XQ8A 5KFFA 3IRXA 1KVCA 3IAYA 4AHVA 1IH7A 4EEYA 5J2KA 4FJ9A 4KRFA 3TAFA 4B8CA 4E7JA 3GILA 2FBXA 2ZTCA 2B4JA 3THVA 7ICGA 5KFWA 2HHTA 4R8UB 2BCUA 4YNQA 4FZXC 2HHVA 1HQEA 2PFNA 3V9SA 2HVIA 5L1IA 3HSTB 4DTSA 3Q8SB 5HHIA 4RQ4A 3SUOA 1A76A 3MXIA 4M3WA 2XRIA 4ECUA 5KFZA 4IQVA 4RT3A 1NJXA 5J2IA 1JLQA 1KFDA 4F4WA 4YN4A 2BPGA 3V81A 4E7HA 4QZFA 3OS1A 1JXEA 5CA7A 3C95A 4CEEA 5J2FA 1LB2B 4NM1A 4YMOA 4YR3A 1Z26A 2D0AA 4I2QA 4RNNA 2X78A 4DTOA 4CJTA 2O4GA 2KZMA 4RQ6A 4C8KA 4M41A 3IM1A 2PXIA 2LSNA 4EBDA 7ICMA 4AHCA 3QIOA 5L1LA 2AU0A 4ED8A 4TUSA 2E6LA 1ITGA 2UVVA 4MF2A 4FO6A 3K5MA 4N76A 5D46A 2FPKA 5K14A 2XCPA 3AUOA 4YR2A 1NK0A 3RJGA 4KLMA 4P4PA 2G8WA 4YXJA 3PX0A 4B9TA 3HJFA 1RDDA 5HRPA 4KN7A 4BACA 2P6RA 1HNIA 2GBZA 3M9NB 3PX6A 3V6KA 4KLSA 2ZD1A 3KJVA 1ZQEA 3C6UA 1S1XA 3QIPA 4JV1A 4RW6A 4PGXA 3TAPA 3NF9A 5J2PA 3RAXA 2ZE2A 1VSMA 4RQ7A 1J9AA 4CF1A 1S9FA 2HVHA 4IQTA 3WNEA 3RBDA 1NK8A 3ZT1A 4GXIA 8ICUA 4JLHA 5I3UA 3AV9A 4QWEA 1Q9XA 4W5RA 4C8NA 4B9UA 1G15A 4NY8A 4ED3A 4ED2A 4FLVA 4LZDA 4CJSA 1VK0A 4RQ0A 4NCAA 4ED0A 3PY8A 4M9GA 5KFHA 4IFYA 4I2EA 1JLFA 4DTMA 4J9NA 4Z6EA 1W9HA 1V9PA 9ICCA 4CF0A 4B9MA 3NCIA 2P66A 4GMJB 1TV9A 1T03A 3DLBA 1LAVA 4Z6CA 5J2DA 5J2GA 3AVJA 5KFIA 4DF4A 4DQSA 3LPUA 4OGCA 3O3FA 5HLFA 2YNGA 5J2JA 3RH5A 4NYNA 4OPJA 3AVNA 5HP1A 2AQ4A 1VRUA 1JL1A 4KLFA 1UT5A 4PGYA 2ETJA 4KMUA 5IIJA 3DLKA 3MABA 4DSEA 5CYQA 9ICMA 2AJQA 1D9FA 2F8TA 3V6HA 4LH4A 3LZJA 1Z25A 4MFFA 3AVGA 4AHUA 1BQMA 3EWAA 9ICTA 4KB1A 4M9LA 1XO1A 3FDSA 1IG9A 1QSSA 3OHBA 4CHNA 3QEAZ 1D8LA 2AGQA 1T7PA 4FJ8A 3HXMA 3GIJA 5HRNA 2BCRA 2C28A 8ICNA 3E01A 2G8IA 1VSDA 1NJWA 1K6YA 3ZDEA 3T5JA 2FBVA 4F8RA 1A5VA 2XGPA 4FJ7A 2IAJA 2BCSA 4IR1A 2YHBA 2QXFA 3N97B 3UQ0A 4QW8A 1FKOA 4YMMA 2IDOA 3ZSRA 3MGHA 1ZQZA 3RR8A 3HPGA 1ZQLA 3KHLA 4MF8A 3ISNC 2FMSA 4NCGA 2M9NA 5D49A 9ICEA 4JUZA 1TKDA 3NAEA 4I2FA 4H4OA 3ZSWA 5DQIA 4ECVA 4FW1A 1DOQA 4DOBA 4CIGA 4DL5A 4O5CA 3VQAA 2VA8A 3VQCA 4RG8A 4O4GA 1RPLA 1Q9YA 1JLGA 3NGDA 4PHEA 5DB7A 4I2DA 4HTUA 1N6QA 5DKWA 1A5XA 4FS2A 1CEZA 4KTZA 4PHAA 2BQUA 4I2HA 3LAMA 5DDYA 4F3OA 3O3GA 4CJUA 4RUCA 4BWMA 3PO4A 4KLOA 4CESA 1ZQKA 2W42A 3KK3A 3LP2A 3P1GA 3MEEA 1JLBA 5E41A 3OYDA 2OPRA 8ICPA 4N56A 5KFCA 3M8PA 2G8KA 4C8OA 4I2IA 5HRSA 3KLHA 4O3OA 3OYGA 4QZ8A 3HYFA 1ZBHA 4DFMA 3MECA 2BDPA 4F4ZA 5BPCA 3CFRA 1R0AA 1RT3A 3V7KA 2HHWA 1IXRA 4M42A 3PNCA 4P2HA 4LSLA 2G8VA 4BE1A 2JEGA 4KHSA 4I9LA 2D0BA 4CGIA 3OYKA 2RF2A 4EP5A 4W5NA 2XO7A 4QWAA 1I3AA 1ZQRA 3ZCMA 3NF7A 4M45A 2FMQA 3QEWA 3L2UA 4J9OA 4LZGA 1ZBFA 4KI4A 3ISCA 2Q3SA 3RB3A 3K5LA 4Q0BA 3AVMA 4QZDA 5DB9A 3NH1A 4I2JA 3F73A 4Z6DA 2RDJA 8ICIA 5FDLA 2ZJAA 2V4RA 4OKKA 1TL1A 3BQ1A 4JV2A 8ICOA 3D0PA 1RXWA 2O4IA 8ICAA 3U3GA 7ICRA 4CHPA 4DTUA 5I42A 1CZ9A 5DQGA 3LWMA 3SQ0A 4IG0A 4LY7A 4KLTA 4GLXA 2PFOA 1SV5A 4RW4A 3T19A 1WCLA 2XY5A 3G6VA 3DLEA 3C2MA 3IHQB 4EZ6A 1KTQA 2V4QA 3C6TA 1ZQXA 2OWOA 3C1YA 4AHTA 4KKOA 3HT3A 3HP6A 4FBTA 2ATQA 2YNHA 1RT7A 2W9MA 4R66A 5EOZA 1JMSA 5C42A 1ZBIA 1TL3A 3RAQA 4CHZA 1A77A 4FLTA 3MDCA 4CGJA 3BQTA 3RTVA 1VSFA 4YD1A 9ICGA 3DRPA 4GW6A 1RCHA 4Z4HA 4CEZA 4AHSA 5KFVA 4PWDA 3MR2A 3ZT4A 4NLKA 1HMVA 3M8QA 3PX4A 5DMRA 5KG6A 3AA4A 2BCVA 4CIEA 5J0WA 2KQ2A 1ZQSA 3ZSXA 2HNYA 1L3VA 5KFTA 1W0HA 3OS2A 2DPIA 4Q44A 2ZUCA 1RT6A 4UBBA 3I8DA 3ISDA 5DBAA 3H8WA 1SZPA 1NK5A 1LAWA 3M9OB 4AH9A 4M0AA 4Q8EA 3HVTA 2WTFA 3KTQA 2R8KA 4ED7A 4JWMA 3K57A 4FLUA 3DLRA 3QETA 1HRHA 4FJNA 4F2SA 2C22A 3Q8MA 5DGBA 4K8XA 2GWSA 5HMLA 4B8AB 2DFLA 4O3NA 5J0QA 2EHGA 3AA2A 3V4IA 4CJEA 3PW5A 2Z1HA 3V1RA 3ZSZA 1BPZA 1WCNA 3RR7A 5J2QA 4I9QA 2XY6A 4FXDA 2BGWA 3AVLA 4R63A 3HK2A 1BCMA 1IO2A 4O3QA 4KHNA 3JPNA 4ELUA 4QCLA 1S0OA 3BGRA 2NRVA 1X9SA 1B9DA 3VQ8A 1C1AA 3ZD9A 3T5LA 1REVA 3G6XA 1NJZA 1C7YA 4DTXA 1KDHA 1D8YA 3K59A 4DOCA 3DYAA 4FJMA 3PUFA 3HPOA 3TI0A 1NKBA 1BIZA 4NLNA 4F4YA 5KG4A 5KFOA 1HYZA 9ICLA 8ICCA 4DTJA 3L3UA 2V9WA 3KD1E 4FLZA 3DM2A 3VN5A 4L8RB 3IG1A 3TAGA 1Z00B 3MBYA 2ISOA 3RJJA 4CK1A 4DFJA 1ZQGA 1S97A 3SV3A 4RW7A 3AVKA 4FW2A 3QZ7A 1K1SA 4DLGA 2X6SA 1ZETA 1RYRA 1TK0A 4I27A 