3PVFA

Structure of c126s mutant of plasmodium falciparum triosephosphate isomerase complexed with pga
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVSFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the role of the fully conserved Cys126 in triosephosphate isomerase by site-specific mutagenesis--distal effects on dimer stability.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 97
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pvfA00
4FB7A 3NQEA 4QQ3A 1TREA 1W3NA 3NQFA 3DFPA 1XDMA 5DY3A 2X1TA 4K38A 2FB3A 1XBYA 4MVAA 3O63A 5EL1A 4LWWA 4O18A 2E5DA 2V81A 1M7OA 4UFHA 1S5TA 2ZCGA 5FF7A 4WD0A 2YYUA 2ZZ7A 4ZMGA 3GDTA 2ZFAA 1GJPA 4OV4A 1XDLA 3LHYA 3S5ZA 4RCXA 3NQAA 4BI5A 4ORMA 3EX6A 2ZQ0A 3BG3A 3IRDA 4PL1A 1PE1A 2NUYA 1PCWA 2C1HA 2YFNA 3NQMA 4PCFA 2Y6ZA 1IXQA 2A2IA 4BFAA 3R12A 5BW6A 4JDBA 4W9TA 2XFWA 1F74A 5U4NA 2C18A 5K3VA 3UWUA 3FYPA 4OV9A 4UTWC 4LRSA 3G8RA 3G1FA 2P1FA 4Z0JA 1Z44A 3R89A 4ZQMA 1JRCA 3FIGA 4JTSA 4O16A 1ZAJA 4NX5A 4UTTA 3UPWA 2VENA 3M9YA 1ICQA 3BLIA 4YMZA 2FTPA 4D2JA 1LRQA 4LS1A 1KW1A 4MY1A 3T44A 3GYEA 4HNUA 3OEXA 3B03A 3W7RA 4Q33A 4A22A 2NWSA 1K02A 3RK8A 1G4SA 4AB4A 4JTLA 3L5AA 3NQ8A 1ALDA 1ZENA 2QR6A 4K6AA 3W2UA 4GUJA 1BTMA 4XKYB 5FF0A 5G1YA 3N9SA 3KRZA 2YPIA 3W70A 3NEVA 1UJPA 3LHTA 5AYZA 1TQXA 3N2MA 5G2WA 3B06A 3MP5A 2E6YA 4CNPA 3P5ZA 4ZQRA 4XBKA 3EWBX 4MY8A 1GVOA 3EX3A 1ZCOA 2WNQA 5I3JA 5LGXA 3GXPA 3LB0A 4LC8A 3WFAA 2UV8G 1T99A 1KV8A 6TIMA 1XXXA 1SO3A 4GUFA 5MHBA 3L0NA 2CW6A 2E5BA 3PBVA 4AF0B 2FPTA 3CLMA 1WBJA 5I3IA 5FEWA 4UTMA 1UASA 3LCFA 1W5MA 1K7EA 1SSGA 4FX8A 3LHZA 2NWRA 3BLEA 3MO7A 3B04A 3QQ1A 3GXNA 4UFMA 3WK1A 4RK8A 4RR4A 1TV7A 1OFDA 1WX0A 1I2RA 3TUUA 4WX2A 3LCIA 3MI3A 1TV5A 4FNSA 3CIWA 1W5QA 1OFAA 2YYTA 3TJXA 2H3DA 3OG3A 1H50A 1AG1O 1TRIA 4N9CA 2RDWA 3EWUA 3UY8A 4Z0SA 1SZFA 2QCDA 1YXYA 3HBLA 4HNNA 3I7SA 3DFNA 3R5EA 1J4EA 3TH6A 1EX5A 1O5XA 3JR2A 5C2XA 3W1LA 3SZ8A 3W2KA 1TPWA 4JTUA 4IMDA 3W1XA 4UFIA 3NQ7A 3NQ2A 3M6YA 4UC5A 5L9FA 1D3HA 3L9CA 1MEWA 1VHNA 3C52A 5FF4A 1JCXA 3SGUA 1R46A 4AHPA 5F2GA 4ZZ9A 5KITA 4WY0F 4MFEA 1I8JA 3C2RA 1EUAA 4M6QA 2ATMA 5HNRA 3S9YA 1OHLA 3LTYA 3KVMA 1NF7A 3EEGA 3TU9A 1G4TA 3W72A 2E6DA 4DBDA 2GJLA 4PA8A 4GFSA 4WY0B 1D3GA 1GVFA 3F4NA 2HTMA 1OG0A 1Z48A 3STFA 4XTDA 3OHIA 4YXGA 1W5PA 1W56A 2VFFA 1EUNA 3IIZA 5DY2A 1OABA 2BZNA 3KOFA 3MP3A 4QNWA 1OK6A 1ME9A 4MZ1A 3S42A 5DN1A 3MHFA 5F2LA 3W87A 3LBCA 4O50A 3P61A 5HQEA 2GVGA 2A6NA 1LM1A 2RH9A 4JXCA 1LBFA 2GVLA 1RR2A 2C14A 4Y6GA 3KHJA 5F4SA 4NJHA 1H62A 4BR1A 3W7OA 4QAIA 3U2OA 3QMTA 4CCDA 3TQKA 3LERA 4DF1A 2WNNA 4O4VA 3ABSA 3P62A 2JBMA 1TTIA 3O6YX 2GQ9A 2FDSA 2Q8LA 4TIMA 3TKFA 4JTHA 2A7PA 2ISSA 1FCUA 1EP3A 1R30A 1OFRA 1N7KA 1MSSA 1KFBA 1O4UA 5K7JA 3WK0A 4FO4A 1EPXA 3FFSA 5EY5A 5FEXA 2ISVA 3UQNA 4N2YA 3UXAA 3KX6A 4H6KA 4QNEA 2Z0IA 4LS2A 3HF3A 1U5JA 4UUIA 4O54A 2GVJA 3LGEA 3EB2A 2NXGA 4ORIA 1PS9A 4E2BA 4JIQA 1A5AA 1LOQA 4RXGA 4JX6A 3HB9A 3DFTA 1KLZA 2QAPA 1XM3A 2ZRVA 3FYOA 3KAOA 3NQGA 1VYSX 5IM51 1S5VA 1H63A 3QC3A 2IQTA 2ZA1A 1ME8A 1TCDA 4MY9A 2FQIA 5F2IA 4HSOA 5FF3A 3LRKA 1QOPA 1VR6A 1VPXA 3N73A 4DELA 3QQ0A 4WOZA 3LCHA 1RQEA 3LCWA 1OYAA 1LRTA 4O4WA 2E77A 2QAFA 3GX9A 1VCVA 1TTQA 2X1UA 3TAOA 3O06A 3SJ3A 3M5XA 3MYPA 1GG1A 5DBTA 1XL9A 4TMCA 3O6CA 1QCWA 4RV8A 2WSRA 5EYWA 3PSWA 4FNPA 3BW3A 2GQ8A 1FWNA 1TPC1 3C8FA 1QAPA 4MJZA 3W22A 3C56A 2OMAA 2A7NA 4Y9AA 3W7NA 3DHDA 4MOZA 1RQHA 1ZAHA 1R2SA 4JD4A 2X1SA 1D9EA 3UYCA 1PL9A 1W37A 4GUGA 4IPIA 3FJLA 4JS3A 4JTEA 1R47A 4BK9A 3GNDA 5BMXA 1K8YA 5BRBA 3TXZA 5D2VA 3T78A 5SWUA 3PUOA 1SUXA 1S5WA 3PBUA 3L5MA 1TIMA 4OHQA 3MWAA 4HNVA 3MHGA 1QR7A 1JCJA 4IQLA 4WXZA 1FWRA 2CLFA 3M5ZA 2EHHA 3GB6A 3HIJA 5AFDA 2PRHA 4CNNA 3DI0A 3LCGA 4MLJA 4M6PA 1PCKA 5G2HA 2P0OA 1EP1A 4ZL1A 3R8RA 3BO9A 1H7XA 3C4UA 3M1ZA 1HO1A 1W0MA 3W1QA 2ZA3A 4NU7A 5D02A 1JQXA 4IGHA 4LUIA 4CCCA 2QDGA 1FDYA 2V2HA 4FNQA 4NJKA 3TIMA 3W83A 2RDUA 1A5CA 4OE7A 2TYSA 4JYDA 2WNZA 4NX0A 4O11A 3I68A 3LDVA 5HR7A 1SFLA 4LOCA 4IPJA 1OFOA 2NXHA 4BI6A 5CG7A 3NA8A 3NAVA 4B5NA 3NQCA 5E1QA 3MJYA 3S5YA 1GPWA 4Z1BA 2YR1A 3W74A 2E1DA 3TXVA 3W85A 3OA3A 1ZJIA 4HPJA 1GQNA 3I6RA 4ADSA 3NL2A 1FUYA 3GR7A 1XCFA 2YW4A 4BWLC 3G1VA 2CLLA 3NM1A 1FXPA 3P74A 1P0KA 2ZRXA 4HSNA 3TDFA 4UTUA 2FIQA 2OJPA 4C1KA 4QJ1A 5H2ZA 3NL5A 1QO5A 2JGYA 3TE9A 3S1UA 1IXOA 3W1PA 3W1MA 3PR2A 5DCBA 3W7JA 2B0MA 3HPXA 3H55A 1X1OA 2VFIA 4O10A 1AL8A 1SO6A 1SQ7A 3BK0A 4JYFA 5F4WA 3CEUA 3P7YA 1UUMA 3G8EA 1ZFJA 3P82A 3LXAA 3W2NA 1OF6A 1VYPX 1AL7A 5K9XA 1XBXA 1J5TA 4O1AA 4JDYA 4O12A 1RV8A 4LUJA 4KKXA 3D0CA 3Q2DA 3W7MA 4O1CA 1THFD 2R14A 3IVSA 2J88A 3H54A 4HNTA 4DXVA 4UCGA 3S0CA 5D2TA 3PSVA 3TSMA 3CB8A 2D73A 4UXDA 1Q6RA 4ALDA 2NV1A 4FXRA 1L6YA 2QUVA 4JYEA 4N6EA 4FX6M 1TSIA 3PB0A 3G22A 3C3NA 2I1OA 2PRLA 3W2LA 1XUUA 3FOKA 3GAKA 2A5HA 3A5FA 1EWEA 4DQWA 4ML9A 3QZEA 4MYXA 4FXSA 2O7QA 4UTLA 3PB2A 1H7NA 4O0KA 2PCQA 4X9SA 1FDJA 1KM4A 3A23A 4CQ8A 5LNUA 1ML1A 3WJXA 4O1DA 3HQ1A 2WSYA 1VCGA 3VE7A 3DHFA 1UBSA 3EWXA 4K8HA 5D30A 1QPQA 1KM5A 1H7RA 1HO4A 3SFKA 2YXGA 1CI1A 3NYZA 1B4KA 1SFJA 5KZDA 4GC4A 4RZ4A 4Y90A 