3PVFA

Structure of c126s mutant of plasmodium falciparum triosephosphate isomerase complexed with pga
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVSFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Probing the role of the fully conserved Cys126 in triosephosphate isomerase by site-specific mutagenesis--distal effects on dimer stability.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 97
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pvfA00
1DKWA 2TSYA 1FCBA 2DORA 3SGUA 3FKRA 4MIMA 4HPXA 5HNRA 1QPNA 2ZZ6A 3C2FA 3MHGA 2DZXA 4N4QA 1H1YA 1JRCA 1OYBA 1QPRA 2ZTKA 3EX4A 3TV8A 5G2HA 3GVGA 3LB0A 4AWSA 4AHOA 3QPYA 3GR7A 1W0MA 4BK9A 3U8GA 2J6XA 2PRMA 2FB3A 4WOZA 3W73A 4UTIA 4I7UA 4RZ4A 4LU0A 1W5PA 3TXZA 3CIXA 1RD5A 4O12A 2XFWA 3CLMA 1FWRA 3NQFA 4GNJA 3B03A 4RXGA 5C2XA 1HO4A 3V1PA 4LUJA 1WYIA 4AWTA 4ADTA 1LRTA 4JN6A 2YGYA 3HG3A 1JUBA 4H3DA 1VC4A 4FXSA 1BTMA 3P5YA 2DZUA 1O5KA 2ZRYA 4IQLA 1FWWA 1AMKA 3IGUA 4POCA 3E02A 1DOSA 1ZNNA 2A6NA 3E12A 2WOQA 2QF7A 1I2QA 4AXKA 3EEGA 1DJQA 3BW3A 1LM1A 2X1RA 3L2IA 2A1YA 1I2NA 1OABA 1ADOA 4GBUA 2QCNA 1XUZA 1KFCA 2G97A 1CW2A 3ATYA 5E93A 4Z1BA 1ICSA 3UZ5A 4M6QA 3P8IA 3W7OA 4EF8A 5DY2A 2GVJA 1IF2A 3FA5A 1RZMA 3M44A 3TC7A 3S8HA 2A2IA 1HTIA 3LHTA 3MI3A 1A5BA 5HJLA 5L6UA 3GDKA 3W2KA 1AL8A 1JQVA 1WAUA 1WBJA 3GDMA 3W7DA 3PAJA 3NQ7A 4ZQMA 3M5ZA 1JULA 3W1LA 5C6MA 2V5LA 4UR8A 1XXXA 3USBA 1YYAA 2CLEA 1W3IA 2AAMA 5F1UA 3W1NA 2VENA 4N4PA 3C52A 4UC5A 1D9EA 1N55A 5LGZA 3GDTA 1ML1A 3S5OA 2ABAA 4OE7A 5EBUA 2CLLA 4JYDA 3NEVA 4O18A 3G1VA 1ALDA 3NNTA 5F4WA 5IBXA 2YCEA 1LORA 2H8ZA 2CLIA 1N8FA 1R2SA 2Q8ZA 3EWXA 3F1QA 3PVFA 4HHPA 4JTGA 2JGQA 3BG9A 5D2YA 3A23A 3L65A 2ZZ7A 3S1VA 3T4CA 1U83A 2DJLA 3Q37A 3CPRA 3SZ8A 1GVQA 2C3ZA 4O1DA 2QCGA 2ZFAA 4M6PA 4GJ1A 4FO4A 3HB9A 3B06A 3CQ0A 3N73A 4GUJA 3G1YA 4QISA 1G67A 1PV8A 2WPBA 1ICQA 4JS3A 3PSVA 1OX4B 1RQEA 3W7IA 4YCPA 3OVPA 2E1DA 1S5TA 1X8FA 2E6DA 1L6SA 4B5NA 5CZ0A 5AHLA 2G5WA 3NR0A 3DBPA 2C1HA 4FX8A 1G4SA 2FJKA 3W87A 1VCGA 1FQ0A 1EUAA 2C13A 4JDYA 1GTEA 1OX4A 3W23A 3MMTA 4ADUA 1VHCA 1LOLA 3NZ1A 3PUDA 3U2OA 3CWOX 2E09A 3HGRA 2ZDRA 5DXYA 5D33A 1QDSA 5DCBA 5AFDA 1MEWA 4N9DA 3S42A 3WK2A 1LBFA 5EMUA 1JCMP 5K9CA 3STEA 3W2UA 3DH7A 4O11A 4IX2A 2TRSA 2WNQA 5AN7A 2C19A 4HNNA 4MLJA 3IGSA 3OVQA 2ZZ5A 2O7SA 3H55A 1K03A 1KA9F 3W86A 5DLCA 1OX6A 3EX3A 3C6CA 1SFLA 3RFAA 3PC0A 3RU6A 4JIPA 3KXQA 4K37A 1XUUA 3VFLA 1XI3A 4GUHA 3GR8A 2V2HA 3TR2A 2E6AA 6ALDA 3DHDA 5FEWA 2FPVA 5D04C 3MW7A 5AC6A 1O95A 4AWUA 5FESA 1EUNA 3QZEA 4LS2A 3W2NA 3WJYA 1QCWA 2CLHA 2J27A 1AW5A 5DXXA 4TR9A 1YTEA 4YCOA 4E2DA 4TO8A 2E5BA 3TH6A 4MZ1A 1X6UA 1PHQA 1XBZA 4Q33A 1TCDA 5K9XA 4UTTC 5EKYA 3B8DA 4PH6A 2A7NA 3KRZA 2CZDA 4FF7A 4FX6M 2CLFA 1KFKA 5D2TA 3QQ0A 4JX4A 5DBTA 2A7PA 3GX9A 2FB2A 3L0KA 4O28A 3A22A 2R8WA 1GVRA 4OWGA 2CZEA 3VNDA 4RX0A 2KZHA 1QMLA 5K4ZA 2JKAA 3BG5A 3QSRA 2DZPA 3GNNA 1DHPA 4LC8A 3MBFA 4DPPA 2YX0A 2Z6JA 1ZAIA 2VFIA 5LNVA 2RDWA 4DPQA 4UUIA 2HS6A 4UTLA 5CPOA 1LCOA 5LNRA 3HPXA 1KM0A 3TA6A 2YSWA 4DEFA 3W22A 3HPSA 3P5ZA 1YLVA 3INPA 1VH7A 1JUKA 4OU1A 1N7KA 3VCRA 4UFMA 5LNWA 2ZZ2A 3LHUA 4GWEA 3G1HA 3O63A 4CQ8A 5LNUA 1PCWA 4QNWA 3WJWA 5G2WA 4DO5A 1TPUA 1VLIA 2XN0A 4NJJA 4Y9AA 3W1AA 4U28A 2ZRXA 2DZVA 3R89A 4R7JA 2Y89A 1K8XA 3LBMA 3ATZA 2RDUA 2TMDA 2ZBTA 1YXYA 2CZ5A 3H54A 3P7YA 2YZRA 3MWAA 4BWLA 2ZZ3A 3M6YA 5D05A 4K8EA 4AAJA 3SI9A 3TAKA 4GUFA 5F2IA 1G7VA 4O15A 2Q3OA 3NQCA 3NPWA 2J9YA 4FNSA 3EWBX 4GXMA 1B4KA 2JBMA 3BV4A 4M6VA 3PUEA 4UR7A 3NL3A 3HG4A 4A3UA 4LVFA 1OX5A 3QEZA 5GVJA 1KM2A 4QM1A 4MFEA 5CKSA 3BLIA 4JY8A 3TXVA 3WK1A 4KFOA 1TPWA 3E49A 2WO5A 3EXRA 1UJPA 4ZMGA 1LYXA 4O1AA 1KTCA 3L5MA 3PB0A 4QIUA 1TPB1 4X3ZA 3N2MA 3A5VA 3NDOA 2E6FA 4NX5A 1W5MA 3W76A 1K8ZA 3MHFA 2NX3A 2NUYA 4QQ3A 4JX5A 3S5YA 2CLOA 1B57A 3ABRA 3FEMA 5H2ZA 5D37A 5F2GA 3L68A 2A21A 4N9BA 1UBSA 1XBXA 4EOUA 1GOXA 3T40A 4A29A 2YR1A 1R30A 4NZFA 3RLVA 2OX1A 3SFKA 1LRNA 1EIXA 1W5OA 1DJNA 4R33A 2EHHA 3NOEA 2QUUA 5CPLA 3RMJA 4LW7A 5J5DA 1H7XA 3SGZA 4NXKA 4FNTA 3BLEA 3DI0A 4XTDA 5D2WA 2BLEA 5G1TA 5LSMA 2H90A 2NUXA 3LXBA 4JTIA 1VPXA 4NNAA 1MEIA 1SUXA 2QCFA 3GYEA 5ABTA 3C3NA 5AHEA 1RQHA 5CSRA 3S1WA 3PG8A 3G8RA 4BR1A 4DQWA 1AK5A 4JD4A 3BVJA 5KITA 2FPYA 3N34A 3EWZA 3AO0A 3KX6A 2DZTA 4DBEA 3PBYA 5IM51 5D32A 4YLWA 2BSLA 5DY3A 4XWUA 4DO4A 2CZFA 1EP1A 2B4GA 3B04A 3MYOA 2GPTA 3O07A 4NJIA 5CSSA 1EWEA 3M5YA 3G0SA 2C18A 3OEXA 2GUUA 1EA0A 1CX9A 2B7PA 5CZSA 3TW7A 2VFFA 1TPEA 4JTFA 5D09A 2VEIA 4TU1A 4UTMA 1P0KA 4P2VA 4IGHA 3NAVA 1E51A 5FI8A 3G1XA 4N6FA 1WDWA 3TMQA 3TC6A 1B3OA 3T55A 3MYPA 1XDLA 4RXFA 3IV3A 3L5LA 3R12A 3CEUA 3M7WA 2VFGA 4DBDA 1Z41A 5BOOA 3C56A 4NNBA 1L6YA 2NUWA 5BMWA 4S2CA 3IVUA 1S5VA 1JRBA 2H3DA 3L0NA 1W31A 1T0OA 3THQA 5HUPA 2Y70A 4X2RA 3S6DA 3PSWA 5K3VA 5BMXA 2ABBA 4BI5A 1W54A 4MVAA 2VEKA 3MI6A 3N9SA 5IBXC 1W5QA 3G1DA 1H7PA 1JCNA 3W70A 3DFNA 1PVNA 3LCWA 2J9ZA 1TV5A 1YADA 1TTJA 1YDNA 3EWUA 1SO4A 2F7FA 4WUIA 1TPH1 3RF9A 5E1QA 3EX6A 2YW4A 5TBOA 3FOKA 2QCDB 2Z2UA 2Y62A 3DXIA 1OJXA 1HG3A 3BO9A 5H91A 4K7VA 3ZS4A 1KLZA 3KAOA 4I7WA 3BW2A 3M43A 