4M2YA 9ICVA 2GV9A 2VG7A 3AO5A 3Q8LA 1LW2A 4O5KA 5KFRA 2DFFA 4PY5A 4F5NA 4QZEA 1S1VA 2HB5A 5KRSA 1EKEA 3DLHA 2FPLA 1UA1A 3QE9Y 9ICKA 3UXNA 1XC9A 3DLGA 1ZQFA 5CZ1A 5BOLA 4DL2A 4BE0A 3SQ2A 1MC8A 4XUSA 1BIUA 5HRRA 5HP4A 4E0DA 4NCBA 2R8IA 4QZBA 3GFKB 3AU2A 1BCOA 3D45A 1S5JA 1JN3A 4DQRA 4DMNA 4DL3A 2J6SA 3RJKA 5JUMA 5C25A 2A1RA 5SZTA 1X2IA 4CIFA 3V6DA 4HCBA 3EYZA 1L3SA 2VG6A 5CHGA 1RT5A 2NUBA 4JS4A 3B6PA 3KLFA 1RTHA 3K5OA 2BANA 1SKRA 1JXBA 2J6TA 1ZQQA 4GVMA 5DLGA 1B22A 4Z0UA 4I29A 4IQWA 4YD2A 4KHQA 3RB6A 4ECTA 5D4BA 4DL6A 2BQRA 3OYBA 1U9LA 2ZTDA 4FJKA 1U49A 3PO5A 9ICNA 4J2BA 1NKEA 1BGXT 2HHSA 3ZDAA 4FJHA 2PFQA 3OYJA 5C5JA 1ZBLA 1WSIA
chains in the Genus database with same CATH superfamily
2XMAA 2MQQA 4MFBA 2R7VA 3QBXA 4FOEA 4I6MB 1FERA 2Y1LB 3EPGA 3CM6A 2ZXIA 3J7ZT 2I7NA 2KJ8A 1ZBTA 2F1FA 4OHVA 5EX3A 2FHKA 1IWGA 2MUTA 4X4PA 2R7XA 2LYHA 4M9NA 1VRTA 4NASA 2RQKA 4OMFG 2KIWA 1X9WA 2YMQA 4FKYA 1OSDA 3GFXA 3OHAA 1KLMA 3CJRA 4IRCA 3RH6A 2Y1IA 2V63A 2XMUA 3CD6N 2DEIA 3B4MA 4CECA 5JMNA 5H1SQ 1FXDA 3I56N 1G3OA 1NHUA 1BISA 2BJDA 8ICZA 1ZM3A 3LL3A 5CA5A 3UR3C 4Y2YA 1X6IA 4UAZA 1S9EA 1R8HA 2YPZA 1NGIA 4ZPVR 5IXUA 3M05A 4EYIB 4W5TA 5HR6A 1RP5A 4AUKA 4UB6U 2RHSB 4BXOB 2UXBF 1WNEA 1LV5A 2GS8A 4OPKA 3CCQN 3LDNA 1CXUA 4ZLPA 3L4IA 2OEKA 1NJIO 4RQ8A 3HFZB 2CH5A 3CJ7A 4QIGA 3OTCA 1NOMA 2GMHA 2J6UA 2HMPA 4TSXA 3CD6S 3DDNA 4RWTA 9ICBA 2AGPA 2NUHA 3I56S 2OSRA 4F71A 4BC2A 1NKCA 3CCTA 3OTBA 3IDHA 3LZIA 4C8LA 2E6MA 2IHNA 2FLOA 3ZTPA 3M8SA 3KWIA 4KLGA 1A6SA 3NF6A 4DL0C 4DWIA 4DOAA 3HILA 4RW6B 4FK4A 1BQNA 2WF6A 4FWPA 3S3MA 1RK8A 3CCQS 4NLUA 4B9NA 3KOAA 3ISND 2HIQA 3AVAA 1Y97A 4HHHA 2J5AA 1HNXK 3KJQB 1OKJA 1SC6A 2KV2A 2QEXN 5AI5A 2DY1A 1QE1A 4JB3A 2FC8A 3I9ZA 4UQTA 2ROEA 4ENOA 2VDHA 2HRTA 3W63A 3OYIA 3CJKA 2HI0A 3TSPA 5CYMA 1MU2A 1K47A 1XNRK 3LK9A 5HAOA 1BPYA 4CGDA 4M5JA 1Y4ZB 3KLIA 5BRHA 1MROA 1ZPWX 3C14A 1BI4A 2OEJA 3WC0A 4DZDA 1MNEA 5ALJA 3GR1A 3SENA 4ECYA 4CZMA 2QEXS 4E3SA 2AQ0A 2MYFA 1BWEA 3TADA 4NLGA 1XMOJ 3RB0A 3IR6B 2WVDA 4QS8A 3MM6A 5AKJA 1CBKA 1HQUA 4JI6F 4YR0A 2H48B 3UD4P 3MWTA 5DM7L 4IRKA 4PKHA 1T8EA 1N88A 5BYRA 4JI8J 1WOOA 2ZVIA 2D3O1 3ZXWA 3KD3A 2GQ2A 1NMNA 4UASA 4C9DA 9ICPA 1AFIA 2FBTA 3TEGA 3QDKA 4RUBA 3VEXA 2CPEA 4J9QA 2F3JA 2MZTA 5CD4A 4NEZA 2YWEA 3T7ZA 8ICSA 2CJYB 1XIQA 5ALSA 3PYGA 1RWOB 5FPNA 4OX9F 3NP5A 1VC5A 2YWWA 1N60A 1ASWA 2A40A 3WNHA 3C0BA 3FFIA 4XH1A 2YJFA 3B54A 3D2SA 2FLLA 5K20B 2H1YA 1HNWJ 4KLQA 3NF8A 7ICFA 1RADB 4M5DA 1GTHA 1BHLA 1JI7A 1UKUA 3BJYA 3CF5Q 3ZDDA 4OLAA 2ADCA 4RKUC 3T79A 3U26A 3SUQA 4B1XB 3CC7N 1I51B 3PMLA 1RZTA 3ISZA 4RW8A 3QEXA 8ICQA 1OO0B 5DG9A 3OFEA 5ETNA 2EXUA 2DNGA 3KYLA 1VR6A 1JLGB 1XS9D 3I0RB 2GH1A 5CP2A 2IA6A 1B99A 1RHJB 4PYAA 4UAYA 2YN4A 3BM7A 5F8IA 2ZOFA 3AMZA 1HLUA 2KVSA 1TAMA 4DR5J 2YQ1A 3OR1A 4DZ6A 1VSLA 1WC3A 3K2PA 1RTDA 3W3SA 1CJTA 4CFCA 2E5LF 5KT6A 1B9FA 4U7BA 2KVCA 1WAJA 2WAQC 2DNPA 3EDRB 2RUSA 4P52A 1CPZA 5C10A 1HWLA 4AHRA 2W9CB 3WK6A 2ZJPQ 2HHUA 3ZX2A 4CJQA 2UXDF 3H6EA 2RQCA 1KVAA 1GXLA 2OSQA 2BZ2A 5GTHU 4LRCA 4ER8A 4NLYA 3J7A1 2B6AA 3IAS9 4NLZA 2WHOA 3ONQA 1N32K 2BKOA 4OX9K 1QTMA 2UUAJ 2EWSA 1T9UA 3K8VA 3GE9A 3ICXA 3NGYA 5TKYA 2DBBA 1HPZA 3UKRB 4JMUA 3PTWA 3DC2A 2EK1A 1S1UB 3TP2A 1FVQA 2A1SA 3OTOJ 1HYSB 3HFVA 3GYNA 1OXJA 4LQ9A 2GZOA 2DGOA 5B0FA 4DPXA 2VQFJ 2EAOA 3CCVS 4AM6A 1B43A 1SZHA 1FTRA 4K7QA 3D2NA 4I1TA 2PAVA 2IYGA 4I7FA 4BVOA 1PJ6A 2E1EA 2KT5A 4WE1B 4KH6A 5JVGL 3QRQA 3LW5C 4HH0A 5KGWA 4JI0J 1ZQPA 5DDPC 1N5YB 3H3NO 1VDVA 2MZQA 2OPPA 4RBTA 2CN1A 3OGUA 2O6KA 3SCXA 1M1GA 4PHPA 4HR2A 4FLWA 2CQPA 5D3GA 2W2OP 2R7UA 2BM0A 3ZEUB 4HHJA 3S8SA 5IT4A 2I5JA 8ICEA 4XPCA 2D3DA 3ZZ0A 2DISA 3NVZA 3N6LA 2WB1C 3CJQA 5C2DA 4KAIA 2HEKA 2A18A 2BJ7A 3JYTB 2E5LK 1HHSA 2AJ0A 4OZ1A 1ZQVA 1EKSA 5EXWA 1OUQA 2APOA 4KLLA 3ED5A 3P4IA 1I5OB 4M3RA 2RILA 4IL6U 3P49B 1D4XA 2L48A 1PBUA 1IV8A 3RRGA 3N79A 1Z2LA 2UXDK 4JI1F 3U4LA 3HHNB 3PFOA 3GLJA 2XSFA 3OFHA 5J2CA 4DS4A 3DLJA 4B9SA 3RMAA 2CPDA 2XS5A 2UV8A 4F4AA 4CFAA 5I3PA 4MEXA 1YAGA 3AD7C 2B4VA 1FRIA 