3PVBA

Crystal structure of (73-244)ria:c holoenzyme of camp-dependent protein kinase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
345
structure length
341
Chain Sequence
AKKGEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (73-244)RIa:C holoenzyme of cAMP-dependent Protein kinase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 81
structure length 341
sequence length 345
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pvbA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pvbA02
1L8TA 5JQ5A 4BY9E 4I94A 1SVEA 5JMSA 5AX9A 1Q3WA 4FT7A 4WG3A 5TE0A 3FMHA 3U6JA 3HKOA 2XEYA 2OO8X 4X2FA 2VO3A 3ZXZA 4ZS4A 4BCNA 4FL2A 4BWKA 2UZTA 5T6KA 2PMOX 2VV9A 4FMQA 3BHYA 3TZ8A 3C4WA 4E7WA 1H1WA 4TNDA 3FL5A 1K9AA 1UKIA 3W2RA 3EN9A 5B7VA 4WBBB 2HY0A 5IKWA 1Y8GA 3PY3A 4TYHB 4YLLA 5B2KA 3I5ZA 1A48A 4I4FA 1CKIA 2QOFA 2YIRA 3FE3A 1Q8YA 3EFKA 4FKVA 4OTPA 4DG0E 4JRVA 4F9CA 2VTMA 3AC2A 4A9RA 2VX3A 2OBJA 2XYNA 3ENHA 4GYIA 4IM3A 4Q2AA 5HLWA 3ATSA 2WMTA 2JKQA 3RWPA 4QMYA 4BCFA 3MIYA 4DFXE 3AD5A 3ZBFA 2Z7SA 3HRBA 3L8VA 4BI2A 4NW6A 3CTJA 1ZWSA 3AC8A 3FQHA 5E8WA 3U4WA 2CGWA 4M13A 3O7LD 2R3MA 3NNVA 3Q04A 4L3LA 4BYJA 4BZDA 5E8UA 4O84A 2QU6A 2R3JA 1GY3A 3RPRA 4DTKA 1M17A 3V5LA 3MYGA 4G5JA 4PF4A 4RVTA 3QQLA 3Q96A 2XZSA 4RZWA 4UWBA 1H01A 1DAYA 2WMUA 5H8BA 3R21A 4QMLA 3TNIA 3C4EA 3KEXA 4G6NA 1OPLA 1NY3A 3FZTA 3OXZA 3QRTA 5HNGA 5HBJA 4DT9A 5CAPA 3SC1A 4LRMA 4QOXA 4F7LA 1H1QA 5CAUA 3UIMA 2XNNA 3P23A 5HBHA 4O83A 1DAWA 3BRBA 3E64A 3V5TA 2HWPA 4EONA 2R3KA 5CASA 4LFIA 2ZV2A 3F2NA 5AP4A 4FI1A 3OF0A 1JLUE 2XK8A 2QOOA 2VX1A 1YXSA 2R64A 2ZV7A 2JKMA 2O8YA 3MH3A 4Y72A 4XP3A 3BHVA 5DR9A 2C1AA 2UW6A 3VQUA 1MUOA 5HO6A 4F65A 3UQFA 3NRMA 3B2TA 2FGIA 3C13A 3KF7A 4IIRA 4JBOA 4G5PA 4QQCA 4USFA 2WEVA 3KRLA 5IF1A 2P2IA 2XNEA 3BGZA 5HG7A 2C6LA 2BUJA 5D1JA 3G9LX 3KRWA 4QP4A 5HE2A 3RAKA 3RPOA 4BZOA 2F7XE 4USDA 4MKCA 1G8AA 3PE2A 5HGIA 5LWMA 4U41A 4EH8A 2Q83A 4V05A 3VS5A 4BGQA 4J71A 4KINA 5CLPA 4K11A 2HZ0A 3LMGA 3LFAA 4LUEA 5C8NA 3EQHA 2JDOA 2X9EA 4OUCA 1SMHA 4CVAA 4JDIA 4PDYA 4A4XA 2WMAA 4FKWA 1B38A 5DG5A 4GUBA 4AA5A 4ITIA 4GV1A 3EQCA 2JBPA 3F69A 3FMLA 4U44A 3V01A 4ZTSA 4IM0A 3DK3A 4IZYA 4PL5A 5H2UA 4Z3VA 2E9NA 4HNIA 4NFMA 4V04A 2BIKB 3UG2A 3HMOA 3R1SA 2IW9A 5ANJA 2IZRA 3G5DA 1OL7A 5IUIA 2PE0A 4FVPA 5DYJA 5E90A 2X2LA 3RAIA 2QODA 3E3PA 5LMKA 1Q8UA 3ID6C 2XKEA 4L46A 5M55A 3P1AA 1GOLA 2J51A 2XK6A 4QP2A 4APPA 5L2IA 5ANOA 3V3VA 2IW6A 4ONAA 1CKPA 3IGOA 4WNPA 3HEGA 3R8PA 5CSWA 3OP5A 4AF3A 2CDZA 1ZOHA 4YNOA 1WVWA 1Q8TA 3E8EA 3PZEA 3R6XA 4QTBA 5DIAA 3W1FA 5JN2A 4N70A 3R71A 3C4CA 1JSTA 3JYAA 3KQ7A 3WBLA 2UW0A 3FDNA 3L9NA 3MVMA 3SD0A 3PIZA 3GU8A 4C4HA 2ZM3A 3G51A 3GQIA 3VS0A 3KXHA 3ZRKA 4BRXA 4FTJA 3BV3A 4JAIA 1KE9A 1OGUA 4IAAA 5AR4A 4YTCA 2XKDA 2RG6A 4NM0A 2F57A 2BCJA 4HYUA 3MS9A 4RIWA 1UV5A 5CAOA 3E62A 2PUNA 4L3PA 1TQMA 3CKWA 3BU6A 5L6WL 4ZJVA 2VTTA 4DBNA 4RX7A 5CVGA 2VWUA 1G5SA 3UP2A 4EK6A 4W8DA 3ZH8A 2C0IA 5HVKA 1OKWA 1OKZA 2JC6A 4KIKB 5I9WA 4Y83A 4FX3A 2CNUA 4O7SA 3QF9A 3E8CA 1YI4A 4OTDA 4BYIA 2B9IA 1R0PA 4IAFA 4FNWA 5LCKA 4RVMA 5AP2A 4O0XA 2OIQA 3HV7A 4IJ9A 3KCKA 4FEQA 2PVJA 3TJCA 5FUTA 2E9PA 3RHXA 4DITA 5BX0A 4HZSA 2RSVA 2VTNA 4Y73A 3GCQA 3LXKA 2G2FA 3WZJA 2VAGA 2QG7A 4WG4A 4M7IA 1LEZA 3I1AA 4JBVA 2J4ZA 3QRJA 2VTLA 4PUZA 4UXLA 4B9DA 4Z7GA 5BVNA 4IFGA 4XJ0A 3EYHA 4X6QC 2BRBA 4YJVA 2UVZA 3T9IA 4YGAA 3GOKA 5D10A 3PJ8A 2WQOA 4M69B 4RLLA 3ZO3A 3QGWA 4YSJA 2ITYA 4MF0A 3ANQA 4CFXA 4IVCA 4FSTA 5B0XA 5HNBA 4DBXA 4PPAA 3UGCA 4MAOA 4RJ4A 4DHFA 2B55A 1UNHA 4OT5A 5HI2A 3VRZA 2HXQA 3PA4A 5M44A 4F08A 4FTIA 5HLPA 4F7JA 3CPBA 4Y5QA 1TQIA 4GIIA 3BGPA 3G2FA 2B0QA 3F3UA 3TZ7A 1NA7A 4RC3A 4TYHA 4L52A 4J8MA 4ZY4A 3MVLA 4KS7A 2GSFA 1I09A 2QURA 4ANLA 3OWJA 1U4DA 2EXMA 4I0RA 1UWHA 2UZWE 4BBMA 3RKBA 4TRLA 4EHVA 4EHZA 2P2HA 1OL6A 4IANA 2VNYA 3OW3A 4XNEA 3NGAA 4XOYA 3QA8A 4RVKA 3DAKA 4JG8A 5CEQA 2HIWA 3RI1A 4EK5A 3UZRA 3SA0A 1YWRA 4PTEA 5ANDA 4E8AA 3LE6A 4IQ6A 4H3BA 4RA5A 3OG7A 3S1HA 2RF9A 5KNJA 4XOZA 3DT1A 3VC4A 4HJOA 2GCDA 4KSQA 1U5RA 2BTSA 3HDMA 4J96A 4QP1A 4YNEA 5CAVA 4AFJA 4PP7A 2Y4IC 5DMZA 3ZM9A 2QI8A 3TN8A 3D14A 3R1QA 1ATPE 1R1WA 1XKKA 3JY0A 1XO2B 5HG8A 2GNIA 2UZLA 3B8RA 1F3MC 4IC8A 4DEDA 4DFYA 3HYHA 2X2KA 4KIKA 4EI4A 3VUKA 3AGLA 2VUWA 3UYTA 4RC2A 2BTRA 3C4ZA 5IEYA 1V0PA 4G3GA 1P2AA 2J2IB 4NFNA 3FSKA 4OTRA 3A7HA 3H3CA 5AP7A 5HVJA 1P4OA 4L53A 5A4EA 1PXLA 5L4QA 4JQ7A 1KSWA 1M7QA 4I1ZA 1WBOA 3DDPA 2C6OA 2GHGA 1Q97A 4P90A 1YHVA 3RTPA 3SG9A 2FO0A 1OMWA 1UU9A 4GS6A 5DHJA 3EN7A 4C33A 3S0OA 1LP4A 2IVTA 3A61A 3QX4A 4X6RA 3IDBA 5GJFA 3II5A 3S4QA 3IPHA 3SRVA 4E4XA 5IA5A 2PK9A 4ENXA 4C38A 2I0YA 4CZTA 3FMJA 2YIXA 4Q5HA 5FBNC 3I6WA 2X7OA 4DC2A 1U54B 2CSNA 4F1TA 3U55A 2C68A 5EI2A 3KL8A 1Y57A 4MTAA 3DZQA 2C6TA 2XKFA 2PSQA 1STCE 3R7YA 3ROCA 4AU8A 5BVOA 4DH8A 4IX6A 4DGLC 4B8LA 5EYMA 5F94A 3EH9A 3QZFA 4LQMA 3FJQE 5GJGA 3EIDA 2VZ6A 3WZEA 3QTZA 4RJ8A 3A7GA 3U4UA 3MGYA 3QRIA 4EQMA 4CG9A 2R3IA 2XIRA 3CQUA 2IWIA 3VBXA 2B9FA 4CFVA 4QMUA 4BVUA 3LCDA 1CM8A 4IVBA 1Z9XA 3NCZA 4PP9A 4YUQA 2GQGA 3E87A 3KK9A 3UVQA 3LVPA 