3LOTA 4AHPA 4IPIA 4Q32A 3KOFA 4TIMA 1BWLA 4UXDA 2B7QA 3IIPA 3W74A 4O1BA 3TX9A 3MUXA 5MHBA 2B0MA 2RFGA 2QCDA 4JNMA 3MP3A 4XBKA 5LHFA 2QJIA 2E5DA 4CLMA 3THAA 3OG3A 3ANYA 1GZGA 3W9ZA 3SW6A 1F74A 4JIQA 2Z0IA 3TK7A 3KHJA 3GIYA 2A6LA 3DFPA 1H63A 1HL2A 3DFSA 4NU7A 4UMCA 3NGJA 2AQWA 5HWNA 1FDJA 4XQ6A 3HGOA 1K7FA 1LLZA 1IXPA 2E5CA 1OF6A 1D3GA 4RLIA 1FXQA 2A85A 2GQ9A 4WXZA 1IGSA 3M5XA 3IIXA 4UTUA 4C1LA 2WSRA 4I9AA 3QYQA 2P0OA 4EF9A 4NQ1A 4LTSA 5AC7A 3S5ZA 1GG0A 2J88A 3LHVA 3QF0A 1F7BA 4CCEA 1DV7A 2ATMA 3HJZA 1EPXA 1OFEA 2V2CA 3MHUA 3N9RA 4Y8FA 3CM4A 3L0GA 3CT7A 1JQXA 1RR2A 1H5YA 5AC8A 3W1QA 2X1UA 4FNPA 3LCGA 2VKZG 3M5VA 4G1KA 1A5CA 2VC6A 3TFXA 2QCMA 2WNNA 4LRTA 3I7QA 4XUGA 4O4VA 4A22A 5HWJA 4GUIA 1G4TA 3LHZA 3W7JA 1A5AA 5EL1A 3W3OA 2ZYFA 4DELA 1VCVA 2FTPA 3NA8A 1PHWA 2H6RA 1XCFA 3SJ3A 3SY5A 4BI7A 3VI2A 3PWAA 4PL1A 4JGDA 4NX0A 3T44A 3B0VC 1FXPA 2P1FA 1V5XA 1WV2A 4A2SA 4NVTA 4CNNA 4O54A 4UFJA 2NV1A 3IVTA 1IXNA 1H7NA 1B4EA 1XDMA 3CHVA 3GB6A 4NXSA 5AYYA 2ZRVA 4QJ1A 2CU0A 3IEBA 3E96A 1GEQA 4OT7A 5C54A 4QNEA 4PC8A 4AHQA 5DELA 3BARA 1P5BA 2PC4A 2E77A 3HIJA 2BXVA 1F6KA 2C6QA 3LDVA 4UFIA 3NVTA 1TV8A 2B7NA 3PF3A 1AW2A 4IUOA 4MOZA 4Y96A 1NSJA 3G22A 3OHIA 1H7RA 3M47A 3C0JA 3A21A 5KMYA 1WBHA 3NO5A 3TUUA 1H51A 2OMAA 2OT1A 1I2OA 5C55A 3A24A 3QQ1A 3TQVA 4AH7A 3W2MA 2ZRZA 3KVJA 2EKCA 5G4EA 3SR7A 1NF7A 5EYWA 4ICNA 3LHWA 2VFEA 2X16A 3GK0A 1LOSA 3TSBA 3HMJG 2NV2A 3UPBA 1YTKA 2VOMA 2Y7FA 5I3GA 3QMRA 3C2VA 1SSGA 3NQ6A 3G1FA 2YFOA 1TO3A 1GVOA 1NAL1 2HSAA 1TPVA 3VKJA 3GXNA 1NFBA 3DZ1A 1QO5A 2FPTA 4MPQA 4XZ9A 5LHEA 1B9BA 2RHGA 2JK2A 4O19A 5BNKA 4FNRA 4IPJA 4NT0A 4WZHA 3ABQA 3KVKA 1W8SA 5U7SA 4E0CA 3H53A 2V9DA 2E6YA 3FJ6A 3QMTA 4HNVA 4D2JA 4K38A 3PUOA 5LZLA 4Z1DA 2NWRA 3P61A 1QWGA 5K4XA 3CTLA 1A5SA 3GDLA 3EX2A 1P4CA 1SW7A 3TSDA 2G95A 4LRSA 1XL9A 2A5HA 3G18A 1F73A 1A50A 1LOQA 2WQPA 3UWVA 5A8GA 5KINA 4FX7A 2CLMA 4BWLC 1MZHA 2CWNA 2A4AA 3HGJA 3O6DA 2QCCA 5HWMA 3QW3A 1ME8A 3FKKA 2ISVA 4UMBA 1F6PA 3LHYA 3V75A 3LTPA 2OZ0A 3EKZA 3N2XA 1G69A 4O16A 4N02A 3F03K 4LVGA 3QJAA 1FCVA 1DBTA 4MJZA 3LRKA 4UTKA 4AEOA 5D02A 2BZNA 3W7NA 3D0CA 3P80A 4MZYA 2Y85A 3O16A 1W1ZA 3EB2A 4WOQA 2Y7DA 5G2IA 4WXYA 4UIOA 1F76A 1SSDA 1KFLA 5DBUA 5LNSA 1SO6A 1H7WA 2VFHA 1A53A 1GG1A 3UQNA 3IGXA 1H50A 1DL3A 1WX0A 2P10A 4DF0A 3CC1A 1P1XA 2EPHA 3L9CA 4LOCA 4PTNA 2ZA3A 2NZLA 3TQKA 5BRBA 1GVFA 1VR6A 3O8AA 1DQWA 1VQTA 4LVBA 2JKEA 3DFTA 3A9IA 4PODA 3B05A 3FFSA 3PG9A 4O52A 4HSNA 5F2LA 5DN1A 1H1ZA 3W1MA 1JR1A 3P81A 3B4UA 4JTEA 1IXQA 4JTHA 3HOJA 5AHFA 4YWIA 1OVDA 2E68A 2GQAA 4HN4A 3S1UA 1CI1A 4Z08A 4CCCA 3P84A 1SR9A 1NVMA 3B0UX 4JTUA 3NQ8A 3P67A 1L9WA 2CW6A 3W1XA 4HNTA 1I4NA 1RQBA 2EF9A 3M16A 3CEPA 3SECA 5CZTA 4H6KA 3TW6A 2A0NA 2DZSA 3R2GA 4RR4A 4RKAA 1VRDA 2D73A 4OQVA 1GYNA 1KM1A 3QPZA 3M0ZA 3BGGA 4MFDA 4BF9A 3LI0A 1IIGA 4WX2A 5FF3A 3W83A 1KV5A 2HMCA 3R5EA 1KTNA 1GJPA 1YDVA 1I2PA 5T26A 2OJPA 2ZRUA 4N2YA 4MUZA 1FWTA 4JXCA 3W1TA 4FNUA 2B7OA 5FEZA 1JCXA 1S3HA 2FIQA 3QW4B 4JYEA 4Z1AA 1R46A 1P0NA 1ME9A 2XN2A 1EWDA 1R47A 2ZRWA 4FEZA 4IMFA 5CPNA 2V30A 2NXHA 2YPIA 3DFOA 1HFBA 4I7VA 5HR7A 1O94A 3GKFA 5HINA 3RLUA 2YW3A 1QAPA 3JRKA 4M7SA 3GNDA 3LERA 2O7QA 3DHFA 4KFNA 1FDZA 3R13A 2W6RA 4RCXA 1W37A 1F2JA 1Q6RA 4C1KA 1YPIA 1R2TA 3GXTA 1V7YA 3NXFA 5A5WA 4S1FA 1SZGA 4HT3A 4LV4A 2Z6IA 1VS1A 2YFNA 2Y61A 1OF8A 1JUEA 2ZZ4A 1FDYA 2R91A 3T7VA 2ZA1A 2PRHA 2PURA 3NQMA 1H61A 1MEHA 1RVGA 1TTQA 3BG3A 2QR6A 4FHAA 2Y6ZA 1JCJA 2BTMA 2H3BA 3BGJA 4Z1CA 3O6YX 3MP4A 4RJEA 5D30A 7TIMA 2HTMA 1OFAA 5HUOA 5KZDA 4RZ6A 4K39A 1Q6QA 2QCEA 5DCEA 1F05A 3K30A 3L66A 1ZCOA 3UY8A 3EXSA 4BFAA 4XBSA 4K7YA 2GJNA 2NX9A 5I3IA 3STGA 1GVSA 3DAQA 3N14A 4K8HA 2NLIA 1OYAA 1G6CA 1GWJA 2W0UA 3P62A 4ALDA 1ZAJA 4CCDA 4LC6A 2X1TA 2WSYA 3NQGA 3TE9A 3MBDA 1Q6OA 3TMLA 2RKXA 1TB3A 5KZEA 1GYLA 3GKAA 4O0KA 4UTWA 1VYRA 5HULA 4K36A 4FXRA 1GPWA 1O60A 2QUVA 4MZ8A 3PULA 1J4EA 3NG3A 3S1XA 1Z44A 1ZHAA 5LGXA 5F2MA 1T99A 1XC4A 1KV8A 3W7QA 1I8JA 1SQ7A 1FY6A 2LLEA 1R2RA 1OG0A 3HF3A 3LCHA 3HQ1A 1K7EA 4Z0JA 3ZR4A 4NJGA 4ZQCA 5D2VA 1S5WA 4LS1A 2DZWA 4J9JA 4RV8A 2GVGA 4IWWA 1EP2A 1QNVA 3S5NA 3G1AA 1G4EA 3W07A 4N9CA 3TCEA 3WK0A 4AMAA 4UFHA 2RH9A 3EWWA 5CG7A 1KW1A 1KTBA 4O57A 4UFKA 3W84A 1NF0A 1I45A 3IVSA 3NPVA 5D03A 1TMHA 1DQXA 3DKJA 5I3HA 2DU2A 5KTLA 1FX6A 4EIVA 1ZFJA 1SFJA 2QJGA 3I65A 1QPOA 3RNDA 2V5BA 3CWNA 4FB7A 1SZEA 3KVMA 2JKPA 3NYZA 2PCQA 1O4UA 3STFA 1M7PA 4MY9A 2VXNA 3W7RA 3F4NA 1J5TA 4FIQA 3UWZA 3PR2A 1LBMA 4O50A 4CNPA 6TIMA 1D3HA 4WY0B 1L6WA 3ELFA 4UNLA 1SW3A 5KSWA 3TAOA 1U5JA 1UUMA 4JY9A 3P74A 4YXGA 3LXCA 1TQXA 5CPMA 4LS0A 3DENA 3E0IA 3BK0A 2V82A 2C14A 3W6YA 2W79A 1Q45A 2I14A 4LT9A 4H4IA 1OFPA 3W75A 5U4NA 4ZVJA 1EP3A 5AYXA 4R34A 1ME7A 4L4LA 4WY0A 4ADSA 3DU0A 3QC3A 4IOTA 4KWWA 2QEZA 2ZQ0A 3DKLA 5TQLA 1SZFA 1OFBA 5AOUA 1UCWA 1TPFA 3W88A 5HQEA 5AB3A 2IQTA 3FYOA 3BLFA 3UD6A 3LTSA 2EGZA 2FQIA 2DP3A 4AB4A 3CIWA 2AGKA 4KKXA 3TJXA 4JR5A 3C61A 3MJYA 1TQJA 4CQAA 3KFTA 2PE4A 3B0PA 4YMZA 2X30A 5FF7A 3C2OA 1HO1A 5SWUA 1M6JA 1UUOA 3A5FA 1KBJA 1H62A 3LCIA 4E2BA 1BEUA 4UTJA 2V0TA 4XKYB 1TRDA 