1TAQA 5ALUA 3SI6A 4FK2A 5D15A 2DKXA 2OCEA 3S1TA 1Y5NB 4RQMA 1GOAA 3HD2A 5E7OB 2W2QP 2H4YB 1A5WA 1RU2A 3M9MB 3MM5A 4CZFA 3M2VB 4CTAB 2O8BA 2FF3B 3AVCA 4F02A 1B92A 2C2NA 1VBKA 2BV3A 1RBUA 4KHPJ 3KFUF 5A2QO 3CCEN 5DZ6A 3MFHA 2QK9A 4M9JA 4DFPA 4K25A 3MN5A 3BZKA 3F5EA 1FXXA 1NI3A 4ILRA 5DS7A 2B5JA 2XMKA 1YZ6A 2MQPA 2HAIA 4Y2QA 2F9JA 4J9KA 4RUHA 1PKUA 4CT8A 4Y00A 4LSZB 1AT1B 1KNZA 2JGUA 3OL6A 3QXGA 2AH5A 4BLGA 2UU9F 1FK9B 4FM1A 2IIRA 5F9LA 4Q7AA 4NLSA 4OKJA 2W7PA 2LMRA 2NRXA 2CPZA 4J9RA 3IG8A 1N52B 2RDIA 2RHFA 1S6QA 4CF9A 3ETMA 3I1YA 2HNZB 1H7XA 3SPYA 3PSTA 9ICRA 1ZS6A 3HW8A 2IM2A 3B78A 3VGTA 3SQ4A 2BE2A 1CULB 3QQCD 5K5MA 1RNHA 5J0RA 1NO8A 2ZIWB 1V4TA 2GVZB 1WC0A 4LD0A 4ZVFA 3D9BA 3LDPA 2VA2A 5LY3A 3L2VA 1T9TA 1XMBA 4B3MF 5FIIA 2Q66A 3M32A 5B5EU 1PUZA 4ZVGA 9ICAA 2XMTA 1NDLA 4JD2B 4JI1K 5KFQA 2BCQA 4ANCA 3N7PD 2Y0BB 4J2AA 1K8AT 3PSPA 4FYYB 4I2CA 4F3TA 3KLGA 2VFUA 1KHVA 5E3QA 3KLFB 1YBUA 1M5KC 1XERA 5H2FU 1YTAA 2EFVA 4FJIA 3IBPA 4O8KA 4DV4K 3H5UA 4H5NA 1RHKB 2Y1JA 5KAIU 3WZ0A 3TABA 2BEFA 3MDQA 2QJ3A 3C1ZA 3A1YG 1V4SA 4MQ3A 1FI4A 3A3PB 3FBBA 2HOIA 2AHOB 4RNFA 5IIIA 2LMIA 2E4LA 3J7YP 2V67A 2DH8A 3D3BJ 3LGHA 2OPSB 8ATCB 2FLPA 1K1QA 2CQCA 1K73O 5ALGA 1QM9A 1DAXA 4O0IA 4A8MP 3P31A 2AGOA 5ETVA 2D9OA 2F9WA 3PIOQ 3V9WA 2QLXA 3DOMB 3T1HF 3FEYB 2FDNA 3Q83A 4ZVHA 1PZNA 1ASUA 3CE8A 3L4BC 1X1PA 2YH0A 4DSKA 4WJBA 4F92B 2UU9K 4G3IA 4YB1P 3UKUA 5GAGU 1GLDG 1KL9A 3HKZC 2NO5A 3D28A 3KJNB 1OSCA 4YMEA 4O9MA 1IVZA 1PVRA 4TQRA 2W4DA 2EAPA 2CGJA 1P90A 1RBSA 3JPTA 4A8SA 3CDBA 5LMUJ 2Z0GA 1KQKA 4RNOA 2EANA 1XR7A 6FDRA 3V1QA 2Q0ZX 1CS4A 4LFCJ 3MTKA 1JKHA 1XQIA 1E3MA 3KK2A 1FKPB 3UD5A 5IQ6A 4PR6A 4DV5F 2ATCB 1HR0F 4V19J 1UQVA 5KFJA 3BYRA 1DBDA 3MD1A 5BRFA 2CGKA 3TUPA 3FGUA 4XRHA 3CJ1A 4PG8A 2VKQA 1RTIA 2HBRB 4Y1CA 1IKVB 1ZJNA 4UW2A 2NYHA 2FQQB 3O6WA 3IBFB 4V19S 4OYWA 2H5IB 4CRJA 1B0PA 1RACB 3CEDA 4J9MA 4NPOA 1LFPA 1FRLA 3US5A 2ZH4A 2RH3A 5AQGA 3AVFA 4K42A 1AUSL 4H5VA 5AXNA 1FIQA 3BV8A 5ALXA 3O3HA 2KSOA 4RUAA 1RWVB 4IO9Q 1VSIA 3RMCA 3LALA 1VBYA 1SC3B 2C2MB 4WIIA 5I9EB 3VETA 4FM0A 2A1AA 4EYHB 2V8PA 5JS2A 3OYFA 4USKA 2AJ1A 1IKWB 2FXUA 4UOCA 3T1HK 4K4XA 2ZKTA 2E7WA 1DQ9A 2ZJ8A 2OD4A 2OYQA 1U47A 1QHAA 4BRMA 2ASLA 2V8HA 3NEKA 3GJQB 5A8WA 3AVHA 3WK7A 1WTBA 4J9LA 4IKFA 2VC1A 2M4MA 1EWRA 4DU4A 4DV7J 3HPHA 3Q8QB 2M0GB 4CF4A 1UFKA 4K5SA 4GV9A 4XDCA 3ZSOA 4F9OA 1N2XA 1N36K 3OYHA 1N8RT 2AX0A 2QIFA 4X2BA 1CJVA 3H7IA 3T3FA 1SVDA 4E1NA 1NAQA 4KPYA 5ETOA 2ZHAA 5ALFA 4WQ5A 3AFGA 3ULHA 3DXKA 5BRDA 3BQ0A 2O8FA 3I4HX 1G6BA 1RJJA 2ZC3A 1PYSB 1L7NA 1LXNA 3R5CA 4FZVA 4OI1A 1WN7A 2OUGA 2Z2MA 3EN9A 3OBWA 1HR0K 3GIKA 1FXRA 2ZH8A 1CJUB 4N8NA 1LW0B 2FY1A 3BP8A 3VR1A 2DT9A 5KT5A 3MXHP 3QGPA 3A2FA 3A8IA 2O8DA 4MYUA 5E0OA 1YBTA 3IWXA 3GMGA 4E7KA 5J2MA 4JAXA 2EC2A 5K8NA 2VOPA 5AE2A 4NOHA 5AQXA 1LFWA 1RXOB 3BPDA 1YGYA 1JNZB 4ZVUB 4TYAA 2PY5A 5J1EA 1DQ8A 1U45A 1EX8A 7FD1A 1LKYA 4X4UA 1SKSA 4ISFA 5AKZA 1RAAB 1Q86T 1V5IB 3UNYA 2G09A 1RM6C 1T6DA 2ZUBA 3O6QA 4XIUA 4CFDA 4LFAJ 4CNYA 1RKJA 4CF8A 2E1MC 2LYVA 2CJQA 3QLHA 5IFMA 4C0BA 1X8DA 4H4MA 5AJ3J 4J90A 4NXNF 3U6FA 3NTUA 2UUBK 3HWTA 1ZQYA 3TQEA 4ZCKA 4ETZA 1S76D 2Z1JA 4E7LA 3L8BA 2RU9A 3UDLA 2Y3YA 1VSHA 4U96A 4JS5A 4OX7A 3K0SA 2NRTA 4A48A 1GLLO 3K58A 3ZC4A 5L1KA 5IWAK 1ZQNA 3VAGA 3DXMB 3F9MA 4I2AA 4F04B 2V8VA 5HJYA 1FO4A 4NRUA 1ZM4A 3GV8B 5HBMB 2B4PA 1AZSB 3SV4A 3L3FX 2AEFA 2P6UA 7ICKA 1ZH5A 3OR2B 4Z6FA 3CQ8A 1HNZK 1KTVA 1IBLJ 5I3QA 3HI0A 3AVIA 1ZQMA 3JS9A 1WC5A 1MQ2A 1LWCB 5I4MA 1Z1BA 1Y5LB 2BM1A 3CD7A 4AXJA 3N28A 2AP1A 4KLJA 3H1VX 3KKRA 1KCFA 1F6TA 2FUG9 4HYKA 4DUYK 3MWPA 3NH2A 5ALMA 3KVGA 2G2OA 4C80A 4NYFA 1RXVA 1JX4A 3KD5E 1RTJA 3W9IA 1UWAA 2VD3A 1DGSA 4P7TA 3FMBA 3P5BP 3PSIA 4QZCA 2W9BB 4ZPDA 3W9HA 3EL2A 3R1HA 2GO8A 4K4WA 3VV2B 4KHYA 1RG6A 3TUJC 3TARA 1WC1A 2UUCF 3VQTA 3R1XA 2UVUA 2GX9A 1VQSA 3F9KA 4L73A 1YJWN 3CJ5A 1HJRA 4B3SJ 3R9KA 2HBMA 2VWJA 1M1KT 4CM2A 3J80Y 4Y34A 2ZIVB 2DCUB 3P45B 3VGVA 1WELA 4MN4C 3N6MA 4JI5J 2DJWA 4NLQA 5HHHA 2MAXA 4DN0A 2V5HG 2QKBA 1V5VA 