3PVFA

Structure of c126s mutant of plasmodium falciparum triosephosphate isomerase complexed with pga
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVSFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Probing the role of the fully conserved Cys126 in triosephosphate isomerase by site-specific mutagenesis--distal effects on dimer stability.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 97
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pvfA00
3W9ZA 1N7KA 1G4SA 4K8HA 3M41A 4NVTA 3BVJA 5TBOA 1Z41A 3AJXA 5AN7A 3L21A 2CLFA 2ZZ2A 4JN6A 3W1AA 4NUWA 3UWVA 5K9DA 2VEMA 4RV8A 3G1YA 3S5YA 2G5WA 3QW4B 1CW2A 2X1TA 4ZQNA 4LW7A 5G4WA 4AAJA 1H51A 2PRLA 4AF0A 3GR8A 1BWLA 4N9EA 4PA8A 1GTEA 3BLIA 4UTWA 2Y88A 1G67A 2J9XA 2NV2A 3W7MA 2OCZA 1GPWA 4GNJA 4MKNA 1RQEA 3LCWA 1HG3A 2YYUA 2NXHA 2VFDA 2C1HA 1OFPA 1SQ7A 4K7VA 1T96A 3FKKA 3GDRA 3GX9A 3P82A 1TMHA 1YADA 3P8IA 4LTSA 2A7RA 2Y61A 3TU9A 5CPNA 1RPXA 4JTHA 1F76A 1TSIA 2RH9A 4IPJA 5D04C 1K3UA 4CNOA 1C8VA 3EWZA 4TU1A 5F1UA 3W23A 4UMBA 4JTKA 4TX9A 3S5NA 1FWWA 1AL8A 4JICA 4Q32A 3LRKA 1B4EA 1Z42A 2FB3A 2VENA 2E5BA 3HPXA 4POCA 3P5YA 1TRDA 4WZHA 3STCA 1KTCA 4UUIA 1ICPA 5K4ZA 4Z08A 4JYFA 3UYCA 2I9EA 2R14A 4RK8A 3E02A 4GFSA 4Y6GA 1H60A 1HUVA 3GB6A 1AL7A 1ZAHA 3FOKA 2FPVA 4UTHA 3B04A 3K30A 3L5AA 1P4CA 4LUIA 3W2NA 2CZEA 3KRUA 4WY0A 1XXXA 2E6AA 4OU1A 5I3FA 2QDGA 3G24A 1H61A 4G1KA 3B0PA 3W7LA 4CQ8A 1W3TA 1RV8A 3BG9A 2Y70A 1EB3A 3IGUA 3CT7A 4CNPA 1FWSA 1FDJA 2QUUA 2NWRA 5CZJA 1XBVA 3F1QA 3GDKA 4DO6A 3C2EA 3JS3A 1KLZA 4MOZA 1RVGA 3M9YA 3SFKA 4P2VA 1OK6A 1J4EA 3P62A 1TPDA 1HL2A 2BWGA 4ADUA 4O16A 4BWLC 1TTPA 4E38A 3TQKA 3M5XA 3FIGA 3BLEA 3LHUA 4CCCA 4RXFA 3EKLA 3CB8A 1SZGA 3C4UA 4MZ1A 3WJSA 4CNNA 4EF9A 1SO4A 1OFBA 2QJHA 4O10A 3DFSA 4D2JA 1GVFA 5A8GA 4ZMGA 3CEPA 4JX5A 1Y0EA 1AG1O 3NM3A 3O6CA 3I7QA 1H1ZA 4K8EA 1BTMA 3MW7A 1NF7A 5LHEA 2A6LA 5F4SA 3DU0A 2QUVA 3A9IA 2YDAA 2BX7A 2V5LA 1F7BA 5AYYA 1G7UA 4ICNA 1HO4A 4UNLA 2GVJA 1TTJA 4M7SA 2QCCA 4MLRA 4O1CA 5G4EA 3W7KA 5HUPA 3KHJA 3P60A 3W2JA 1I8JA 1B3OA 3LCHA 3N2XA 