3GIYA 2ZZ1A 3G3MA 3GLCA 3NQVA 4HIBA 5AHEA 5FI8A 2QCFA 3QMRA 1TJPA 1W8SA 2QJHA 3NDOA 2JGQA 2YW3A 3PF3A 1OX4A 3G1XA 3EXTA 2WKJA 5E0KA 3TFCA 1YADA 5KINA 2A4AA 3STEA 2QCEA 1GVQA 3W76A 3QW4B 4ZVJA 4ZQOA 5IBXC 3RF9A 1TTJA 2I14A 2CLMA 1KFEA 2NX3A 1DJNA 2NX1A 1SZNA 1JR1A 3BG9A 3YPIA 3W7LA 5I3FA 3NR0A 2CFFA 4XBSA 5LZLA 2G97A 3HG5A 1B4EA 2ZRUA 4JTTA 5AOUA 4RX0A 4A2SA 3TAKA 3C6CA 1G7VA 4FX7A 3LI1A 3LHUA 3TCEA 1IIHA 3IIXA 2C19A 5BNKA 1YYAA 4CQAA 2VEPA 3O8AA 2ISWA 5CGQA 3VCRA 2VC6A 2J27A 3BGJA 1YLVA 3C2EA 1LYXA 3BG5A 4RZ6A 3HGSA 4LVFA 1H7WA 1VGAA 3B8DA 3O15A 5TIMA 2LLEA 4CQ9A 3TW7A 2Y7FA 4GE8A 3DFQA 4OWGA 1QFEA 3WJWA 2CLKA 3EWWA 3IGSA 1TQJA 2AGKA 3B05A 3AJXA 3LTPA 5HJLA 1SW3A 2ZA2A 4JY9A 5C6MA 5EBUA 1NSJA 3MBFA 3DU0A 2Z6IA 4OT7A 1DL3A 4HHPA 3ZS4A 4FNUA 3PUEA 2A1YA 1LBLA 3O07A 1JCLA 4RLIA 4UTIA 4JX5A 2NUWA 2NZLA 4FNTA 3UZJA 1NAL1 5HUOA 1AK5A 2H8XA 1W54A 3M43A 2J9YA 3N34A 1KBJA 1DOSA 3EWYA 5D2XA 4POCA 3L2IA 1O95A 3SY5A 1XUZA 2VFDA 4S1FA 3CIXA 2QCLA 4CCEA 3FEMA 1OVDA 5KZEA 4PH6A 4OU1A 3NZ1A 1EP2A 3BW2A 1FCQA 3L5LA 1KV5A 4IMFA 3INPA 3FS2A 2BXVA 1QPOA 2C16A 1MEIA 1M7PA 1ME7A 1J2WA 1R2TA 5IBXA 2RFGA 3G1DA 3SECA 3N3MA 4AH7A 5LHFA 1FX6A 2RKXA 4R53A 5HWJA 1QDSA 1YTDA 1ZY9A 3NPVA 1L6SA 5H91A 1WQ5A 4UMAA 1KFKA 4WOQA 2V82A 2V8ZA 3NL6A 3CEPA 1GTEA 3DXIA 3PY2A 2E6AA 5EA9A 2ZZ5A 3DZ1A 2G96A 3QH2A 3HG3A 4PL2A 3M5VA 4O15A 3G0XA 4CLMA 1SZEA 2ZZ2A 1L6WA 3O1NA 3W73A 5E93A 2A21A 4DEFA 3OIXA 4I9AA 5T26A 3E9AA 1KTNA 1LCOA 2ZTKA 4I7UA 4IMGA 4ICNA 1ZALA 5D03A 5LNVA 2V5LA 5CZTA 4AWUA 3BGGA 4M7TA 3LV6A 1H1YA 1KFJA 2NX9A 3ELFA 3QPYA 1I2QA 6ALDA 3DH7A 1VHCA 2CWNA 3LCXA 2DP3A 1U83A 4R7JA 4JR5A 4WZHA 1YDVA 2CLEA 1SU5A 5LNWA 4Y8FA 5K2ZA 1FDZA 4M5PA 3MI2A 2ZYFA 3THQA 5KZMA 2A0NA 5BMWA 3W07A 3BVJA 2KZHA 3UZ5A 4DPPA 1T8XA 2EKCA 4P2VA 4MIMA 3P81A 4K37A 1H7OA 1T96A 3A21A 4XTIA 3NO5A 3UWVA 1LORA 1G6CA 2YGYA 1DQWA 4O8RA 1QNVA 2CZEA 4PTNA 2W6RA 1MEHA 1P4CA 4DF2A 2DZXA 4IMCA 5CPLA 1XKYA 2Y7EA 1BWKA 3FJ6A 4O19A 3QPZA 5F2MA 4ONVA 4JNMA 1XI3A 1KM1A 3JS3A 3V1PA 1H5YA 3W7GA 4UTKA 4IWWA 2VEIA 1K7XA 3CWNA 4RZ5A 3QFEA 3W9ZA 1BEUA 1QOQA 4UNLA 3DBPA 2TMDA 5DCDA 3HG2A 3CTLA 4YCPA 4AVFA 2J9ZA 2ABAA 4JY8A 3UXDA 2NXIA 2V5BA 1DJQA 3NQDA 3DKLA 2A85A 2H6RA 2YZRA 2JKAA 3WK3A 1KTBA 2Q8ZA 4NVTA 2GQAA 3GK0A 3W71A 2TRSA 1JCMP 3W1TA 1YPFA 2BTMA 3TV8A 3KVLA 1F6PA 1GTHA 4MYAA 3N9RA 4NJJA 2NV2A 5LNSA 1LLZA 3NL3A 2QDHA 5FEPA 1AMKA 4A21A 3CQ0A 2WO5A 1OFBA 3PULA 5DCEA 3F4WA 1FXQA 3LI0A 1DHPA 3F1QA 2NLIA 4O52A 5L6UA 4O13A 1TPUA 3LCLA 3O16A 3R13A 1ICSA 3EXRA 2R94A 3G18A 3Q58A 4AMAA 1G7UA 1VQTA 3THAA 2YDAA 5LSMA 1WDWA 3LRLA 2I9EA 1SO4A 4JTGA 1GEQA 3VNDA 1FWWA 4M7SA 3P67A 3NVTA 2Z6JA 4EOUA 3PM6A 3GVGA 2VFGA 5D04C 4LC6A 3EX4A 2XN2A 3PC0A 1LRNA 3RFAA 1I2NA 1N55A 1VH7A 2WSQA 1C29A 3W84A 3SSJA 1H1ZA 2EAWA 5DLCA 1IXPA 2ZRWA 4IXXA 4UTJA 1QWGA 3G1HA 2HSAA 1H61A 1P0NA 3ZWSA 1VZWA 3C61A 3PAJA 1RZMA 4KFOA 3G1SA 5ABTA 3BARA 5D32A 4WJEA 3ABOA 4NUWA 3DI1A 3DFOA 2QUTA 1KM2A 3Q94A 1TPFA 4C1LA 4A2RA 4N4PA 2PURA 2CLOA 1V7YA 3EX1A 3PUDA 4QM1A 3W86A 1JQVA 4AXKA 2ALDA 4EVZA 2B7PA 2V30A 2X30A 1F76A 1RD5A 2CLIA 2QUUA 3C0JA 2OT1A 2Z2UA 3V75A 4O14A 4HPXA 1TRDA 3LOTA 1QO2A 4NNAA 3E12A 4K7VA 3WK2A 4E0CA 3E49A 3LHVA 3MBDA 3UWZA 5D09A 1RQBA 4OBTA 3GNNA 1G67A 1FWTA 4UTTC 1MXSA 4KWWA 1F6KA 2Q3RA 3LLDA 4UNKA 2XN1A 4S2CA 1SSDA 4IMEA 5AHIA 2V0TA 5EKYA 2V9DA 3C2OA 4UFJA 5LHEA 4M19A 3TSDA 2R8WA 4DO6A 1GT8A 4DO4A 4YCOA 2VKZG 3LTSA 4H3DA 3K30A 1WOBA 3IGUA 4WXYA 3IIOA 4RXFA 5HWMA 1LBMA 1EWDA 3NQ6A 2HS8A 1QPNA 4I7VA 4Q32A 3UPBA 2QJGA 4AF0A 5FEZA 1A5BA 4OGZA 4IXHA 4WY0A 5A8GA 5D2YA 3HMJG 3DENA 4NJIA 4UFLA 1G4EA 1ONRA 4LS0A 3RMJA 2C3ZA 2Y63A 4S2BA 3KRUA 1F7BA 3FKRA 2GOUA 3SW6A 2Q3OA 4PFMA 3USBA 3T40A 7TIMA 3IVTA 1WAUA 2WJZA 4MZYA 3U6WA 3JRKA 1SO5A 1YDOA 5AB3A 3L68A 3E96A 4JTIA 2HS6A 4EWND 3QJAA 2Y61A 3NNTA 4MPQA 3W6YA 4AHOA 2QCDB 1X6UA 2VOMA 1YXCA 2NUXA 3FKKA 4TR9A 3S5NA 3B0UX 1KM3A 3W1RA 2C0AA 5DELA 5AC7A 5HUPA 1KFCA 3P8IA 4NZJA 4XUGA 3M5YA 1V5XA 2Y62A 3TW6A 1HG3A 3QF0A 1SW0A 2BSLA 3HOJA 4LVBA 5LKYA 5J5DA 5KMYA 1DBTA 3QSRA 1GWJA 3ATYA 1I2OA 2ZZ4A 5CKSA 3TK7A 1FWSA 1W5NA 3M44A 2A6LA 3CHVA 4N9BA 5CPMA 1W1ZA 2XN0A 5K4XA 5F1UA 1VLWA 3PWAA 1G4PA 2QCNA 4I7WA 4EF9A 3TSBA 1B57A 1LOSA 4ADTA 2EPHA 1VJIA 2YX0A 3WJSA 2H8ZA 3LX9A 3E02A 4LY8A 1OFEA 3EWZA 5CZSA 4GNJA 4AEOA 4KFPA 3TQ0A 4DO5A 1QMLA 1LZOA 1L9WA 3N14A 1YTEA 3NPUA 2GUUA 2W0UA 4TX9A 3W1AA 2QCCA 3G3DA 5HULA 4LVAA 2R91A 4UIOA 2E09A 3U8GA 4LRTA 1TV8A 1Q6QA 2RDTA 3L67A 2DZVA 1XC4A 3HGRA 4UTWA 5LGZA 4O57A 3HG4A 3RNDA 3CPRA 1AW1A 1NF0A 2DZSA 5C5YA 1TTPA 4ZQCA 3QEZA 3MYOA 3DKJA 1PHQA 4LV9A 3OVRA 1HTIA 1OYBA 1FQ0A 4N02A 4PODA 3T4CA 1JUBA 4E2DA 3LV5A 4X3ZA 4NZFA 4QISA 2JKPA 4GUIA 4JTFA 3FA5A 1XBVA 4UR8A 3VE9A 5FESA 1F2JA 4NJGA 3RU6A 3W7DA 4XWUA 5C55A 2E5CA 2FPVA 3GAYA 5DBUA 3UY7A 1HL2A 3UWWA 1X7FA 1WXJA 2DORA 3W7QA 5I3HA 1VLIA 1PIIA 4A29A 1I2PA 5HWNA 4P61A 3GDRA 3NZRA 3W7CA 2CLHA 1KBIA 3PVFA 2DZTA 1EB3A 2VXNA 1N8FA 3OBKA 4TU1A 1KFLA 5EPDA 4YLWA 1G69A 2VEKA 1FCBA 3TX9A 3LLFA 3H53A 3TNOA 1TPDA 4LT9A 1BWLA 