5CU3A 4PY1A 2QO7A 4FIEA 4RWLA 4YBJA 3SQQA 2I0HA 4ANNA 4PMPA 3BGQA 4DGOA 5KE0A 3SOAA 5JGDA 5HICA 3DBDA 4I6HA 5AWMA 2QOQA 3DBQA 4QP3A 4FT5A 4ZJJA 3KKVA 5IDNA 2AC3A 5I3OA 4C3RA 3LM0A 5FQDC 3ZUVA 2ZOQA 3HGKA 3KK8A 1RDQE 3QTWA 4UBAA 4JI9A 5C01A 2PMIA 4FG9A 2JIUA 3MVJA 4D2TA 2BRNA 3IK3A 1WBPA 4BIBA 5LVPA 5HHWA 3ULZA 3FLWA 3KULB 3E8NA 3VS4A 4F9BA 1YHSA 2OZAA 3UE4A 5KHWA 4QT1A 3ZHPC 4B4LA 2XIKA 3W18A 4GKHA 4DN5A 3VJNA 4KIQA 4L45A 2R4BA 2PZYA 5JZNA 2R3PA 4ERWA 4NTTA 1UA2A 2GDOA 3QGYA 3RPSA 4D2WA 4FNXA 4AGWA 5EDPA 2X7FA 2JEDA 4L44A 4WG5A 4F1OA 5CF4A 2WAJA 4W4VA 5AUUA 3R30A 2EXEA 1P14A 2J50A 4G6LA 3D2KA 4HVGA 3MWUA 5CWZA 2AUHA 2QO2A 4EOQA 1APME 2G2HA 3NZ0A 4QO9A 3KVXA 1FVVA 4KD1A 4ZTQA 4B99A 4JQ8A 4CQEA 3F2AA 4X2JA 3HVCA 4TN6A 2OZAB 3H9RA 5CF6A 2WMXA 5HCZA 2W1FA 4YHJA 5HVYA 5E7RA 3WYXA 3BX5A 3T3UA 1VYZA 4BN1A 2WTKC 1IG1A 1TQPA 2KTYA 2BRMA 2P33A 4Z55A 1ZYSA 1GZKA 1J3HA 3KN6A 1PJKA 3FLZA 4FL1A 2WMVA 5DGZA 5EI6A 3R8MA 3RCJA 2P3GX 4JG6A 3ZSHA 4O7TA 4FL3A 3BYMA 4EH6A 3R00A 4FKGA 5JRSA 4BF2A 4YMJA 2QOBA 4TY1A 4A9UA 5A6NA 3PIYA 3DJ7A 5CI6A 2VN9A 3VHKA 3VAPA 4AWIA 4G3EA 4QQJA 2W1GA 5LARA 5A4QA 4UXQA 3QQUA 4O27B 2W06A 2WTCA 2F7ZE 4GVJA 3QCSA 3EB0A 3OCBA 3PWYA 4ZIMA 3THBA 4X2GA 4AN2A 4LG4A 4AT4A 4O0UA 3VUGA 1QPEA 4WD5A 3RNIA 1LR4A 3R1NA 5AJQA 4MD8E 3SXSA 3TJDA 5JK3A 2RFNA 2VTQA 4BDAA 4EC8A 1H4LA 4RGJA 5FXQA 3NYVA 4CCBA 2E9OA 4AACA 2X8DA 4MXYA 3GENA 3MB6A 3VBYA 4FK6A 4EH3A 5A46A 1VYWA 1CTPE 3P08A 2BPMA 4ZZOA 5KO1A 1SZMA 4AP7A 4U7ZA 3OTUA 4H3QA 2BILB 4IDTA 5KMNA 1OBGA 4YZMA 4A9SA 5CVHA 3CTQA 4EH5A 4KKHA 3Q6WA 3WZUA 1Q8WA 4C4GA 4I6QA 4PL4A 2X6EA 4NUSA 3GBZA 4BKYA 2IZTA 4ZSGA 3NUUA 2HENA 4BL1A 3PLAE 2YIYA 4D5HA 2X8IA 5EKOA 2GTNA 2VGPA 3QRUA 5EK7A 4Y85A 4D1SA 2QVSE 1Q41A 4IX4A 3NW5A 4NIFB 4R7IA 1SVGA 4IW0A 4ALVA 5JFSA 5KBQA 3P86A 2QKRA 2YITA 3CBLA 4NZWB 5AP1A 5IUGA 2XYUA 2WB8A 1YQJA 4CMUA 2CN8A 1Q5KA 3RAHA 3F2RA 3IW6A 4EJ7A 3OXTA 5CXZA 2BZIB 2ITWA 4L8MA 3FXXA 5IH5A 4YJQA 4XV3A 4D28A 3KC3A 2B54A 5EYCA 4FBXA 1RE8A 4KKEA 4Q5EA 3VNTA 2EB3A 4E6DA 1NW1A 3KXGA 4AZSA 2ZAZA 5KZIA 4CV8A 4DEBA 3QYZA 4U8ZA 4MBIA 1V1KA 4BBFA 3BHHA 4H3PA 2ZDTA 2OH0E 1FOTA 3RINA 5H9BA 1K2PA 1DS5A 2V55A 5I9ZA 4QTEA 5FM2A 3H0ZA 4IADA 1Y8YA 4MBLA 4XLVA 3GB2A 2PZ5A 3D5WA 3KXMA 3RK5A 3Q3BA 5IISA 2NPQA 3ZLWA 2BZKB 2PVRA 3DA6A 5EM8A 4FKIA 2F2CB 4IX5A 3HECA 3TNPC 4CYIA 2B1PA 4FV2A 3BIZA 4P7EA 3ZYAA 1U59A 3CS9A 1UVRA 2HK5A 4XG4A 2QKWB 1W8CA 3DFCB 3QC4A 5IG1A 3WARA 4IC7A 3LIJA 3WILA 3O0GA 1OUKA 4LRJA 3V51A 5ANEA 1BL7A 3SRVB 3WOWA 4F0IA 1UKHA 2GHLA 5A14A 4GFMA 4K9YA 4GIHA 4GKIA 2JBOA 2V62A 4IACA 3FL4A 3TZ9A 5JH6A 4FVRA 4G3CA 3NNUA 3NUNA 4H39A 4HPTE 4GMYA 5DNRA 2WQMA 5HTBA 3TV6A 2BIYA 3F9NA 1WCCA 3ETAA 3HLLA 4KBAA 3QD3A 3VUHA 3VBQA 4IBMA 3GFWA 2XNOA 3T8OA 5HLNA 5FXSA 1E1VA 2W1DA 4A9TA 2ZMDA 3BCEA 4LOQA 4DLIA 2HXLA 2WPAA 4WKQA 4EBVA 3CQWA 4M69A 2XBJA 3A99A 4D4RA 4G9RA 3I60A 3QKKA 4WUAA 5FTQA 3DDQA 1OM1A 3S00A 4I93A 4FV8A 2W5AA 5KBRA 1Q99A 4JRNA 2WTWA 2DWBA 2UZOA 3IGGA 5FEQA 3E7OA 3MFTA 2XMYA 4CEGA 2YIQA 4OTFA 3FAAA 4AA4A 5CSHA 5AR5A 3Q5IA 1OIYA 5AV4A 1OL1A 2X81A 4OR5A 4AGCA 4FTCA 5HD4A 3U6IA 3DQWA 4OT6A 4EOMA 4U80A 3L9LA 1KOAA 3EQBA 5LXMA 2R0UA 1DI8A 4QRCA 4MWHA 4XG2A 5FRIA 3R9RA 2PWLA 3I7BA 3QCXA 5M56A 2C0TA 3ERKA 1M52A 1ZLTA 4DT8A 4O7NA 4TL0A 3Q9YA 3K5VA 3SXRA 3S95A 1QL6A 3DQXA 4IDVA 2BALA 4E4LA 4S31A 2YWVA 5EFQA 2XKCA 4LOPA 5IDPA 4EZ3A 3EQRA 4F99A 4XG6A 4PV0A 5CQWA 4BFMA 4DEEA 3FPMA 3MBLA 4JJRA 2QOIA 2QOKA 4BBEA 5IZFA 5E9EA 2JDTA 3N4TA 2C3KA 3UYSA 4JIAA 4YJTA 3G33A 3OWLA 4BDKA 2YM8A 3AT3A 5AEPA 4JG7A 4RX8A 5DLSA 5E8TA 4NK9A 2A19B 2I1MA 1UNLA 4LMUA 2C5XA 5JZJA 4I24A 4J7BA 3FQSA 1OBDA 3RAWA 2DQ7X 3OHTA 4ALUA 2VTOA 2YCSA 3F88A 1RQQA 3R01A 4QMZA 4L67A 4RX9A 3ZBXA 3P9JA 2P4IA 5BUEA 2CGUA 3P0MA 4IE9A 4DLJA 5GZAA 3ORNA 4XH6A 3WF8A 4CKRA 2HWOA 1WBTA 4MQ2A 4AE6A 4O7YA 4I6BA 2XIXA 3IOPA 2W17A 2WIPA 3DJ6A 5KUPA 2QOHA 3CD3A 3AXWA 2PVKA 3CKXA 5ETFA 5FD2A 3VWAA 4CLIA 4E4NA 2YCFA 3QL8A 5JRQA 3QQKA 4FSMA 4BTFA 4LGGA 3DV3A 3SG8A 4M14A 2ZJWA 5CY3A 2OICA 4A06A 4F6SA 5I0BA 1H1PA 3QUPA 1H1RA 5HG9A 3U51A 3CD8A 3AQVA 4FIGA 3ZEWA 2H34A 1GZOA 3MV5A 3JXWA 3QU0A 3LQ5A 4U81A 2ERKA 1OECA 2R2PA 4DEAA 3NIZA 5AV1A 4C59A 5GNKA 3TL8A 4CCUA 4UMQA 2WIHA 2PU8A 2VTIA 3TCPA 3P7AA 3UQGA 3R22A 3IQ7A 1IAJA 4AZTA 5FDPA 1HCLA 2W4JA 4RZVA 3WZKA 4FVQA 3UOJA 2ZMCA 4AZVA 2F2UA 4TTHB 1CSNA 1FGIA 3AG9A 3Q32A 3PVUA 2PYWA 2CKEA 2OG8A 1IA9A 4G34A 5KKRC 4ASEA 2Y9QA 4U5JA 3K5UA 4FV9A 4HYSA 1Z5MA 4JQEA 3UNZA 2ERZE 1KWPA 3AT2A 3OT8A 3ODYX 4RPVA 3UOHA 4C2VA 4DG2E 2IZSA 3PXRA 1REKA 5J1WA 3PFQA 5AV2A 5HORA 5IH6A 4MD7E 4FV1A 2QD9A 3DLZA 4MQ1A 4M15A 2ZV8A 2YIWA 4IVDA 4YHTA 3F6XA 3KCFA 3IDPA 4JBQA 1U5QA 2PE1A 3A8XA 2LAVA 4FV0A 4L42A 5HNIX 3KMWA 3HNGA 4O0RA 4AN3A 3EQDA 3W2SA 2YN8A 1OITA 3ORIA 2J9MA 4FA2A 4DFUA 3FXWA 5FEEA 3F82A 2HY81 3BU3A 1FVTA 4EH2A 3NYOA 3EJ1A 3R9DA 3OWKA 5EM5A 4CFNA 3EFWA 3NS9A 2ZB0A 3AMAA 3V6SA 3RPVA 3MESA 1PXJA 3QZIA 4RJ3A 5KMLA 3LHJA 3W8QA 2YDIA 5M4CA 5E8XA 4W4WA 2B53A 2QU5A 3FHRA 5TKDA 2IPXA 4QTAA 1PXMA 4FT0A 4DE4A 1PMNA 1Z57A 