4BI6A 5HMSA 4N9EA 4IXXA 2ATSA 1TPDA 4MYXA 1FCQA 3BW4A 2OT0A 1RPXA 3QSTA 5G4WA 4M19A 4YL2A 5D38A 1OFOA 2Y7GA 4N6EA 2QCLA 4R53A 4XKYA 5HR6A 2CFFA 3LBCA 3QH2A 4O53A 2Y63A 1SU5A 1XM3A 1K8YA 3W7PA 3GLCA 4JTJA 3P8JA 1LDCA 3T78A 4ORIA 3EX1A 4AF0B 3UWWA 3R8RA 4CQ9A 1Z42A 1VLWA 5E0KA 2F84A 4TMCA 2FFCA 3E9AA 3LCLA 3G3MA 3HPZA 4LV9A 2YXGA 3KRSA 1SPQA 3SSJA 1AL7A 2J9XA 1THFD 3FS2A 1FCUA 3MI2A 1KBIA 3TSMA 3G0XA 1MSSA 1WQ5A 4OBTA 4AF0A 3KRUA 3P82A 1DORA 1OK6A 3PBVA 2WKJA 4Z0SA 2R94A 3LGEA 1LTDA 5D2XA 1JCYA 3FIGA 4X22A 3WJSA 3UWUA 1KFJA 1OFRA 4HIBA 4O13A 2QAPA 1EEPA 3W1UA 1TRIA 3M41A 2X1SA 1X1ZA 3C2RA 3LRLA 4HNUA 1TSIA 4IX0A 3YPIA 1VYSX 2ISWA 1YXCA 3GDRA 1ZENA 3GAYA 3UXDA 4IMEA 2C15A 1UB3A 4Y90A 1KFBA 1MXSA 1K3UA 4WJEA 4MYAA 3HG2A 2QCHA 4GC4A 3HGSA 3M1ZA 3LV6A 2BX7A 4L4MA 3TDFA 1FBAA 3O05A 1TV7A 4HKPA 2YDAA 1OYCA 3P60A 1XFBA 3UYCA 3L5AA 1WOAA 1BWKA 2WV8A 3WK3A 2QDHA 5G5IA 1X1OA 4PA8A 1KM4A 3W2JA 3W1RA 3NL2A 1EB3A 3FJLA 3W1PA 1YDOA 4JTLA 3TU9A 4DXVA 1TPC1 4ORMA 1KM6A 1TJPA 5I3JA 2NWSA 4ONVA 4WQ6A 5BW6A 3IRDA 4P61A 3SIZA 3UWQA 2WNZA 2C16A 1SW0A 4O4WA 5J5RA 3BPWA 3LV5A 1LLWA 4FIRA 3DGRA 1YPFA 2C0AA 1RV8A 4HSOA 4DF2A 1W3NA 4OV4A 3NQEA 1KLYA 4OHQA 4NNCA 3NQDA 1H7OA 4NJHA 1PS9A 2YYTA 1EX5A 1LBLA 5FEPA 5EA9A 3AJXA 1Z48A 1JVNA 4CNOA 3W71A 3TJLA 2G96A 3LLDA 4AVFA 2VEMA 4PFMA 1BKSA 1TTPA 3HO8A 3MO7A 1O5XA 2HS8A 1FUYA 1JCLA 4S2BA 4DO6A 1C9DA 3W7CA 3G1SA 5I3KA 1ZJIA 2RDTA 3PB2A 1PIIA 3PBWA 3M9YA 3LCFA 1F5ZA 3I7SA 3UNDA 3QM3A 2ALDA 4RK8A 1PE1A 4IXHA 4UCGA 3EWYA 3QRHA 3PBUA 5DCDA 1KFEA 3GXPA 2NXIA 3IIOA 3NQ2A 4UTHA 1ZAHA 1QFEA 3W85A 4X9SA 4UFLA 4PL2A 4O1CA 3W7HA 3CU2A 5F4XA 4ZQRA 4Y6GA 2OCZA 3F4WA 3TQ0A 1LRQA 5G1YA 3JS3A 3NM3A 2J24A 3FLUA 3OIXA 1J2WA 1IIHA 1XBYA 1QOPA 3NPXA 3LXAA 3G8EA 1TTIA 5F4SA 1AW1A 2GVLA 4JTKA 3ABOA 3WJXA 3LTYA 4O14A 4WY0F 5TIMA 1VJIA 1GQNA 1C29A 2NX1A 8TIMA 1W3TA 3ABSA 3LI1A 4QITA 3Q58A 2I9EA 1X7FA 4JTSA 4LY8A 3OBKA 2X2GA 4UNKA 1SO5A 3ZWTA 3W7KA 3TFCA 3OVRA 4E38A 1OFQA 3QFEA 2A7RA 2Q3RA 2GJLA 2QAFA 4IMGA 3TNOA 5FF2A 2ISSA 1TREA 5CZJA 3GZ3A 4NUWA 3STCA 3KVLA 1HUVA 4UTWC 2ZTJA 1C8VA 3L21A 4JDBA 1OK4A 4LWWA 2V2DA 1FWNA 1WOBA 4ML9A 2FLIA 5EY5A 2H8XA 1ONRA 4U4MA 2GQ8A 1QR7A 4EWND 1FWSA 5KZMA 5LKYA 3MP5A 3G0UA 1M5WA 3LLFA 4KFPA 4ZL1A 4IMDA 4A2RA 3GAKA 4GUGA 5AHIA 3O06A 1SZNA 1IXOA 2V8ZA 2Y7EA 2JGYA 1VGAA 2PRLA 3W7GA 1TJRA 1G7UA 3EKLA 5K9DA 4MY8A 4MY1A 2WSQA 4GRSA 1GTHA 2Z1BA 4O10A 1QPQA 4GFSA 5AHMA 3FYPA 3IIVA 3LM7A 3VE7A 3UXAA 2ZCGA 3TKFA 4LVDA 2V81A 3C2EA 1W5NA 3U6WA 3WFAA 4JEQA 5EPDA 5FF4A 3I6RA 4TMBA 4UTTA 4JTTA 3HBLA 3TROA 3NL6A 2CLKA 3C8FA 4LNYA 1ZALA 3CB8A 1ZY9A 2VELA 3LX9A 1NEYA 1KM3A 4KWVA 2QKFA 2XN1A 3HG5A 4M5PA 2GOUA 2BWGA 1GT8A 4GE8A 1LZOA 4IJBA 3QMSA 4O8RA 4TX9A 1LROA 4OV9A 3S0CA 1XKYA 3ZFHA 1AG1O 4ZQOA 2Y88A 2VFDA 4PCFA 4DF1A 3WJZA 1VYPX 1L2UA 3Q2DA 2ZZ1A 3UWYA 1Y0EA 4ZZ9A 1M7OA 5C5YA 3OA3A 1W56A 5FF0A 1TIMA 3LRMA 3DFQA 1VZWA 2TPSA 1G4PA 3DI1A 4QSHA 4ZQPA 4NJKA 2EAWA 1OHLA 3N19B 4JICA 2R14A 3W7MA 3G3DA 4JX6A 4WD0A 1H60A 1PL9A 4ZQNA 2QJHA 4NZJA 3LCXA 4FNQA 1T96A 3O6CA 4MLRA 2I1OA 1XBVA 3RK8A 1YTDA 1LP6A 2NXGA 2UV8G 2YYUA 1Q3NA 3NQVA 3JR2A 5CGQA 1UASA 2FDSA 2Q8LA 4Q4KA 1SO3A 3PY2A 5K2ZA 3IIZA 3O1NA 3PM6A 2ZA2A 4XTIA 3C4UA 3Q94A 4MJMA 3UZJA 4LVAA 3NZRA 4LUIA 1DVJA 1OFDA 3NL5A 4O17A 3N3MA 5F1VA 4IMCA 4K6AA 4O0ZA 1K7XA 3NPUA 3PS7A 1JJKA 1PCKA 1I2RA 1WA3A 3VE9A 4UMAA 5I3FA 3G24A 4OGZA 1YXDA 4MKNA 3W7LA 5K7JA 1VHNA 3W7EA 5FEXA 3I68A 3S9YA 3UY7A 1VCFA 4JYFA 5AHNA 3NQAA 2QDGA 3W72A 4M7TA 3NM1A 1QOQA 4W9TA 4QAIA 1T8XA 2DJXA 1KM5A 1QO2A 1WXJA 4EVZA 3O15A 2WJZA 3L67A 1ICPA 1MO0A 3W2LA 1Q6LA 2QUTA 3I7RA 5L9FA 4PEKA 4A21A 1TYGA 3UPWA 3EXTA 5AYZA 4HPJA 3TIMA 2TYSA 1K02A 2VEPA 4RZ5A 3ZWSA
chains in the Genus database with same CATH superfamily
4MMWA 1EC8A 3SGUA 1WDRA 2W63A 3FKRA 4MIMA 5C2GA 2QMKA 2ZZ6A 4BCEA 2KX9A 4N4QA 3UXIA 1QPRA 1ADSA 3WLMA 1K6AA 3SUUA 4GQRA 4KBXA 3M0MA 1PX4A 4U2YA 3U8GA 2J6XA 2RJGA 4WOZA 4GABA 3WDJA 1MFUA 1JDEA 4LU0A 3THCA 2ZUWA 3ENLA 3RPTA 4GKLA 3CLMA 1FWRA 3AYRA 1KCLA 2WCGA 4LUJA 9XIMA 2VUNA 3WNKA 2QPXA 3LSBA 3HG3A 2WW5A 4HK6A 2P88A 3AXHA 4CCZA 3E02A 2A6NA 1JEZA 2WOQA 2POTA 2QF7A 3AOFA 4GZIA 1DJQA 1LM1A 4AZ6A 4NZ1A 1FHDA 2A1YA 3N29A 3MY9A 1EGZA 2A3BA 1G5AA 2G8ZA 4ERAA 3HV8A 3ATYA 4Z1BA 3UZ5A 3P8IA 4B5WA 3TEVA 1RZMA 3M44A 3LHTA 1W1TA 3MO4A 5C71A 4A3RA 1QNRA 3W7DA 4ZE4A 1YPXA 1MW2A 5M2FX 4X2PA 4UR8A 1XLAA 3USBA 2GOKA 1WZMA 4D6JA 3W1NA 3V7PA 3OLEA 2VD9A 4PMRA 4UC5A 2OFJA 1LQ0A 1D9EA 3A3WA 4XSMA 2R1LA 2IKIA 5LGZA 1JDDA 1EHNA 1Z6KA 4JOMA 4H8HA 1ZS2A 2CLLA 3TONA 3NNTA 1OY0A 4H01A 5IBXA 1R9XA 4PFHA 2CLIA 2Q8ZA 3F1QA 1Q63A 3BC9A 5D2YA 4L4OA 3A23A 1W3JA 3L65A 4J40A 2ZZ7A 3S1VA 2VMFA 2VEFA 3CPRA 3LPFA 3F4VA 3AIWA 4L1XA 3GG7A 2EO7A 4XV0A 5A3HA 4F48A 1NOFA 4FO4A 3HB9A 3B06A 4W84A 4I9TA 5CC5A 4GUJA 4ECLA 3G1YA 4QISA 5ABGA 2PP0A 1ICQA 1JDAA 2EPMX 4KPLA 4HJFA 3W25A 2UZ9A 3CAWA 4DLMA 3O3RA 1BKHA 1S2VA 5CZ0A 1IR1A 2G5WA 1KXQA 3DBPA 4TUFA 2DDXA 5AYIA 2FJKA 2IPJA 4JIEA 3GR4A 2C13A 4JDYA 1O66A 2OXNA 3NZ1A 3PUDA 4GI4A 4RDYA 4C6IA 