4IOTA 3LBMA 4LW7A 4FHAA 4JTJA 1H60A 1JUKA 3KRSA 4Z08A 1DVJA 4PEKA 4YWIA 4MKNA 4EF8A 3ZWTA 2DJLA 3UNDA 4A3UA 3DFSA 4GRSA 1ZAIA 1SPQA 3O05A 5K4ZA 3B4UA 3TC7A 4NNBA 3TC6A 2DZPA 3G1AA 4TO8A 3IGXA 5LNRA 1GYLA 4FIQA 3BLFA 3NPXA 2Y7DA 3AO0A 5D05A 3PBYA 2OX1A 3CC1A 1K8XA 3CU2A 4MFDA 2O7SA 2H3BA 2ZRYA 2TPSA 5CZJA 4ZQPA 3P84A 3IEBA 4FF7A 1M5WA 1TPH1 1LROA 4LU0A 4HN4A 1T0OA 4NXKA 2J24A 4LVDA 3G1YA 2BLEA 3W7IA 1K03A 2CU0A 3S5OA 4L4MA 3EXSA 5CSSA 1YXDA 3P8JA 5BOOA 3ABRA 4QITA 3SGZA 1W3TA 1P5BA 3ANYA 1GVRA 1O5KA 1F73A 3FLUA 1OF8A 2ZZ6A 4CNOA 5AHNA 1O60A 4MLRA 3I65A 2JKEA 5GVJA 3QYQA 3VFLA 1TMHA 4UMCA 5I3GA 1Z41A 4U28A 1JRBA 5FF2A 5G5IA 2QKFA 3L65A 1Q45A 1JJKA 3WJYA 4H4IA 3IV3A 4PC8A 5D33A 1GZGA 3DAQA 1LP6A 3DGRA 5TBOA 1B3OA 3EKLA 3BW4A 3L21A 4JX4A 2B7QA 1LDCA 1RPXA 1Q6LA 2DJXA 4R33A 1M6JA 1TB3A 3RLVA 1C9DA 3G0UA 1SR9A 3WJZA 1W5OA 1WYIA 1DORA 3QM3A 4MZ8A 4G1KA 2A7RA 2JK2A 3N2XA 1Z42A 1A50A 4DF0A 2E6FA 1YDNA 2YSWA 1Y0EA 4BI7A 1JULA 4YL2A 1OJXA 3W2JA 1VRDA 4Q4KA 3F03K 3E0IA 3CT7A 3MUXA 1A5SA 3STGA 4DPQA 4NT0A 5G1TA 2PE4A 3S1VA 3KVJA 3MP4A 4K8EA 3W1UA 1GG0A 2PC4A 4WQ6A 3S8HA 2CZDA 2DU2A 5HR6A 1TPVA 1NVMA 5KSWA 2FPYA 2ZDRA 3TJLA 3ZFHA 2FLIA 3NGJA 4IJBA 1K8ZA 1MZHA 3CWOX 3HGJA 3UWQA 2B7NA 4L4LA 2VELA 3GDLA 4LTSA 5D2WA 1CW2A 1OK4A 3IVUA 3M0ZA 3L66A 2Y89A 3MHUA 4DBEA 3QW3A 1GOXA 2HMCA 3W23A 3ZR4A 1BKSA 1IXNA 3MMTA 3Q37A 2C6QA 2C13A 1JCNA 4WUIA 1EA0A 4XQ6A 2B4GA 4RJEA 3ATZA 1VCFA 4Z1DA 5I3KA 3C2VA 2ZTJA 3A9IA 1TPB1 3C2FA 4OQVA 3TA6A 3LXCA 4LV4A 1B9BA 3L0GA 3NM3A 1ADOA 4BWLA 4AHQA 3W75A 1UUOA 5G2IA 3W7KA 1Q6OA 3O6DA 2X16A 5G4WA 2CZFA 2VFEA 4IX2A 1VYRA 1OX6A 4O1BA 3VKJA 3HPZA 1PHWA 4GWEA 5D37A 3W2MA 1E51A 4IX0A 3LHWA 4FIRA 4JEQA 1TPEA 1H7PA 4N9DA 1QPRA 2G5WA 3NG3A 2FJKA 4TMBA 3W7EA 1X1ZA 1OX5A 3G24A 5EMUA 5HINA 3I7RA 4E38A 1VS1A 3MW7A 5AC8A 1VC4A 1TYGA 2GJNA 2WPBA 3GR8A 1EEPA 4QSHA 3UWYA 5C54A 2AAMA 4N9EA 2X1RA 1WA3A 1WBHA 3SR7A 5J5RA 2BWGA 2QCHA 4GBUA 4LNYA 3L0KA 2YCEA 4IUOA 4JN6A 2W79A 1F05A 1AW2A 4HKPA 3STCA 4X2RA 1NFBA 1MO0A 2VFHA 1DV7A 1IGSA 4QIUA 5K9CA 2F84A 1KM0A 3HGOA 2QCGA 3QSTA 1A53A 4KFNA 5AYXA 3T55A 1JVNA 1I4NA 3A22A 4JTKA 3P5YA 1KM6A 4AWSA 2ZRZA 3GKFA 3UD6A 3BV4A 1R2RA 5A5WA 3M47A 1LOLA 2QCMA 5D38A 3EKZA 1UB3A 3SIZA 1OFQA 4K7YA 2BX7A 2J6XA 3M16A 1KA9F 4N6FA 4Y96A 2ZBTA 1ZNNA 4ZQNA 2TSYA 4Z1CA 3HO8A 4EIVA 5AC6A 3TR2A 1KTCA 1UCWA 2B7OA 1PV8A 3TMLA 1OFPA 2Z1BA 1O94A 2FB2A 5TQLA 2ZZ3A 2WOQA 1FBAA 1XFBA 1ZHAA 2C15A 2Y88A 4HT3A 3B0VC 4O17A 1JCYA 2GPTA 3S6DA 1DQXA 2F7FA 3R2GA 1YTKA 2CZ5A 1OYCA 3S1XA 4FNRA 5F1VA 4UMBA 1EIXA 2WQPA 3KFTA 3NPWA 4LVGA 3QRHA 4J9JA 1HFBA 3ABQA 1CX9A 1P1XA 2V2DA 5U7SA 1AW5A 4XZ9A 2QF7A 3PG8A 4RKAA 3GKAA 1F5ZA 3EX2A 3PBWA 8TIMA 4UTHA 4GXMA 5F4XA 4UR7A 5CPNA 3MI6A 1IF2A 5AHLA 3A5VA 2QEZA 2G95A 1OX4B 3PS7A 1DKWA 4AWTA 3IIVA 1Q3NA 1GYNA 1TJRA 2ATSA 2EGZA 2QJIA 4NXSA 1K7FA 2V2CA 1NEYA 3TMQA 1C8VA 4K39A 3HJZA 4UFKA 5CZ0A 5CSRA 1PVNA 2WV8A 1WV2A 3QMSA 4MJMA 4N4QA 3TFXA 3LM7A 1X8FA 1SZGA 3NXFA 2DZWA 2VEMA 1S3HA 3OVPA 3GZ3A 2PRMA 1GVSA 1FCVA 4AAJA 3TROA 3KVKA 3LRMA 1KLYA 4X22A 2J9XA 1RVGA 2OZ0A 1HUVA 5HMSA 1LTDA 4U4MA 3M7WA 3OVQA 4R34A 3TQVA 1WOAA 1H51A 1W31A 4O53A 4NNCA 1JUEA 2H90A 4JICA 2Y85A 1SW7A 2ABBA 3KXQA 4KWVA 3VI2A 3GDKA 4ADUA 2OT0A 3LXBA 3NOEA 4GJ1A 4Z1AA 3GXTA 3T7VA 4BF9A 1TO3A 3CM4A 1LLWA 3B0PA 3P60A 3N19B 3RLUA 1L2UA 3G0SA 5AHMA 5AYYA 3W7PA 2Y7GA 3M41A 4O28A 1YPIA 1XBZA 3S1WA 3W3OA 5KTLA 3GDMA 4O0ZA 5DXYA 2DZUA 5K9DA 2X2GA 4K36A 1FY6A 2AQWA 1IIGA 2OCZA 4FEZA 2RHGA 5DXXA 2YFOA 4MUZA 3IIPA 1I45A 5AN7A 4GUHA 2Y70A 5CPOA 3HPSA 3P80A 1K3UA 5G4EA 4JGDA 2E68A 3BPWA 4XKYA 2EF9A 3W88A 5AHFA 3SI9A 3W1NA 2FFCA 4JIPA 1ICPA 3I7QA 3PG9A 1W3IA 4M6VA 4NQ1A 2P10A 3W7HA 3A24A
chains in the Genus database with same CATH superfamily
2XH4A 4RDZA 4JHZA 3GNPA 5DY3A 5I02A 4BEUA 1YNYA 4HA1A 2W62A 3LMYA 1XBYA 3CHDA 3EPNA 4JFWA 5EL1A 4H9VA 1M7OA 1FWAC 3KL5A 1NELA 3GDTA 1TX0A 4OV4A 3S5ZA 6ENLA 4RCXA 4BI5A 2DT3A 4PL1A 4D6FA 2NUYA 4JN8A 1PCWA 2C1HA 2YFNA 1WUEA 2BDQA 2VC5A 1IXQA 3R12A 1A5NC 4PCPA 4UQCA 2OKOA 3M0LA 1C9WA 3TP4A 3WLOA 3ARZA 2C18A 4UTWC 3WQ4A 2REQA 1O66A 3R25A 4IIHA 1WNOA 4ZQMA 3GUWA 1A5LC 4JTSA 2NSOA 2OFJA 5C70A 4NX5A 3UPWA 4GY0A 1REQB 1FWCC 3FHQA 3BLIA 3N18A 1UZDA 3D47A 4HTYA 2F38A 2BB0A 3TLLA 4DY1A 4H6RA 4QSFA 4QAWA 1O68A 3LPOA 4A22A 2POTA 4ACZB 3NTYA 5MKGA 4JTLA 3H4WA 3L5AA 1ALDA 3QR1A 3O0KA 3GR4A 1BTMA 4XKYB 1UWIA 3N4FA 3EDJA 5G1YA 3N9SA 4WJ8A 1C7TA 2YPIA 3UZZA 4L4OA 3WNOA 3LHTA 1TQXA 1V6YA 3TN3A 4MY8A 1GVOA 2WNQA 2VUYA 4C6DA 4LC8A 4M6UA 3TR9A 2UV8G 1T99A 2E28A 4B2DD 4IQEA 3GS6A 1UG6A 1SO3A 4TOQA 2HV5A 4IZGA 3G1RA 3RLHA 4AF0B 1ZBVA 4DM2A 1WBJA 4UTMA 3S83A 3LCFA 1W5MA 4HP5A 3LHZA 4PTMA 4KEUA 3QQ1A 4UFMA 1Q5MA 1R3RA 1I2RA 4ROQA 3CIWA 1NP0A 1OFAA 1ITQA 2HROA 4KMQA 1AG1O 3QC0A 2VX4A 2RDWA 1KGXA 4M56A 1TWSA 1A0EA 1SZFA 4AFYA 4AZCA 4Y9PA 4CEUC 3RG6A 3MUIA 2ZC8A 4Z2LA 3IJ8A 3TH6A 1EX5A 1O5XA 4JQAA 1J93A 4MWAC 3UA3A 2O92A 3BQ5A 4DYKA 1D3HA 2W91A 1DXFA 2GL5A 1R46A 1H11A 1W17A 5F2GA 1TZ9A 4HB7A 1UD5A 4GBDA 1RK6A 1I8JA 1EUAA 2YCLA 