2ZUGA 2QSFA 4NXNK 4AD6A 2EKNA 4UB2A 2XGQA 1RUSA 5HROB 3HHLA 3OHRA 4CO4A 2CQDA 2A5XA 4NL5A 3KLVA 4NRTA 3HSZA 4CVNE 3LGNA 4BWJA 3CVKA 1VYAA 5D4LA 1S10A 1VSJA 1QAYA 3A0HU 3ZX0A 4NLVA 4JEPA 5J2BA 1DLOB 3TSUA 4DR4K 1BU6O 2GGPA 3ID6A 4MO4A 2OP5A 3L0QA 3QO9B 3MPYA 1YJWS 4FFDA 2P9CA 5HQMA 4IG3A 4WCEL 3FBCA 2XS7A 1YX2A 1XK8A 1BNOA 4CYUA 4KGXB 1O03A 3SD7A 2W4PA 3TAMA 4ZITA 2I0XA 4YQWA 3T9ZA 3HCXA 1T3QA 3DOLB 3CO9A 2WBNA 3HM9A 3FJ2A 2KICA 3SCJE 1RQ0A 4DUTA 2JGAA 4DV0F 5J2NA 2FJ6A 1REGX 2ZUDA 3J7ZO 4E7IA 3FZ2A 4OYIA 1W2IA 2ERRA 1L3UA 2FZGB 5EE9A 3SYZA 3AOCA 5C24A 3C23A 3PW2A 1XI1A 4HL9A 1ZJMA 4PL7A 5J0SA 2FC9A 2W6KA 3LYSA 4CO3A 2GO9A 1ZQDA 3HM8A 3D4JA 5AIAA 2CQHA 3TZXA 4DSFA 4FWMA 2QL5B 4QWDA 2WBMA 1R89A 3QEPA 1PYOB 4RW9A 3H4DA 3KLEB 2R2RA 2UUCK 4FZYA 3NCQA 1KFTA 2DGVA 3TNVA 5BR8F 3NMUA 2H3QA 4ZKAA 3TSQA 2HMIB 4B1WB 2ZM6J 4TNOA 3VESA 2F1JA 2FPMA 2P5OA 1DXSA 4XQ8A 2KJVA 1PJ7A 5KFFA 5AQVA 4OI0A 1HBMA 2W1BA 4DN9A 3MM9A 5LMNJ 5D0GA 4KRFA 4P7VA 5H9FK 2K8CB 1KC8T 2QWPA 4GKJJ 4IZ9A 4FOIA 1RT2B 3MR7A 1LOTB 3LQVA 2ZXHA 1XR5A 4OX6A 4E98A 5KFWA 1FWKA 2HHTA 2BCUA 2P9LB 4YNQA 1UFLA 4EFAC 2P9SB 2BYCA 1PGZA 3HRDD 1NDKA 1X9JA 4DTSA 1ITPA 1DTQB 3SBMA 3QWUA 1A76A 3SUOA 4I67A 3MXIA 1SXLA 2XO6A 4RT3A 1JLQA 3ZNUA 3QJJA 3FZHA 4F4WA 4YN4A 2BPGA 2AIRB 2VGNA 4DR3J 4E7HA 4QZFA 4A8YA 1T95A 2RRNA 1ZAXA 4FWKA 3H20A 4CEEA 2MKCA 1PVQA 1FO1A 4YMOA 4YR3A 4DR1F 3I28A 1Z26A 2DNNA 3VWSA 4IJAA 1N5QA 2I5HA 3R3TA 4F3QA 1MWQA 4K2JA 1RHRB 1FHTA 4RQ6A 2FE9A 4P10A 1Q8KA 3IM1A 2G0CA 2UZAA 5AK5A 2Q0UA 2A19A 3CULA 3HOSA 4DV0K 5L1LA 5F1XA 1WG5A 4JOUA 2V2ZA 4ED8A 3FM9A 4Y28C 4MYTA 1ITGA 2V51B 4YY3F 4MF2A 4FO6A 2EDUA 4FDFA 3K5MA 2ZH5A 4X62K 4YR2A 2E5SA 1NK0A 2DGUA 4NZ6A 4FPRA 4Y2XA 1T9XA 1WHXA 1RDDA 2ODGA 3AGKA 2MLYA 1HNIA 2BRLA 1SWVA 4DXLA 2ZD1A 1T02A 3B9JA 4AYBD 5BPMA 3C6UA 3O1WA 4RW6A 3CD0A 2ZE2A 4JBCA 3IN5A 1VSMA 4BRKA 2KHDA 4OV1A 1J9AA 2A3JA 5EN1A 4CF1A 3AEVA 1NNDA 2H54B 4C7QA 3RBDA 1NK8A 1U0SA 3ZT1A 4GXIA 1UJ5A 1Q9XA 2O8CA 4ED3A 3DKDA 3UD3P 4FLVA 2IHR1 1VK0A 2QX0A 4NCAA 3PYEA 2EFQA 5KFHA 2A2DA 4QYRA 2ILZA 2IVNA 3QUCA 1IQZA 9ICCA 4CF0A 3BY5A 3GBTA 2DRDA 1S1XB 4TYBA 3QIPB 1T03A 3C16A 4GV6A 3DLBA 5J2DA 3ILOA 3WEEA 1BA1A 2YH1A 5DM6L 4DF4A 2HK3A 3QAEA 3ZETB 1N33F 2IY5B 5HMYA 3EGZA 2GJFA 2OELA 4OGCA 1VQ5N 1KQQA 1H2UX 5ETPA 2RAQA 2ASOA 1VQKN 5J2JA 3RH5A 3R27A 4QIEA 2AQ4A 3QU5A 4XTTA 3SIPB 4FXWA 4DR1K 2KT3A 4LBIA 1JLFB 4KMUA 3OFGA 5CHCB 4MIWA 3VZHA 4LF8K 2FI1A 4DSEA 5CYQA 2AJQA 1J5EF 3EZUA 2OEHA 4KGKA 5AKYA 1BQMA 1G99A 3EWAA 9ICTA 4OJ5A 1J27A 1PK3A 2PBDA 2HSZA 2MKHA 4WF9Q 1IG9A 2MJNA 5IT9Y 3UVJB 4JKGA 5ELZA 3BR9A 2XSJB 1VQ5S 2QTDA 4FJ8A 5MAOA 4OZ5A 4YEAA 1VQKS 2BCRA 5HRNA 4MKVA 2F7VA 3L5KA 3BR8A 2PMZF 3NAIA 2Y8WA 1YXQA 4LF6F 3PEHA 3DLKB 2MZJA 4DFDA 2YWKA 3O1LA 2FBVA 4F8RA 5DDQC 2XGPA 4FJ7A 4O0NA 1HA1A 2BCSA 4WFAL 2DGZA 2ZKUA 4Y65A 5HMXA 3ZSRA 4CDGA 1N0UA 1RE1B 3KDNA 1K0VA 5CRXA 2FMSA 2HURA 9ICEA 3AODA 3NAEA 2P9IB 3MUMP 3ZSWA 3JAMY 1DOQA 4DOBA 5GADU 3U1NA 2H51B 3CCLN 4O5CA 2VA8A 5AKKA 2OPQB 4ID5B 3GE1A 1RPLA 1JLGA 4PG5A 5DB7A 3VGKA 3QJLA 3I8BA 4FVCA 5BR9A 3A12A 3UN5A 2VFRA 1B70B 4FS2A 1CEZA 2PC6A 4F3OA 2E5HA 4CJUA 2ZJQQ 4CF3A 3GG0A 3O3GA 4ANDA 1JUDA 2W42A 4KLOA 3UE2A 4OPHA 4EHUA 2EQYA 3ELHA 1S6OA 2PSZA 4USMA 3MAAB 3FUYA 4LF7J 3AOAA 5E41A 1RKIA 8ICPA 4OX8A 2HFOA 2HSTA 2MZ1A 2DITA 1PIEA 3HYFA 4DFMA 4ZVQB 3H0RB 3CCLS 2BDPA 2E8AA 2RB7A 4LBHA 1RT3A 4FWSA 5FPDA 1HNXJ 3D6JA 1IXRA 2OFHX 4M42A 3PNCA 4FYXB 4NLDA 1GMWD 2JEGA 4KHSA 2E7XA 1T9VA 2RF2A 5CCLA 1KP6A 2FF6A 2XO7A 4IEIA 2DXDA 4UUWA 3KK3B 1ZC6A 1VQYA 1UL3A 2NYIA 3NF7A 2MGZB 3MEEB 2VQEK 2Q3SA 2J7KA 3K5LA 4HTIA 5DB9A 3NH1A 3GWCA 4IOAL 3UKRA 2K3KA 2ZJAA 1TL1A 3BKTA 8ICOA 3IV6A 4HH1A 4NYOA 8ICAA 4TVAB 3TZYA 4OJ6A 1YUWA 1OS5A 4PXDA 5CZVA 3NVVA 1S1TB 2EZXA 2GMJA 2Q6BA 4DV2F 4BGBA 5AE1A 4LY7A 1NU4A 4KLTA 4GLXA 1S99A 4RW4A 1V38A 4JKHA 3T19A 2RU3A 2UXBJ 3O5BA 3TX8A 3G6VA 2ZIXB 4EZ6A 2XG8A 2V4QA 1ZQXA 2OWOA 1H7WA 3RYLA 3CJ2A 3HT3A 2DF4B 2E29A 2YNHA 5HL7Q 2YTCA 5C42A 4YORA 