2WHLA 3PZMA 5IDIA 3MMDA 4MNJA 4L65A 4ZEPA 3S3GA 3OQ8A 2C1GA 2PLJA 4N9DA 3WK2A 1LBFA 3APTA 3P14A 2PU0A 4O11A 3PPFA 4HCLA 3U0HA 2WNQA 2RJHA 3QLDA 1IZCA 1BG4A 4Q4PA 4L6OA 3IGSA 1HKIA 1Y5VA 3W86A 5M1TA 2OWCA 1OX6A 3RFAA 3LUTA 3U7VA 3PC0A 4Q4OA 3KXQA 4U33A 4H6EA 4DAFA 1A3HA 3GR8A 4V1XA 1KO0A 2E6AA 3IJ9A 5JUVA 1ESWA 4B91A 4AWUA 1E6ZA 1XLGA 2E0PA 3WQWA 1X1NA 4LS2A 3WJYA 1QCWA 4GBDA 4Z2KA 1AW5A 3GU9A 2BBFA 2PEVA 1CZ1A 3PN8A 1BD0A 3CUZA 4RE3A 4TO8A 4ACZB 4A8NA 2CC0A 3DHPA 4Q33A 2WMJA 1OSEA 3RXZA 1TCDA 4FLSA 1E55A 3WL1A 4UTTC 2OQLA 3T42A 5GJMA 4C6PA 4W4QA 2CERA 4D1IA 4FX6M 1JPHA 3I3DA 1Q6CA 4JX4A 4TV5A 5JXQA 3GX9A 3TJ4A 4O28A 3A22A 1MXGA 2R8WA 1NDZA 4BEQA 3AJ7A 4RX0A 1OADA 2JKAA 3BG5A 3QSRA 2DZPA 3FAWA 4NAEB 4DPPA 2Z6JA 1ZAIA 2VFIA 3H21A 5LNVA 4DPQA 4UUIA 2RAGA 4UTLA 1HP5A 5CPOA 5LNRA 3QOMA 4DEFA 1TZ7A 4M0XA 1VH7A 1JUKA 4OU1A 1N7KA 1R87A 5GNYA 5IXEA 4S3JA 3O63A 3WNMA 4QCFA 2Q8XA 4F8XA 1PCWA 4AIUA 5G2WA 4DO5A 1TPUA 2R9RA 2W61A 2WMFA 3K4WA 4Y9AA 1UWRA 2Y89A 4C6QA 1HNYA 2X7WA 1QU4A 2WZTA 3UR5A 3ZIZA 5I0DA 1J0IA 3V5FA 4V15A 2YZRA 2PUZA 3UR7A 4L1GA 1PWMA 4P8WA 2INFA 4EPDC 4GX8A 3N9KA 1E9YB 2BOFX 4FNSA 4GXMA 1NP0A 1B4KA 3M6DA 1QI2A 2JBMA 3KOYA 4M6VA 3PUEA 3TLLA 3NL3A 3W0KA 4D8ZA 5C7HA 3BOLA 1S3TC 3H7RA 4O0QA 1KM2A 4Z2JA 1N2VA 3WK1A 4JY8A 1IZKA 4GKTA 2Z2AA 6ENLA 2WBKA 1LYXA 1C90A 4O1AA 3GXFA 1S2UA 3L5MA 4DBWA 5C2CA 3B8SA 3LG3A 2D1ZA 3N2MA 5D8ZA 3A5VA 4AXNA 2E6FA 4U5IA 4J3UA 3W76A 2J75A 5BOFA 2NUYA 5HPOA 4QQ3A 4DM1A 4JX5A 2CLOA 1CXEA 3FNDA 3DIPA 4BS0A 1RP9A 4J35A 1N8WA 2POZA 3L68A 3WH5A 3GZAA 3RLVA 2Y24A 3OYZA 3BSGA 1W5OA 1DJNA 4R33A 1E1EA 4DNMA 3ZYZA 4BEUA 3N15A 4PTDA 5CPLA 3AQUA 3KLKA 3CMJA 1UD3A 2GGHA 3SGZA 1PYMA 3BLEA 3N6QA 3WKZA 5G1TA 2BLEA 3T2PA 4HYVA 4X61A 4H9UA 3LXBA 4JTIA 4NNAA 2FZ8A 1MRQA 5I00A 3L4YA 4HZMA 4I8YA 4XX6A 3FJ4A 3G8RA 3D46A 2XVNA 3WF3A 3H22A 4AVOA 4JD4A 3N12A 3H8AA 3BVJA 1D3CA 2FPYA 3N34A 3WDRA 3KX6A 2VRQA 3KOWA 1TZZA 4AY7A 3B04A 3VGDA 3O07A 3T9PA 1EWEA 4J27A 3M5YA 3G0SA 1W3KA 3MC5A 1PBGA 8A3HA 1EA0A 2Z1XA 5CAKA 4DWSB 1TPEA 5D09A 2VEIA 4UTMA 4P2VA 4IGHA 4Y2WA 3NAVA 5HDRA 1E51A 1TA3B 2AAAA 4NZ5A 4URIA 3T55A 1XDLA 1TJ2A 3L5LA 4QG6A 3M7WA 4R27A 4DBDA 5BOOA 3C56A 3AHVA 2NUWA 1BSLA 4GLEA 3IVUA 2XH2A 2JFEX 3RCNA 4ZXOA 3T0BA 1JRBA 3L0NA 1KWGA 1ZCCA 2X0SA 3GTIA 5BMXA 2XZ7A 1F3WA 1GOIA 4BI5A 2J8GA 4MVAA 3N9SA 1TG7A 2AOSA 1EJVC 3DFNA 2EG7A 2J9ZA 3KZPA 1TV5A 1RBAA 1YDNA 1JFXA 2F7FA 4HPGA 4W88A 1M04A 3QV8A 3PJXA 5TBOA 4ML4A 4BQ5A 1HG3A 4ZGYA 3AFBA 1KLZA 1DIEA 2BFGA 4LYKA 3PHAA 3I10A 3WNNA 4UCFA 3KOFA 4UXDA 2B7QA 5IDZA 2GQ3A 3WMCA 4JNMA 2QCDA 4XBKA 3MP3A 4C90A 4UTFA 5LHFA 2QJIA 1LUCA 2E5DA 4QJ3B 4KRTA 4CLMA 1Q6GA 3SN4A 1UMLA 3RPDA 4B5SA 2D69A 3GIYA 2A6LA 3DFPA 2WNWA 4UMCA 2UY2A 2AQWA 3NGJA 1CNVA 1X6NA 3MKCA 4QLLA 5J8LA 2QVNA 1XLFA 1OF6A 2VC7A 1JD9A 2J62A 4LXFA 1IGSA 1Q2RA 4XUYA 1NQ6A 3QYQA 2XJ7A 4GI6A 2HNHA 3LHVA 4IG2B 4Q22A 2H9AA 1X6LA 2PDPA 4CCEA 2ATMA 2V2CA 4RNIA 4Y8FA 2OKOA 1JQXA 1RR2A 1KRBC 3VD7A 5AC8A 1JGMA 2D3NA 4F66A 3LCGA 4G1KA 4QLKA 2QCMA 1XH1A 4FZIA 3I7QA 5E9XA 4AD1A 3EOOA 3GIQA 4GUIA 3LHZA 2GZXA 3GC5A 4OBRA 3W3OA 3PANA 1U1HA 5DX7A 1LQAA 1VJZA 2FTPA 1ZJBA 1PHWA 2H6RA 3HQOA 3SY5A 3IJ8A 3VI2A 3PWAA 4BI7A 4PL1A 4JGDA 4WHBA 3BJSA 1UOZA 4EXBA 3B0VC 4DO7A 3MWCA 2F8QA 3KOXA 1H7NA 4NXSA 2EJ1A 1E9IA 1QK2A 3CT2A 3IEBA 3SUVA 1GEQA 3NUKA 1O6IA 1GOKA 4PC8A 4PMXA 4AHQA 3VNLA 3HIJA 4IH3A 1F6KA 3LDVA 1GKPA 4IUOA 4KEZA 3M47A 3C0JA 4QP0A 4D72A 3A21A 4S23A 2VO5A 3E2VA 3ONBA 1H51A 4MGGA 4PCTA 2OMAA 3TOPA 2DFAA 4L5ZA 4AH7A 1S5NA 1XIIA 4LAMA 2HBVA 1C93A 3SR7A 5E0CA 1TR1A 4H04A 3LHWA 3V18A 3HMJG 2NV2A 3SIMA 2Y7FA 1CECA 1FWAC 1UYQA 3NQ6A 1D7FA 2HSAA 1J01A 1T40A 3DZ1A 3GXNA 1M7JA 2YL9A 2ZVIA 4TQTA 4XZ9A 1WB0A 1U5VA 2JK2A 4H7CA 4L6HA 1A49A 4PUMA 2XTKA 3IJ6A 3V5OA 3F5JA 1AH0A 3ABQA 3NQBA 5U7SA 3K1DA 2E6YA 3M46A 4K38A 4Z1DA 3N2BA 2NWRA 2JF7A 1SFSA 3CUJA 2VX7A 3GDLA 4A8LA 3AIQA 4YVVA 3SFWA 4IIHA 3ZJ7A 4J3WA 1O5RA 1XL9A 1A50A 4R5EA 3UWVA 5A8GA 3EZ4A 2DPEA 1AQHA 1UPMB 2CLMA 4A35A 1DXIA 4G5DA 4RV3A 4MNKA 1R9ZA 3BAXA 3VABA 2ISVA 1F6PA 3LHYA 3V75A 3LTPA 1UR8A 3UPMA 2YCIX 3EKZA 1UPPA 1CLKA 5JIPA 3F03K 4GVGA 2FHCA 3QJAA 1HKWA 4U2ZA 3W7NA 3D0CA 2V63A 4MZYA 4PUNA 2Y7DA 4ATLA 1FP8A 2E28A 3VNZA 3KBWA 4Q8NA 1FWGC 1GG1A 1H50A 1WX0A 4XIMA 1GZJA 4M3PA 3CC1A 4E2OA 1E0VA 3VAVA 3EOSA 3TQKA 1GVFA 1DQWA 4AIOA 3STPA 3R6IA 2JKEA 4K68A 4QR6A 5DN1A 1H1ZA 1HVQA 2ADAA 4CQCA 1JR1A 1EJTC 4JTEA 1BGAA 1DJWA 2E8YA 5AHFA 4YWIA 1OVDA 1NVMA 1MNZA 5M3WA 3BOXA 2CW6A 4HNTA 2WKLA 1EA9C 1ODZA 2EF9A 3SECA 2HDJA 2A0NA 2VR2A 4RR4A 3B9OA 2Z29A 1VRDA 5FOOA 1T8QA 3GC2A 4OQVA 1GYNA 1H49A 3QPZA 1XIFA 1Q4WA 3KEHA 4IPLA 4AC1X 3LI0A 2WMHA 5DMYA 1XS2A 1GKQA 2J7CA 3O2LA 1R3TA 1XGEA 2YIHA 1VBRA 4JXCA 3VDHA 5FJPA 3W1TA 4ZOBA 1JCXA 4H8VA 3AWNA 1EWDA 4NHVA 3GXIA 3BMXA 3RO6A 2V30A 2YPIA 1JPKA 3DFOA 4I7VA 1O94A 3GKFA 5MF5A 4DZHA 2YW3A 4PRRA 2PC8A 4E4UA 1Q8AA 5C9WA 1QAPA 3JRKA 3GNDA 3LERA 4WEVX 1YE4A 1FDZA 3M0VA 4RCXA 1KGXA 1WDPA 4JEJA 1EPVA 3NXFA 4YPJA 2PDQA 4Q8OA 4KETA 1SZGA 4HT3A 1PSCA 2OSYA 2O9TA 