3TCEA 3ZR4A 1O60A 1VLIA 3C52A 1JCLA 2WSYA 4AVFA 3W1LA 5HJLA 3BW2A 5AOUA 3EEGA 4H6KA 4O4VA 1XFBA 3MHFA 1SW3A 4DF2A 3LI1A 4PEKA 1QNVA 3S0CA 3G1XA 1B4KA 5KZDA 1TPFA 3P84A 5AHNA 3W88A 3NL5A 3R5EA 1G6CA 1TTQA 1F73A 5MHBA 3LCLA 3W7EA 4N6EA 5EKYA 3PG9A 2CW6A 4W9TA 2PRMA 4NJJA 5IBXA 1ME9A 4LV4A 4HNUA 2RDTA 3QW3A 4UFMA 3E12A 5U4NA 4AB4A 2R8WA 1TRIA 2NUYA 5F4XA 3STGA 1KFCA 1DQXA 3T7VA 1F6KA 5E0KA 1OFQA 5EL1A 2WSRA 1YXCA 1PHQA 3DFQA 1TIMA 4KWVA 2YW3A 2FB2A 5C55A 3PUEA 1K8XA 2Y89A 4M6PA 2F7FA 2ZTKA 4E2BA 3NVTA 1OX6A 1LZOA 1YTEA 3CM4A 3QQ1A 3SR7A 3DGRA 2B7PA 4JS3A 3TH6A 1NVMA 2OX1A 4IQLA 3NL3A 4GRSA 4A2SA 4LS0A 4IGHA 3JR2A 4LOCA 2WPBA 2E6FA 3PSWA 2ZA3A 5KMYA 1QOQA 1FX6A 3E49A 1PIIA 4Q33A 2H3DA 1R2RA 2GQ8A 4UTKA 3UY8A 3O05A 1LORA 4M6QA 2QKFA 8TIMA 4QISA 2RDWA 1O4UA 4OE7A 4BFAA 4OQVA 4UTJA 2WV8A 3OG3A 3TAOA 4O4WA 3TROA 3W1QA 2OZ0A 3KRSA 4IPIA 3D0CA 1L6YA 4NZJA 3HGJA 3Q2DA 1U5JA 3TK7A 1GEQA 3LDVA 3N9SA 3UNDA 3GYEA 2TMDA 1KFKA 3TXVA 2RHGA 2V2CA 1AK5A 3NNTA 3BGJA 2V8ZA 4A21A 5KZMA 4E2DA 2TRSA 4CQAA 2JKPA 4HNNA 2ZRYA 5LGXA 2ALDA 1FCQA 3W7GA 1L6WA 3GNNA 2Q8LA 3RNDA 1R2SA 1XDLA 2FPYA 1OFRA 4O50A 3W2UA 3W1UA 1TPVA 3W70A 3W7RA 4JIPA 4MLJA 3KVLA 1M7OA 2NX1A 3I68A 4LV9A 4U4MA 3NQFA 1LROA 3TMQA 3NAVA 3LXCA 3P80A 1GG1A 3O63A 3PY2A 1K8ZA 3IVUA 2C6QA 3NPXA 3N2MA 4LU0A 5D02A 1FY6A 5CZ0A 3LCFA 4WX2A 1OG0A 3B4UA 3KAOA 2G96A 5DBUA 2AAMA 1FUYA 2HTMA 1OX5A 1EUAA 1BKSA 4JYDA 3W2LA 3TIMA 5BNKA 3GDMA 3G8EA 3WJWA 4O14A 1JCYA 1VR6A 2JBMA 3RLVA 3MI2A 2BZNA 2V2DA 2H8XA 3L0KA 5F1VA 3DKLA 3YPIA 3ZWTA 1ICSA 4FNTA 4LVBA 2NUXA 4X22A 4XQ6A 4RZ4A 3FYOA 4FIRA 2A0NA 3DAQA 4O17A 1NF0A 3OEXA 5TIMA 5H91A 4Z1CA 3TJXA 3SZ8A 2ATSA 5KITA 3GXNA 3W83A 5D03A 2E6DA 2DZVA 2B4GA 3W84A 5BMWA 3L65A 4XWUA 1EA0A 4FNUA 4MY8A 1P0KA 4MVAA 2C3ZA 3LCXA 1WDWA 4UR7A 4OV4A 4UFJA 3IVTA 3NR0A 2HMCA 3PR2A 4K7YA 1GZGA 2DZSA 2QCGA 3F03K 3S42A 1OYBA 5D2VA 2X1UA 1SU5A 1EPXA 3THQA 1OYAA 4YLWA 4OWGA 3F4WA 1KW1A 4K37A 3NXFA 1QPRA 3EWXA 3QQ0A 4CCDA 3LTPA 1W1ZA 3UD6A 1LP6A 5F2LA 3NQAA 4ZQOA 3UZJA 1GYNA 5K2ZA 3M7WA 1L9WA 3HG2A 2VEPA 