4M6QA 2ATMA 1XIMA 3S9YA 3LTYA 1B3YA 3KVMA 1WDRA 1ADDA 1EQCA 1XWYA 4F0LA 1EC8A 3TU9A 1G4TA 4HMEA 4PA8A 4OUEA 4C6FA 3WLJA 2HTMA 3ITVA 1OG0A 3AHXA 2Z28A 1W56A 2WQDA 5CEWA 4MMWA 2IPWA 5RUBA 1E0XA 3LUTA 3HQOA 1OK6A 2VM8A 4IIBA 1D2KA 4MAVA 3MHFA 3W87A 3P61A 4Y6GA 4PB5A 5HA7A 3TTOA 4MNJA 3NCOA 3UJRA 2WLZA 3BMXA 3U2OA 1VD6A 4CCDA 1DIEA 3ONCA 3LERA 4PUEA 3TQKA 5BXPA 5CXPA 2WANA 3UVAA 1AD4A 3BUVA 2GQ9A 4TIMA 2JIEA 1E40A 4J35A 2WNWA 1BXCA 1RPKA 3NFUA 3BLLA 2PWDA 3EDFA 1KFBA 4FO4A 5EY5A 1YNPA 3KX6A 3IGHX 3N17A 2C1GA 1ISZA 5IDZA 1V6WA 2XJ7A 4E2BA 4JIQA 1A5AA 4Q6JA 4BHYA 4JX6A 3HB9A 3VDGA 3VIHA 2ZRVA 3FYOA 3VILA 1VYSX 3T0BA 3VIGA 2PMQA 1O5RA 1UA7A 4PMQA 1BVNP 3QPEA 3EOOA 3B8WA 5IXEA 2PDNA 3LU2A 4R5EA 4HBKA 3LMZA 1W9PA 3UETA 1VR6A 3QQ0A 4WOZA 3PHAA 4ZB0A 3LCWA 1OYAA 1YQ2A 2E77A 2R9RA 5BWAA 2OR2A 3GX9A 1QW7A 1RA5A 4H8NA 1DIDA 3O06A 1CXKA 1GG1A 1UKPA 5DBTA 1Q2RA 4TMCA 1QCWA 1R7OA 4RV8A 2GGIA 4W87A 2YL8A 1EKOA 3BAXA 1FWNA 1TPC1 3C8FA 4MJZA 3W22A 4W85A 3LSCA 2A7NA 1US3A 2V5KA 1B30A 1E0VA 1RQHA 3VNZA 4GVHA 3PBMA 3E5PA 2ZUSA 4GNKB 4PRTA 5JBFA 4TVDA 2X0HA 2YB4A 4KW2A 3RMEA 3WH9A 4W8BA 4GUGA 4M82A 4HOXA 4M8UA 3E3HA 1R47A 3HV9A 4BK9A 4BA0A 3O0FA 5BMXA 5BRBA 3PZNA 5T9BG 1T6MA 2E40A 2IW0A 1KRCC 3L5MA 1TIMA 4OHQA 4FZIA 4PCTA 4HNVA 3MHGA 4IT1A 4DI8A 3N2TA 3E0FA 1TKKA 4WXZA 4HVXA 3M5ZA 5AFDA 3GNOA 3DI0A 3LCGA 4MLJA 3VGBA 1GZJA 4EXAA 1PCKA 1UKSA 2JF6A 3AZSA 2Z4GA 3R8RA 1H7XA 3M1ZA 1W0MA 1S2UA 2WJDA 2VR4A 5BOEA 4KWSA 4LUIA 4EPDC 2F6XA 3W83A 4GYKA 4OE7A 3LG3A 3CQIA 2TYSA 2V3FA 2PEVA 3VMOA 3LDVA 4MPKA 1P0EA 1H5VA 1UWAA 1SFLA 3WF0A 3OPSA 1OD8A 4GZEA 4B5NA 3NQCA 3VIIA 5E1QA 4BQ4A 1B3WA 3AIVA 2YR1A 3B8SA 2P88A 5CJ5A 3OA3A 1W8GA 4HPJA 5BU9A 1GQNA 3I3DA 3HTWA 3ZQ9A 1XCFA 2VWTA 3G1VA 2CLLA 2EQDA 1CDGA 3OVGA 4DX3A 4RPQA 4K3ZA 1VBGA 4XUYA 2EXOA 3USZA 1HIZA 4NI8A 3VIKA 1HL8A 4GD0A 1R38A 3W1MA 3PR2A 3K8MA 1AH3A 1XLMA 2WHLA 3MZ2A 4O10A 4HMDA 3WQEA 3BK0A 5E9XA 4GKTA 3CEUA 1R5YA 3P7YA 3ZLFA 1UUMA 3G8EA 4ZOEA 5AKQA 3LXAA 2RAGA 5GJNA 5BXTA 3BJFA 3W2NA 2DW6A 1VYPX 1ZB5A 1XBXA 4IPPA 4DJDC 1OCJA 1JD7A 3TTQA 2R14A 3EMQA 4GQRA 3IVSA 3WEMA 4Q8VA 1EJ7L 4RV3A 4AVNA 4R9OA 1PEZA 1MW1A 4B5WA 1POKA 4L6DA 4JTAA 2QUVA 2WBGA 4WDUA 3AIRA 4FX6M 1E6RA 4MF4A 2I1OA 3B9EA 3IUDA 1XUUA 1Z3NA 3GAKA 3H26A 4EAYA 3ISIX 4H41A 3U9IA 2A5HA 2VZSA 3A5FA 2XM2A 1EWEA 3WDQA 2GSHA 4FXSA 4QXIA 5A2CA 1TUXA 2E67A 2WHKA 3TZNA 2QHAA 3A23A 4CQ8A 3WJXA 4DXKA 1VCGA 5A8PA 1QW8A 1V02E 1QPQA 2VEGA 3IUHA 1B90A 3HV8A 1VBJA 1JYXA 4HCDA 1H0GA 1B4KA 1ECQA 4Y90A 3G3MA 3LYEA 1TJ2A 2WAGA 3PFRA 5HNUA 5FA5A 1W8SA 3NDOA 3PF3A 2WCGA 2WKJA 2DSVA 2HE8A 3N9KA 3U3HA 3QW4B 1IGWA 1ODUA 4ZVJA 2PF8A 5AYBA 3FA4A 1CECA 3RF9A 1ZQ5A 3T07A 1AUSL 1KFEA 2Z2AA 1JNEA 2V68A 1XYZA 1JZ2A 1JR1A 3YPIA 2PUZA 4CCZA 5H6HA 1XICA 4GI4A 2CFFA 5LZLA 2G97A 3HG5A 1B4EA 2PB1A 2WHJA 3TAKA 4YTUA 1CIUA 3C6CA 3FA3A 1G7VA 2QJJA 3PWIA 3TCEA 5BNKA 2C19A 2V63A 4QTGA 2VEPA 3O8AA 2ISWA 1E1EA 3C2EA 3BSHA 1PKMA 3WNKA 5C9ZA 1LYXA 1V3IA 1Q63A 3CMFA 3B8DA 3O15A 4DJDD 3TW7A 2Y7FA 3GH4A 3AMDA 1VIWA 3FYYA 1HP5A 3TTSA 3DHPA 3NSXA 1U30A 5EBUA 3AISA 3MBFA 4OT7A 4HHPA 5E6YA 4FNUA 3PUEA 2WVUA 1LBLA 2IXVA 3BAJA 4LALA 2NZLA 1NAL1 1CCWB 3ZLHA 1W54A 1CLKA 1KBJA 4GG9A 3EWYA 3V36A 3GE7A 3SCPA 3SY5A 5D8ZA 1MRQA 2WZEA 2QCLA 4WDWA 2GUYA 4IIDA 4CCEA 3B9AA 1NH6A 5CC7A 1TMQA 2YCKX 1X6LA 5FJUA 3SUVA 2BY2A 4OU1A 1J0YA 4IF2A 1FCQA 3K8KA 4RL3A 3HFTA 4LY4A 3L23A 4UQAA 3VD9A 3FS2A 3F2BA 1MEIA 1M7PA 1WXYA 1F3EA 5IBXA 3G1DA 1IZKA 4P8UA 1ZP4A 2RKXA 4CNTA 4R53A 5HWJA 1MW3A 1L8NA 4J40A 2G3JA 1LT8A 3KS5A 1J0KA 3WDPP 3BH4A 1BVWA 3LY0A 2J74A 4Y2WA 4S3KA 1GTEA 5EA9A 4LUSA 5C9UA 5E0FA 2G96A 4F0SA 4XZNX 2J8GA 1SZEA 2ZZ2A 2OB3A 2YBVA 2ZVRA 3O1NA 3W73A 5E93A 2DUAA 4GX9A 1IWPA 2CBJA 1LCOA 3HURA 4OBRA 5D03A 5LNVA 3LV6A 2OYLA 1A47A 2NX9A 2FMNA 4ATDA 6ALDA 4PBEA 5A2BA 2IKJA 4S3GA 1GYMA 2OLHA 2OZ3A 2CWNA 4R7JA 2DUXA 3V0TA 3QGKC 1SU5A 3OZYA 3V18A 4OECA 2OWCA 1XIGA 1E9ZB 3S5SA 2A3CA 3N04A 3U57A 4YTQA 5DMMA 1T8XA 2EKCA 4MIMA 3P81A 4YN5A 4DN1A 3NO5A 3AZTA 2J7HA 1LORA 3SQSA 1MDLA 2OPJA 2YGYA 5T91A 4AZ6A 2HISA 4KT2A 2CZEA 3ZO9A 1MEHA 4I3GA 2IPGA 4NSBA 1E3ZA 2Z7GA 3E5BA 4H8VA 3FJ6A 1I9CB 3QPZA 2OO6A 5F2MA 4ONVA 3KTXA 3SO7A 3WD1A 1JZ7A 1GEHA 1KBBA 1BEUA 3U5UA 3AC0A 4UNLA 1EGZA 3R79A 5DCDA 3CTLA 5LIYX 4YCPA 4DLMA 1JGMA 1VPYA 4JY8A 2V5BA 3NQDA 2XGIA 3DKLA 4H2CA 2JKAA 3OO2A 4NVTA 3GK0A 2J13A 4GYFA 1OT1A 3D6NA 4KCTA 3SCUA 1EJVC 3ARPA 2ZKMX 1KQZA 3BSMA 1F6PA 1GJWA 2NV2A 1LLZA 3NL3A 3E38A 4LEFA 1KXVA 3IJLA 4U2ZA 3GVRA 3HPFA 2VX6A 1XIDA 4O52A 3DHUA 1MI3A 3PPHA 5H8UA 3O16A 4DWDA 1RK5A 1DTUA 2RJHA 3QTPA 2R94A 1AZ1A 4KPLA 3LA4A 3REQB 1IZJA 2Q71A 5KEZA 2V5JA 3GXMA 2NQHA 4XB3A 4ERAA 3WSUA 1UKQA 1FH9A 2VFGA 3GVGA 1YBQB 5D04C 4LAKA 1N55A 2WSQA 5LXEA 1C29A 1E6SM 1YMYA 2XWDA 1H1ZA 3GNXA 2YL5A 3BLKA 5DLCA 2ZRWA 4QS5A 1UP3A 1UR2A 1A4LA 2PZNA 3VX1A 1DXIA 2X05A 4KFOA 3AXXA 4IG2B 3AYSA 3CV6A 1S2TA 2EPLX 3ABOA 4WJEA 3RJXA 4UR9A 3URNA 2HK0A 3DI1A 2J75A 4DZIA 2QUTA 2HEJA 2WC4A 3Q94A 1TPFA 1E71M 2OODA 5AVHA 1A5KC 1NWUA 2X30A 1D7KA 3C0JA 1VP5A 