4X3FC 5ANKA 5D9HA 2E9VA 4M12A 1OIRA 4EWHA 2HZIA 3PVBA 3VS1A 5IU2A 3LXNA 5LWNA 4GVAA 3R8LA 5BVDA 5A6OA 5AAGA 2WOUA 4BDHA 3QCYA 3KF4A 5DPVA 3JUHA 5DA3A 3A4PA 4FTUA 3ZU7A 2CNQA 3KRRA 2YDJA 3FBVA 3FMNA 2CPKE 3VF8A 4QD6A 2YJSA 2B52A 4IZ7A 3R8VA 2C6MA 4APCA 2PZPA 1YDTE 3MFUA 3ZLSA 4FOCA 2I7QA 4EKLA 4R6VA 3K54A 5AR2A 3IOKA 4GSBA 4NCTA 5AV3A 3D5VA 3F3WA 2ITZA 3F5GA 2QQ7A 3QWKA 3BYUA 2GU8A 3ZO2A 3LMHA 2FA2A 4J8NA 2UZDA 4KIPA 4PL3A 4RG0A 5CTPA 3RCDA 4F7NA 3R7EA 3D15A 3UG1A 4M0ZA 2GNLA 2R9SA 5BVEA 3WI6A 1VR2A 2OF2A 1PXNA 4I5CA 3EN4A 3DTWA 5HIDA 3OY3A 4RSSA 3OC1A 5HE1A 2WMSA 4RIXA 4TWOA 4FC0A 4WT6A 4RX5A 3WF7A 2SRCA 3A2CA 2A0CX 5DFPA 3ZFYA 4O82A 1KE6A 4ERKA 1ZMWA 4AAAA 4EYJA 4ZTMA 4ZZNA 4I21A 2R0IA 4W9XA 2HAKA 5DH3A 3HP5A 4RRVA 4R78A 5C4KA 3TUCA 4O7ZA 2ZM1A 2V5QA 4E4MA 3OUNB 2PL0A 4FSQA 4GUEA 3W33A 4K1BA 4RIOA 1PKGA 2XRWA 3NAXA 3QLFA 3LXLA 4UYNA 4RMZA 3FWQA 2QHMA 2UW8A 2XCKA 2Z60A 4WIHA 3DPKA 3CY3A 4L7FA 1XH8A 3VJOA 4EOLA 4AGDA 2X39A 5AUWA 1ZXEA 2CMWA 2C1BA 3BZ3A 3Q5ZA 4I20A 4MXZA 5ANGA 1Q4LA 3TIZA 3C9WA 3ZFMA 4QP7A 2V7AA 3IONA 4CXAA 4BR3A 3MPAA 4S33A 3COMA 4L9IA 3AGMA 3L1SA 4EWQA 4U0IA 5KX8A 1VJYA 3U54A 2EU9A 3DAJA 4ZMEA 4M3QA 4IZ5A 3OOMA 2C6KA 2QO9A 4YZ9A 4NYEA 3IW5A 5BUJA 3FLYA 1YI6A 4OTHA 3UMXA 2BZJA 4G2FA 3GI3A 3GT8A 3QYWA 2YZLA 4IAZA 3ATTA 3HAMA 4O81A 2VWYA 2DS1A 2GFCA 2W7XA 4TPTA 2WOTA 3R7GA 3GCPA 4E6AA 5IMEA 3FKNA 3DXQA 4N6YA 4FTQA 1Y6BA 2UZUE 1XH9A 2YM6A 3UTOA 2X6DA 4ITJA 1PYXA 1WVYA 3BLQA 4WSQA 3F5PA 4QYGA 3SHEA 4UWCA 1A06A 1H8FA 1KE5A 2NO3A 2O64A 3NMUF 3QTXA 2GNFA 2O0UA 4UMPA 4ASZA 4AA0A 2X1NA 3QQJA 3QTQA 3ACJA 1JSUA 4TWCA 3MH0A 4D9TA 3ZMMA 3PJ2A 5LQFA 3CGFA 4ZK5A 4YO6A 5FGKA 3EQIA 1WAKA 4MCVA 1BL6A 1FMOE 5AIKA 4V0GB 4J97A 4ANMA 4BDEA 1M7NA 4FGRA 2BFYA 4BCPA 5EHOA 3Q9WA 4D2VA 3GC7A 4CFMA 2XNPA 5D12A 4YO4A 4XS2A 3NNWA 3L9MA 3QTRA 1YVJA 5L8KA 3PDTA 3FMKA 3DS6A 3GVUA 4AT3A 1WBNA 2WQNA 3C1XA 2YAKA 4YJOA 3K3JA 5EW3A 1PMVA 1ZRZA 4QYEA 4YZBA 4FIJA 3ORKA 4JX7A 3GCVA 5BYYA 3M2WA 4WSYA 3HA6A 5FG8A 3A4OX 4J52A 3VQHA 4D1ZA 3FMDA 2R5TA 1YW2A 2XK7A 2CKPA 4MXOA 4JX3A 2BMCA 4RJ5A 2BROA 3R7IA 1Q3DA 4CYJA 3MTFA 2BAQA 4OTIA 4JS8A 5I9UA 3GCUA 5LCJA 3NCGA 3OD6X 5GZ8A 2UVYA 3HRCA 1B6CB 4P4CA 3JS2A 1Q62A 3RZBA 4MBJA 2R7BA 4QMXA 4RVLA 2PPQA 2OJFE 3OTVA 5F95A 5HX6A 1I44A 2OIDA 3G6HA 3N9XA 2BHEA 4EUUA 3DTCA 3GXLA 3V6RA 3C4XA 5CS6A 3IW7A 4AW2A 4YPDA 5CZIA 5M4FA 3DFAA 1A9UA 4I23A 2WU6A 5J1VA 2FSMX 3TUBA 2FSLX 3R63A 1JWHA 4JDHA 3BQCA 3E5AA 4E20A 5CVFA 2EB2A 2O65A 4XBRA 1PHKA 2EWAA 4K6ZA 1O6KA 4KA3A 4OAUC 4JNWA 3MY1A 2V0DA 2G2IA 4KRCA 3AMBA 3PPKA 3LCSA 4IB5A 5D41A 4CRSA 1WZYA 1IR3A 3PJ3A 5K0KA 4E6CA 3ZZEA 3RK7A 3F5XA 4G3FA 4ZSLA 4PDOA 4FEUA 2JGZA 4I0SA 1JAMA 3ZSIA 4AXAA 1JKSA 3UPXA 2XVDA 3POOA 3LFNA 3REPA 3ZUTA 4V0GA 4ANBA 1YKRA 4CT2A 3N4VA 4FT9A 4J53A 4S34A 4JOAA 1NXKA 5E1SA 3VULA 4IJPA 2UW5A 2R3LA 4C36A 5C1QB 1PXPA 3QTUA 4U43A 4W4YA 4C4IA 2UW4A 3B8QA 5CEOA 2F4JA 3VUTA 2HYYA 4BCMA 4BDJA 1IEPA 3UIUA 3QUDA 5EKNA 4FTKA 4UV0A 4YHFA 5DE2A 5AR7A 5CEIA 5I5ZA 5M51A 1AD5A 1T46A 2NRYA 2BHHA 3MA6A 5JGAA 4BZNA 5I9XA 4FKOA 3FZRA 3HZTA 3QTIA 3ZXTA 2ITQA 2VWWA 2XIYA 1QCFA 2Y4PA 3BLHA 2FYSA 3Q2MA 3QC9A 3SLSA 1XBCA 3R1YA 2WNTA 2Z7RA 4FTMA 1E1XA 3PP1A 2PVYA 5L8LA 1MRVA 1S9IA 3R7VA 1LUFA 3BE9A 4WNOA 3MDYA 4DG3E 3RVGA 5FTOA 3R02A 2RFEA 3O51A 1ZY4A 3PP0A 4U40A 1PMEA 4DFZE 5DEYA 2ITNA 4O2PA 4J98A 3H10A 5HEZA 5J95A 1XH4A 4EH7A 4K33A 4EUTA 3R83A 4H36A 4FICA 4UMTA 3NYXA 2GS2A 3HRFA 4QMMA 5L3AA 3NIEA 4YLKA 4F63A 1HOWA 3MH2A 3QD0A 3ZRLA 4O7LA 3Q4ZA 4IMYA 3R7OA 3OBGA 3RMFA 3L8XA 3IG7A 5LMKC 1JQHA 1JPAA 4D4SA 4PQNA 2PUUA 1PKDA 1TKIA 4FNYA 5HBEA 2ITPA 2OXYA 4UX9A 5CX9A 4FEWA 3UVPA 2Z2WA 4PWNA 4O1OA 4QMSA 3MB7A 4UB7A 3QQFA 3QD2B 2P0CA 4ZJIA 4LGDA 3EQPA 3N4UA 1OKYA 1CMKE 1ZZ2A 3I4BA 3LFCA 5L8JA 2JDVA 4JL9A 4XG8A 2WKMA 5C8KA 5M08A 3SAYA 3QD4A 4UALA 3UVRA 5DBXA 3BQRA 3KXZA 4G17A 5BQ0A 3Q2JA 5JFWA 2IVUA 3O50A 4QNAA 3QA0A 4CFWA 4R3PA 5DT3A 2XJ1A 2Z7LA 3HMNA 3Q4UA 2JFLA 2QCSA 3BV2A 1PY5A 2BRGA 2WHBA 2RGPA 3CJGA 5DT0A 3PJ1A 4XP0A 4O86A 4DCAA 5M4UA 3R9NA 2A1AB 3C5IA 1H00A 1OIQA 2RG5A 1XHAA 1YI3A 3PXFA 2H9VA 4GJ2A 3U9NA 4DH7A 4GG7A 5J9YA 1Q24A 3U6HA 3A7JA 2VWIA 4QMTA 4AX8A 2HZNA 4C35A 4BWPA 5IQDA 3VF9A 2X0GA 4D9UA 2X4FA 3LM5A 2C3IB 3Q4TA 1R78A 4ASDA 4D0XA 4RBLA 4EL9A 2VTAA 4DH1A 2YEXA 4II5A 1E9HA 3PZHA 3IKAA 2OJIA 3QLGA 4F9YA 1ZOEA 2HW6A 2JAVA 2VWVA 5CXHA 2OJ9A 3TACA 4MNFA 3NYNA 2PVFA 3R0TA 4I3ZA 4M84A 4LL0A 3F61A 4MH7A 3ELJA 4HYHA 2HW7A 5CNNA 3WF6A 2YM3A 1IA8A 2PVMA 4IHPA 3SDJA 1Q61A 5EW9A 5TOZA 4IEBA 2RL5A 4OAVB 3C51A 5EQPA 5HTCA 4IWQA 4EZ5A 2NNWB 2ONLC 1RW8A 3DKOA 3GC9A 5H8GA 2C4GA 3ZOSA 5A4LA 4YLJA 1BI8A 4YP8A 3MVHA 1OZ1A 4PDSA 4D55A 4TW9A 1NT2A 3E3BX 5BPYA 5M07A 4MXAA 4GRBA 3LMIA 5CZHA 3GU4A 2CKOA 4DAWA 5E8SA 1UNGA 1WMKA 2C3LA 5J8IA 4FZ7A 4YC6A 3FC1X 3EMGA 3K3IA 4HGEA 5IQBA 2C47A 2OU7A 4IWPA 4Z9LA 4RWKA 4PPBA 3JR1A 4ZS0A 4RLKA 4NEUA 4TZRA 4CZUA 3KN5A 3ZRMA 2C6IA 2JLDA 4D0WA 4XRLA 1XR1A 3OEZA 4IAYA 3BELA 4C37A 4G31A 2VO6A 4FEVA 3HUCA 3UO5A 1FQ1B 3QBNA 2R3OA 5EDRA 3R9HA 5CALA 4XV1A 