1NFBA 3TX9A 1K7FA 4GE8A 2RKXA 4DF0A 3CWOX 3ATYA 1DV7A 1QPQA 2G97A 1YDNA 4N9DA 3NQ6A 3W1PA 4NXKA 5AFDA 1P0NA 2JK2A 1SFLA 3PWAA 1UCWA 1ZENA 2ZDRA 3W1TA 1OABA 4AMAA 3IIOA 2A6NA 4EVZA 3G1DA 2C14A 2YPIA 3GKFA 4UTLA 1KTBA 1QMLA 1UUOA 5K4XA 4DELA 3A23A 3F4NA 3LV6A 3LCGA 1AMKA 2XN2A 1VCFA 3QSRA 2I1OA 3QPZA 1H62A 2I14A 3BG3A 4N6FA 1ZFJA 4AHOA 4X3ZA 3W7OA 4XZ9A 4AWUA 1PCKA 3QFEA 3LLFA 1LBFA 1LM1A 4Y9AA 1GQNA 1W5QA 3OVRA 5CGQA 2C16A 3DHFA 2JKEA 3ABQA 3IV3A 1OFAA 1A5AA 1JR1A 3HB9A 1QPOA 2WOQA 4YCOA 3CU2A 3M6YA 1KA9F 4YWIA 3CQ0A 4EIVA 1LYXA 1GVSA 3W76A 3HBLA 4CLMA 2EGZA 4UMCA 1FDYA 1O95A 1UASA 3BV4A 2PCQA 3R2GA 3FS2A 2YFNA 3BW4A 1XCFA 4FNRA 4FO4A 1LOLA 1ICQA 1TJPA 3STEA 2IQTA 2DORA 3PB2A 3EX2A 3S1VA 3TDFA 1ME7A 1OF6A 2ISWA 1LCOA 3R13A 5G2WA 1W3NA 4BWLA 5L6UA 1TJRA 1JCNA 3QH2A 3UWYA 3C8FA 4MY1A 1TO3A 5DBTA 1ZALA 4LC6A 1I4NA 4Y8FA 3DBPA 1VYPX 4JTLA 4M6VA 4IMFA 2CLHA 3ABRA 4GUGA 1H7WA 3W85A 1ADOA 2EF9A 3UQNA 2ZZ3A 1FCVA 2XN1A 2CLMA 4ZQCA 1W5NA 4B5NA 2YZRA 3LERA 3LXBA 3H54A 3TUUA 3LOTA 2DZXA 2QUTA 3UPBA 1VHNA 5LNUA 3NQ7A 2H3BA 5TQLA 2NXGA 5CPLA 1MXSA 4UFIA 3IIVA 1I2QA 1KM0A 3RU6A 3WK3A 4IMCA 4KWWA 2VEKA 2BSLA 4WUIA 3O1NA 1LRQA 1XM3A 3TXZA 2CU0A 3C3NA 5HQEA 1M7PA 4JTUA 2P1FA 2VFHA 3PM6A 3DENA 3EX3A 3RFAA 2NWSA 4U28A 3PG8A 1QO2A 3NGJA 3A5FA 4PFMA 4UTTC 1BWKA 1GG0A 2DP3A 3MI3A 3FKRA 4FIQA 2J6XA 3PAJA 5LNSA 2E09A 4MYXA 3PUDA 4WOQA 2O7SA 3TR2A 5LSMA 4FHAA 4LT9A 3HG4A 4JDBA 4PODA 3NQGA 3NQMA 1KFBA 5I3KA 3MJYA 3W7CA 3P7YA 1K8YA 4ZZ9A 3EWYA 3L0GA 3O8AA 4RZ6A 4AWTA 1TPWA 3CEUA 5J5DA 2GJNA 2ZTJA 3G1AA 1E51A 1XDMA 1UJPA 4DF1A 3N3MA 3EXTA 1SW0A 1TPB1 3W1XA 3IEBA 4LUJA 4IXXA 1TCDA 1TV7A 4XBKA 2RFGA 3GKAA 4GUJA 1F05A 3TV8A 4A29A 3AO0A 1TTIA 2QCFA 4TMCA 1W37A 1LDCA 1R30A 2DZTA 3B06A 1I2PA 1I2OA 1IGSA 2X1RA 2QCHA 5DELA 3SSJA 3NQEA 2V81A 2QCEA 1JQXA 3SGUA 2Z6JA 4NNBA 3RMJA 5C54A 3EX4A 4O1DA 2H6RA 1FWRA 5D2YA 4O53A 4NJHA 2QCNA 4EF8A 3M47A 3ATZA 4XKYB 1RD5A 4MFDA 2ZCGA 3G1HA 5AHLA 4X2RA 4QIUA 5C6MA 3L5LA 5AHMA 4BF9A 3U6WA 1YDOA 2BTMA 3W1RA 2GVLA 4JTSA 4LC8A 3TE9A 1VCVA 3GNDA 1PVNA 