4TV6A 3V75A 4O14A 1ZTVA 4HPXA 1TRDA 3LOTA 4QQUA 1VFTA 3WK2A 3SN1A 3LHVA 2VRQA 3GRIA 5D09A 1RQBA 1RY8A 3GNNA 3WNNA 3H7RA 1K9FA 1FWTA 1BPLB 3C0LA 1VEPA 2XN1A 4X9YA 4IMEA 1A49A 4EPBC 2D0FA 4GLEA 4AYSA 2XTKA 4CN6A 1CGTA 4M19A 2R8WA 1GT8A 4YCOA 3LTSA 4H3DA 3IIOA 5HWMA 1LBMA 4JIEA 4LSBA 4B5TA 1EWDA 3NQ6A 4BF7A 2HS8A 1DWGM 1QPNA 3UPBA 2QJGA 4AF0A 2IPJA 5LIUX 1HKWA 4IXHA 5A8GA 3GU1A 3PJXA 2Y5EA 1ONRA 1DEDA 4S2BA 1AQMA 1YW1A 1EIBA 4GO9A 2GOUA 3USBA 3BJTA 1C8YA 3T40A 7TIMA 1WAUA 2WJZA 4GGHA 4MZYA 2QYGA 2QV4A 3BAWA 1N8IA 5I78A 1BSIA 4JTIA 3DFHA 3CYVA 3QJAA 4N0RA 4MPQA 1EDGA 1X6UA 1KM3A 4H2HA 2CIPA 2DSUA 5AC7A 2D22A 3ZLGA 4FALA 3QF0A 4B5SA 5J5DA 4NP7A 2VRJA 1GWJA 3ATYA 4C7GA 2VDHA 3TK7A 1UH3A 3K8LA 1FWSA 4HCLA 2A6LA 4N9BA 2XN0A 3Q67A 1PTDA 5F1UA 2Y5JA 3GG7A 1QK0A 1PWMA 4I7WA 3W24A 4EF9A 4XVEA 2EPHA 1VJIA 5JUVA 4EPKA 4G7EA 2XISA 1OFEA 3VIMA 3H2NA 5CZSA 4GNJA 4AEOA 3S9ZA 3N14A 2E0PA 1A5UA 4I8DA 3NPUA 4V33A 2W0UA 4Q4MA 4AUBA 4GYPC 4C6LA 3G3DA 7REQB 2QDDA 3ARQA 1GZ1A 4YWSA 4XIAA 3VD4A 4LRTA 3BTNA 1FH7A 1TV8A 2RDTA 3EYPA 4BQ3A 1XC4A 5LGZA 4JCLA 4JIRA 3HG4A 4DZ5A 3CPRA 3UF9A 1AW1A 1QPKA 4ZQCA 2D2HA 3QEZA 4ZXOA 6XIAA 4PB4A 4Z1YA 3OVRA 4ZFMA 3KOZA 1FQ0A 3QOMA 4PODA 5BZAA 2J79A 4E2DA 1E5JA 4X3ZA 1OB0A 4GACA 2PDIA 2BBFA 2W92A 1PZ1A 1M53A 4MNLA 5FESA 1S1RA 2FPVA 3GAYA 1U1UA 5DBUA 3MUZ1 1ISYA 1TELA 3UY7A 4L9YA 2PLKA 3TONA 3W7QA 4TVCA 1PIIA 1ZPTA 3DECA 4A29A 1BFNA 2ZOXA 3FAXA 3GDRA 4GJIA 3KOXA 1KBIA 2VXNA 3CZJA 3TX9A 1QI3A 2CHNA 2AAAA 4LT9A 1H3GA 1T41A 1OCNA 2ACSA 2VWSA 4LW7A 3ZIZA 4C6KA 4YWIA 4EF8A 3ZWTA 2GGGA 2DJLA 1V51A 1HF6A 2FZ8A 3B4UA 1NWRA 3OJGA 2Z1VA 3NDYA 4NNBA 3TC6A 5LIXX 3TYBA 3L4WA 3WLRA 1YRRA 5HXMA 5A8QA 3TW9A 3NPXA 1H49A 4ICCX 4AZBA 4QE5A 2ZRYA 4DWSA 4GQBA 2TPSA 1GORA 2Z1XA 1ZRQA 3QZAA 3SB0A 3S47A 4ZTXA 4HSHA 1YKWA 1PAMA 4NXKA 2O4QA 3G1YA 3S5OA 3COTA 4QJ4B 4JCMA 5KETA 2OG9A 4QITA 1W1VA 1TCMA 3ABRA 1J6OA 1W3TA 3LQLA 2P76A 3FLUA 3V5CA 1PIFA 3QV8A 1O60A 3FXYA 2HXUA 4MLRA 4GINA 4HJWA 2JKEA 2O9TA 1XYCA 1TMHA 3EMCA 4WF7A 4E3VA 4XAFA 5I3GA 3G77A 4DYJA 4Q8WA 4IIEA 1X98A 3V5FA 3TYAA 1MUWA 4QJ3B 9XIMA 3HA1A 3H7VA 2IKGA 1DE5A 1LP6A 3H70A 3ECQA 2ACQA 3DGRA 1FA2A 2DY3A 3WZ0E 5A3HA 2WMFA 4JX4A 4NRRA 1P6WA 3RLVA 4FXFA 1KXTA 1OIMA 3WJZA 1WYIA 5XIAA 2JK2A 1HJXA 4I6KA 4E2OA 4WR3A 3W02A 2PTDA 1GKRA 3E2RA 1WZKA 4YL2A 3W2JA 1OGSA 4XAPA 3CT7A 3E1F1 4H8UA 2G41A 3EZ4A 4OFCA 4GNVA 4DPQA 4I9TA 4A8LA 1EF2A 2PI6A 5HR6A 2DU2A 3QHNA 1F6YA 3NYDA 1MZHA 2G50A 3WQOA 3CWOX 3HGJA 2J7GA 1ZZMA 1XCXA 2VELA 4LTSA 1MXGA 3MHUA 2PWGA 2J7EA 4CVWA 4NY2A 3QW3A 4F2BA 5I2UA 1V3LA 4B2DA 3W23A 3FSUA 1WDPA 3PWGA 3Q37A 1BD0A 5HATA 1BYAA 2VQTA 4ZEPA 1AQHA 3WQFA 2B4GA 4RJEA 3ATZA 4MNKA 4JTDA 3VOGA 3C2FA 3TA6A 4LV4A 3L0GA 4K2SA 2EG7A 3SUWA 4PUUA 3W75A 1Q6OA 4PMOA 5G4WA 2CKSA 2VFEA 4EPEC 2WMGA 3B8IA 3TA9A 1T7LA 3BLDA 1W6TA 3W2MA 4XSMA 2D3LA 5DMYA 1KR1A 4KIRA 4JEQA 5E9AA 2G5WA 4K1WA 4C91A 1BTCA 3N12A 3NG3A 3B8UA 3DIPA 3TJ4A 1AH0A 1X1ZA 4ZO7A 4E38A 1Z89A 2CITA 2ZWZA 1L8PA 1VBHA 2AAMA 4N9EA 4WIWA 2X1RA 3PJUA 3UCQA 1PXGA 1WBHA 5IHRA 3CWHA 4MWAB 5I5RA 2YCEA 3I3BA 4JN6A 4BF5A 2PTWA 1MO0A 1M65A 4Z17A 4PTWA 4AIBA 1J0JA 3R4IA 1T5AA 4HA4A 1XKJA 3HGOA 2QCGA 3T55A 4JTKA 4WJXA 4AWSA 3F5LA 3GKFA 2OQYA 1R85A 3BV4A 1R2RA 3EDDA 4J28A 1D8WA 3R1ZA 1ITCA 3SIZA 1DIOA 1NDVA 2HXTA 5C2CA 2J6XA 3MMDA 4N6FA 2ZBTA 2PA6A 4DLFA 1V3JA 4KWUA 3SEPA 3DYPA 2B7OA 3UPMA 1X39A 2GJXA 3TMLA 1XGEA 2FB2A 1FWEC 1EF3A 1XFBA 1ZHAA 2Y88A 1N2VA 4YTRA 4ZE5A 1JCYA 2EBNA 4C6IA 2GPTA 3UXKA 4NKCA 1YTKA 1E1CB 3DN5A 4DM1A 1OYCA 3TTEA 4FNRA 1XHGA 1NDZA 3QRHA 3B97A 1R9ZA 2PC8A 4A6GA 1CX9A 4KS0A 1Q65A 3LGGA 2E8YA 4GJJA 5B7ZA 2QF7A 3CS2A 4GY7A 1F5ZA 1GVIA 1XFCA 2ZXBA 3SRDA 3VUPA 1MQPA 3WMSA 4F0RA 5AHLA 4TVUA 1J18A 2TAAA 2JF7A 4AWTA 2B81A 1GYNA 3UCDA 3VU2A 5FJJA 3P3BA 4UFKA 2UZ9A 1UP0A 3QMSA 5HK4A 4N4QA 3RU8X 1XP3A 2WK2A 1X8FA 3AXHA 3GZ3A 2PRMA 4PZVA 2PBOA 1GONA 3LRMA 4FOJA 3VKKA 2J9XA 1Q6EA 1HUVA 2XINA 3FNDA 3SCTA 2Z1KA 4U4MA 1A4MA 1XV8A 3W37A 1XG3A 4NNCA 4PYSA 3VINA 4D72A 1UQZA 4XV0A 2Y85A 4TUFA 4KH2A 4WKFA 3KXQA 4KWVA 1VRXA 1MRAA 3V1HA 3GDKA 3WUEA 4NZ5A 3GNRA 1CGWA 4BF9A 2TODA 1W1YA 3PUGA 1I0BA 3RLUA 1L2UA 3PZVA 5AY7A 3FW6A 2QLYA 2HVMA 3WEZA 3CO4A 3W3OA 5I0DA 5KTLA 3GDMA 1FFQA 4R27A 3SY8A 2X2GA 1W3KA 2RHGA 1QNQA 4MUZA 3IIPA 2ESCA 4AIOA 1AVAA 5D9NA 4GC3A 3HPSA 4AWEA 3P80A 3AXMA 2OLSA 2VUNA 3KBMA 3BPWA 3URBA 2F6UA 5AHFA 2XSXA 1UW9A 4H9TA 3VDBA 3RITA 2FFCA 3W7HA 1ELSA 1K70A 4FB7A 3VOJA 1OGBA 3NQFA 3DFPA 3GTXA 4GI9A 5HOSA 4K38A 2CERA 2NQZA 4PGLA 4GI6A 1RCXB 3O63A 5I00A 1IWAA 4LWWA 4KESA 2E5DA 4O18A 2ZCGA 2ZWYA 5FF7A 3MDUA 3PTKA 2YL6A 3BDKA 4GIAA 3HFYA 2ZZ7A 2R1NA 3TN5A 2ZFAA 2CLPA 1GJPA 1TV3A 4TTGA 3LEPA 3NQAA 3W29A 4ORMA 2PDYA 3UR8A 3IRDA 1PBGA 4FSAA 1FWIC 4HU3A 3NQMA 1R9YA 1V0LA 3VMPA 1KGWA 4W9TA 2HNEA 1F74A 1OSEA 4LYPA 4W5UA 3UWUA 3ES7A 3LM3A 2CBVA 3FYPA 3WYZA 5GPRA 2P1FA 4JKLA 3R89A 3GFZA 3CB3A 3FIGA 4O16A 1Z8AA 3WQDA 4S3BA 1OC5A 1E55A 3M9YA 3BICA 1E6XM 5M1TA 4JN7A 3MV01 4D2JA 4LS1A 5EMMA 4MY1A 3J7HA 4A8IA 3OEXA 3W7RA 5A6BA 2UBPC 3AXIA 1LQAA 