4EC9A 2OZOA 3MY0A 3IS5A 3D7TA 4FIHA 2QONA 3E63A 1OVEA 5HKMA 3VVHA 3ANRA 3TTJA 1ZMVA 4IB1A 4E5BA 1G3NA 3ZUUA 2Q0NA 3TI1A 4WO5A 4EORA 4KWPA 3DKCA 1O6YA 5HU9A 4G3DA 2GS6A 3JPVA 3SX9A 4FTRA 4FV3A 5LVMA 3HMPA 2GNGA 3FYKX 4TXCA 4RIYB 3BPRA 4ZMFA 3ZCLA 4ZSAA 3UBDA 2G9XA 2FSOX 4UZHA 5GIPE 2PUIA 1DM2A 5J87A 3ENMA 2Y6MA 3NUXA 3KFAA 4OTQA 1YRPA 2JIVA 2B9HA 5IQCA 2W1EA 2W99B 4N6ZA 5LMBA 3QAME 5IQIA 3T3VA 2IVVA 4FYNA 2W4OA 5E91A 3C5UA 5CSXA 1BKXA 5HZNA 1G8SA 3NUPA 3QCQA 2J0JA 5CSVA 2YDKA 2W9ZB 2OF4A 4E3CA 5HD7A 3TIYA 3RP9A 2UW3A 3OFMA 4CD0A 2XH5A 4QQ5A 2R3RA 3BWJA 5EM7A 2YHVA 4AUAA 4F70A 5J5SA 4GT5A 4WUNA 4CFUA 1ZAOA 3IDCA 4D5KA 2XJ0A 1V0OA 5JQ8A 4HNFA 2ZYBA 2VTRA 3WIKA 3WZDA 5IA4A 3NLBA 2XB7A 4EQUA 3CP9A 1QPCA 2IO6A 3FKLA 4E5WA 1PRYA 4AW0A 4ALWA 4BCQA 3FI2A 3A8WA 1JOWB 4F1MA 2ITOA 3PYYA 5IH4A 2PTKA 2PVNA 4YTHA 4JR3A 2XIZA 4FUYA 4RFZA 4AOTA 1BI7A 4PTCA 4IH8A 1XBAA 5AFVA 1GZ8A 2J0LA 4NM3A 3GP0A 4FYOA 4O7WA 2REIA 3TG1A 3LFFA 1WVXA 3N51A 3JVRA 3K2LA 5BMSA 3FZOA 5J7BA 1GIIA 4N57A 2QC6A 2WFYA 3JY9A 3POZA 4M66A 4NW5A 3VO3A 3EN6A 5GJDA 4KSPA 4BCGA 2PULA 4FKRA 4D1XA 2Z7QA 4QNYA 3LFDA 3PUPA 5AUXA 2CNVA 4DTAA 4W4XA 4U97A 1YDRE 4DGMA 3AC4A 4BCIA 5L6OA 5E8YA 5TO8A 2BRHA 4I5PA 4E1ZA 5JEBA 4FT3A 4ORKA 3OMVA 1IRKA 4NIFA 2NRUA 5CU6A 2CCHA 4FE2A 3A7FA 4AE9A 4JLCA 5IPJA 5IUHA 3I0OA 4YU2A 4JDKA 5M57A 5F4NA 3TKUA 5E4HA 2ESMA 4FIIA 2J90A 1MQBA 4ZY5A 2C5YA 5LVLA 4MYGA 2Z8CA 3RJCA 2JD5A 3CEKA 4GW8A 3PXKA 4O22A 3QKMA 1JVPP 2IZUA 3EQGA 1KV2A 4D4VA 4BTJA 3BYSA 3NUYA 3O8PA 3ORPA 4FZAB 4HZRA 4TYEA 4C8BA 3VUIA 3P78A 4QYHA 2OH4A 3ZTXA 1H28A 5CEKA 2XK4A 5DEWA 3TKHA 3F3ZA 4O7VA 4PTGA 4YZNA 2GQSA 3U87A 4IWOA 3FZPA 3QUEA 4ACDA 4QP9A 5I9VA 5J79A 3MY5A 1UU8A 4HPUE 1ZYCA 5GZ9A 4C02A 2Y0AA 3NWWA 2OLCA 2XNBA 5E8ZA 3Q9ZA 3ORLA 4ZLYA 2HCKA 4PMMA 4KBCA 4U79A 3AT4A 1XH7A 3NPCA 1J91A 1MRUA 3OBJA 3P7BA 4NT4A 4X3JA 4K8AA 4FK3A 1AGWA 2CN5A 2VD5A 5DR6A 3V5QA 3MPMA 4U3ZA 2R7IA 3COIA 4OW8A 1GNGA 3ZFXA 5EHLA 3FI4A 3RALA 2X2MA 3RK9A 4FGBA 2OXDA 3DBEA 3MTLA 5FP5A 4NJDA 3LCOA 2YWPA 3G0FA 4FTOA 4EJNA 3VS3A 2FH9A 4PRJA 2PMNX 3U8WA 4QTCA 4QMVA 3OS3A 5IQEA 3FZ1A 5B2MA 4CNHA 1GAGA 5EI8A 4M68A 4R3CA 2ZDUA 1FGKA 1REJA 4K0YA 4MEDA 1R0EA 3Q53A 5BUIA 3PPJA 5FBOA 3FXZA 4DINA 5LJJA 5JGBA 3LQ8A 2F7EE 3A60A 4X2KA 2BKZA 1W83A 4MNEB 4R5SA 3ZDUA 2PHKA 1XQZA 3QQHA 4NSTA 3BEAA 3SOCA 3VBWA 4LGHA 4DFLA 5CAQA 3HDNA 2OFUA 4X2NA 5HU3A 2UZNA 3TNHA 3F7WA 3U9CA 2WELA 1OL2A 4CKIA 4QMWA 5L2QA 3ZDIA 2OJJA 3D9VA 5KHXA 3CGOA 1MRYA 3ORZA 3PG1A 3I6UA 4KKGA 4DYMA 3ALNA 1JKKA 2A2AA 3H9FA 4BHZA 5K3YA 1GIHA 5AP0A 3RWQA 4WRGA 4I41A 2WQEA 2GPHA 3W2CA 4JXFA 4EH4A 3RZFA 2B7AA 3LAUA 3O8TA 3I81A 4NWMA 3V5PA 4YSMA 3NEWA 3FHIA 2OWBA 3D4QA 3HMIA 3W2OA 4F0FA 2BAKA 3AMYA 4FKUA 4J1RA 4WRSA 4AZEA 3SV0A 4AW5A 3UNJA 4I5HA 4WNMA 2ETMA 4DEIA 4EHGA 3ORXA 2IJMA 3ALOA 3EQFA 1NVSA 2RFDA 3DU8A 5HIEA 1EH4A 4FKSA 4WA9A 4XX9A 3FKOA 2GNHA 3G90X 3Q52A 3I5NA 2VTHA 4S2ZA 5CF5A 1CDKA 2PY3A 5ETAA 3I0QA 3QHRA 2VO7A 1LEWA 4M97A 2YJRA 3DBFA 3FV8A 2C5OA 4DF3A 3IW8A 1KOBA 4YJRA 1AQ1A 4GH2A 1ZY5A 1OI9A 2HZ4A 3DXNA 4ZP5A 5E8VA 4CMOA 5J5TA 4FSNA 4NTSA 2VWBA 3QWJA 1ZMUA 1ZYDA 1P4FA 1OKVA 4UYAA 2J5FA 2YM5A 4ZZMA 4LV5A 4XLIA 4F4PA 4F09A 2UVXA 3MW1A 3UODA 4BIEA 3WF5A 4C0TA 4O38A 5CI7A 1ZARA 3V04A 2EXCX 3NW6A 2F9GA 4AQCA 4QMQA 4UN0C 4HCTA 2C3JA 3D2IA 3O8UA 3OT3A 4Q9SA 4D2PA 1W84A 3KB7A 3CPCA 1R3CA 5JSMA 5FWKK 2CLXA 4YJSA 4BCJA 2W05A 1O9UA 4UZDA 2XM9A 4AZWA 2XP2A 3QALE 4PNIA 2EUFB 4WOVA 3TTIA 4MHAA 4RA4A 4AGUA 4AN9A 5IA2A 4ZEGA 4CG8A 2W1IA 5E1EA 3BE2A 3RBWA 1YOJA 4PMSA 3OOGA 1RJBA 5BYLA 2P55A 4BGGA 4EOJA 2NP8A 3CSVA 2CGVA 4L6QA 3BHUA 4OLIA 1H08A 5EDQA 4R7BA 4LOOA 4EBWA 4XV9A 4S30A 2VWZA 3DOGA 3RPYA 3JVSA 3PE1A 4GK3A 5DVRA 1BYGA 2ETKA 4ZXTA 3AD6A 4ID7A 1K3AA 5A9UA 3VHEA 3UPZA 5C8MA 3PTGA 4AW1A 4N0SA 1H07A 5KZ0A 4I92A 5HO7A 4XG3A 2Z02A 2I40A 4FV4A 5LVNA 2UW7A 5KMMA 4ACCA 3TNWA 4BICA 5TR6A 2O5KA 3EZRA 2W0JA 4ZSJA 3LFEA 3D5UA 3MI9A 2YLEA 2XBAA 3TV7A 5K4IA 4LI5A 4L7SA 4ZTHA 3HMMA 4FV7A 3GOPA 5GINE 1Y6AA 1J7LA 3VUMA 3LFBA 3DK6A 4Y46A 4O0SA 4CMTA 4UWYA 4RWJA 4MF1A 4Y5HA 2XJ2A 3GQLA 3PY0A 4BDIA 2OSCA 4FF8A 2Q0BA 3EFLA 3LPBA 4QP6A 2UZBA 4KABA 5D7VA 3OROA 2ZVAA 5AA8A 1IASA 1H27A 2VO0A 4O6LA 4GJ3A 4TYIA 2I6LA 3B2WA 2R3FA 3UNKA 1XWSA 1V0BA 1M14A 3BYOA 2PZIA 4DTBA 3LXPA 4Y8DA 5ICPA 4UY9A 1OL5A 4AFEA 4K18A 4AZFA 2C6EA 4PPCA 2W5HA 3KU2A 4RFYA 1VZOA 4R77A 5FDXA 2PMLX 4IX3A 5BVFA 4O0WA 4DGNA 2C69A 3G9NA 4J95A 3SW4A 4LV8A 4BTMA 3TDVA 3FLSA 4X7QA 5K5NA 4NJ3A 2UV2A 4I6FA 1W0XC 4R8QA 3A7IA 3HV5A 4FEXA 4ANSA 2ONLA 4E26A 4QYFA 4A4OA 3FLNC 1QPJA 2Y6OA 1XH5A 3TNQB 2F49A 4X0MA 2DYLA 4FTTA 1OUYA 4JAJA 4LYNA 3QXPA 4FSZA 5F1ZA 5IQFA 2WEIA 3COHA 4QPAA 3R73A 4EOIA 4QMPA 3QRKA 5JKGA 3H9OA 3ZM4A 3KGAA 4P2KA 4QPMA 2W4KA 2RIOA 3GC0A 4IVAA 2PUPA 2YFXA 3VS2A 2J0KA 1OPKA 2PE2A 2ZM4A 5AP3A 5AM7A 4BB4A 3FUPA 4GL9A 1S9JA 1JBPE 3LFSA 2V7OA 3CXWA 4GT3A 4YC3A 4YZCA 5AR3A 3TEIA 3DLSA 4BDBA 3ZC5A 4MVFA 3HUBA 5JFXA 3OEFX 3EHAA 4GG5A 3C0GA 5TT7A 1PYEA 2A27A 3O17A 3FSFA 4RT7A 3NR9A 4HGTA 2YZAA 4IZAA 2OJGA 4U45A 3TZMA 