4YTTA 1S1RA 2Z6IA 1JUEA 1FDYA 3T7VA 3PAOA 4FR1A 1RVGA 1V7AA 2Y6ZA 5GPRA 3SCPA 1JCJA 5CQ1A 4Q7IA 1Q2SA 5C9RA 2HTMA 5EB8A 4C6OA 3TLQA 3K30A 3W01A 1XYAA 1ZCOA 4XK2A 4MWAB 2PDYA 5I3IA 1BF2A 4IGNA 1JZ7A 2Y5JA 1YW1A 1GWJA 4WKAA 3P62A 3ITOA 1ZAJA 4LC6A 1GOWA 2WSYA 3B8TA 3TE9A 2PTZA 4WF7A 5KZEA 3GKAA 4O0KA 1BRLB 1PZ0A 4MZ8A 1O60A 1VKFA 4P5UA 3APGA 4QJ5B 1UJQA 4Q8QA 1Z44A 1W1B1 2FFIA 1T99A 3CQJA 3W81A 1ONXA 1SQ7A 1XIEA 1R2RA 1OG0A 1VB9A 3HQ1A 4HGXA 3ARRA 1TIWA 3ZR4A 1OGSA 1FWCC 4RV8A 4Q8MA 4GINA 3R4IA 3S5NA 5XIAA 4H19A 3Q45A 4N9CA 1CGVA 4GZEA 3VOIA 4NYYA 1WO2A 3E38A 1ONEA 5FL1A 3VILA 1S2CA 3EWWA 1KW1A 1KTBA 4MKVA 1BHGA 3VNYA 1VFTA 5D03A 5FAJA 4EACA 3OYXA 3AXMA 4S3AA 1IT7A 2YJQA 1FX6A 3OGVA 2V5BA 2D0FA 1SZEA 2PDMA 2JKPA 4REQA 3DBNA 2OKTA 1M7PA 2JEPA 1B31A 1LBMA 3A4WA 1D3HA 2F6XA 2QUNA 3ELFA 2CIPA 1M9HA 1DTNA 1TQXA 6REQA 1DJHA 1PZ3A 3BK0A 4ICMA 2V82A 4RE2A 1Q45A 3EB3A 2CETA 4LT9A 1V3HA 3W75A 4ZVJA 4KQNA 3IK2A 4IIGA 2V5KA 1HKKA 4IOTA 4KWWA 3NURA 1RH9A 2VDHA 3H23A 5HNNA 4ZB0A 4JFTA 2OZ3A 1ISZA 3C0LA 5AB3A 2IQTA 3FYOA 3PBGA 2EGZA 2DP3A 3ZT6A 1I75A 2DUAA 2ISDA 3KDOA 3MJYA 3R79A 3KFTA 2PE4A 2CLPA 5HMDA 2D2GA 3BTNA 2IQDA 1KBJA 4FOJA 2HEJA 3BLLA 1TWSA 1M3UA 1AA1B 3WNLA 3HZ3A 4BI6A 3BXWA 4W5UA 1KWKA 3QY8A 1PUDA 4S38A 3RO8A 1Q7MA 3DX5A 2XM2A 1A5KC 1FHVA 3WMBA 1KR1A 2ATSA 4MYXA 2PBOA 1RPXA 3QSTA 4YL2A 4U3CA 4F0KA 4N6EA 1T5AA 4WDUA 1EQPA 4F0MA 1EBHA 2BY3A 2CFFA 3LBCA 4HMDA 2Y63A 1MZRA 1SU5A 1EIBA 2E9LA 4IZGA 3FA3A 2CBUA 3W7PA 4JTJA 1GK8A 1NOWA 3VIKA 3CLWA 3UWWA 3PZGA 3RCMA 3OO2A 2R1MA 3AI0A 1AH3A 5E0KA 2FTWA 4LUYA 4XBJA 3UW6A 4AZCA 2J13A 2YKKA 3OLDA 3KCOA 3G3MA 3WLJA 2WZHA 5I3DA 1AL7A 1THFD 2QJMA 4E5TA 1PYFA 2W9MA 1MSSA 4OBTA 4AWEA 4AZHA 1DORA 4PR4A 3H70A 1PKYA 3KTXA 4AIBA 2R94A 1LTDA 5D2XA 2BS9A 1TKKA 1T7LA 1F6YA 4X22A 3WJSA 1EGMA 3UWUA 1KFJA 2VRJA 1H2JA 3ARQA 3W1UA 1TRIA 2X1SA 1TZ9A 1UUQA 1XH0A 3C86A 4IX0A 4GCAA 1AQMA 3W00A 3QV6A 3V0UA 1W9PA 3UXDA 1J9YA 1P1MA 1UB3A 1E6QM 1H11A 1BXBA 2NW0A 3B8UA 1MUCA 3BAKA 4WJEA 3HG2A 1W8GA 1Z89A 4GC4A 3HGSA 3M1ZA 3TDFA 2BX7A 2ZADA 1FBAA 4I90A 4HKPA 3W53A 3WK3A 1XLCA 4X0NA 4PGLA 3W1RA 3NCOA 3NL2A 3MZ2A 1IWAA 4AW7A 5EMLA 1DEDA 1WKEA 3HMCA 3TU9A 3NFUA 1K9DA 3QV7A 3N2TA 1OZQA 2NWSA 4GI8A 4P61A 3TN6A 2WNZA 2C16A 4DUVA 1ECEA 1OCQA 2NQ9A 1XSIA 1G94A 4C1NA 3F4CA 3R1ZA 1YPFA 4ATWA 3MQTA 4DYEA 1TUFA 4OHQA 4PTWA 3QTPA 3PTQA 1LBLA 3KTSA 1WKFA 3BMVA 3GUWA 1Z48A 2AQVA 1JVNA 3UETA 3W71A 3O0KA 3Q4DA 3QR1A 4AVFA 3H7UA 1PDYA 3OP2A 2VEMA 2VWTA 3WBEA 1X38A 4PFMA 3GG0A 1TTPA 2W5FA 4ZOEA 1O5XA 1JCLA 4S2BA 3K4DA 3TA9A 1S5MA 2FHBA 1POJA 4WSKA 5I3KA 3WH7A 5FL0A 4M6UA 5FJOA 1NELA 3HQPA 3VM5A 4HVXA 1F5ZA 3I7SA 5DQPA 1TFVA 2QGYA 1TE6A 2FDMA 4IXHA 3QRHA 3PBUA 3K8KA 2VZTA 3FSTA 3NQ2A 2NXIA 3PPGA 5BRPA 1QHZA 1QFEA 1UP3A 1K6WA 1NFPA 2BNJA 3K4AA 4X9SA 2YCJA 4UFLA 4O1CA 1GORA 3TTOA 3CU2A 1X96A 3UJSA 4K1GA 2OCZA 3AAMA 3JS3A 4M24A 3NM3A 3WL0A 2J24A 3RDKA 3OIXA 2DIEA 4F0LA 2X8RA 3NPXA 1QOPA 3LXAA 2G50A 4JTKA 1K9EA 3LQGA 1X98A 3FDGA 3WUEA 8TIMA 3WFLA 1QWKA 4G7EB 3LI1A 4QITA 3RLGA 3DCPA 2I9EA 4GYPA 2VM8A 3OBKA 2ZC8A 2ZXDA 3LSCA 2CYGA 3OVRA 1OFQA 4OFCA 4IMGA 1E56A 3AXIA 4F9DA 3GZ3A 4H9XA 3UERA 1ZLPA 4GQQA 4AEFA 2C0HA 3STCA 3WLLA 2G41A 4EX4A 3L21A 4JDBA 3F4DA 1FWNA 1O1ZA 1GQKA 4ML9A 2FLIA 3OW1A 4ZA0A 3T2QA 1GGOA 1RJQA 4ZO9A 3MP5A 4IJRA 4DIAA 4IT1A 5DMMA 3UYIA 3CZGA 5EU9A 4ZTXA 5DMNA 3IJIA 3B9EA 3LLFA 3VOCA 1Q6DA 5AHIA 3H24A 3UR2A 4MUPA 1IXOA 1UQYA 3N6HA 4CGTA 3ZJ6A 1FH8A 3V1HA 4H9VA 3MDWA 4H9YA 5K9DA 4U10A 4AZIA 2WSQA 2EXOA 3AIBA 3E5BA 2Z1BA 3T1GA 5CLTA 4GFSA 4W7UA 1PJ9A 3LM7A 2I57A 2XH4A 2ZCGA 4J5NA 2V81A 3DHUA 4IQJA 1W5NA 3U6WA 3WFAA 2XG9A 2XM1A 3W27A 2GJPA 2VELA 4KWVA 2F61A 1LG1A 4GACA 1ZP3A 1Y5WA 3CJPA 4MB4A 2BWGA 5I09A 1L8NA 3QMSA 2PODA 3BLKA 1UP0A 3S6OA 2R1NA 4XD5A 5CC3A 4I5RA 4AD2A 3WJZA 1VYPX 1J11A 1Y0EA 5C5YA 2FVKA 4JTCA 1W56A 2NV9A 2IPGA 2CHRA 3DFQA 4GG9A 2INZA 4YHEA 2TPSA 2PGRA 3UNTA 3GS6A 2F2HA 4F9JA 4JICA 4M56A 4RL3A 1H60A 3H4GA 3UXKA 1IEXA 4NZJA 1IQ8A 4FNQA 1PAMA 5BOEA 3AS0A 1YMYA 4MLRA 1NU5A 1GJWA 3RK8A 2ZKMX 5XIMA 3WF2A 2WPGA 1FA2A 1HQTA 1QTWA 3XINA 4H00A 2Q8LA 4Q4KA 1E71M 5GNXA 4FAMA 3POCA 4MJMA 4GIAA 3MUIA 1WDQA 3KWSA 2BVWA 4LVAA 3NZRA 4LUIA 5ENLA 3AHYA 5A6TC 1XICA 3A3HA 3FX4A 4DBUA 4IMCA 4M81A 4K6AA 1K7XA 1GEHA 5ABEA 3U4FA 5CBJA 1Q85A 1JJKA 4DB7A 3KLLA 3VE9A 4PCPA 4OGZA 1LLOA 3SN0A 4INFA 4W8LA 3S9YA 1GOQA 4JYFA 1TWZA 2P8CA 1LWJA 3N04A 3W72A 4M7TA 4FLQA 4KRUA 4EXAA 3EPMA 1ITXA 4QCEA 4CD4A 3F5LA 1ICPA 2O92A 3VKKA 2QUTA 1J79A 1YIXA 3DDMA 4CQBA 3UCDA 5CGTA 1XIJA 2HCVA 5A2BA 1DKWA 2VZUA 3QQWA 1IGWA 4B9YA 2TSYA 3BURA 5CG0A 4HPXA 4PUWA 1E0WA 3C2FA 1U30A 5JBFA 5G2HA 4IHCA 2OPJA 3LB0A 4AWSA 3WQ5A 4PYSA 3GR7A 1F3TA 2Z00A 2DIKA 4UTIA 4RZ4A 3K8MA 4QTGA 1A5LC 4QSFA 3CIXA 4O12A 4DUWA 1XLKA 2XFWA 3GBEA 3RX2A 3W28A 1W91A 2HWGA 1I6NA 4GIRA 4BQ2A 3CV2A 2ZUSA 1HO4A 5CPQA 2QZRA 3G2GA 3AZSA 4AWTA 1ZSXA 2CHNA 3C0QA 1MW0A 5AZ0A 2E9MA 2YGYA 3GG8A 1JUBA 3ES8A 3P5YA 1HX0A 1O5KA 1FWWA 4WRHA 4POCA 1EO5A 4KWUA 4HYWA 2X05A 3E12A 1TX2A 2PP1A 3SCRA 7ENLA 3VTRA 