3V35A 1K02A 4B5XA 1PZ2A 1ZENA 3GD6A 4IQDA 4QEEA 4MG4A 4KETA 1QATA 4GUJA 5XINA 1REQA 3NEVA 3PPGA 3FDGA 5G2WA 3B3DA 3P5ZA 4ZQRA 4XBKA 3SCSA 3EX3A 5TAOA 1ZCOA 5I3JA 2E4TA 3S6TA 1RH9A 1Y7VA 2R1MA 2DSKA 4ACZA 2WJEA 4EXQA 1XXXA 1PTGA 5MHBA 2CW6A 1GHRA 3BANA 2FPTA 3PTDA 1ZJHA 1XYMA 1R7AA 1RLCL 1UASA 4IG2A 1TV2A 3MO7A 3B04A 4UBPC 3I4KA 2XIJA 2Q6ZA 1UR1A 3CZKA 3WLSA 1XYAA 3TUUA 4B5UA 4G5DA 1V7AA 4TXEA 2ZUMA 4JKKA 2F2KA 2YYTA 3OTRA 3TJXA 5IRPA 2H3DA 4N9CA 1PWLA 1TRIA 5I24A 4Z0SA 1Y65A 1AA1B 1M04A 3B8VA 4YVXA 3HBLA 3I7SA 1TVLA 2PGEA 1EZWA 2BHYA 1HGWA 3WENA 2DQXA 3R5EA 1J4EA 3JR2A 5C2XA 3CXOA 2VC9A 4JTUA 3R10A 3W1XA 3LLXA 3NQ2A 4NYYA 3M6YA 3L9CA 5FF4A 1JCXA 4Q22A 3SGUA 3N11A 1QHOA 4EXBA 4J27A 5CC5A 5HNRA 1OHLA 2WMKA 1FWDC 3OGRA 4JOMA 3W72A 3L4YA 1QTWA 2POZA 4GFSA 4WY0B 1D3GA 1GVFA 3F2CA 3UR5A 2DH2A 2G3NA 4PMVA 4XTDA 2FHCA 4YXGA 3QBUA 3VCCA 3IIZA 4REQA 3VDHA 4ZO6A 4LBSA 3WLPA 5DY2A 3APGA 3AALA 3MP3A 1HKKA 4F2UA 1ME9A 3S42A 1R9XA 3LBCA 1LM1A 4JXCA 2GVLA 1LJYA 1S38A 3UGVA 2OKTA 1WZLA 3W7OA 4QAIA 1XCWA 3QMTA 4BEQA 2I5GA 1CGUA 2D0GA 3RCMA 2WNNA 4O4VA 1MNSA 1DP0A 3EDEA 1ZCCA 2Q8LA 2GQ3A 2XIQA 1DJZA 3ZT5A 1CENA 3K1GA 4U33A 1N7KA 1B9ZA 1EPXA 2Y2WA 3IJQA 5FEXA 2D0HA 5JIPA 4N2YA 3UXAA 3V7PA 1JDEA 4D6DA 2Z0IA 4LS2A 3HF3A 4D1JA 2ZUWA 4CN1A 1TWIA 4O54A 1SFSA 1GNXA 3EB2A 4ORIA 1PS9A 2X09A 1KRMA 5HQMA 1LOQA 3CZLA 2F9RA 2JIWA 3ZJ7A 4JTCA 4QX4A 1S5NA 1E1FA 3NQGA 4NAFB 3T4WA 5BXSA 3GBDA 4C1NB 5IM51 1CXLA 3T8QA 1M68A 1H63A 2WZMA 4QLLA 3T0TA 1FKXA 1ME8A 4MY9A 5F2IA 4HSOA 3PNZA 4CVUA 1VPXA 2XM1A 3N73A 4F9DA 2QW5A 3LCHA 4O4WA 3TYEA 4XAYA 4FPSA 2X1UA 1GKPA 3RIKA 3SJ3A 3MYPA 1M7JA 2C0HA 3MTWA 2WZIA 5DT7A 2OEMA 3I6EA 4E2VA 3R0DA 3GVVA 4FNPA 3OLGA 1E9YB 4H7ZA 3SUSA 1QAPA 4DAIA 2OQHA 4IP7A 2OMAA 3WQWA 5EFFA 4Y9AA 2Y0FA 3CV7A 2Y24A 2QPUA 6CGTA 2X1SA 4HK6A 5D9PA 1VFOA 1TR9A 5DEZA 2ZUTA 2CYGA 4KRUA 3FJLA 4JS3A 3L2MA 3GU9A 1EH9A 1WUFA 4QG9A 3T78A 1HZYA 4DBWA 3T6CA 2PGFA 1VFMA 3MWAA 1FHLA 2QMJA 3VM5A 1JCJA 4V15A 1FKWA 2EHHA 3GB6A 2PRHA 4PMNA 9RUBA 1PKYA 5C8BB 1EP1A 3GY1A 3C4UA 3KLLA 1OY0A 3U0HA 1OD0A 2JEQA 2ZA3A 5FJOA 4NU7A 4UB9A 1JQXA 4CCCA 1JAEA 2QDGA 3TIMA 1V0MA 2RDUA 1F9CA 1XD1A 4ZOBA 2XU2A 1TA3B 3O9NA 3H2FA 1SMDA 4NX0A 4IFRA 4OOZA 4LOCA 4QROA 3NA8A 4K1GA 4G6CA 3BMVA 3S5YA 5HJXA 2OX4A 1UH2A 3ZR6A 3TXVA 3W85A 3WLTA 1XIJA 5CBJA 2DH3A 1X1NA 3DBNA 4E5TA 1XC6A 2PPGA 1NARA 4ADSA 3NL2A 4NAEB 1FUYA 1UR4A 3ORWA 3VZZA 2XH2A 3OB8A 4RE4A 1NFPA 3TDFA 3W00A 5JU6A 3T1GA 2OJPA 1XH2A 4QJ1A 1EC9A 5H2ZA 4AMCA 3TE9A 3S1UA 1V08A 1IXOA 1R0MA 5DCBA 3W7JA 3OU8A 2B0MA 3HPXA 1X1OA 1AL8A 1RVKA 2DZAA 3EPOA 1IEWA 3GTFA 4FXJA 1PIGA 3PZ9A 1AL7A 1EHNA 2ADAA 4O1AA 3CL8A 4O12A 2NVDA 4LUJA 3UVIA 3W7MA 3SRHA 3RUBL 1THFD 1UYQA 4KEZA 4ZCWA 1WDSA 1WDDA 4L56A 3R8GA 2J88A 1G5AA 4DXVA 3S0CA 4G8TA 1Q6RA 4E4PA 1PPIA 4FP1A 3AFBA 1L6YA 4JYEA 2EG8A 3DYOA 3ZVHB 3C3NA 3NVDA 2PRLA 3CHEA 5HMFA 3W2LA 4ROPA 4LBUA 5CGTA 1F3WA 3QZEA 1KC7A 5DFAA 3PP7A 4UTLA 3B40A 2PCQA 3GIPA 2BVYA 1KM4A 5LNUA 1ML1A 2G3MA 2VX7A 3VE7A 1UMLA 4LAOA 1KM5A 2XWEA 2J7DA 1KR0A 1HO4A 4WKHA 4L9ZA 1POJA 2IXUA 3SFKA 4LYQA 1CGVA 3R43A 1RSCA 4IHCA 3ZSTA 4MTVA 4K68A 5KZDA 3BCDA 4H9XA 1TG7A 3GLCA 3SCOA 2BGQA 3NQVA 4Q8UA 4HIBA 3H6OA 2QCFA 3NSNA 4Q7NA 3QMRA 2XVPA 1Q4WA 2YW3A 2PDMA 3G1XA 3EXTA 5E0KA 3VKDA 3TFCA 2QIIA 2A4AA 2YXOA 5KINA 3W38A 3W76A 3SRFA 4ZQOA 1OCBA 5IBXC 2CLMA 4KCUA 4F79A 2VJXA 1DJNA 3BQ6A 4EWJA 4XBSA 4I8YA 4KRZA 4JTTA 3KDOA 5AOUA 3DOPA 7XIMA 4FX7A 4M0XA 1BVZA 3LHUA 4CQAA 3V0UA 3SJNA 3HPAA 5CGQA 3BGJA 5A8MA 1YNQA 4RE3A 3HGSA 4LVFA 5TIMA 5DF0A 3DFQA 3H2AA 4Q3MA 1QFEA 4XX6A 3EWWA 3IGSA 1DWHM 4MWAA 2VHLA 2VYOA 1R3YA 1RUSA 4Q4QA 3AJXA 4RDWA 3LTPA 5HJLA 4JY9A 1CLXA 5C6MA 3DU0A 2Z6IA 1DL3A 2X8RA 3A12A 3ZS4A 4Z2KA 3BXWA 3APYA 1NOWA 1X96A 2ZX5A 1PO9A 4FNTA 3UZJA 2C71A 2H8XA 2J9YA 3N34A 1DOSA 3GXFA 4POCA 1XUZA 2D2GA 4MNMA 1V4YA 3ZZ1A 2XSAA 4QG6A 3C3UA 5KZEA 5BXRA 1EP2A 2XZ9A 3BW2A 3L5LA 4HTBA 3INPA 2XIIA 2BXVA 4RNIA 2C16A 2NQ9A 3A64A 1R2TA 2INEA 3N3MA 4S3CA 3AIBA 4GZJA 2WSKA 3VVGA 5LHFA 1FX6A 2PWHA 1QDSA 1YTDA 1ZY9A 3LENA 1QNOA 2WM1A 1WQ5A 1KFKA 3KZPA 2V82A 1KCLA 2V8ZA 3NL6A 4GI8A 3BMWA 4YHGA 3DXIA 3F5JA 3PY2A 2W4XA 3QH2A 3CYJA 4Q7IA 3M5VA 4PMJA 3Q45A 4O15A 3VNLA 3G0XA 3GU2A 4V2XA 4WSHA 3QHOA 4DEFA 3OIXA 1XLBA 2YCIX 4I9AA 5T26A 2HPIA 2OQLA 4IMGA 1DJIA 1ZALA 2V5LA 1CXHA 5CZTA 4AWUA 3BGGA 4M7TA 4D71A 1ZL1A 3CGTA 1H1YA 3NZGA 1TE1A 3ITOA 1GPFA 2Y4SA 3QPYA 2GVEA 4Q8OA 3KBVA 3LCXA 2DP3A 2GJRA 4JR5A 4WZHA 1WDQA 1WZAA 5LNWA 5K2ZA 3G6MA 4M5PA 8A3HA 3PZQA 2ZYFA 3THQA 5ABFA 3CQHA 4LH8A 1ZJAA 4LGXA 5KZMA 3FN9A 2FKPA 3BVJA 5EU9A 4P2VA 4ERIA 2XVNA 4K37A 4XTIA 3PN8A 1EXPA 4L64A 3V4BA 1G6CA 4HZ6A 4G56A 1DQWA 2QNEA 2XHYA 1MDRA 5IHSA 3UG5A 3GFXA 4IFOA 2W6RA 1J6PA 4DF2A 2JQXA 3P2VA 5CPLA 1G9HA 1XKYA 2Y7EA 1BWKA 2Z7KA 4O19A 2P53A 4PSRA 4JNMA 4GK8A 3ITGA 3JS3A 3V1PA 2REQB 1JPMA 4W7VA 2FZNA 1K7XA 3CWNA 5EMKA 3W9ZA 4XD6A 1QOQA 4DJDA 1SM9A 2TMDA 4MDPA 1Z32X 2J9ZA 4D1IA 2NXIA 1XRFA 2A85A 2OEJA 3REQA 2H6RA 1KTBA 2Q8ZA 3IAQA 2TRSA 3DX5A 3CBWA 3GG1A 4INFA 3B9OA 1JPKA 