3NDMA 5BNJA 5F9EA 1FMKA 2V22A 2JKKA 3PVWA 4ACMA 3M1SA 3AD4A 4XRJA 1YXXA 2FB8A 2BR1A 3OVVA 4O21A 5CENA 4MNEA 3ROYA 3OCTA 3Q9XA 3PY1A 3EWHA 3GEQA 4CGAA 3FY2A 4FG8A 1H24A 3ZO1A 3E92A 4C4EA 4F7SA 3LLAA 3HX4A 5G6VA 5KMOA 4L43A 2CKQA 4ZSEA 5AV0A 4MWIA 4W8EA 5M06A 3EYGA 3R04A 3PXQA 4TYJA 1YOLA 3H4JA 2ACXA 4GT4A 4LUDA 3ZO4A 4C34A 3ZEPA 4JT3A 4RJ7A 4XG7A 3EN5A 5EYDA 3O7LB 3ZS5A 4JR7A 3SKCA 4HVDA 4X3FB 3NUAA 2WTJA 2YABA 5K9IA 5CEMA 5FM3A 3FPQA 4FR4A 2XUUA 5FEDA 3V8SA 3F3VA 3UO4A 2YLFA 1YXTA 2HELA 2XNMA 3KA0A 3DXPA 1Q8ZA 4GEOA 3QZGA 2Y8OA 3WF9A 3SW7A 2R3QA 3ULIA 3WIGA 2VNWA 4F64A 2PVHA 3Q60A 5EQYA 3GU6A 2UW9A 4HGSA 3PRIA 4MK0A 1J7UA 5D11A 1FBNA 5CU4A 4HOKA 2WD1A 2B4SB 3R7UA 3MJ2A 3IO7A 4FKJA 5LOHA 1PXKA 3Q6UA 4TWNA 4EHEA 3AC5A 4Z16A 5KKRB 3MIAA 2J6MA 4MX9A 4KNBA 4X21A 2Y4IB 4QP8A 4BC6A 4YTFA 3W2QA 3HV4A 4PNKA 2I0EA 5AMNA 2GFSA 1BLXA 2VTSA 2XNGA 3DJ5A 5ACBC 5M4IA 2WU7A 4QPSA 4KAOA 3W55A 4E6QA 2O63A 4D2SA 4GK4A 4FIFA 4BCHA 4LRKA 5FTGA 5LVOA 4CKJA 4HCUA 5B2LA 2QOCA 3R9OA 1YXUA 4FODA 3LJ0A 3EZVA 3FC2A 1SNUA 2R3NA 4XUFA 1XBBA 4C58A 4HGLA 2C5VA 5TF9A 1U54A 1SM2A 2R3GA 3ITZA 5HG5A 4EH9A 3BWFA 1IAHA 3VUDA 4MXCA 1UU7A 2ITXA 5K5XA 3OCSA 3F3TA 3GU5A 4O7RA 3UJGA 3M11A 4X3FA 3W8LA 4ZLZA 4CZYB 1H0VA 4O0VA 5I4NA 4PDPA 2I0VA 5HCXA 2BDWA 4ENYA 4F9AA 3G6GA 3WE4A 3KMUA 4BGHA 2BKKA 4M8TA 4ZTRA 4EK3A 4R1VA 2G1TA 4H05A 4I0TA 2PZRA 4FKQA 3TM0A 4ZAUA 3UZTA 2H6DA 3NVKI 3UOLA 4WHZA 3D94A 4RIYA 3CTHA 4KBKA 2IW8A 4NKSA 3UMWA 4GU6A 4EEVA 4ASXA 3E93A 4OBPA 4CSVA 3TKIA 1M2PA 4EQCA 3NVMB 2X4ZA 3EFJA 3FEGA 5IEXA 2WMWA 1MQ4A 1YHWA 2WO6A 5CT7A 3QKLA 5ANIA 2WMRA 5L2SA 4RIXB 1ZOGA 5HX8A 3PXZA 4FTNA 3KY2A 2GQRA 4XV2A 2JIIA 2C6DA 4OGRA 4TWPA 4DEGA 4JBPA 3C0IA 5DR2A 3D7TB 2YERA 4C7TA 1JKTA 1PXIA 5EOBA 4C2WA 4GU9A 5FXRA 4IB3A 4V01A 5AX3A 5E92A 2R3HA 3CJFA 3DY7A 3GFEA 4PX6A 1F0QA 5HCYA 1GZNA 3NUSA 3AC3A 4BI1A 4DEHA 4CLJA 5LMAA 4NCTC 1VEBA 3ZLYA 1T45A 5BMMA 3LQ3A 2CLQA 3QXOA 1KE8A 1BX6A 3DNEA 3HP2A 4AOJA 3UQCA 3GGFA 4I5MA 4K2RA 4Y95A 4B8MA 1QPDA 2WQBA 5ETIA 5C9CA 1ZZLA 4CRLA 5L6PA 3LCKA 4IWDA 4GK2A 4IFCA 1W98A 3DKFA 4I4EA 5HE3A 4E93A 3VN9A 4MD9E 2OFVA 2OIBA 5AIRA 1W82A 5ACKA 1MP8A 2GS7A 2BDJA 3UC4A 4H58A 4QQTA 1YDSE 2UUEA 2W1HA 4FTAA 3ZLXA 3HV6A 5AUZA 5HQ0A 4YZDA 2YCRA 3QZHA 5EOLA 3P7CA 4BTKA 5M53A 4XYFA 4EOSA 4YURA 3TT0A 3W32A 2QOLA 2W1ZA 4Z7HA 3TV4A 3AOXA 2VX0A 3NAYA 1L3RE 1XH6A 4U3YA 4P5QA 3PRFA 5CQUA 3ORMA 3Q4CA 2BFXA 2A4LA 2YM4A 4ZLOA 3EL8A 2O3PA 4FTLA 3UOKA 3S2PA 3UIXA 4J99A 3TWJA 1SYKA 5HO8A 5KMJA 4IAIA 2C0OA 2UZEA 2FVDA 3VRYA 4AS0A 2GHMA 5FP6A 4G6OA 3G15A 2IG7A 3FLQA 2YCQA 4H1JA 1SNXA 4USEA 4FSYA 4YTIA 3CIKA 3CY2A 3DKGA 4DH3A 1CKJA 3ORTA 3BLRA 5CNOA 2BVAA 2GTMA 1U46A 4EK8A 4ZY6A 5CANA 4FV6A 4BHNA 2XS0A 1JSVA 3NX8A 4N4SA 4NM5A 4UMUA 5K0XA 4ZOGA 5EH0A 3GUBA 4B7TA 2LGCA 4E5AX 3HAVA 1KV1A 3FZSA 3HL7A 2XF0A 3M42A 1H1SA 1WBSA 5H3QA 5BVWA 1OB3A 2QHNA 4O0YA 4CFFA 3W2PA 1Y91A 5BYZA 4XEYA 4FKLA 4TNBA 3ZZWA 5IQGA 4ACGA 4ZTLA 4FUXA 4KIOA 4EK4A 3DBCA 4O6EA 3KREA 1FINA 4CTBA 3KXXA 4LM5A 4CTCA 4DFNA 4GFOA 3I79A 5AUVA 4FSRA 4QTDA 3MFSA 2EVAA 2C5NA 3R28A 3RNYA 5A4TA 4C3FA 5EG3A 5JT2A 3UIBA 2H96A 3RHKA 3NNXA 4FZDB 5J7HA 2G15A 4RWIA 4BI0A 4M67A 3S3IA 3F5UA 2OKRA 1ZYJA 3C50A 4YJNA 4L68A 1QMZA 3PSDA 4D58A 2QR7A 5IA1A 3OZ6A 1ZYLA 3V5WA 3RGFA 2WMQA 4ARKA 4JDJA 5C4LA 3QX2A 5FLFA 5M09A 3F66A 3PG3A 1YOMA 1YWNA 3W16A 2WTVA 2J7TA 4RIWB 2BAJA 5EW8A 5A54A 3G0EA 5EHYA 5GIOE 4KUJA 5AR8A 3GNIB 3DGKA 4A4LA 2OGVA 2VTJA 1URCA 3C0HA 4C61A 1WFCA 1XJDA 3DCVA 3FI8A 2RFSA 3OUKA 4F0GA 1X8BA 5CT0A 5CYIA 5C27A 3GCSA 4AG8A 4U6RA 2J5EA 4F9WA 4YJPA 2C30A 2CJMA 4WBOA 3IW4A 4W9WA 5IQAA 4RFMA 4E73A 1GIJA 3BU5A 3OWPA 3EKNA 4HVSA 2X9FA 3ZC6A 1PXOA 5IEVA 4DFBA 4U42A 5EM6A 5EQEA 4IAKA 4U9AA 5DI1A 3DAEA 1B39A 3O2MA 2VU3A 4L3JA 3IECA 4BDCA 5A4CA 1PMUA 4RQKA 4NKAA 3W10A 2O2UA 4YC8A 5JFVA 4XCUA 3OW4A 3FMMA 4C62A 2X8EA 3V8TA 5D7AA 4R5YA 4UMRA 5ITAA 2ETRA 1M2RA 2XCHA 3PVGA 3LFQA 1H26A 4JIKA 4QYYA 3FMEA 4BWXA 3NSZA 4R7HA 3RM6A 4OTGA 3AC1A 4ANOA 3VW8A 2J0IA 3L8PA 2OXXA 1JKLA 2OW3A 4R1YA 3WE8A 4B0GA 5HE0A 4F6UA 3DZOA 4BIDA 4FV5A 1KE7A 3O96A 4B6LA 4EOPA 3E88A 2G01A 2JAMA 1KUTA 1ND4A 2E2BA 2J0MB 2WMBA 3VW6A 4FSUA 4QMNA 4DA5A 1PF8A 4DH5A 3UDBA 2DUVA 2QR8A 4C4FA 2WTKB 3TXOA 3GC8A 5GHVA 3PLSA 4G16A 4HVIA 4EOOA 1UWJA 3KULA 1FVRA 4HCVA 5J9LA 3SGCA 3LOKA 4HW7A 1J1CA 1LPUA 1HCKA 3V5JA 5KMKA 3DNDA 1R39A 2WGJA 3VBVA 1BUHA 4ANQA 3EKKA 2B9JA 4GFGA 1DI9A 3MFRA 5AAEA 1NVRA 5HESA 3MN3A 2YA9A 3PA5A 4IM2A 3GU7A 3BKBA 4BCKA 3BBTB 1NVQA 2E9UA 3LCTA 4AT5A 1BMKA 3CCNA 3VS6A 2Y7JA 3FI3A 3WYYA 4BDGA 4C4JA 1GJOA 4FKTA 4P5ZA 3R8UA 4CQGA 5K4JA 3KVWA 4O91A 5L2WA 4OTWA 4G9CA 3QHWA 1SVHA 3CLYA 4EOKA 3T9TA 4TYGA 5ETCA 4AOIA 3EL7A 2YAAA 3BYVA 3DB8A 3R8ZA 4DGGA 1J7IA 4NL0A 3L8SA 3LZBA 5AADA 1P5EA 2XRUA 4K77A 3LKMA 1H0WA 3P5KA 4TT7A 4C57A 3TUDA 4A7CA 4EKKA 5CF8A 3RM7A 2WZJA 3D83A 4FZ6A 2CGXA 2W5BA 1ERKA 1JNKA 1H25A 3CQEA 5DRBA 4TKSA 3D7ZA 4BCOA 1TVOA 3R2BA 3UP7A 2AYPA 3ZSGA 4DCEA 2QG5A 3ET7A 3PWDA 5HIBA 3PA3A 3P4KA 2JDRA 5G1XA 4O2ZA 4MXXA 2CCIA 3PPZA 4LMNA 5T3QA 