2OD6A 1F3FA 1TL3A 2JH7A 3SK3A 4C98A 4LUBA 4FLTA 3U1LA 2F63A 2AJ4A 1R6VA 3RTVA 2RIJA 1BO5O 9ICGA 3DRPA 3DHXA 4U7CA 5JU5A 4AHSA 4ES2A 3ZZOA 4PWDA 3ZT4A 4NLKA 3M8QA 4C23A 1E6YB 4DI6A 2OEMA 3AA4A 2VOOA 2E2OA 2BBEA 1YQHA 1L3VA 5KFTA 2CGLA 2C2ZB 3IS9B 2DGTA 3OS2A 1YJUA 3MOJB 4Q44A 3NMAA 2ZUCA 1D0EA 3EZWA 4UBBA 4K8RA 3I8DA 4BVPA 3H8WA 3WUHA 3M9OB 4EI2A 2MKSA 4WU2A 2R8KA 2F9TA 4FLUA 4U8VA 3Q8MA 3IXQA 1HMVB 3D1OA 4A8KA 1KQSM 2K1RB 1F3VA 2R4FA 2VKZG 1HBUA 2EHGA 4X4QA 2L08A 1HI1A 2OHFA 3AJDA 5DO2A 4CJEA 3V1RA 1C4CA 3IM9A 2CNOB 2M52A 3LM2A 1RWUA 3RR7A 4DB3A 4FXDA 1ACMB 2GVDA 2A6OA 1IO2A 4O3QA 2WC9A 3JPNA 4QCLA 1SB3C 1KQSR 3EX7B 4AE5A 4MK7A 3L4PA 3G6XA 1C7YA 4K50A 2IOFA 1QTNB 1KDHA 1D8YA 4DV2K 2N7CA 3RG6A 1URJA 5IC4B 1F44A 5KPTA 1GTEA 2BJEA 5KFOA 3T6JA 3V4IB 2JHEA 1NRKA 4JI6J 1NMDA 1K8AO 2G2YA 3H2UB 5A8KB 3VN5A 3MX5A 3MBYA 5LM7E 1F2HA 3CJ0A 4CK1A 2B43A 4DFJA 5B08A 3AOBA 4FW2A 3QZ7A 4DLGA 3Q2SC 3VGUA 3BGRB 3KXDA 2HQDA 1QUVA 4M2YA 3QFPA 1WB9A 4X4VA 4BG8A 4PY5A 2QMWA 2RDDA 1SBRA 1TUWA 2ZWOA 2FTRA 4OX9J 4PEOA 4C1NK 2HNDB 3DLHA 1UA1A 1Q7LB 5MLCQ 4GFJA 1HKGA 4QR2A 4UY8T 4L72B 4A5AA 3ETRA 4BRCA 1SPBP 5HRRA 1RAGB 3OVSA 2GVZA 2R8IA 2OMOA 3AU2A 3D45A 5AZJB 4RW7B 3OUYB 1MLAA 4DQRA 3IC1A 5LJ5Y 3NS7B 3RJKA 4LF9F 3QU4A 5SZTA 2HGMA 4HCBA 4HT5A 2X51A 1WSVA 2W01A 3SAFA 2VG6A 2HKEA 1EHWA 3DLGB 2JWLA 5F0WA 3KLFA 1OPIA 2BANA 2AYGA 1UVMA 2AD9A 4UARA 2J6TA 1ZQQA 3BN7A 4EU0A 2L9DA 2M3DA 5ETSA 4A57A 4YD2A 2KMDA 2KVIA 3RFAA 3RB6A 4NMXA 5D4BA 2E88A 1U9LA 2ZTDA 2HQ3A 3LF0A 4C0HA 4J2BA 5GAHP 5H9EJ 1NKEA 4LVNP 1Q7YT 3WIVA 1WSIA 1PSDA 5C25B 1TAUA 4PXCA 2B4UA 3V6DB 1OJ4A 3SQ1A 8AT1B 3DWLA 4YG2A 2M8HA 1VQPN 4HI1A 4CEQA 2BGGA 2YMLA 3UDEA 2L5YA 1N48A 4U7UD 1MN7A 4ECXA 1F0XA 2UXDJ 4HLBA 4GMKA 4QW9A 4OKEA 2ITGA 4LVSA 2GA7A 3P96A 3O08A 2DK2A 2BA9A 3TTFA 4CLLA 4TXSA 4MFBB 1VC6A 5L38A 3R2CJ 3JXOA 5J29A 1A0PA 1X5OA 3IBWA 2MUTB 3NCRA 2QMUB 1VQPS 4E89A 4NM2A 4MDAA 3SEIA 1VRTB 2LEPA 4Y2AA 4NA1A 1C0FA 2UXCF 3TKAA 1KLMB 2QYCA 3QBCA 3NGIA 5FD1A 1YWXA 3HL8A 3GJTB 1N34F 2M88A 3HVRA 4ZPAA 2V7YA 2XY8A 3O8WA 4MIAA 4LF9K 1S9EB 2ASJA 3FCVA 2RE2A 4S0MA 2HBKA 2W7AA 1WOPA 3OJUA 2IA0A 4NWBA 3DDKA 4GO7X 3MGVA 1T94A 2KD1A 3AAWB 2ZH9A 5ADZA 2YKQA 3I31A 4PPZA 1IKVA 5DZ7A 1ZQBA 3KJVB 4FYVB 3FZLA 2PKEA 2KN7A 3IG5A 3B8AX 2P9KA 4TU8A 4DKWA 1ZBSA 3VGLA 1YI2N 5THWA 2H5JB 1N8RO 2Z4PA 3ETOA 2VWBA 3C5FA 1IR1A 4UB3A 3H90A 1UVIA 2OGUA 1ASVA 3LPEA 3AARA 1TV6A 3QICA 4BR0A 3V2UC 1HUZA 1VK3A 2BOPA 1NGBA 1H2VZ 3V7LA 4I2BA 1P9QC 8ICLA 2C1EB 3OSNA 4NLRA 3QINA 4ECSA 4DX8H 5KAKA 3RWUA 4CK3A 1BQNB 2J0SD 5TISU 2V6AA 2ZBIA 4IO1A 1JL2A 3GCWP 2BPCA 2DXFA 3PZPA 4IXCA 4KTWA 2W43A 1YI2S 5KRTA 2VB6A 4DL7A 2CFXA 3M8WA 2NXEA 1PO6A 4QQBA 4EX6A 1GO3F 2XZDB 7ICHA 3OV7A 2IMWP 3QGIA 5FRMA 1QQ6A 2WK4A 2VG5A 1BPEA 2BRKA 1P8ZA 4DL4A 1Q86O 2NV3A 3CJKB 3GIIA 1VQLN 2RN2A 5CYMB 2X74A 5DGAA 1MU2B 5DJBA 2A42A 1X40A 2YHYA 3BBBA 3U02A 3QU7A 1MROB 3C14B 4QOZB 1BI4B 1QHTA 5CH7B 1M5VC 4CZLA 5KT7A 3E1YA 1N34K 2P9GA 3LP0A 4LF4F 4QAGA 1DARA 2DH9A 2FJBB 1NZ8A 2NRHA 4O5FA 3RRKA 2EZYA 3OLBA 2HHPA 1LW0A 3CYMA 2YX7A 3TZWA 4OD0A 1S72N 5AQPA 4DR7F 3L7UA 2VWKA 3MM6B 8ICGA 1HQUB 4FJXA 5LJWA 1JCGA 3RUBL 3ITHA 4P4OA 1R8BA 1VQLS 2UU9J 1AROP 1VHIA 2CPRA 5HMWA 3MN6A 1RDUA 2KRRA 1HIWA 1V9OA 1S7HA 2I38A 1HNVA 4BHQA 1TYQA 2B8QA 2DFEA 3EZ5A 4DV6F 3K4GA 3RBZA 2GQQA 1U1KA 2KKVA 1HUOA 1S72S 2XY7A 1R8AA 3FFIB 4A62A 1NBWA 1N61A 1J5OA 3AO2A 2JWKA 4B3MJ 3BGUA 2BR0A 4H4KC 5DM7Q 4M5DB 2E2PA 9ICOA 1IBMK 2P5VA 1N54B 2HYIB 2DNZA 1BQXA 4BRQA 4KFBA 2QFIA 3K9JA 2W2PP 1XNQF 3KUGA 2FVPA 3DXMA 5IILA 4RW8B 2DTUA 3NNHA 3O9RA 1RI7A 3JQKA 1T9WA 1RDAA 1FE4A 3OW2M 4YB6A 2ZUAA 3OFFA 4QWBA 3ET6A 1IN0A 4UB4A 1M1KO 3X1LB 2KL8A 3JSMA 4ZIVA 1ZQIA 3O1BA 4BDPA 1BWFO 4UQGA 3UCUP 3ENOA 3C19A 5AZIA 1XJWB 3LDAA 1FT8A 3ZTQA 2PYLA 1LWCA 1DTTA 2C2RA 4LF4K 3OW2R 2VONA 4DU3A 3THPA 1RTDB 3CJ4A 1CJTB 3G96A 8ICWA 3T1HJ 2MSTA 2CA9A 3C66A 5AQNA 5ETLA 4EWTA 2H5XA 4DR7K 4K4YA 2PMZC 1JXLA 4K8ZA 2D0PA 4W98A 1X9MA 2V9KA 5JICA 3TW0A 3QPIA 4JK1A 