1RY0A 3L2IA 2BODX 4JKMA 4MF4A 4GVIA 1CW2A 2XSAA 4RUBA 1EXBA 1ICSA 1MW1A 3W7OA 3P0WA 1K4HA 3D6NA 5AC4A 2FVLA 3R0UA 5BU6A 5L6UA 2PTYA 5I79A 1AL8A 1HIZA 1JQVA 1WAUA 1WBJA 4F40A 4ZQMA 3M5ZA 3W1LA 4RW3A 2V5LA 3HPFA 1YYAA 3VOFA 2HXTA 3RM9A 1P7TB 1V0LA 2CHOA 1AFSA 1MFVA 4IMAA 3CMGA 3HFYA 3GUGA 2EEXA 3PZTA 2VTFA 4OE7A 5EBUA 4O18A 3G1VA 1V0KA 1E6NA 3QGKC 4C91A 2VYOA 1J0JA 2H8ZA 3M64A 2HQAA 3CHFA 1R2SA 1E6XM 3NZGA 2JGQA 3BG9A 4QRNA 1V3MA 3QYSA 2DJLA 2DH2A 2PDUA 3Q37A 1KQYA 2P3ZA 1FWDC 3LA4A 1GVQA 2WQDA 2PDCA 4JAWA 2VDIA 4IQEA 4QFUA 3BCDA 1QW8A 1G67A 1PV8A 3ARSA 4I9MA 4JS3A 2OELA 3RRXA 3WBAA 4GX9A 2GWNA 2W27A 1RQEA 3W7IA 2E1DA 1S5TA 4KGJA 1X8FA 1L6SA 2PWGA 1KBKA 2C1HA 3EDJA 2OGYA 1UIPA 4GPNA 7A3HA 1RCXB 1G4SA 4KESA 3W87A 1VCGA 4AX7A 3ONCA 1F3EA 4ROPA 1XQLA 4IISA 4QJ4B 4LYRA 2DZAA 3SUSA 1GW1A 3MMTA 1KXVA 4ADUA 1VHCA 2GGJA 3LZ5A 4YU1A 5DXYA 2BHYA 3AMKA 2VX5A 1V51A 1JYWA 2GUYA 3QV9A 1W1PA 3WLTA 2Q02A 5EMUA 3QKZA 1JCMP 4CEXC 1E72M 2WHKA 1DQUA 1PTGA 5AN7A 1QRQA 3A3XA 2BASA 3LY0A 1SJCA 3BQ6A 2ZZ5A 5LYRA 2O7SA 1UA3A 1KA9F 1IR2A 5DLCA 1LJYA 1SFLA 3UF9A 1HJUA 4F3HA 2GSHA 2V2HA 3U7BA 3DHDA 3EKGA 2FPVA 1NJJA 2WVVB 3IUHA 1G01A 3BZJA 3KBJA 3CL8A 2XZ9A 4W93A 5FESA 1EUNA 1BYDA 4GQGA 3GNOA 1GPFA 3UP8A 2CLHA 2J27A 2GDUA 4XIAA 2PTDA 3REQB 3V5CA 1B1YA 3UZXA 4UZSA 1I0BA 4XISA 3TH6A 4MZ1A 1X6UA 1EC9A 3N2CA 4PCSA 1XBZA 1SFTA 5FKYA 5K9XA 4LUSB 3GXMA 3B8VA 1OBAA 3HQNA 2A7NA 3B0XA 3TYZA 3KRZA 3BLPX 3MUCA 4PULA 3PFRA 4HA0A 1MI3A 3FHAA 4NASA 4ACZA 1HKVA 2G3IA 3FJNA 1KFKA 5D2TA 1R85A 5DBTA 3E2SA 2FB2A 1F9CA 3TTYA 4OWGA 2BGSA 4MJ2A 2KZHA 1EBGA 3GVWA 1QMLA 4LC8A 3I3BA 4S3CA 3IK4A 2RDWA 3GH7A 4LCQA 1XSKA 2HS6A 1XIBA 1UR0A 4YS1A 3VU2A 1F07A 1UKTA 3HPXA 5CH9A 2PGWA 1YLVA 1QNQA 4NAEA 4ROQA 4UFMA 2CESA 2E7FA 3LHUA 3TJIA 1FKXA 4QNWA 3IUIA 1PO9A 3W1AA 5BYWA 4I9JA 8XIAA 1QHOA 3R89A 3E1F1 4H2HA 3P6LA 3ATZA 4NI8A 4R9XA 3THDA 4AISA 4QBXA 1RY8A 4NZ3A 1WZAA 1BVNP 3CPUA 2QNEA 1TMQA 3VNIA 3PJUA 4DZ5A 4PN2A 5F2IA 2YOCA 2HRWA 4J2MA 3NPWA 4PB4A 1FP9A 3ARUA 2OWWA 3EWBX 2IQ0A 1J93A 1YRRA 4LVFA 1OX5A 3QEZA 5GVJA 3OHMB 1XX1A 4QM1A 2V38A 3F2DA 3BLIA 3TXVA 4KFOA 2WMIB 3E49A 2WO5A 2VCBA 1UJPA 3U5YA 1XYCA 4OUEA 2VGIA 4W86A 4G6CA 1OM0A 2PTXA 1EXPA 2DUXA 4X3ZA 3M07A 3MSDA 4NX5A 1K8ZA 1J18A 2ZIDA 4TOQA 3N6JA 3ABRA 3FEMA 1CWYA 3LN3A 5F2GA 2YL6A 2A21A 3WG6A 2W66A 4L6DA 1GOXA 5HJYA 3NOYA 2CNCA 4NZFA 3SB0A 1JL8A 1LRNA 3WQVA 4OBSA 3WD1A 2EJAA 1BPLB 3NOEA 2Z1WA 3CTTA 4NXKA 4H2CA 2ZXQA 3DI0A 3UT0A 2OLHA 2QVHA 5LSMA 2H90A 1AMYA 2W62A 1VPXA 1QNSA 4HZ8A 2QCFA 1JZ6A 3M0LA 1JFHA 4J3VA 3GYEA 2VJXA 4UB9A 3T4WA 3VMOA 1B0IA 3D3AA 4F2BA 3J7HA 5KITA 3WH6A 1ZL1A 3AO0A 2HE5A 5C0QA 4DBEA 1R3SA 5DY3A 3CUGA 4DO4A 1GUVA 4CEUC 3MYOA 3EB4A 4Q7BA 3CV1A 1E73M 2ON3A 4L80A 2GUUA 1Q7QA 1CX9A 2B7PA 5CZSA 3PWGA 3WNOA 2VFFA 8CGTA 1VP5A 4JTFA 4CU6A 4REQB 2HVMA 1P0KA 3P0XA 2QPSA 4Z17A 1X39A 4NRRA 1EX1A 3G1XA 3LMZA 5MKGB 1US3A 4AVNA 3MYPA 2WMKA 3IV3A 5HATA 1E0UA 1NP2A 4DWSA 5BMWA 2VHLA 4S2CA 1B3XA 1VBJA 1S5VA 2H3DA 7TAAA 1XR2A 1TA3A 5HUPA 2WZIA 2Y70A 2WM1A 2E9BA 2VT0A 2ABBA 1S39A 4L9ZA 1W54A 5H8PA 5IBXC 1EYEA 1H7PA 1JCNA 1VFHA 4KGLA 1XCWA 3LCWA 3CL6A 4AD0A 1A5MC 4U31A 2Z26A 4WUIA 3KZSA 5E1QA 2YW4A 3UU0A 1OJXA 1TWIA 2BXYA 5H91A 4K7VA 3RITA 2FGZA 4I7WA 3LOTA 4IPIA 4HTBA 5A2AA 3GTHA 3MVIA 3FAXA 3IIPA 4D6DA 3TX9A 3MUXA 2ALRA 3VKCA 1W3HA 2B0MA 1JZ2A 1CXKA 2RFGA 3UGVA 4ZOAA 2HBXA 1GZGA 3W9ZA 3BAIA 3SW6A 1F74A 3KUMA 1CGWA 1Z32X 4L4PA 4NU7A 2PDGA 1RA5A 3NYDA 5J04A 2FTYA 1LLZA 2E5CA 7REQB 1V02A 1OD0A 1CLVA 3BCFA 1FXQA 2UY5A 2GQ9A 3W26A 4P7OA 4WXZA 3M5XA 4UTUA 2Q6ZA 4I9AA 3WF0A 2ZUUA 2X42A 5E70A 1RJPA 3GQYA 4EF9A 4NQ1A 4LTSA 3S5ZA 1VAHA 2GGGA 4NP7A 3N2OA 1OFEA 1GJUA 3MHUA 4IUGA 3CM4A 2PDIA 3L0GA 3POHA 5C9XA 2BDQA 1UD6A 1HN1A 1FVPA 1EC7A 1CDGA 3EA2A 3LZ3A 2WNNA 3OIHA 4IG2A 4KEVA 2PFHA 5HWJA 4LB4A 4YJ5A 3B4YA 1A5AA 4LH8A 5EL1A 4JN8A 3ZLFA 3QZAA 4DELA 3WQEA 4UQBA 1VCVA 2VI0A 7ODCA 4AY8A 1XCFA 2A3LA 5I06A 3IJ7A 5PTDA 3RYSA 2DH3A 4TV6A 4XZWA 1NARA 1V5XA 3WUBA 4A2SA 1JYVA 4NVTA 4O54A 1WNOA 3EMQA 1XYLA 3GWQA 1XDMA 2X1IA 2YBVA 4IPNB 3SEPA 1YEYA 4C6LA 4M1BA 4OT7A 1RSCA 4B5XA 4CQDA 3BARA 3LM3A 3RM4A 2BXVA 2C6QA 4UFIA 2X2YA 1YBQB 1UH2A 2WLZA 1AW2A 2YA0A 3G22A 1H7RA 7CGTA 3EWDA 3WLRA 2PD5A 1V79A 3CQIA 1Q5MA 2R1KA 4ZB2A 2OT1A 1I2OA 4AG0A 4TX8A 3BDKA 3TQVA 3S2MA 3W2MA 2ZRZA 3KVJA 1K77A 5G4EA 4NY2A 1NF7A 4ICNA 2VFEA 2X16A 3CBWA 3GK0A 3TSBA 2VOMA 3QKEA 3QMRA 1SSGA 1GKRA 4M29A 2OEKA 1GVOA 3VIOA 2DT2A 1NAL1 1TPVA 3VKJA 2PLKA 1L8PA 3QY7A 2FPTA 2RHGA 3T0CA 2C91A 1KCXA 2VUYA 2DIJA 4NT0A 3KVKA 3H53A 3QMTA 5BWFA 3FJ6A 4HNVA 1V77A 4DVOA 5LZLA 4GNVA 2QJJA 5CCZA 1VEMA 5K4XA 1A5SA 1JNDA 3EX2A 4AD3A 2Y8VA 3AZRA 2IPWA 2A5HA 3G18A 3AMDA 4PMVA 2W92A 2OTDA 3K46A 2CWNA 1RCQA 3HGJA 3FKKA 3TZNA 2OZ0A 1RUSA 1VIZA 1V03A 1R38A 3ORWA 1UG6A 3GW0A 2Y4SA 4IFRA 1DBTA 5CXPA 4UTKA 1F4HA 2BZNA 4WGXA 4MKSA 3DFHA 2BVYA 5G1MA 4GC3A 1K8CA 3ZSSA 1SSDA 3B9NA 3DYOA 4QE1A 1SO6A 4I6KA 2O0TA 1BYAA 1H7WA 2DVUA 1KKRA 1BQGA 2BHUA 3IGXA 1DL3A 4DF0A 3DC0A 3L9CA 3IAPA 5JH2A 1CXLA 2NZLA 5CPSA 