4F6WA 2YM7A 3KRXA 3KXNA 4UEUA 5DOSA 3UO6A 3VIDA 2ITUA 5AUTA 3CE3A 3PSCA 1M2QA 2WTIA 3R2YA 4XHKB 3MA3A 2RKUA 5DT4A 5KMIA 1URWA 5IQHA 3TDWA 2QLQA 5T68A 2IN6A 2ITVA 3C4FA 3F7ZA 2XM8A 3ODZX 3P79A 4ITHA 4KRDA 3KRJA 3BEGA 2W96B 3BHTA 4XG9A 2VWXA 4BKZA 3QTSA 3L9PA 5A3XA 5AP6A 5CEPA 4YBKA 2QLUA 2XA4A 4FG7A 3H30A 3DB6A 2JKOA 2XK3A 4FSWA 1OIUA 3A62A 1FPUA 4NU1A 3D0EA 5IA0A 1O6LA 3H0YA 3OY1A 3I7CA 3OXIA 2YISA 3CC6A 1W7HA 3EOCA 4A9YA 4IB0A 4FOBA 4O96A 4L01A 1F5QA 3D5XA 2X7GA 2XK9A 2UZVA 2BZHB 3E7VA 3MJ1A 3PXYA 2H8HA 4D4YA 3VBTA 5I9YA 3E8DA 4RC4A 4YPSA 5BVKA 4XMOA 2JFMA 2FSTX 4ZTNA 4RJ6A 4EYMA 4CT1A 3HA8A 4M0YA 4QMOA 3LLTA 3BI6A 4I22A 3SXFA 2PVLA 5CSPA 4D2RA 4XP2A 5HTIA 4HVHA 3PJCA 3QQGA 5C03A 4GYGA 1WBVA 4G1WA 5IMXA 5F20A 5C26A 2JITA 2YACA 4KS8A 3KMMA 4OBQA 2XEZA 3C7QA 2OI4X 4RQVA 5AM6A 5AAFA 3V8WA 2VTPA 3PSBA 3LJ2A 3ZONA 4YR8A 3MPTA 1OPJA 2IVSA 3OCGA 4H1MA 2VGOA 2ZB1A 3BBWA 5CU0A 2JDSA 3VS7A 3ACKA 4OBOA 2ITTA 4C3PA 4HYIA 1YWVA 2GMXA 3FQEA 2ZV9A 4S32A 4BKJA 3QFVA 5H8EA 4Q9ZA 3SVVA 4O1PA 5AUYA 5AA9A 5DWRA 4KB8A 3MH1A 2GNJA 5EYKA 2WTDA 4YJUA 3UZPA 4FKPA 4ACHA 5KCVA 4NH1A 2WXVA 4IXPA 5IA3A 2W9FB 1WBWA 3O23A 4O0TA 2HOGA 3FY0A 4XBUA 2KULA 3DK7A 5I3RA 5HOAA 4EZ7A 4L00A 4JVGA 2VRXA 4FZFB 4PMTA 4BDFA 3LW0A 5DRDA 4GCJA 4NM7A 3CR0A 1J1BA 2FUMA 4FNZA 5CU2A 2BDFA 4A07A 5L2TA 4R3RA 1UU3A 4CV9A 5AP5A 3COKA 3MSSA 2W1CA 2CHLA 1YXVA 4LL5A 3NW7A 4BDDA 5DN3A 3HV3A 3LJ1A 3PIXA 3UC3A 2QNJA 3O71A 4WNKA 5J9ZA 3FYJX 2OK1A 2AC5A 1PW2A
chains in the Genus database with same CATH superfamily
1L8TA 5JQ5A 4BY9E 4I94A 1SVEA 5JMSA 5AX9A 1Q3WA 4FT7A 4WG3A 5TE0A 3FMHA 3U6JA 3HKOA 2XEYA 2OO8X 4X2FA 2VO3A 3ZXZA 4ZS4A 4BCNA 4FL2A 4BWKA 2UZTA 5T6KA 2PMOX 2VV9A 4FMQA 3BHYA 3TZ8A 3C4WA 4E7WA 1H1WA 4TNDA 3FL5A 1K9AA 1UKIA 3W2RA 3EN9A 5B7VA 4WBBB 2HY0A 5IKWA 1Y8GA 3PY3A 4TYHB 4YLLA 5B2KA 3I5ZA 1A48A 4I4FA 1CKIA 2QOFA 2YIRA 3FE3A 1Q8YA 3EFKA 4FKVA 4OTPA 4DG0E 4JRVA 4F9CA 2VTMA 3AC2A 4A9RA 2VX3A 2OBJA 2XYNA 3ENHA 4GYIA 4IM3A 4Q2AA 5HLWA 3ATSA 2WMTA 2JKQA 3RWPA 4QMYA 4BCFA 3MIYA 4DFXE 3AD5A 3ZBFA 2Z7SA 3HRBA 3L8VA 4BI2A 4NW6A 3CTJA 1ZWSA 3AC8A 3FQHA 5E8WA 3U4WA 2CGWA 4M13A 3O7LD 2R3MA 3NNVA 3Q04A 4L3LA 4BYJA 4BZDA 5E8UA 4O84A 2QU6A 2R3JA 1GY3A 3RPRA 4DTKA 1M17A 3V5LA 3MYGA 4G5JA 4PF4A 4RVTA 3QQLA 3Q96A 2XZSA 4RZWA 4UWBA 1H01A 1DAYA 2WMUA 5H8BA 3R21A 4QMLA 3TNIA 3C4EA 3KEXA 4G6NA 1OPLA 1NY3A 3FZTA 3OXZA 3QRTA 5HNGA 5HBJA 4DT9A 5CAPA 3SC1A 4LRMA 4QOXA 4F7LA 1H1QA 5CAUA 3UIMA 2XNNA 3P23A 5HBHA 4O83A 1DAWA 3BRBA 3E64A 3V5TA 2HWPA 4EONA 2R3KA 5CASA 4LFIA 2ZV2A 3F2NA 5AP4A 4FI1A 3OF0A 1JLUE 2XK8A 2QOOA 2VX1A 1YXSA 2R64A 2ZV7A 2JKMA 1ST4A 2O8YA 3MH3A 4Y72A 4XP3A 3BHVA 5DR9A 2C1AA 2UW6A 3VQUA 1MUOA 5HO6A 4F65A 3UQFA 3NRMA 3B2TA 2FGIA 3C13A 3KF7A 4IIRA 4JBOA 4G5PA 4QQCA 4USFA 2WEVA 3KRLA 5IF1A 2P2IA 2XNEA 3BGZA 5HG7A 2C6LA 2BUJA 5D1JA 3G9LX 3KRWA 4QP4A 5HE2A 3RAKA 3RPOA 4BZOA 2F7XE 4USDA 4MKCA 1G8AA 3PE2A 5HGIA 5LWMA 4U41A 4EH8A 2Q83A 4V05A 3VS5A 4BGQA 4J71A 4KINA 5CLPA 4K11A 2HZ0A 3LMGA 3LFAA 4LUEA 5C8NA 3EQHA 2JDOA 2X9EA 4OUCA 1SMHA 4CVAA 4JDIA 4PDYA 4A4XA 2WMAA 4FKWA 1B38A 5DG5A 4GUBA 4AA5A 4ITIA 4GV1A 3EQCA 2JBPA 3F69A 3FMLA 4U44A 3V01A 4ZTSA 4IM0A 3DK3A 4IZYA 4PL5A 5H2UA 4Z3VA 2E9NA 4HNIA 4NFMA 4V04A 2BIKB 3UG2A 3HMOA 3R1SA 2IW9A 5ANJA 2IZRA 3G5DA 1OL7A 5IUIA 2PE0A 4FVPA 5DYJA 5E90A 2X2LA 3RAIA 2QODA 3E3PA 5LMKA 1Q8UA 3ID6C 2XKEA 4L46A 5M55A 1XMMA 3P1AA 1GOLA 2J51A 2XK6A 4QP2A 4APPA 5L2IA 5ANOA 3V3VA 2IW6A 4ONAA 1CKPA 3IGOA 4WNPA 3HEGA 3R8PA 5CSWA 3OP5A 4AF3A 2CDZA 1ZOHA 4YNOA 1WVWA 1Q8TA 3E8EA 3PZEA 3R6XA 4QTBA 5DIAA 3W1FA 5JN2A 4N70A 3R71A 4AAYA 3C4CA 1JSTA 3JYAA 3KQ7A 3WBLA 2UW0A 3FDNA 3L9NA 3MVMA 3SD0A 3PIZA 3GU8A 4C4HA 2ZM3A 3G51A 3GQIA 3VS0A 3KXHA 3ZRKA 4BRXA 4FTJA 3BV3A 4JAIA 1KE9A 1OGUA 4IAAA 5AR4A 4YTCA 2XKDA 2RG6A 4NM0A 2F57A 2BCJA 4HYUA 3MS9A 4RIWA 1UV5A 5CAOA 3E62A 2PUNA 4L3PA 1TQMA 3CKWA 3BU6A 5L6WL 4ZJVA 2VTTA 4DBNA 4RX7A 5CVGA 2VWUA 1G5SA 3UP2A 4EK6A 4DHIB 4W8DA 3O5AA 3ZH8A 2C0IA 5HVKA 1OKWA 1OKZA 2JC6A 4KIKB 5I9WA 4Y83A 4FX3A 2CNUA 4O7SA 3QF9A 3E8CA 1YI4A 4OTDA 4BYIA 2B9IA 1R0PA 4IAFA 4FNWA 5LCKA 4RVMA 5AP2A 4O0XA 2OIQA 3HV7A 4IJ9A 3KCKA 4FEQA 2PVJA 3TJCA 5FUTA 2E9PA 3RHXA 4DITA 5BX0A 3PFYA 4HZSA 2RSVA 2VTNA 4Y73A 3GCQA 3LXKA 2G2FA 3WZJA 2VAGA 2QG7A 4WG4A 4M7IA 1LEZA 3I1AA 4JBVA 2J4ZA 3QRJA 2VTLA 4PUZA 4UXLA 4B9DA 4Z7GA 5BVNA 4IFGA 4XJ0A 3EYHA 4X6QC 2BRBA 4YJVA 2UVZA 3T9IA 2IF8A 4YGAA 3GOKA 5D10A 3PJ8A 2WQOA 4M69B 4RLLA 3ZO3A 3QGWA 4YSJA 2ITYA 4MF0A 3ANQA 4CFXA 4IVCA 4FSTA 5B0XA 5HNBA 4DBXA 4PPAA 3UGCA 4MAOA 4RJ4A 4DHFA 2B55A 1UNHA 4OT5A 5HI2A 3VRZA 2HXQA 3PA4A 5M44A 4F08A 4FTIA 5HLPA 4F7JA 3CPBA 2XAOA 4Y5QA 1TQIA 4GIIA 3BGPA 3G2FA 2B0QA 3F3UA 3TZ7A 1NA7A 4RC3A 4TYHA 4L52A 4J8MA 4ZY4A 3MVLA 4KS7A 2GSFA 1I09A 2QURA 4ANLA 3OWJA 1U4DA 2EXMA 4JMQA 4I0RA 1UWHA 2UZWE 4BBMA 3RKBA 4TRLA 4EHVA 4EHZA 2P2HA 1OL6A 4IANA 2IEWA 2VNYA 3OW3A 3NGAA 4XNEA 3QA8A 4XOYA 4RVKA 3DAKA 4JG8A 5CEQA 2HIWA 3RI1A 4EK5A 3UZRA 3SA0A 1YWRA 4PTEA 5ANDA 4E8AA 3LE6A 4IQ6A 4H3BA 4RA5A 3OG7A 3S1HA 