1X4EA 3ZFVA 3CETA 4JKEA 5ALZA 5D4PA 3TAQA 5KOWA 2LKZA 3CFPA 4DFKA 1JLEA 5C15A 2B6AB 2KRBA 3FZBA 2MKYA 3G0ZA 3GQCA 3EM1A 5AT1B 4DV6K 4GC6A 1Q8IA 2LXUA 3H08A 3CCUS 1VC0A 2D8CA 1KBUA 1WHYA 4PKDB 3BF1A 3CG7A 1SKWA 1PJ5A 1HPZB 2IJNA 4ZP8A 1FTCA 1M5OC 5D6GA 1YVFA 3RU0A 5AM4A 2PA3A 3QUTA 2PFUA 4DV5J 3CCMN 3TX0A 1RWMB 3EWGA 3O8MA 1D3WA 2AJ2A 4XPEA 1HR0J 3M8YA 1T44A 3KJFB 4DPWA 5M2UA 3CJ3A 1APSA 3G71N 3QO9A 1R31A 2G2ZA 4I7FB 1HKBA 4C48A 4CCHA 9ICJA 1XNQK 3O80A 3G6EN 2D7SA 3HBTA 3HTVA 3SMPA 2JVRA 4PXEA 1BXNA 2YVSA 2ITMA 1U0HA 5HK4A 3DOLA 3J8AA 2OPPB 3ZZUA 4AQYF 1S0VA 3BPSP 2HLTA 2NSBA 3CCMS 4KN4A 2BE7D 5D3GB 1BPBA 5IOLA 4BG9A 1U04A 2VF3A 1HPMA 1KC8O 5A6PA 2K8AA 5ALRA 3G71S 5KL8B 2MKJA 9RUBA 3O9TA 1YJ9N 4FZMA 1BUXA 5JVGQ 3VAMA 1EP4A 3G6ES 5J2QB 3U1MA 4FYWB 3WK9A 4JI4F 3WC2A 5AQTA 2UVWA 3AO1A 1FFGB 4RPYA 2FVRA 4B17A 2YKOA 4DTPA 3MFIA 1GNKA 4P0QA 3CIZA 4DX5A 5F9NA 4I28A 4OLPA 3T41A 2IMOA 2E2QA 2R7SA 4RX6A 5D77A 2VANA 2QFJA 3FSXA 3HZEA 2D0OA 4ZMMA 3R5JB 1RBRA 1ZQCA 1C0TA 1CVJA 5CR4A 1QS4A 2IOCA 1WG1A 4WP9A 5CJ7A 2JSXA 1GX5A 1DT9A 2IJFA 4IQUA 1YJ9S 4J7CA 3EKSA 2DHHA 2KJWA 5HNKA 3M6WA 3MM5B 4FM2A 6FD1A 2O8BB 1BY9A 1FFSB 8ICFA 2RPIA 5CEHA 4LF1A 4O4RA 4M6WA 3L4QA 3I5CA 4DCJB 2V69A 3ENVA 3AGRA 2P9SA 4JK7A 4O3PA 3Q8PB 4XEIA 1XWLA 3QNMA 5J2AA 4RQ2A 2R8JA 4LF2A 1DTQA 3BN4A 4X84A 4WP8A 1NSQA 4HCCA 3KKAA 1WF0A 2B5JB 4YB7A 4FNIA 4ID1A 4J9PA 1RHQB 5DDRC 4I2PA 3AD8C 2DY9A 2O5DA 1XMQF 1HYVA 3FQLA 4ED6A 4OJHA 1UWBA 4O5EA 2GNKA 5B0DA 2XMWA 4MIBA 1RYSA 4HAIA 4N41A 4ZVEA 4FK0A 2XMVA 3QT5A 5EDWA 2RRDA 7ICNA 2K4IA 5KFBA 2K2PA 3O9QA 3L3CA 2NYVA 2GOLA 3GR0A 4FWQA 5TKWA 2FJEB 3F53A 2OA8A 3MCNA 1JIHA 2MDAA 2ILYA 1Q46A 3C3LA 3MR3A 3V7JA 1IKXA 1HI8A 1RGVA 3NGTA 2ZC4A 1S6QB 3MZIA 4M5HA 3CT9A 4NXNJ 8RUCA 2CNKB 3SCKE 3MCMA 3ZTRA 3PV8A 2Q36A 4CJRA 4A5BA 2BE2B 2HOQA 4ITSA 3SEOA 4X66F 2GX8A 3AO4A 2P9NA 3S7RA 3N4QA 1VMBA 2LKYA 4KRWA 3BO2A 3OPKA 3R2DJ 5SWMA 1TK8A 3DFEA 4JI4K 2BJ8A 2HHQA 3M32B 3QB0A 4CLUA 4LH5A 3WNGA 2ROGA 4OI6A 1WWHA 1YKWA 1UHUA 2W40A 3MAQA 2A41A 1B0VA 3BKFA 1WBDA 1ZQTA 1O08A 2GO7A 3EXYA 3W64A 5LOQA 3KLGB 3WT0A 1XUPO 1YZ7A 1GOBA 4JI3F 4JI2K 2XWYA 2OH2A 3A8YA 3PW4A 1K0TA 3AVBA 3IMXA 3KHRA 2FC0A 1KW4A 2OXOA 4DUZJ 2OI2A 3BZCA 5JVHL 2J4RA 2D9PA 1S8OA 3MCPA 3MGJA 3I0SA 4TUQA 3G82A 5ALNA 7ICVA 2KYXA 2GWKA 4L75A 3W0LA 2DNKA 1OY8A 3G6YA 4ZLLA 4Y2MA 5K8PA 3UN2A 1XMQK 1GAOA 2AXTU 3PW7A 1WUDA 4IQMA 4HHTA 3DJCA 2PA8D 4CRXA 2B7CB 1M5SA 2QA4G 1NGFA 1F9EB 3UKUB 3FC4A 2AZ1A 2KEYA 1WSRA 4CO1A 1JLCA 1E4FT 3RRHA 2AA4A 4CT9A 2AP6A 4BUGA 1YRUA 2CJKA 3MEDB 2QLFB 4GXJA 3NS6A 1JNRB 3M6KA 3JPRA 4QIWF 1R6YA 3KIOA 2RUGA 3UVJA 4WFNQ 3ULEB 4MJKA 3RMDA 2XSJA 1M90T 1CS4B 1JKHB 5AM2A 2DH7A 2ZWHA 4KGMA 4DQPA 3CF5L 4C2MA 3OQ2A 4WKYA 1Z3EB 5BOMA 4ICAA 3P5JA 2Z1GA 4PUOA 3WKDA 5KOXA 1RTIB 1E6VA 1ZQOA 3T9NA 3CW2C 4YHHF 1ATNA 3MR6A 2ZJRL 4HVJA 4JI3K 3IRUA 1GMVA 2GHVC 2YJEA 1OH7A 2MQLA 3V1OA 1AYEA 4QBUA 1SJ4P 4Y0FA 2YKNA 4CBXA 3VQ6A 2OPQA 4ID5A 2LXFA 4JKFA 1NK7A 5LSRA 3PRBA 3DV9A 1QSLA 3O4WA 4DR2F 2OJ3A 2BXJA 4CK2A 2EBGA 2WAQD 4Q45A 4UB1A 1IR0A 4K4VA 5AI4A 3M6XA 3GZFA 1SWWA 3MEGB 4QZ9A 2QB0A 4PZOA 2ZJPL 1WC4A 4NA2A 3K7RA 1I39A 1U25A 3CMEN 4NE9C 1KWMA 2XHCA 4H0OA 2LP4A 2KHCA 2NRZA 5A8WB 5ETQA 2VJ4A 4USJC 2KKPA 4FWLA 3TACB 3BB5A 1UPHA 1JLAA 4Q43A 3PNIA 4P2SA 5BR8J 2HFSA 3G9CA 3BS7A 3CJTA 2VODA 1HWJA 3U27A 2P8IA 4RWWA 4FF4A 4N47A 2OANA 2GV1A 3H98A 3ZT3A 3KWMA 3DXKB 3DXBA 2O8FB 5KG3A 5DBCA 3LANA 1IKYA 4AT1B 4OHXA 3CMES 2O01C 2KZZA 1WWVA 2RE1A 2Q0RA 4Y2RA 4NA3A 4CW7B 5FLXY 2DPJA 5L9XA 4BRPA 4JKDA 2JH1A 1KAXA 2F4VJ 5JMVA 3OXGA 5DG8A 1Y00A 5B0AA 2MLZA 2RVJA 3TJ8A 5J0YA 2O8DB 3GTYX 2L3MA 3A5OC 4YDUA 4BDYA 1S1TA 4N8OA 4FVUA 5D78A 2MRLA 3HP9A 2ZH2A 1UW4A 2AW0A 5AXLA 2GFFA 1Q0NA 5J2MB 2YY3A 1IBKF 2Q2RA 2K4HA 2Y0SF 5FRNA 2RHQB 3BGFA 4PQUA 4BROA 4ES3A 1VOMA 5J1EB 4X65F 3MUVP 1MN8A 2XLJA 3CC4N 1VGYA 1ZQWA 4PHTX 2G0AA 2WB1D 1BHNA 1HBOB 5AQWA 5HANA 3BQ2A 5J0XA 3VA3A 2XULA 4HTLA 3EY1A 3WXLA 1SQGA 3F2DA 4P74A 4DR2K 5AQZA 1FKAF 4EBCA 