3O8AA 1WUEA 1VQTA 4LVBA 5I24A 3L2LA 3A9IA 3B05A 2WMGA 3AYSA 4O52A 4HSNA 1TJ0A 3W1MA 5KZ6A 3CS2A 3RMEA 4HA1A 1MXDA 1IXQA 4JTHA 1UWIA 3RIKA 3R8HA 5HXMA 2E68A 1W1VA 2GQAA 4Z08A 3VM7A 3P67A 3BQ5A 1RQBA 4JIHA 4PE8A 3CEPA 3TW6A 1GQIA 2DZSA 3R2GA 4H6QA 2GDVA 1JYXA 2P5NA 1O7AA 1KM1A 1UR9A 2P8BA 4XVEA 3LU2A 3M0ZA 3B9AA 4MFDA 4BF9A 2VDGA 1IIGA 1DHKA 5FF3A 2OO0A 1VBGA 1XG3A 1GJPA 4EKJA 1YDVA 3MCNA 5DF0A 1I2PA 5T26A 3DN5A 2ZRUA 4N2YA 1FWTA 2B7OA 1P48A 1DJYA 1C7TA 4Z1AA 1R46A 3UJ2A 1R47A 1TCMA 1C9WA 4FEZA 2BGNE 2V5JA 2ZRWA 3MT1A 1EZ2A 2AL1A 3CWHA 5FJRA 3RLUA 4DN1A 5EMKA 4L1WA 4E3VA 2XWEA 2O7QA 1DJXA 1WKYA 1AQ0A 4HNOA 4UR9A 1R2TA 3GXTA 3BH4A 1V7YA 3QR0A 3GBDA 1XLMA 5DEZA 3T81A 5CJNA 4LV4A 3PZ9A 4Y9OA 3ZT7A 2ZA1A 2PRHA 2PURA 1TTQA 4FHAA 2D2HA 1OINA 3CIVA 3CYVA 3VKAA 2BTMA 2H3BA 4Z1CA 1UQZA 3BJFA 3HFTA 4RJEA 5D30A 1OFAA 5KZDA 4RZ6A 3UZWA 1Q6QA 2QCEA 2WSPA 3AISA 2WAGA 4XBSA 2GJNA 1DWIM 1JZ4A 1RA0A 3DAQA 3H4XA 4K8HA 1MNSA 2FYMA 2W0UA 4ALDA 1E4LA 4GCXA 1IZJA 3TN4A 4CCDA 2YB4A 2F38A 3TMLA 4UTWA 1UKOA 5HULA 1PIFA 5LIUX 4GGHA 4MWAA 4YTSA 4PTVA 1V6VA 1W1A1 4GQ0A 5DO8A 3S1XA 4OTKA 3T07A 5LGXA 5F2MA 1EOMA 4AZBA 1FY6A 3WH8A 3A47A 1BRLA 3ES7A 1XCXA 4ZQCA 4H9MA 1WXZA 4LS1A 2DZWA 1JGIA 3OODA 4IWWA 2HK0A 1JZ8A 2J7HA 2O9PA 3SJNA 1G4EA 4ZFCA 5CEWA 3TCEA 3WK0A 2BB0A 3NO1A 4GYKA 1J0YA 1EQCA 4IFKA 3L4WA 4FK9A 3W84A 5A6LA 4DWSD 4JPGA 4FI4A 2HNEA 1REQB 1B2YA 3C2YA 1W6TA 2OOFA 3T6CA 1A47A 1BQCA 4XSLA 3MCMA 5I3HA 4U5KA 1EEXA 1ZFJA 4D6FA 3L2MA 1VPQA 4FB7A 3CWNA 1KGWA 2PWEA 2DQXA 1O4UA 4JKLA 4Y9MA 3PJWA 5HAOA 3STFA 5E5CA 2OO6A 3OZMA 4MY9A 4HCHA 6TIMA 4O50A 5ABFB 4W87A 5H1WA 3ZVHB 3ZLGA 4UNLA 5A2CA 1P43A 1U5JA 4YXGA 5M17A 2AMGA 5CPMA 5I2UA 3DENA 1XW8A 1DIDA 9XIAA 5EMYA 2W79A 1BYBA 4H4IA 1EP3A 4R34A 3AROA 3WDPP 4ADSA 1PKMA 5A95A 1UZHA 4DJDA 2ZQ0A 3DKLA 4Q4RA 4TVUA 1UKPA 1UCWA 5A8PA 4JQ1A 3UD6A 1OEPA 3T2OA 3DERA 4AB4A 2WJEA 2AGKA 3CIWA 4JR5A 3CZLA 1KRAC 3FHQA 1XQKA 4KH2A 5T8GA 4CQAA 3K13A 3B0PA 3CH0A 2J47A 1BG9A 3WFZA 4YMZA 2G3NA 3CK5A 1HO1A 1F61A 4JNYA 1EKOA 1QATA 3OBEA 4UTJA 4B9ZA 3NDYA 3P93A 1TRDA 1V3KA 4IXXA 2FHFA 2OYLA 1DIKA 4HOWA 4M19A 1HVXA 2QDEA 3S5SA 2Y7GA 3FGCB 1BSIA 2VVSA 5I03A 2C71A 2QCLA 1XSJA 3QH2A 4HNCA 1U2YA 1XM3A 3B40A 4E8DA 2E8ZA 1V4YA 1P0EA 3GLCA 1LDCA 1XLDA 3COTA 4C6NA 2WWCA 1XPYA 4ORIA 3PZIA 4AF0B 3R8RA 1Z42A 1VLWA 1KNWA 4TMCA 5HNTA 3E9AA 2OODA 1YQ2A 1TELA 1Q7ZA 4PEEA 2OZ8A 4JFWA 3SSJA 1FCUA 4L9XA 2BP1A 3G0XA 3K8LA 1H1NA 3KRUA 2GGIA 2WJDA 3AALA 2DT3A 4G7FA 4EXQA 3FIGA 4B2DA 1EJRC 4PZVA 1OFRA 1HL8A 1TSIA 1ISYA 3URNA 3GDRA 1ZENA 4PTMA 3RLHA 1R86A 4EAMA 5AECA 5A6SA 4Y90A 2XVGA 4PTXA 1KFBA 2Z25A 3WBYA 2NQJA 1K4GA 1TV7A 2J77A 4HCDA 3VVGA 3UYCA 5BCAA 2WV8A 3VCNA 4FF5A 5G5IA 4PA8A 1CYGA 5C70A 1R6WA 3FJLA 3MANA 3W1PA 1XLJA 4JTLA 3OZPA 1WKDA 4IQDA 3VFCA 4RNJA 4ONVA 3G1RA 3VC6A 3SIZA 3WX7A 1IEQA 4O4WA 3W6MA 2V5CA 3SRKA 4CNUA 3IARA 3LV5A 1UD2A 4JQ3A 1C91A 2BY2A 3DGRA 3MSRA 1QBAA 1RV8A 3BAWA 4JFVA 4HOXA 4NJHA 1H7OA 4MADA 3UJRA 1V0NA 3OVGA 3TTSA 1M41A 4V33A 1GNXA 4RE0A 4J4KA 4CNOA 1AZ2A 1EJWC 4I3GA 2G96A 4XD6A 1XKJA 3MJMA 1BKSA 3UG4A 1PEZA 3KBNA 4DO6A 1C9DA 1X97A 1DP0A 5EMMA 3FDKA 4AFYA 1ZJIA 2RDTA 4M1RA 2XU2A 1OQFA 2Z4GA 4GYFA 3LCFA 5H8UA 3UZYA 2NQZA 4JL1A 3QM3A 5DRIA 1E0XA 4RK8A 4UNIA 3F5KA 4GXPA 2W3ZA 1CGYA 3EDEA 3W85A 3MZNA 2WCSA 2CITA 3A6OA 2XIQA 5F4XA 3EDDA 3VMNA 1LRQA 2VL4A 3AZTA 1FWJC 3FLUA 4RNFA 1IIHA 2IPFA 3G8EA 1TTIA 2OEJA 3WEZA 3V36A 2GVLA 4Q8WA 4TVCA 2VGFA 3WJXA 3SGGA 1GVEA 3LTYA 4O14A 1YNPA 4WY0F 2FZDA 5TIMA 1GQNA 5D9NA 1XISA 3MCOA 1C29A 2PCEA 4MNMA 4RDVA 1W3TA 3ABSA 3Q58A 5E9AA 2V67A 4UNKA 3IACA 3T0AA 4JHMA 3W7KA 4HPNA 3TFCA 3ARZA 3HM7A 2A7RA 2VD8A 1HP4A 2GJLA 2QF8A 1TVPA 1WDSA 2VRKA 4G7EA 4OVXA 3P2VA 1R9YA 4LAOA 4LWWA 1WOBA 4JTAA 5EY5A 3URAA 2PF0A 1WDDA 2GDQA 4C5YA 1IEVA 4EWND 1FWSA 2QQ6A 1IWBA 3WQDA 5C9UA 3KS5A 4ZL1A 1S2WA 3VD5A 4A2RA 2JEQA 3GAKA 4GUGA 4E6MA 2INEA 2XYLA 2Z1VA 4JCLA 1JI1A 1SZNA 4WK9A 4EPKA 3WDHA 3W7GA 1G7UA 3QN3A 2BY1A 3SCTA 4GRSA 4Q8UA 1QPQA 4PRWA 4WDTA 1DIOA 3FYPA 3IIVA 2G4FA 5C7VA 2HXUA 3VZYA 1R3WA 3RCYA 4MSSA 4GVHA 2J8FA 3IAQA 4JEQA 3GDBA 4KCUA 2G3FA 3I6RA 4QDWA 4TMBA 1SMAA 4JTTA 3HBLA 3TROA 4HU8A 4LNYA 1ZALA 5I7GA 3QFWA 1IHIA 2V3EA 3QLLA 1KM3A 3PBMA 3VO0A 2QKFA 1V8EA 1UIOA 3ITVA 4IJBA 3TYEA 2CCRA 4TX9A 3KW3A 2NVCA 1XIGA 3CV7A 2GSEA 2Y0FA 5CSYA 1YHTA 2O55A 2JALA 3G5EA 2VFDA 4DF1A 4YHGA 1P6WA 3Q2DA 2PDLA 1NY1A 4ZSUA 4YNGA 2F2KA 5JVLA 3CO8A 2OLSA 3OA3A 1XP3A 2CZVA 1M1BA 1TIMA 3KE0A 9RUBA 1WAWA 2J7BA 4MWAD 4NJKA 3BAYA 1J0ZA 2EQDA 3QHOA 1WCGA 3H2NA 3N19B 3UWEA 4DLFA 2R14A 3VGFA 4WD0A 1B3ZA 1PL9A 5A6KA 4H7VA 3W6LA 3AC0A 1T96A 4X60A 2XVPA 1XBVA 2V3DA 1FWBC 1LP6A 2NXGA 4MDOA 2ZVRA 1NDVA 3CYJA 1SO3A 3C4UA 3Q94A 2YB1A 3UZJA 3IRSA 3AU2A 1XLEA 1P0DA 1J0HA 4LEFA 1E3ZA 3N3MA 3WF4A 3NPUA 2OQYA 4IPPA 2WVUA 1US2A 1I2RA 1W9BM 5K7JA 1OT1A 1VHNA 1FTXA 5A6MA 1VCFA 2PDHA 1LWHA 4W9TA 2DJXA 1QO2A 1P6BA 4EVZA 1TV4A 4C5ZA 2ZX5A 1YDYA 4WDWA 3W2LA 1Q6LA 6XIAA 3MDUA 2XGIA 3OZOA 3MS8A 1E1FA 2Z1SA 3UPWA 5I23A 5AYZA 1EDTA 4HPJA 3VUPA 3WCZA 4DJDD 