3NZQA 3ARSA 2DT2A 3JUGA 1UPPA 5FEPA 1AMKA 4A21A 4UQ9A 1BRLA 1HVXA 3A4AA 2WO5A 1OFBA 1SJAA 3PULA 3CAQA 3WQPA 1NFGA 1FXQA 3LI0A 4WKAA 3F1QA 3A4WA 3EOUA 4ECLA 1UJQA 4O13A 1TPUA 3M64A 1DE6A 1V93A 3POCA 2PTXA 3R13A 1E4MM 4J3WA 2VX5A 3U4FA 4V1YA 1G7UA 1VQTA 2YDAA 1WDWA 3LRLA 3NXLA 4JTGA 1SO4A 1GEQA 1FWWA 4M7SA 4J3SA 3RX3A 3NVTA 2Z6JA 2BODX 4AX7A 1K6WA 2I16A 4H9MA 2XN2A 1HP4A 3PC0A 1I2NA 1WZMA 4GZ7A 1VH7A 3W84A 3SSJA 4FOKA 2EAWA 1IXPA 3FGCA 2HSAA 3L4UA 4MB4A 1H61A 3ZWSA 1UKOA 3C61A 4C90A 3TTYA 3PAJA 1JD9A 1KWGA 2X42A 3OP2A 6XIMA 3G1SA 5D32A 2AGTA 3PPCA 2Z1WA 4NUWA 1QI5A 2RJGA 1BG9A 4NZ1A 4QR6A 3DFOA 3D46A 1BWVA 4RPPA 1KM2A 4N4PA 2PURA 3PUDA 4AXKA 4EVZA 4HHHA 3F2DA 3MCMA 2PAJA 2CLIA 3R7MA 2ZDSA 2Z2UA 1TJ0A 2YOCA 1RP8A 2QULA 2YJQA 3BLPX 4LCQA 3AHZA 4LAUA 1QXLA 4OBTA 1G67A 4UTTC 3DERA 3APTA 1MXSA 2YIHA 4KWWA 2Q3RA 1QUMA 3LLDA 4S2CA 1SSDA 4FLOA 5EKYA 4PFHA 3C2OA 4G7FA 4UFJA 5LHEA 4Q8QA 3W26A 1UP2A 3AWOA 5FJPA 2YCLB 4PMUA 4RXFA 4HD5A 3C0QA 3TN4A 4OGZA 1DIKA 3A13A 4HHMA 3AROA 3KM8A 2ZC1A 1G4EA 4LS0A 1JFXA 1L0PA 1Q6GA 3OODA 1CGXA 3FKRA 1H2JA 4U2YA 1BQGA 1W2PA 2WWDA 4E8DA 4GKLA 3QY6A 1J0HA 1XQLA 3U4AA 3UG3A 1UH4A 3KUMA 3L68A 3V16A 2HS6A 2Y61A 3IACA 4AHOA 2PDHA 2QCDB 1UROA 2QGYA 3W1RA 3HM7A 3WN6A 4WDTA 5IFTA 2DFAA 4NZJA 4XUGA 3GTNA 1V5XA 3TW6A 1HG3A 4CD6A 3H23A 1SW0A 4NI3A 2GDQA 1I2OA 3RX4A 2Z26A 2PLMA 5CKSA 1K8CA 2WYSA 5J04A 5CPMA 1W1ZA 1BF6A 1ZP3A 4MWAE 4V27A 4GHRA 1VLWA 2QCNA 2E25A 1E43A 1IV8A 3TSBA 3O6AA 1B57A 1EQPA 2YX0A 1G0CA 2H8ZA 3A9BA 3L4XA 2BNJA 1N82A 3E02A 1P0BA 3VIPA 3EWZA 3MB9A 2R1LA 1LZOA 1WKFA 4OOUA 1YTEA 4TQTA 3UU0A 2PLJA 1Q8JA 1QI4A 3W1AA 3KTSA 1AZ2A 3EWCA 1DHKA 4J2MA 5HULA 5A1AA 1VF8A 1QBAA 4F0KA 2VC7A 1NM9A 3WDJA 2GUBA 3L2LA 5IDIA 2VI0A 3AHTA 4MHBA 2DZVA 3V0SA 1I60A 5JH2A 2AOSA 1ZJBA 4G7EB 1Q8AA 1DWFM 2DZSA 2PP3A 2V6AA 1OYBA 3VKCA 4IISA 3T4CA 1XISA 4GVGA 3GSMA 1L6GA 5FL0A 4HZ8A 4NL1A 2JKPA 3D5HA 4GUIA 4UR8A 1F2JA 1TZZA 4NJGA 3W7DA 1MUCA 4DB7A 5I3DA 3MWCA 4H7CA 1HL2A 3UWWA 3AMLA 1VLIA 2B31A 1I2PA 3P93A 3UG8A 4P61A 4DJEC 2G4JA 4OUIA 4NAFA 3W7CA 3ABZA 3MU7A 3PVFA 2DZTA 1UD8A 4DRSA 4TU1A 4HPHA 2IMRA 4XBJA 5EPDA 2PGRA 3SUTA 4DIAA 4XZWA 2E3ZA 4FI4A 2A3BA 1SVDA 3LLFA 3TOYA 3H53A 3UW6A 2ZXQA 4C6BA 1BWLA 4JTJA 1H60A 5E70A 4MKNA 1C90A 1AQ0A 4GRSA 2BOEX 1ZAIA 1SPQA 3O05A 5LA1A 3AS2A 3TC7A 4MB1A 4P8WA 3GO2A 2DZPA 3G1AA 4TO8A 1KCXA 2HE5A 2WVSA 4PE8A 3OHMB 3PBYA 2BVDA 1NOUA 1EO5A 2FDMA 2H3BA 2F2HA 1SMAA 4UQEA 4DUOA 2QDEA 1XIFA 1XGZA 3A4XA 4H04A 4FF7A 3XINA 1GHSA 3MZNA 3KBNA 4HN4A 2PD9A 4GYJA 1TZ7A 2BLEA 3DC0A 4UWMA 3W7IA 5C7VA 1K03A 5A6AA 4L4MA 2XGZA 2JE8A 4KBXA 4W93A 3P8JA 3BOFA 3KCLA 4JL1A 1P5BA 1GVRA 1F73A 2P3EA 4CNOA 1KNWA 1KKRA 3WMCA 3MKVA 4DWSB 1C8XA 1CWYA 3VFLA 3VO0A 2X7VA 4I5RA 4YU1A 1JZ8A 2A3AA 4EANA 3P6LA 2GZXA 2IS7A 5G5IA 4Z2JA 2QKFA 3WH7A 1Q45A 1W2VA 3WLQA 3TLQA 1X6NA 1QOXA 2A79A 5CG0A 4PC8A 4PUKA 1FWFC 3QV9A 1GZGA 2WMIB 4XD5A 3DAQA 1OADA 4JPGA 1P1MA 4BY3A 5TBOA 1B3OA 4NYUA 3L21A 1AJ2A 2KAUC 1Q6LA 4PUJA 2DJXA 1UUQA 4AD0A 1KXHA 3AQUA 4KGJA 2D24A 3H4XA 1JNDA 1TX2A 1TA3A 3G0UA 4R88A 3QM3A 3B0XA 4KGLA 3EWDA 5T8GA 4C6EA 1XF0A 2A7RA 4DJED 2E6FA 1YDNA 5E5CA 2YSWA 2BG5A 4BI7A 1IT8A 1JULA 1VRDA 3E0IA 3N3TA 3CZEA 3WUFA 2OVLA 3VXGA 5G1TA 3ERPA 3MP4A 1E6NA 2UY5A 1JZ5A 4WQ6A 3GDBA 1TPVA 3W27A 1W91A 2PDUA 1VPQA 4HHLA 2YA0A 3NGJA 1X97A 2ASHA 4O8AA 3UWQA 1K9EA 2B7NA 3GDLA 3L66A 1S2CA 1Z9AA 5DMNA 1KQYA 4RE0A 3I10A 3WLLA 1BKSA 3EA3A 3MMTA 1VENA 5A6LA 1SFTA 3LZ3A 5EMYA 1E5NA 1EA0A 1XGDA 3WH8A 4HMNA 4LCRA 1VCFA 4Z1DA 4J4KA 5I3KA 2ZTJA 1HGYA 3OLEA 1SYTA 1TPB1 1JF6A 2INFA 5JIWA 1HXJA 1ADOA 2FVLA 1EA9C 1EYWA 5G2IA 3W7KA 1I6NA 4PMZA 1V6UA 3T2OA 4B3LA 4NAEA 2DPEA 2ZX7A 4O1BA 3GQYA 4Y8EA 3VKJA 1EOMA 4L65A 1E51A 2C1IA 1TPEA 4N9DA 3K2GA 1UIOA 3UGRA 3A3XA 1G1YA 3VX0A 4TMBA 3W7EA 1OX5A 1CB2A 3G24A 4J7RA 5EMUA 3MS8A 2O9OA 2BS9A 4AY7A 5AC8A 4PN2A 2C8NA 3GR8A 3AS3A 4I9MA 4QSHA 3VOFA 3M4HA 4W4QA 5C54A 1Q85A 1SGJA 2BWGA 3QLDA 3L0KA 4IGSA 1FP8A 2O9PA 4CU8A 1AW2A 1XD0A 4X2RA 1NFBA 4PMDA 3ZM8A 3S9IA 2DVUA 3QR3A 3PZIA 3T81A 1QNRA 1RP9A 2F84A 5FJTA 3IRSA 5JQ9A 3RX2A 1E1CA 5AYXA 4AC1X 2WLYA 1KM6A 3MMWA 5H8MA 2ZRZA 5I6SA 3RCYA 3OW1A 1CBGA 1UB3A 4K7YA 1UHVA 4AIUA 3NWRA 4A8RA 2FH8A 4ZQNA 2TSYA 5AC6A 2DT1A 1LG1A 1CT5A 3TYZA 3WQCA 2C15A 4HT3A 1ZBKA 4IM4A 2F7FA 3R2GA 4GQ0A 2CZ5A 4WGHA 3PBGA 3ZR5A 2XDFA 2ON3A 1HFBA 1J9YA 2AL1A 4MAZA 1AW5A 3PG8A 4RKAA 3WUGA 3EX2A 2G3FA 3VGEA 4X61A 1C7SA 4GXMA 4C5YA 4LUSB 3SURA 3MI6A 1IF2A 3WUBA 2D3NA 4UOQA 3A5VA 3KWXA 2HNHA 3PS7A 1MUMA 2G95A 2NLYA 2ATSA 1TJRA 5HMDA 1Y5XA 2V2CA 3TMQA 1XH1A 1TV4A 2EPMX 3HJZA 1W9BM 3L4TA 1HN1A 4AY1A 1PVNA 3OQ8A 2DIEA 4MJMA 1IWBA 1CZ1A 3LM7A 3IJ7A 1OZMA 3DCPA 3NXFA 1UZ1A 2VEMA 3OVPA 1ENUA 1S3HA 1FCVA 4AAJA 5BU6A 1ZU8A 3MCOA 4IIFA 3OG2A 4HPGA 4X22A 2VL4A 2OZ0A 1TVPA 1RJRA 1O7AA 5HMSA 3UYIA 4QS6A 3M7WA 3OVQA 4PSPA 1GOOA 1H51A 4JICA 3SQMA 5CSYA 1VB9A 2VDGA 4EX4A 1BGAA 1P43A 1H0IA 2FZDA 2ZX8A 4ADUA 4Q8PA 1J0IA 2J66A 1QI2A 4XZLX 3C8NA 3CAWA 1LLWA 1UC4A 3P60A 8XIAA 3N19B 3VMNA 4BCEA 2WCSA 3W7PA 2Y7GA 1B3VA 