2BW7A 1GLEG 2LI6A 1D9AA 4YY3J 1M5HA 5AIBA 2MQMA 1IG8A 3ULDA 3H46O 4KC5A 1VQ4N 2KM8B 2ZGYA 2ASYA 3W5XA 2MSNA 4C8MA 4OYPA 4EUVA 2R9LA 5JS1A 4K4HA 3TEHB 2K89A 3FLCO 3KDOA 1VAZA 4H8KA 4F5RA 4NV0A 3HSJA 4EHTA 2BX6A 5KI6A 5AHXA 2VASA 3IS9A 9ICIA 2JV3A 5L1JA 4EENA 5CB1A 2HWTA 4CJ5A 3GDQA 5J2EA 2L41A 4L6V3 4Y0WA 1ZD2P 2XHWA 2IBOA 2MPUA 4NEYA 3IAM9 5AQUA 2ACMA 3S6EA 3W1YC 2R8GA 3BSNA 1Q82O 1ZD4A 2I2YA 2IC3A 1JWWA 1QZ6A 5F41A 2R2TA 1F60B 3D54A 2PEHA 1CLQA 2LEAA 3TVKA 1PG5B 4F0HA 4JI7K 2BKPA 4K0KF 1VQ4S 2FSNA 1EAYC 4WTOB 1O8BA 2CQ3A 4W90B 3PR5B 3MM8A 3DMJA 1N33J 4UY8O 4C3KA 3T1AA 5KFKA 3BZQA 4A8OA 1EZZB 3KUEA 4DLEA 5KG5A 2W2MP 2N3OA 5DG7A 5E3PA 1QQ7A 1CJKA 2DY4A 4IDKB 4CZIA 1RTJB 4M8LA 1FRHA 4DPTA 1S0NA 3TTCA 4QZIA 4X65K 1J5EJ 1UPMB 4QOTA 4K4TA 1HKAA 5E26A 4ACOA 1DHMA 1VLBA 4BC5A 4CE9A 5AQQA 4QWCA 4CO2A 4E8UA 3G8TA 3K75D 4CJWA 4UZCA 2Y1RI 2CWKA 1S6UA 2J0WA 3TOQA 2OIHA 4Y3CA 1C0GA 1NUEA 2EFGA 1ZRMA 1ZXOA 4JV5J 3LA0A 2DRBA 2HNDA 2C2EA 3NOGA 1VS3A 2DNLA 2KFZA 3CRXA 4LF6J 2HZAA 3WXKA 1Q7YO 4YVZA 3U8XA 3FZKA 2Z8QA 3OA9A 3MOZA 2GGPB 1TR0A 4Z2XA 2W8LA 3RSEA 3SXLA 4JYAJ 3NFAA 4O5BA 2ZNYA 4DX7A 4IG3B 4KQZA 3NG8A 1ZXIA 4CYUB 1RILA 3GSIA 3AA3A 4RCHA 4USTA 4BRLA 2ACYA 2W2NP 3TAMB 2ESEA 4ISGA 5IIMA 1ULRA 1NH7A 1U26A 4NLOA 2DKOB 4K43A 5AK6A 4JKAA 3QFUA 2FHJD 1KQGB 2BACA 1OVYA 1MG7A 3SUPA 2HVEA 2X6NA 3WQPA 4IFEA 3DI6A 2JLGA 4R8UA 4ECWA 5J2NB 2ZHOA 4CZCA 1XQSC 4CGFA 3L2RA 3OLAA 1KVIA 1EXQA 3D6TB 1VIXA 5C24B 1ZQAA 5EGYA 1N56A 3P5TL 4A46A 3NCPA 2BQ3A 4H5RA 4DBQA 5KFSA 7ICPA 4WCEQ 4CZHA 3SAHA 3CI5A 1P7DA 4KH5A 3IRXA 1KVCA 3IAYA 2V2KA 1UW9A 4E1JA 1ZD3A 4ZJQA 4OPAA 1RWWB 3SSQA 4RBVA 3HZGA 2ZTCA 3HKZD 4RNHA 1Y5IB 4QIFA 4RW9B 2DPNA 1ZZNA 4C97A 3VAHA 2HHVA 1HQEA 2PFNA 1KKHA 3V9SA 2E5JA 2HZCA 1LCUA 5L1IA 2KOBA 2NZCA 4USVA 5KFZA 3R9PA 4IQVA 1OMSA 1XMOK 2E2NA 5J2IA 3N4PA 4BR4A 4F0KA 1HBMB 3MM9B 2LEBA 5CA7A 4NM1A 9ATCB 2D0AA 1GMWA 4B1VA 1P9YA 4NL9A 2R7QA 2O4GA 4JI8K 2X3GA 3LDLA 3UQSA 3O3LA 4M41A 1XNRF 4EBDA 2DIVA 5ALWA 3THWB 1GT8A 1S79A 4ZDNA 2I8EA 2XI2A 1Q81O 3QIOA 1FEEA 2ZEJA 1RYUA 5GAHI 1OY9A 3KK1B 3NXZA 2E6LA 3SSRA 1FD2A 2YWHA 2HS3A 4DV2J 2QN6B 4ZVSB 3W60A 2KP7A 5AM0A 1JLQB 3VCBA 2DB1A 4JN4A 2FPKA 1HX1A 2XCPA 2A1BA 1QVFM 4KLMA 2AYMA 5F8GA 1MMLA 1V85A 3KMQA 2EG2A 3HJFA 5HRPA 4BACA 2JX2A 4MLHA 1HNWK 2WONB 3OTOF 3V6KA 4KLSA 3PLAA 4DV3F 3KJVA 4ATNA 4J91A 5AKLA 4U7UK 2W4CA 5F3XB 4C8ZA 4GRSA 3TAPA 4NLPA 2NLWA 3NF9A 3AAPA 3MUTP 1S9FA 1QVFR 4K4UA 3WNEA 3VCDA 8ICUA 2F2AB 4ED5A 4PRFA 4C8NA 4B9UA 4YDDB 4OL8A 2AF6A 2F8MA 5FJ4A 2MB0B 4CJSA 4JI0F 1UEUA 1DQAA 3PY8A 3DRRB 4QS9A 2MQOA 4DTMA 4J9NA 2J8SA 5E84A 1HNIB 2GUPA 1V9PA 2ZD1B 3C6UB 2HBZB 2P66A 2AV5A 1YDLA 4DR5K 2WVEA 4Z6CA 5RUBA 1DURA 2ZE2B 1FVSA 3DAWA 5KFIA 3NNCA 4DQSA 2G0IA 3GFZA 3LPUA 4ANEA 3ZO7A 5KAFU 5J8YA 2YNGA 5IQQA 3AVNA 2O8CB 4CE6A 1DFDA 2HFZA 5CE3A 2ZBPA 3PRDA 4KLFA 5ALLA 4M63A 2YKMB 4B02A 2VHGA 2HMXA 5AQFA 4IKAA 2U2FA 1SV0A 2FSKA 1NU0A 1T03B 1B4FA 3C16B 3LZJA 1YRXA 3AVGA 3WEEB 1YK9A 3CPWM 5C7PA 1XO1A 1DKGD 2GAHC 4M5LA 2LCWA 4CHNA 2AGQA 5AM1A 2JFKA 3GIJA 3C6AA 2Q1LA 4WK3A 3CDUA 1GX6A 3QRRA 1NJWA 1TMMA 3OVAA 2G5IB 3ZDEA 1BNPA 3CPWR 1K9MT 5CYQB 3OTOK 1WI6A 3QBWA 4DV3K 1LXJA 2HF3A 2VQFK 1BQMB 4IR1A 3O2IA 2BJ3A 5E3RA 3T69A 5E5NA 1ZQZA 1ZQLA 1X4GA 4JKGB 4MF8A 1FRKA 3DCAA 3PM9A 2M9NA 5D49A 4ZN1A 4JHDB 1RA7A 3GP9A 4USUA 3SQIA 4I2FA 1N32F 5C0YA 2WHEA 4ECVA 2HG4A 3H2LA 3NUQA 4FWOA 4CIGA 4USAA 4JI0K 5AQIA 3VQAA 2HAFA 2WZ1A 1H6KX 3MN9A 1Q9YA 4PHEA 4HTUA 4ZCMA 1R3NA 4CWBA 1NEEA 3MEKA 2BW2A 2DHGA 4KB7A 1NHKL 1KR4A 4I2HA 4OIXA 4LF9J 2VJVA 2ZDPA 1Q79A 2G13A 1GK8A 2RS8A 2AMCB 1NGCA 1X7VA 2QLWA 3M8PA 1Z4NA 3JB9k 2G8KA 4C8OA 1K5OA 4NI2A 3BSOA 5A8RA 1SJ1A 2LYAA 2MSSA 3OYGA 4QZ8A 1ZBHA 1RSCA 3MECA 4DV1F 4F4ZA 5BPCA 4LFBJ 2MKIA 3P3DA 4NLCA 3V7KA 2HHWA 4OHYA 4CZGA 4USWA 2H3GX 4P2HA 4LSLA 2VYPA 4ZVPB 3FMWA 3SR6A 4CGIA 3OYKA 2K4PA 3BREA 4QR0A 5EY4A 4QIWC 2QXLA 4CP5A 5AQLA 1U1NA 4NXMJ 1TQLA 4NZ0A 1S59A 2FMQA 3L2UA 1ZBFA 4B1UB 4V19X 3ISCA 2LECA 3CC7S 3F0NA 