2RF9A 5KNJA 4XOZA 3DT1A 3VC4A 4HJOA 1TFFA 2GCDA 4KSQA 1U5RA 2BTSA 3HDMA 4J96A 4QP1A 4YNEA 5CAVA 4AFJA 4PP7A 2Y4IC 5DMZA 3ZM9A 2QI8A 3TN8A 3D14A 2XANA 3R1QA 1ATPE 1R1WA 1XKKA 3JY0A 1XO2B 5HG8A 2GNIA 2UZLA 3B8RA 1F3MC 4IC8A 4DEDA 4DFYA 3HYHA 2X2KA 4KIKA 4EI4A 3VUKA 3AGLA 2VUWA 3UYTA 4RC2A 2BTRA 3C4ZA 5IEYA 1V0PA 4FJVA 4O4DA 4G3GA 1P2AA 2J2IB 4NFNA 3FSKA 4OTRA 3A7HA 3H3CA 5AP7A 5HVJA 1P4OA 4L53A 5A4EA 1PXLA 5L4QA 4JQ7A 3W0OA 1KSWA 1M7QA 4I1ZA 1WBOA 3DDPA 3NFGB 2C6OA 2GHGA 1Q97A 4P90A 1YHVA 3RTPA 3SG9A 2FO0A 1OMWA 1UU9A 4GS6A 5DHJA 3EN7A 4C33A 3S0OA 1LP4A 2IVTA 3A61A 3QX4A 4X6RA 3IDBA 5GJFA 3II5A 3S4QA 3IPHA 3SRVA 4E4XA 5IA5A 2PK9A 4ENXA 4C38A 2I0YA 4CZTA 3FMJA 2YIXA 4Q5HA 5FBNC 3I6WA 2X7OA 4DC2A 1U54B 2CSNA 4F1TA 3U55A 2C68A 5EI2A 3KL8A 1Y57A 4MTAA 3DZQA 2C6TA 2XKFA 2PSQA 1STCE 3R7YA 3ROCA 4AU8A 5BVOA 4DH8A 4IX6A 4DGLC 4B8LA 5EYMA 5F94A 3EH9A 3QZFA 4LQMA 3FJQE 5GJGA 3EIDA 2VZ6A 3WZEA 3QTZA 4RJ8A 3A7GA 3U4UA 3MGYA 3QRIA 4EQMA 4CG9A 2R3IA 2XIRA 3CQUA 2IWIA 3VBXA 2B9FA 4CFVA 4QMUA 4BVUA 3LCDA 1CM8A 4IVBA 1Z9XA 3NCZA 4PP9A 4YUQA 2GQGA 3E87A 3KK9A 3UVQA 3LVPA 5CU3A 4PY1A 2QO7A 4FIEA 4RWLA 4YBJA 3SQQA 2I0HA 4ANNA 4PMPA 3BGQA 4DGOA 5KE0A 3SOAA 5JGDA 5HICA 3DBDA 4I6HA 5AWMA 2QOQA 3DBQA 4QP3A 4FT5A 4ZJJA 3KKVA 5IDNA 2AC3A 5I3OA 4C3RA 3LM0A 5FQDC 3ZUVA 2ZOQA 3HGKA 3KK8A 1RDQE 3QTWA 4UBAA 4JI9A 5C01A 2PMIA 4FG9A 3PUFC 2JIUA 3MVJA 4D2TA 2BRNA 3IK3A 1WBPA 4BIBA 5LVPA 5HHWA 3ULZA 3FLWA 3KULB 3E8NA 3VS4A 4F9BA 1YHSA 2OZAA 3UE4A 5KHWA 4QT1A 3ZHPC 4B4LA 2XIKA 3W18A 4GKHA 4DN5A 3VJNA 4KIQA 4L45A 2R4BA 2PZYA 5JZNA 2R3PA 4ERWA 4NTTA 1UA2A 2GDOA 3QGYA 3RPSA 4D2WA 4FNXA 4AGWA 5EDPA 2X7FA 2JEDA 4L44A 4WG5A 4F1OA 5CF4A 2WAJA 4W4VA 5AUUA 3R30A 2EXEA 1P14A 2J50A 4G6LA 3D2KA 4HVGA 3MWUA 5CWZA 2AUHA 2QO2A 4EOQA 1APME 2G2HA 3NZ0A 4QO9A 3KVXA 1FVVA 4KD1A 4ZTQA 4B99A 4JQ8A 4CQEA 3F2AA 4X2JA 3HVCA 4TN6A 2OZAB 3H9RA 5CF6A 2WMXA 5HCZA 2W1FA 4YHJA 5HVYA 5E7RA 3WYXA 3BX5A 3T3UA 2ZFYA 1VYZA 4BN1A 2WTKC 1IG1A 1TQPA 4AXCA 2KTYA 2BRMA 2P33A 4Z55A 1ZYSA 1GZKA 1J3HA 3KN6A 1PJKA 3FLZA 4FL1A 2WMVA 5DGZA 5EI6A 3R8MA 3RCJA 2P3GX 4JG6A 3ZSHA 4O7TA 4FL3A 3BYMA 4EH6A 3R00A 4FKGA 5JRSA 4BF2A 4YMJA 2QOBA 4TY1A 4A9UA 5A6NA 3PIYA 3DJ7A 5CI6A 2VN9A 3VHKA 3VAPA 4AWIA 4G3EA 4QQJA 2W1GA 5LARA 5A4QA 4UXQA 3QQUA 4O27B 2W06A 2WTCA 2F7ZE 4GVJA 3QCSA 3EB0A 3OCBA 3PWYA 4ZIMA 3THBA 4X2GA 4AN2A 4LG4A 4AT4A 4O0UA 3VUGA 1QPEA 4WD5A 3RNIA 1LR4A 3R1NA 5AJQA 4MD8E 3SXSA 3TJDA 5JK3A 2RFNA 2VTQA 4BDAA 4EC8A 1H4LA 4RGJA 5FXQA 3NYVA 4CCBA 2E9OA 4AACA 2X8DA 4MXYA 3GENA 3MB6A 3VBYA 4FK6A 4EH3A 5A46A 1VYWA 1CTPE 3P08A 2BPMA 4ZZOA 5KO1A 1SZMA 4AP7A 4U7ZA 3OTUA 4H3QA 2BILB 4IDTA 5KMNA 1OBGA 4YZMA 4A9SA 5CVHA 3CTQA 4EH5A 4KKHA 3Q6WA 3WZUA 1Q8WA 4C4GA 4BJJA 4I6QA 4PL4A 2X6EA 4NUSA 3GBZA 4BKYA 2IZTA 4ZSGA 3NUUA 2HENA 4BL1A 3PLAE 2YIYA 4D5HA 2X8IA 5EKOA 2GTNA 2VGPA 3QRUA 5EK7A 4Y85A 4D1SA 2QVSE 1Q41A 4IX4A 3NW5A 4NIFB 4R7IA 1SVGA 4IW0A 4ALVA 5JFSA 5KBQA 3P86A 2QKRA 2YITA 3CBLA 4NZWB 5AP1A 5IUGA 2XYUA 2WB8A 1YQJA 4CMUA 2CN8A 1Q5KA 3RAHA 3F2RA 3IW6A 4EJ7A 3OXTA 5CXZA 2BZIB 2ITWA 4L8MA 3FXXA 5IH5A 4YJQA 4XV3A 4D28A 3KC3A 2B54A 5EYCA 4FBXA 1RE8A 4KKEA 4Q5EA 3VNTA 2EB3A 4E6DA 1NW1A 3KXGA 4AZSA 2ZAZA 5KZIA 4CV8A 4DEBA 3QYZA 4U8ZA 1G8JA 4MBIA 1V1KA 4BBFA 3BHHA 4H3PA 2ZDTA 2OH0E 1FOTA 3RINA 5H9BA 1K2PA 1DS5A 2V55A 5I9ZA 4QTEA 5FM2A 3H0ZA 4IADA 1Y8YA 4MBLA 4XLVA 4BJJB 3GB2A 2PZ5A 3D5WA 3KXMA 3UDSA 3RK5A 3Q3BA 5IISA 2NPQA 3ZLWA 2BZKB 2PVRA 3DA6A 5EM8A 4FKIA 2F2CB 4IX5A 3HECA 3TNPC 4CYIA 2B1PA 4FV2A 3BIZA 4P7EA 3ZYAA 1U59A 3CS9A 1UVRA 2HK5A 4XG4A 2QKWB 1W8CA 3DFCB 3QC4A 5IG1A 3WARA 4IC7A 3LIJA 3WILA 3O0GA 1OUKA 4LRJA 3V51A 5ANEA 1BL7A 3SRVB 3WOWA 4F0IA 1UKHA 2GHLA 5A14A 4GFMA 4K9YA 4GIHA 4GKIA 2JBOA 2V62A 4IACA 3FL4A 3TZ9A 5JH6A 4FVRA 4G3CA 3NNUA 3NUNA 4H39A 4HPTE 4GMYA 5DNRA 2WQMA 5HTBA 3TV6A 2BIYA 3F9NA 1WCCA 3ETAA 3HLLA 4KBAA 3QD3A 3VUHA 3VBQA 4IBMA 3GFWA 2XNOA 3T8OA 5HLNA 5FXSA 1E1VA 2W1DA 4A9TA 2ZMDA 3BCEA 4LOQA 4DLIA 2HXLA 2WPAA 4WKQA 4EBVA 3CQWA 4M69A 2XBJA 3A99A 4D4RA 4G9RA 3I60A 3QKKA 4WUAA 5FTQA 3DDQA 1OM1A 3S00A 4I93A 4FV8A 2W5AA 5KBRA 1Q99A 4JRNA 2WTWA 2DWBA 2UZOA 3IGGA 5FEQA 3E7OA 3MFTA 2XMYA 4CEGA 2YIQA 4OTFA 3FAAA 4AA4A 5CSHA 5AR5A 3Q5IA 1OIYA 5AV4A 1OL1A 2X81A 4OR5A 4AGCA 4FTCA 5HD4A 3U6IA 3DQWA 4OT6A 4EOMA 4U80A 3L9LA 1KOAA 3EQBA 5LXMA 2R0UA 1DI8A 4QRCA 4MWHA 4XG2A 5FRIA 3R9RA 2PWLA 4DDIA 3I7BA 3QCXA 5M56A 2C0TA 3ERKA 1M52A 1ZLTA 4DT8A 4O7NA 4TL0A 3Q9YA 3K5VA 3SXRA 3S95A 1QL6A 3DQXA 4IDVA 2BALA 4E4LA 4S31A 2YWVA 5EFQA 2XKCA 4LOPA 5IDPA 4EZ3A 3EQRA 4F99A 4XG6A 4PV0A 5CQWA 4BFMA 4DEEA 3FPMA 3MBLA 4JJRA 2QOIA 2QOKA 4BBEA 4LDTA 5IZFA 5E9EA 2JDTA 3N4TA 2C3KA 3UYSA 4JIAA 4YJTA 3G33A 3OWLA 4BDKA 2YM8A 3AT3A 5AEPA 4JG7A 4RX8A 5DLSA 5E8TA 4NK9A 2A19B 2I1MA 1UNLA 4LMUA 2C5XA 5JZJA 4I24A 4J7BA 3FQSA 1OBDA 3RAWA 2DQ7X 3OHTA 4ALUA 2VTOA 2YCSA 3F88A 1RQQA 3R01A 4QMZA 4L67A 4RX9A 3ZBXA 3P9JA 2P4IA 5BUEA 2CGUA 3P0MA 4IE9A 4DLJA 5GZAA 3ORNA 4XH6A 3WF8A 4CKRA 2HWOA 1WBTA 4MQ2A 4AE6A 4O7YA 4I6BA 2XIXA 3IOPA 2W17A 2WIPA 