1R87A 3SUUA 3W0KA 2QVHA 4B3KA 4IPLA 2DZUA 5K9DA 4JEJA 4TTUA 4K36A 2OCZA 4FEZA 5DXXA 2YFOA 1I45A 5ABHA 3M07A 1QWKA 2NQLA 4X0VA 2Y8UA 1RD6A 4WSKA 4AZ5A 1K3UA 4JGDA 4W7UA 1UBPC 4XKYA 1ICPA 3I7QA 4MJ4A 2CEQA 4UQBA 4ZOAA 4M6VA 4NQ1A 1P0DA 2P10A 3NQEA 5M5DA 4QQ3A 1TREA 1W3NA 1XDMA 2YCJA 4AXNA 1YE4A 2QT3A 3EEZA 3WMBA 1XS2A 4MM1A 5ABFB 2V81A 4PMYA 4UFHA 2ZADA 3AUOA 2CXEA 4WD0A 4IIGA 2YYUA 1PJ9A 4ZMGA 1BLIA 3LHYA 3VDAA 3EX6A 2ZQ0A 1KWKA 4P5UA 2Y6ZA 2A2IA 4BFAA 3WD0A 2W5FA 4P8XA 4B5VA 4Q6XA 4JDBA 2PDFA 5K3VA 1EYEA 2XZ7A 1WKEA 4LRSA 4H19A 4Z0JA 1Z44A 1BG4A 3ARWA 1H1NA 3CASA 3VCNA 3MVIA 2H9AB 4L6OA 1R3VA 4RDVA 1RXOB 2CC0A 3H24A 1W3HA 3U7BA 4YMZA 2FTPA 2PODA 1KCKA 1LRQA 1KW1A 3K13A 3T44A 5C71A 4H6EA 1O1HA 2BY1A 3E0WA 1PX4A 3UA4A 2P5NA 3GH7A 4AEEA 4Q33A 2NWSA 4H00A 1ITUA 1XJBA 3RN6A 3H22A 3DUGA 1G4SA 2IPFA 5ECVA 3NQ8A 4XAGA 2QR6A 4K6AA 3W2UA 3QKEA 1US0A 5FF0A 5M17A 4J3TA 3KRZA 4QCEA 3C5QA 4OVXA 2PFHA 5AYZA 2YZ5A 3N2MA 3B06A 3MP5A 2E6YA 4CNPA 2V5CA 4OJYA 3EWBX 3EKGA 4L6HA 1Q2SA 3GWQA 4F9JA 4DJFC 3GXPA 1Z7AA 4JQ1A 3WFAA 4ZA0A 2XPKA 1IEXA 1VJSA 3AIEA 4PCSA 6TIMA 1O1ZA 4FLQA 4BQ5A 4CU7A 4DUXA 3CLMA 4W7WA 5FEWA 4F0MA 3CQKA 1K7EA 3KRBA 1VIZA 4RK8A 4P7OA 4RR4A 3MA8A 1TV7A 1OFDA 3IJ9A 4WX2A 3E74A 3LCIA 4EK7A 2HPMA 1TV5A 3RXZA 4FNSA 4XZMX 1W5QA 3W6MA 3VOHA 3THUA 4CN4A 1H50A 1J79A 3MC5A 3KS6A 3AU6A 3FY1A 3NEHA 2I57A 5HNTA 3OZPA 1B54A 5A6TC 1FWJC 4QDWA 4NZCA 1RBAA 2QZRA 3W1LA 3SGGA 3W2KA 2VVSA 1TPWA 4IMDA 3NQ7A 2V5DA 5L9FA 4HCHA 4HNLA 2PDXA 1VHNA 3M6DA 4GH3A 4Q8MA 1EJWC 3FVDA 4AHPA 3D3AA 4MFEA 1KGUA 1J2BA 1NF7A 3EEGA 1Q7ZA 3POHA 4OTKA 2GJLA 3N4AA 3F4NA 3PFMA 1LUCB 3STFA 4BJHA 2GDUA 3OHIA 2BASA 3WLIA 1VFLA 1HT6A 1EUNA 5XIMA 4NASA 1OZQA 3VZXA 1PDYA 2PF0A 2BZNA 1LL4A 3KOFA 4QRNA 4QNWA 1F3XA 3WF4A 3D3FA 1LWIA 1CXIA 4O50A 5HQEA 3NUKA 1MW0A 3S2NA 2PWVA 4MDOA 1LBFA 2J78A 2C14A 4XZBA 2OGYA 1V6XA 4BR1A 3EBVA 4I5XA 3CL6A 4H83A 1TJ1A 1HL9A 3N4EA 4RW5A 1JZ3A 1SZRA 4DF1A 5TNVA 2JBMA 3RO8A 5CCZA 3O6YX 4C6PA 2FDSA 4WVXA 3TKFA 5A6KA 2PWEA 3LK6A 1CXEA 2GGEA 2ISSA 2QIWA 3AUJA 3BAIA 1FCUA 2VCBA 7PTDA 1OFRA 3CZ8A 4EAMA 1O4UA 3FFSA 3UQNA 1DXEA 1GCYA 1QK2A 1U5JA 4UUIA 2GVJA 3BOLA 2X1IA 4CUCA 2QQ6A 3CNYA 2WJFA 4RXGA 3DFTA 3QYSA 4G9PA 5BYWA 2QAPA 3KAOA 1YE6A 3W28A 4KRTA 1DJGA 3DFYA 1DQUA 1S5VA 1TVNA 3QGVA 4B3ZA 4L80A 2XFYA 1XSKA 3MANA 1TCDA 3MVTA 2FQIA 1M03A 1Q6CA 5FF3A 1JZ6A 5CLWA 3W53A 3LRKA 1QOPA 1GOQA 3OZMA 1RQEA 2VZTA 5HQLA 4HNCA 1UOKA 1VCVA 3LGDA 4PUWA 3M5XA 1VFUA 2Z1SA 4X63A 1XL9A 2YBTA 3O6CA 5EYWA 3PSWA 3UEQA 2GSJA 5DT5A 4IP4A 2CWXA 4LCSA 4CD4A 3OBAA 3CZGA 4FLSA 4QDMA 1KO0A 4IMAA 4WK9A 4D8LA 1UR0A 4ENLA 3W7NA 1GKQA 3DHDA 4QLKA 3KZSA 4IJRA 4XO7A 4C6OA 4PMXA 1V0NA 1R2SA 4F4RA 1OQFA 5BRPA 3UYCA 1HJWA 3UWEA 1PL9A 1W37A 3RPDA 4IPIA 1LL7A 3QV6A 3VD7A 1HJUA 4JTEA 3PTQA 3TXZA 5JBDA 5D2VA 3PUOA 1NY1A 3NZPA 2VT0A 3PBUA 2CZVA 2E9MA 4LEQA 4D6EA 4AZGA 1QR7A 2J62A 2GYIA 4IQLA 3WY1A 4W88A 3SDOA 3CK5A 3F5KA 4M3PA 4CNNA 4KEVA 3FVMA 5EFDA 2P0OA 4ZL1A 3VC6A 3BO9A 1HO1A 2C91A 1W1B1 5FSEC 4Y9NA 3DYMA 4IGHA 1V8EA 2V2HA 4FNQA 1P6CA 5A94A 2PWUA 2PU0A 3VGFA 4PBGA 4D6HA 2Z24A 3LPPA 2VDIA 3I68A 2VP8A 4IUGA 4IPJA 5I7GA 4V28A 8RUCA 3IUIA 1GPWA 4Z1BA 4ZB2A 2FGZA 1S2AA 1IR2A 1ZJIA 1GK8A 3FJ4A 3GR7A 4QCFA 2YW4A 4Y9MA 3NM1A 1RJQA 3P74A 1P0KA 2ZRXA 5H8PA 3WG6A 2CBIA 4HSNA 4YVPA 4DWSC 3W1PA 1B3ZA 2ODOA 4S39A 3C0SA 3BCFA 2UY2A 2W66A 3H55A 3MJMA 5F4WA 4L9XA 2XVGA 1TR1A 3Q4DA 3H2CA 4LANA 3P82A 3S2CA 1OF6A 1R3TA 4JDYA 2ANUA 3WFLA 1RV8A 4KKXA 1MFUA 3Q2DA 5FJRA 1G01A 4W84A 1B1YA 1WE5A 3WKZA 3H54A 4HNTA 3CAKA 3SCQA 4JIIX 4W8AA 3U2ZA 4UCGA 5ECUA 5D2TA 3PSVA 3TSMA 1A0CA 3IJ6A 2NV1A 4FXRA 5CJNA 1AQFA 1OWQA 1TSIA 1GJUA 1OCQA 2D2OA 1U1JA 3FOKA 5AC4A 3KBJA 1YX1A 4XZIA 3FCPA 5FKYA 3RR4A 2FHFA 4ML9A 4MYXA 3CUIA 2O7QA 2DEPA 3PB2A 1H7NA 3VYLA 1XIEA 4X9SA 3GVWA 1FDJA 1V3MA 3ZYZA 2OSWA 5GQBA 4CU6A 1UBSA 4Q8NA 4HYVA 5D30A 2HQAA 3DEQA 4QE4A 2J8FA 1CI1A 2Y8VA 3ZVHA 4C6NA 1SFJA 4PEEA 4GC4A 4XKMA 3GIYA 3BZJA 4JNYA 3QY8A 3U2EA 5FI8A 5AHEA 4Z2HA 2PDPA 4O1FA 4ES4A 4US5A 1TJPA 2JGQA 2R6OA 4ACYA 1YADA 3H12A 2F8QA 3STEA 4YS1A 2NV9A 1JYNA 3R0UA 3H2MA 4KCWA 3RRAA 4JZ5A 4M24A 4QBXA 3WLMA 1MMFA 4WLCA 4BZYA 3DDMA 2EPKX 2NX1A 1CTNA 4KIEA 2PP0A 3NR0A 2ZRUA 3UZWA 1XLHA 4Q7BA 1QHZA 4HN8A 3QQWA 2QS8A 4A2SA 2YL9A 1EX1A 1Z6KA 4LX4A 5LIWX 2NW0A 3VGHA 2OSYA 3IIXA 1IEVA 1YYAA 4IPNB 3VCRA 2J27A 4JFTA 2NSXA 1YLVA 4U3AA 3PNUA 3I4EA 3BG5A 4RZ6A 3WQVA 3PPFA 1H7WA 2JFEX 2LLEA 1F3TA 2D1ZA 3ENLA 4GE8A 4OWGA 3N2OA 5IFPA 2CLKA 2UY4A 1HQTA 4AZ7A 3B9DA 2ZUVA 3B05A 2ONEA 2HJPA 2OU4A 1UIPA 1NSJA 1GOWA 1Q66A 1W1IE 4RLIA 4UTIA 4JX5A 2PDKA 2NUWA 5HUOA 1MQQA 3M43A 1E6QM 1O95A 4JBRA 2VFDA 4S1FA 1HVQA 3CJPA 3ITTA 1IHIA 3KOWA 2R82A 2BGNE 1M1BA 3FEMA 1OVDA 2W27A 3ABXA 4GISA 4U31A 1WP6A 5I77A 3QGAC 2QVNA 4CNSA 4B4HA 4JFUA 4ML4A 2E9LA 5CBIA 4EKJA 3L4VA 1EJXC 2QJMA 1QPOA 1KBLA 5G1MA 1ME7A 4CQBA 5PTDA 1XRVA 4U3CA 3QFWA 2OOFA 5C0QA 4GABA 3NPVA 4B92A 1KBKA 1L6SA 2FZ9A 1TWZA 3VGDA 3JVAA 2X0SA 5LYRA 2NT1A 2ZZ5A 3DZ1A 1KXQA 3LZ5A 5T9CE 3LN3A 2WPGA 2EEXA 3HG3A 4PL2A 3N2CA