3AVMA 1M5PC 3F73A 3Q24A 4UOGA 1TP7A 2EFNA 1AQ6A 1S4EA 2HBQB 5FDLA 5AI8A 3AM9A 1RT3B 3BQ1A 1RXWA 4KHPK 2X3DA 4DDFA 4CHPA 3W61A 1ZOTA 3AY0A 2HBYB 4PAAA 3WX4A 2RF2B 5I42A 2F7TA 5LXRA 3R5DA 3THXA 1FWLA 4K59A 2B56A 3DU6A 2PFOA 4MH8A 2P35A 1SV5A 3G8SA 5L46A 1Z1ZA 1WCLA 1YJRA 4DCOB 1JROA 3DLEA 3C2MA 3UNGC 3C6TA 1U8WA 4AHTA 3H8MA 3OXFA 3CSKA 2UXCJ 3S6JA 2PN6A 1YJTA 1TL1B 2QA1A 3NGKA 4M7YA 2QTWA 2EBEA 1A77A 4F26A 3PHTA 1N34J 4CGJA 1PAEX 4DPOA 4Y2VA 3EXCX 3WXIA 2AX1A 2HPUA 2K8GA 4Z4HA 1R0BG 3K89A 1V3RA 5KFVA 4PL1A 3TJAA 4RW4B 1URNA 4LFCF 1ZQSA 5LXYA 3MM7A 4MHVA 4QZVB 4ZVOB 2HNYA 2PFFB 1W0HA 4CBWA 1NGHA 1RT6A 1GQEA 4KH1B 4A4JA 2C3PA 2YNHB 4DV1K 3ISDA 5C42B 1TL3B 4AH9A 4M0AA 4AL5A 4Y2CA 3HVTA 2K4EA 3VAKA 1VBXA 4UB8U 1U09A 4ED7A 2JHDA 1FDNA 3C15A 4C6AA 2E1YA 4BC4A 2ZH3A 2RLTA 3DRPB 3QETA 1HRHA 1E4GT 4FJNA 4F2SA 1PK1A 2C22A 3U9DA 4PWDB 2B6GA 3M8QB 2MMYA 3KNAA 2GWSA 4G1PA 2JLFA 3CCZA 3CB4A 5HMLA 1BA0A 4BX9C 2DFLA 3MPVA 4IO8A 1Q16B 2P9PA 3M5RA 4CI6A 3PDNA 2A2CA 1I6JA 3PW5A 2Z1HA 3ENQA 2QA2A 3ZSZA 1BPZA 2F9DA 4C0ZA 5J2QA 2V8GA 4I64A 3THTA 3HK2A 2MHNA 5ALYA 4KHNA 2LA4A 1RDFA 2CVEA 4UW9A 1X9SA 1B9DA 4WIQA 3D2EA 2EEYA 2YY6A 1DY3A 4B3TJ 4FJMA 4JKCA 3PCOB 2BJ9A 3QNWB 4QYZJ 1BIZA 4OJGA 4F4YA 5BPLA 3AQPA 1EARA 1HBUB 2VC0A 1U1QA 1HYZA 1NGGA 9ICLA 2YX1A 2Y0SC 5A6WA 1F9HA 3NGSA 4DV4F 2V9WA 3KD1E 2XTJP 5F3TA 2DNYA 3ZNJ1 3IG1A 4IWVA 2WCXA 1Z00B 2ISOA 1TE2A 2W11A 1GXTA 5ALEA 4UATA 2CJBA 2GVDB 2DNRA 1K1SA 2X6SA 1ZETA 2QB1A 1FEHA 2DNMA 3J81O 4CNQA 3LH2S 4I27A 4LF4J 9ICVA 4N77A 3VGSA 5KFRA 2V2VA 3FQKA 2DFFA 1Q95G 2HB5A 4ZOHC 1ZPVA 3Q22A 3M30A 3QE9Y 5FP0A 4DR7J 1J97A 1XC9A 4DL2A 2Q4TA 4HHUA 3M2UA 4FPBA 3UMBA 5IC6B 4XUSA 4LFCK 1BIUA 2IM0A 1VLYA 5M2RA 1P6TA 3GFKB 1MMNA 1OQ6A 2LA6A 3OBYA 1JN3A 1X9XA 5F8HA 4FL9A 4DMNA 5ALVA 4DL3A 2A6AA 5A0LA 1PC5A 2K7JA 3LM9A 2FB0A 2VGMA 1WJ9A 2R7WA 2M7SA 3DXSX 3TUIC 4CIFA 3G4SN 1L3SA 4DR6J 3JTNA 1KVJA 2GIQA 2NUBA 1UVJA 3CCES 2DWQA 1SCJB 1RTHA 1SV4A 2ABYA 3JQMA 4G65A 1Q3VA 2LHTA 4GVMA 1HLWA 2Q3PA 5DLGA 1J2NA 1B22A 3CHWA 2G9OA 3D1QA 4Z0UA 4IQWA 3CCRN 1VQ8N 5GMEA 2GEMA 2XVTA 4CDIA 3CJSA 4ECTA 3L7PA 2JR5A 3PO5A 1GEHA 1BGXT 2KFYA 2IIHA 3P39A 2PFQA 1UEKA 3OYJA 5C5JA 3SBGA 2FGOA 4J37A 2GCFA 1UOCA 1XNQJ 4G6VB 3QT7A 3R1LA 1U6FA 2PI4A 5AE3A 2VG6B 3IR5B 3WXMB 4ICLA 2HSEB 3G4SS 4ZHRA 1MN9A 3EVWA 2BANB 2EAMA 4O23A 1C4AA 2BOAA 4KHUA 4A8FA 4M3YA 2LFVA 2QKKA 1Q78A 4DV7K 1WWUA 1X4HA 1SZ2A 3CCRS 1VQ8S 3BSCA 3D7SB 1X5PA 4ZS6A 2ZHBA 2KYZA 2G0JA 3F56A 4W5OA 1QH9A 3PXGa 2CWXA 1M90O 2HBJA 3C29A 1FW6A 2ES6A 2JEJA 4IDHA 4WBFA 3VQDA 3AQOA 3LWLA 3OL8A 3QU9A 7ICJA 3EUNA 2XC9A 1C6VA 2ZBCA 4DQQA 5KT4A 3KZXA 4DCCA 3OL9A 2A3ZA 1KOHA 2O8EA 3MAHA 2D1KA 4PWUA 2Z2ZA 1U8SA 1Q1KA 3E8OA 2WSCC 3E51A 5HVHA 4WQ4C 1G2EA 3WKCA 4FJ5A 4QZAA 1DGKN 1LK5A 2FJWA 2PE8A 5GMDA 1NLKL 3HULA 1SC4B 4FWRA 4HDHA 4QJVA 2Q31A 3SFGA 3HO1A 4PGQA 1X4BA 3MEDA 1W7AA 2QLBB 1N36F 2I1QA 2EWHA 3PVXA 1LOUA 1VQ9N 4J9UE 4NO7A 2H5EA 5J1PA 4BQLA 3F2CA 5D0EA 4CEBA 3VHQA 3ULEA 4KSEB 4R64A 3B6OA 4CHQA 4CJLA 3C65A 3M2RA 4JNEA 5KQ8A 4I6AA 3W7BA 4DSLA 4JB8B 2IPOB 3TTDA 4DOZA 2DHAA 4LFAK 4JI5F 4PG6A 3M6UA 2C2OB 2AZ3A 4OHWA 2KXHA 2QMXA 5AJ3K 2CAJA 2YQ3A 4ECQA 1KEJA 2QG9B 2KVQE 4TKTA 2OTJN 2DEJA 4UT4A 3KHGA 3LGMA 3UIQA 5L1MA 2WFAA 2LU1A 2MY7A 9ICWA 1VQ9S 3CDWA 3WQTA 4Z94A 2P9KB 4MEYA 4ZIWA 4KH4A 2CJ9A 5LJVA 2WVCA 2AEJA 4XH4A 4KPCA 4AQYJ 2GJIA 2IDEA 5F8NA 4P2XA 2ZJQL 3J7YU 3FCWA 4MKBA 2VJ5A 2XEXA 5KPRA 1BOTO 2N82B 3NBPA 4US8A 1WSGA 3GONA 3OJSA 3RMBA 4G9ZA 1RWXB 3TUZC 3R5GA 5KFUA 1TV6B 3PFEA 1VRUB 1K8KA 2CQ4A 3C7NA 4TLQA 4O3RA 3VQSA 1CUKA 1TVRA 2UUBF 1V97A 4YCXA 1IBLK 4K4GA 3MEGA 3PSFA 2OTJS 4KHWA 4JI4J 4OVLA 3P6YC 2NSCA 1RT1A 2FVSA 4LBPA 1FWPA 1QUPA 3CMAN 1N5WA 2R7TA 2E20A 3Q7BA 3JPSA 1JALA 2ZOMA 1SXDA 1RBTA 4P4MA 4HTJA 2CH6A 5KT2A 3QYYA 5IT0A 4EZ9A 1I1GA 2R7YA 3J7Z5 3R8YA 4O3SA 5IWAF 2QWRA 4OFZA 3UPQA 4OV6A 4IOCL 3LTOA 2E1AA 3O4QA 4B9LA 2E5GA 2D6FC 1X0PA 3R97A 2SXLA 4ES1A 3B0YA 2WSFC 2VG5B 2EG1A 2ZZNA 1GH8A 1Q18A 4A8QA 4JV0A 1HNZF 2IAJB