4DZIA 2DORA 5HNRA 1QPNA 1E70M 2DZXA 5CC7A 1OYBA 2ZTKA 3EX4A 4NAFB 1TWDA 3QPYA 1GHRA 1UR2A 1Y5XA 3OQEA 1YKWA 1L0PA 4I7UA 1W32A 4AC7C 1ZRQA 5REQB 4NILA 4GJJA 1W5PA 4HSHA 4A4AA 3TXZA 2YXXA 4JCMA 4A3YA 3BSHA 4PUJA 1RD5A 4DJFA 1SVDA 1CIUA 3DEQA 4UWMA 3NQFA 4RXGA 3B03A 5C2XA 1H5VA 3V1PA 1WYIA 4PB5A 1PXGA 1HKMA 3EOEA 4H3DA 3U48A 3VGGA 1QW9A 1J2BA 1VC4A 4FXSA 3AWOA 2ZRYA 3IGUA 4HOZA 4UOQA 3UA4A 4QE5A 4AXKA 1BVWA 1W9DM 1I2NA 1OABA 1ADOA 1O1HA 1UD8A 3KM8A 1KFCA 1TWWA 3APYA 4PBGA 1C8XA 2FMNA 3TC3A 2J7EA 4EF8A 5DY2A 2GVJA 3FA5A 2OSWA 3AHXA 3L23A 2FZNA 1HTIA 3MI3A 4PMYA 1EF2A 3AU6A 1HW6A 3ALFA 3UCQA 1UHVA 4GIEA 4AEEA 3NQ7A 1O5QA 1DWAM 3A13A 9CGTA 4B3LA 3KL0A 3WQPA 2AAMA 5HMEA 2VENA 4N4PA 1LWIA 1W1IE 3UG5A 2W91A 3W29A 1ML1A 4OUIA 1NIUA 4B2DD 2QUMA 2ABAA 3A12A 4JYDA 2PDNA 3S9ZA 2WZMA 3S2NA 3NEVA 1R3QA 3KL5A 5F4WA 4G2DA 2FMOA 5JBEA 3NTYA 1N8FA 4Q3MA 3EWXA 3CHDA 3EA1A 3ITTA 3PVFA 1P7TA 3NSMA 2ICSA 5LXXA 4JTGA 2IKHA 3VZZA 3MU7A 3O0FA 1A5UA 1U83A 4KCTA 4H7ZA 3SZ8A 5I78A 3ANVA 4DXKA 1M7XA 4O1DA 3WYZA 2ZFAA 3NVDA 4GJ1A 3HPAA 4LYQA 4IF2A 3K2GA 2X09A 6PTDA 2WPBA 1WUFA 4US6A 1OX4B 4HZ6A 3OVPA 3GVVA 4B5NA 4KERA 4ACYA 2ZXBA 4LQ1A 1XYFA 3R8GA 1SJAA 4GYPC 3KP0A 1EUAA 4FSAA 3W23A 1MDRA 2YDSA 1I60A 1ZJHA 1KR0A 3U2OA 1UR4A 3SCOA 2E09A 1WZKA 4Q7NA 2FZBA 4L61A 1MEWA 4H8NA 3S42A 4Q4MA 2RGMA 3EPOA 3STEA 3W2UA 1AH4A 4IL2A 2XGZA 4CU7A 1F3XA 1OGBA 3GFYA 5TNVA 3M4HA 2BVTA 4HNNA 4MLJA 3OVQA 3VDCA 3EX3A 1M53A 4EK7A 3BANA 4JIPA 4Z2GA 4K37A 3H4WA 5A8QA 3VFLA 1XI3A 2BOEX 6ALDA 4FXFA 1RVKA 2RDXA 5D04C 5AC6A 3O9NA 1O95A 4XKMA 4MJ4A 4G56A 4K8GA 3TP4A 3SO7A 3W2NA 2C1IA 3ITLA 3ANUA 5ECVA 1YTEA 1E3XA 3GFZA 1IEWA 4YCOA 5DT7A 2WVVA 2WLYA 1S2AA 2E5BA 1PHQA 1JF6A 1TUXA 5H6HA 2Q09A 3FXYA 4ZTYA 1EJXC 1OIMA 2ZUTA 1G0CA 1JXJA 3TW9A 1U5HA 3B8DA 4PH6A 1XGZA 3R43A 4FF7A 4ZR8A 3REQA 3N4FA 1ZZMA 3N13A 2QXWA 3QY6A 4Y7EA 1V0MA 1Q8JA 1VD6A 3QQ0A 2P3EA 2A7PA 3ARWA 5IFPA 2I56A 1GVRA 4LUSA 1Q66A 3ITCA 3JVAA 4PMNA 4HQVA 4CUCA 1DHPA 3FVMA 4ICCX 1AJ0A 3I4EA 2GWGA 1ZUAX 1BGGA 4J7RA 1DWGM 1XYBA 4LBUA 3WLKX 1LCOA 3A4XA 1KM0A 3SBFA 2YSWA 3W22A 3HPSA 3P5ZA 1LQ2A 1XPGA 4RNHA 3VCRA 4GWEA 3KCJA 3CAQA 3G1HA 3RX3A 3SCUA 5LNUA 1KD0A 4FPSA 3WJWA 3WY1A 1SM9A 1VLIA 2XN0A 4NJJA 3VKDA 1A5NC 1GQLA 4U28A 1AVAA 2ZRXA 3DG6A 2DZVA 3UVIA 1OGGA 4R7JA 2XGBA 3PWIA 4AZ7A 1K8XA 3LBMA 1ECQA 2VOTA 1EGVA 3K1GA 2RDUA 2CZ5A 4DXXA 3MWAA 2SFPA 4BWLA 2ZZ3A 3M6YA 2FH6A 5D05A 4DRSA 3OGSA 1B3VA 4GUFA 3PUGA 3GVQA 4LALA 4ERIA 4O15A 3TWBA 1R3RA 2Q3OA 1T6MA 3NQCA 4QGCA 1XRSA 2J9YA 4NZ4A 3DOPA 3BV4A 4UR7A 3E0FA 4GFIA 1GVYA 3TN3A 2YL5A 1XF0A 3KDNA 5CKSA 1HKJA 1TR9A 4ZMGA 2PS2A 4XZNX 2J4GA 3H2AA 3PB0A 4QIUA 1TPB1 2ZWYA 3MSGA 3H2EA 3GH5A 3NDOA 1BF6A 3WH9A 5TAOA 4YTUA 3PK7A 2NX3A 2DSWA 2XFYA 3AS1A 4JTDA 3S5YA 4ZODA 2WMIA 5H2ZA 4P7LA 4N9BA 1XBXA 2VC9A 3T40A 4A29A 1RBOB 2YR1A 1JYNA 4QDMA 1I9CB 4IGMA 3WLIA 3CZJA 1EIXA 1M03A 3WD2A 4TVDA 1VBHA 2EHHA 2J74A 1V6UA 4GMEA 2QUUA 4G1NA 3RMJA 4CKQA 2TAAA 1NH6A 4LW7A 5J5DA 4YVXA 1H7XA 3VOHA 2P50A 3L4XA 4FNTA 3W37A 3PZUA 4XTDA 3H2OA 2NUXA 3URBA 4CD6A 3WQ4A 1MEIA 1SUXA 3BAJA 2DY3A 5ABTA 3GRIA 5AHEA 3T05A 1RQHA 4OKDA 4EWJA 5CSRA 3CH9A 4LAUA 4GY0A 4QEHA 4FR6A 1U22A 2DZTA 5IM51 3MUY1 3ALGA 4IFKB 4PSPA 3BL3A 2PBGA 3BSMA 4JBRA 2GPTA 4D1JA 2C18A 5M5DA 4GA8A 1LL6A 2VP8A 2WC4A 3TW7A 1J5SA 3WELA 4F0RA 3M0IA 4GK8A 3H2MA 3EDFA 4PMUA 4J3ZA 4TU1A 2JQXA 1GOOA 4YWSA 3AYTA 2XFRA 4HD5A 3A9BA 4N6FA 2GYIA 3TC6A 1B3OA 3CO4A 2J78A 3KCLA 3CEUA 2VFGA 1H0IA 4LY4A 4FLOA 1Z41A 4NNBA 3MSYA 3KTCA 1L6YA 1NTHA 3MUAA 4AU0A 5IOBA 2PWUA 4RZBA 1W31A 4LF1A 4RW5A 5MKGA 4O8AA 5K3VA 1KGUA 3S1GA 4QAWA 1TVLA 3R10A 5EGRA 5LIXX 2VEKA 3MI6A 3VIJA 4C7FA 4YYFA 3UA3A 4DJFD 3W70A 1PVNA 3UFYA 1SO4A 3KRBA 3S47A 5FSDC 4C7GA 4AY1A 1US0A 3EX6A 5LA2A 3FSUA 4JTRA 2Z2UA 2Y62A 3DXIA 3BO9A 4CD5A 2OOGA 3L4UA 2CWXA 2GVEA 4AMCA 1PX8A 1N82A 4AHPA 3UCCA 4TIMA 1BWLA 3VX0A 4UOZA 5A69A 4UQEA 5KETA 4UQ9A 4O1BA 1Z69A 5ECUA 5MHBA 1KRMA 5HNUA 5A8OA 1R8LA 4PBEA 3BMWA 2ZDSA 4O1EA 4J1OA 2Z0IA 4CN4A 2Y5SA 1PPIA 1ZBVA 5GJNA 4XQ6A 3TYUA 2XISA 4PUKA 3MKVA 2GJXB 3UVAA 2YBUA 2A85A 2XFFA 4GI9A 1ISVA 4NG3A 4XD3A 4JIIX 4C1LA 2WSRA 5FD0A 4J2PA 3PP7A 5AC7A 3QR3A 2J88A 3QF0A 5JMUA 4Q8TA 3S83A 1EPXA 3N9RA 7REQA 4CVUA 3AUOA 4S39A 1RLDA 1WPCA 4FNPA 1XH2A 2VC6A 3TFXA 2HZGA 3D5HA 4XUGA 3PTKA 2GLKA 4O4VA 2DW7A 3U4AA 4V2XA 4A22A 3W7JA 3MTWA 4N7QA 1UROA 3SCSA 3QBUA 2ZYFA 1P6CA 2VCCA 4GO9A 8XIMA 3ID7A 1UH4A 4UQAA 3SJ3A 1POKA 2OZTA 1MMFA 3GNXA 2DVXA 4CN6A 4GQBA 2P1FA 3LMYA 4ZO6A 1WV2A 2NV1A 3IVTA 4ZOCA 4LANA 3GB6A 1V3IA 5AYYA 3E74A 2CU0A 4L56A 5C54A 2ACRA 3NO3A 3SRHA 1U1JA 4FP1A 5EMJA 2TODA 3NZPA 3MMWA 1P5BA 2XSBA 3NVTA 1TV8A 1Z8AA 2B7NA 5DFAA 4MOZA 4HA3A 3TYDA 1PKLA 1W2PA 5KMYA 3S6TA 5FACA 1PWLA 3NO5A 1ODUA 1JXKA 4KIRA 2Y8UA 1EL3A 4E8GA 4GJIA 5C55A 3A24A 3CUFA 4Q8PA 3U3HA 4IJCA 1YBQA 2EKCA 4W85A 5EYWA 5ABHA 3G77A 1LOSA 3UPBA 3IV8A 5I3GA 3WN6A 1RD6A 1TO3A 2YFOA 3FN9A 3SM0A 4LCRA 5LHEA 1F8IA 1OB0A 1B9BA 1R3VA 5BROA 2XIBA 4DX3A 3L4VA 3W02A 4WSHA 2R1PA 4FNRA 5HA7A 1W8SA 3VIFA 4E0CA 1R3YA 2V9DA 2UWFA