4DHZA 3DJ6A 5KUPA 2QOHA 3CD3A 3AXWA 2PVKA 3CKXA 5ETFA 5FD2A 3VWAA 4CLIA 4E4NA 2YCFA 3QL8A 5JRQA 3QQKA 4FSMA 4BTFA 4LGGA 3DV3A 3SG8A 4M14A 2ZJWA 5CY3A 2OICA 4A06A 4F6SA 5I0BA 1H1PA 3QUPA 1H1RA 5HG9A 3U51A 3CD8A 3AQVA 4FIGA 3ZEWA 2H34A 1GZOA 3MV5A 3JXWA 3QU0A 3LQ5A 4U81A 2ERKA 1OECA 2R2PA 4DEAA 3NIZA 5AV1A 4C59A 5GNKA 3TL8A 4CCUA 4UMQA 2WIHA 2PU8A 2VTIA 3TCPA 3P7AA 3UQGA 3R22A 3IQ7A 1IAJA 4AZTA 5FDPA 1HCLA 2W4JA 4RZVA 3WZKA 4FVQA 3UOJA 2ZMCA 4AZVA 2F2UA 4TTHB 1CSNA 1FGIA 3AG9A 3Q32A 3PVUA 2PYWA 2CKEA 2OG8A 1IA9A 4G34A 5KKRC 4ASEA 2Y9QA 4U5JA 3K5UA 4FV9A 4HYSA 1Z5MA 4JQEA 3UNZA 2ERZE 1KWPA 3AT2A 3OT8A 3ODYX 4RPVA 3UOHA 4C2VA 4DG2E 2IZSA 3PXRA 1REKA 5J1WA 3PFQA 5AV2A 5HORA 5IH6A 4MD7E 4FV1A 2QD9A 3DLZA 4MQ1A 4M15A 2ZV8A 2YIWA 4IVDA 4YHTA 3F6XA 3KCFA 3IDPA 4JBQA 1U5QA 2PE1A 3A8XA 2LAVA 4FV0A 4L42A 5HNIX 3KMWA 3HNGA 4O0RA 4AN3A 3EQDA 3W2SA 2YN8A 1OITA 3ORIA 2J9MA 4FA2A 4DFUA 3FXWA 5FEEA 3F82A 2HY81 3BU3A 1FVTA 4EH2A 3BL9A 3NYOA 3EJ1A 3R9DA 3OWKA 5EM5A 4CFNA 3EFWA 3NS9A 2ZB0A 3AMAA 3V6SA 3RPVA 3MESA 1PXJA 3QZIA 4RJ3A 5KMLA 3LHJA 3W8QA 2YDIA 5M4CA 5E8XA 4W4WA 2B53A 2QU5A 3FHRA 5TKDA 2IPXA 4QTAA 1PXMA 4FT0A 4DE4A 3UDZA 1PMNA 1Z57A 4X3FC 5ANKA 5D9HA 2E9VA 4M12A 1OIRA 4EWHA 2HZIA 3PVBA 3VS1A 5IU2A 3LXNA 5LWNA 4GVAA 3R8LA 5BVDA 5A6OA 5AAGA 2WOUA 4BDHA 3QCYA 3KF4A 5DPVA 3JUHA 5DA3A 3A4PA 4FTUA 3ZU7A 2CNQA 3KRRA 3P5JC 2YDJA 3FBVA 3FMNA 2CPKE 3VF8A 4QD6A 2YJSA 2B52A 4IZ7A 3R8VA 2C6MA 4APCA 2PZPA 1YDTE 3MFUA 3ZLSA 4FOCA 2I7QA 4EKLA 4R6VA 3K54A 5AR2A 3IOKA 4GSBA 4NCTA 5AV3A 3D5VA 3BL7A 3F3WA 2ITZA 3F5GA 2QQ7A 3QWKA 3BYUA 2GU8A 3ZO2A 3LMHA 2FA2A 4J8NA 2UZDA 4KIPA 4PL3A 4RG0A 5CTPA 3RCDA 4F7NA 3R7EA 3D15A 3UG1A 4M0ZA 2GNLA 2R9SA 5BVEA 3WI6A 1VR2A 2OF2A 1PXNA 4I5CA 3EN4A 3DTWA 5HIDA 3OY3A 4RSSA 3OC1A 5HE1A 2WMSA 4RIXA 4TWOA 4FC0A 4WT6A 4RX5A 3WF7A 2SRCA 3A2CA 2A0CX 5DFPA 3ZFYA 3VONA 4O82A 1KE6A 4ERKA 1ZMWA 4AAAA 4EYJA 4ZTMA 4ZZNA 4I21A 2R0IA 4W9XA 2HAKA 5DH3A 3HP5A 4RRVA 4R78A 5C4KA 3TUCA 4O7ZA 2ZM1A 2V5QA 4E4MA 3OUNB 2PL0A 4FSQA 4GUEA 3W33A 4K1BA 4RIOA 1PKGA 2XRWA 3NAXA 3QLFA 3LXLA 4UYNA 4RMZA 3FWQA 2QHMA 2UW8A 2XCKA 2Z60A 4WIHA 3DPKA 3CY3A 4L7FA 1XH8A 3VJOA 4EOLA 4AGDA 2X39A 5AUWA 1ZXEA 2CMWA 2C1BA 3BZ3A 3Q5ZA 4I20A 4MXZA 5ANGA 1Q4LA 3TIZA 3C9WA 3ZFMA 4QP7A 2V7AA 3IONA 4CXAA 4BR3A 3MPAA 4S33A 3COMA 4L9IA 3AGMA 3L1SA 4EWQA 4U0IA 5KX8A 1VJYA 3U54A 2EU9A 3DAJA 4ZMEA 4M3QA 4IZ5A 3OOMA 2C6KA 2QO9A 4YZ9A 4NYEA 3IW5A 5BUJA 3FLYA 1YI6A 4OTHA 3UMXA 2BZJA 4G2FA 3GI3A 3GT8A 3QYWA 2YZLA 4IAZA 3ATTA 3HAMA 4O81A 2VWYA 2DS1A 2GFCA 2W7XA 4TPTA 2WOTA 3R7GA 3GCPA 4E6AA 5IMEA 3FKNA 3DXQA 4N6YA 4FTQA 1Y6BA 2UZUE 1XH9A 2YM6A 3UTOA 2X6DA 4ITJA 1PYXA 1WVYA 3BLQA 4WSQA 3F5PA 4QYGA 3SHEA 4DHJA 4UWCA 1A06A 1H8FA 1KE5A 2NO3A 2O64A 3NMUF 3QTXA 2GNFA 2O0UA 4UMPA 4ASZA 4AA0A 2X1NA 3QQJA 3QTQA 3ACJA 1JSUA 4TWCA 3MH0A 4D9TA 3ZMMA 3PJ2A 5LQFA 3CGFA 4ZK5A 4YO6A 5FGKA 3EQIA 1WAKA 4MCVA 1BL6A 1FMOE 5AIKA 4V0GB 4J97A 4ANMA 4BDEA 1M7NA 4FGRA 2BFYA 4BCPA 5EHOA 3Q9WA 4D2VA 3GC7A 4CFMA 2XNPA 5D12A 4YO4A 4XS2A 3NNWA 3L9MA 3QTRA 1YVJA 5L8KA 3PDTA 3FMKA 3DS6A 3GVUA 4AT3A 1WBNA 2WQNA 1VLRA 3C1XA 2YAKA 4YJOA 3K3JA 5EW3A 1PMVA 1ZRZA 4QYEA 4YZBA 4FIJA 3ORKA 4JX7A 3ML1A 3GCVA 5BYYA 3M2WA 4WSYA 3HA6A 5FG8A 3A4OX 4J52A 3VQHA 4D1ZA 3FMDA 2R5TA 1YW2A 2XK7A 2CKPA 4MXOA 4JX3A 2BMCA 4RJ5A 2BROA 3R7IA 4F78A 1Q3DA 4CYJA 3MTFA 2BAQA 4OTIA 4JS8A 5I9UA 3GCUA 5LCJA 3NCGA 3OD6X 5GZ8A 2UVYA 3HRCA 1ST0A 1B6CB 4P4CA 3JS2A 1Q62A 3RZBA 4MBJA 2R7BA 4QMXA 4RVLA 2PPQA 2OJFE 3OTVA 5F95A 5HX6A 3KIOC 1I44A 2OIDA 3G6HA 3N9XA 2BHEA 4EUUA 3DTCA 2X0QA 3GXLA 3V6RA 3C4XA 5CS6A 3IW7A 4AW2A 4YPDA 5CZIA 5M4FA 3DFAA 1A9UA 4I23A 2WU6A 5J1VA 2FSMX 3TUBA 2FSLX 3R63A 1JWHA 4JDHA 3BQCA 3E5AA 4E20A 5CVFA 2EB2A 2O65A 4XBRA 1PHKA 2EWAA 4K6ZA 1O6KA 4KA3A 4OAUC 4JNWA 3MY1A 2V0DA 2G2IA 4KRCA 3AMBA 3PPKA 3LCSA 4IB5A 5D41A 4CRSA 1WZYA 1IR3A 3PJ3A 5K0KA 4E6CA 3ZZEA 3RK7A 3F5XA 4G3FA 4O4FA 4PDOA 4ZSLA 4FEUA 2JGZA 4I0SA 1JAMA 3ZSIA 4AXAA 1JKSA 3UPXA 2XVDA 3POOA 3LFNA 3REPA 3ZUTA 4V0GA 4ANBA 1YKRA 4CT2A 3N4VA 4FT9A 4J53A 4S34A 4JOAA 1NXKA 5E1SA 3VULA 4IJPA 2UW5A 2R3LA 4C36A 5C1QB 1PXPA 3QTUA 4U43A 4W4YA 4C4IA 2UW4A 3B8QA 5CEOA 2F4JA 3VUTA 2HYYA 4BCMA 4BDJA 1IEPA 3UIUA 3QUDA 5EKNA 4FTKA 4UV0A 4YHFA 5DE2A 5AR7A 5CEIA 5I5ZA 5M51A 1AD5A 1T46A 2NRYA 2BHHA 2X0PA 3MA6A 4BZNA 5I9XA 4FKOA 5JGAA 3FZRA 3HZTA 3QTIA 3ZXTA 2ITQA 2VWWA 2XIYA 1QCFA 2Y4PA 3BLHA 2FYSA 3Q2MA 3QC9A 3SLSA 1XBCA 3R1YA 2WNTA 2Z7RA 4FTMA 1E1XA 3PP1A 2PVYA 5L8LA 1MRVA 1S9IA 3R7VA 1LUFA 3BE9A 4WNOA 3MDYA 4DG3E 3RVGA 5FTOA 3R02A 4AXFA 2RFEA 3O51A 1ZY4A 3PP0A 4U40A 1PMEA 4DFZE 5DEYA 2ITNA 4O2PA 4J98A 3H10A 5HEZA 5J95A 1XH4A 4EH7A 4K33A 4EUTA 3R83A 3W0SA 4H36A 4FICA 4UMTA 3NYXA 2GS2A 3HRFA 4QMMA 5L3AA 3NIEA 4YLKA 4F63A 1HOWA 3MH2A 3QD0A 3ZRLA 4O7LA 3Q4ZA 4IMYA 3R7OA 3OBGA 3RMFA 3L8XA 3IG7A 5LMKC 1JQHA 1JPAA 4D4SA 4PQNA 2PUUA 1PKDA 1TKIA 4FNYA 5HBEA 2ITPA 2OXYA 4UX9A 5CX9A 4FEWA 3UVPA 2Z2WA 4PWNA 4O1OA 4QMSA 3MB7A 4UB7A 3QQFA 3QD2B 2P0CA 4ZJIA 4LGDA 3EQPA 3N4UA 1OKYA 1CMKE 1ZZ2A 3I4BA