2TPSA 3NO5A 1J2WA 5G2IA 1FBAA 1DVJA 3C6CA 5FEWA 4MZ8A 4HNTA 3KOFA 1Z44A 2DZPA 5LNWA 2VFEA 1SW7A 3W6YA 1WAUA 5LNVA 4NXSA 1M6JA 1DJNA 3PUOA 1FDZA 4CQ9A 1WOAA 4AHPA 1XBXA 4ORIA 1XBYA 4DO5A 1PCWA 1LBLA 1K7EA 5CPOA 2CLLA 1JVNA 1AW2A 2OMAA 1A5BA 4RR4A 1S3HA 2QJGA 5FEXA 2VFFA 4ALDA 1DBTA 2YXGA 1NAL1 3W73A 3KRZA 4UFLA 3CTLA 2NV1A 2FTPA 3UZ5A 3N34A 2ZRXA 1YPIA 3M5YA 1H5YA 3UY7A 1W3IA 1IIGA 4DBDA 2A7PA 5D38A 4R33A 2V30A 5HMSA 2PE4A 1JJKA 1B9BA 4UMAA 1S5TA 1HTIA 3HGOA 3THAA 1TQJA 4IX0A 4NT0A 1DORA 4O11A 2NZLA 3CLMA 2X2GA 3NZ1A 1QWGA 1JRCA 2Q3RA 1O94A 5HULA 3IIZA 1MO0A 1OF8A 4A22A 2EHHA 2B7QA 3Q58A 5FEPA 1VQTA 1F5ZA 1R2TA 1JUKA 1HO1A 4JDYA 4NJIA 1PV8A 2YR1A 2JKAA 2WNZA 3PBWA 4NU7A 2ZFAA 1VLWA 5FF4A 2ZYFA 1TV8A 3T55A 5AC6A 3V1PA 2JGQA 3SJ3A 2JGYA 3TKFA 5F2MA 4QITA 2A85A 3TW7A 5HWNA 1W5PA 2A21A 5AYXA 3O06A 4ZVJA 3NL6A 3PC0A 4ADSA 5HWJA 4MYAA 1XC4A 2YGYA 3DHDA 4M7TA 1M5WA 3INPA 4AHQA 3BO9A 4FNSA 3LV5A 4NX0A 1MEWA 4UFKA 4PTNA 3MUXA 4WJEA 3TJLA 2UV8G 1O5XA 1TYGA 4YL2A 2V5BA 3QZEA 1H50A 1FXQA 1W54A 2QDHA 4KFNA 2W6RA 1FWTA 5D30A 3LGEA 3C2VA 1G4EA 6ALDA 4N4PA 3NQCA 5AC8A 1MSSA 3QJAA 3IIPA 3SGZA 4FF7A 4HPJA 1TV5A 5EBUA 1KBJA 3P5ZA 1A5SA 2ZQ0A 3G22A 2HS6A 2Y62A 4GUFA 3PSVA 1GYLA 3ZFHA 5C2XA 1EUNA 4JTTA 3NZRA 3LTYA 1VGAA 3L5MA 3C2FA 1U83A 2Y7GA 4LVFA 1J5TA 2DU2A 4IOTA 3QMTA 1GVQA 1GWJA 4Z1DA 2YYTA 1GTHA 1T99A 3S1UA 5KSWA 2WJZA 5D05A 1A5CA 1LOQA 4FB7A 1THFD 4QQ3A 2G95A 5U7SA 1PHWA 4PL2A 2C13A 5DY2A 2VC6A 1H7XA 4JY8A 3I7SA 3SW6A 1UUMA 3QPYA 4Z1AA 3PBYA 1WA3A 1WBHA 5EYWA 3C2OA 2HSAA 3QSTA 5FF7A 3DFPA 3ABOA 5HWMA 3TFCA 3DI1A 1RQHA 3OIXA 3PB0A 1D9EA 1YYAA 2CLEA 4XTDA 1KTNA 2Z0IA 4HHPA 3W07A 2C0AA 1N8FA 2GOUA 4LS1A 1EEPA 4GWEA 1DOSA 2J27A 5CPMA 2XN0A 3R89A 1Q3NA 1SUXA 3MMTA 4O12A 3HPZA 3TQ0A 3ABSA 3LTSA 5HUOA 4OHQA 2A7NA 4O54A 3VKJA 4BI7A 3LM7A 2ABAA 3GLCA 4I7VA 2RDUA 1JUEA 4UC5A 4TMBA 3RLUA 3VE9A 4K38A 1XUUA 4H4IA 4ONVA 3G0XA 3HGSA 2W0UA 5HNRA 3A22A 4N4QA 3S5ZA 3M16A 4N9BA 4RKAA 4UR8A 3MP4A 4JYEA 5SWUA 1Q45A 5D32A 1KM1A 3UWQA 4O52A 5DLCA 4PCFA 4FXRA 3W75A 2ZRUA 1XKYA 3WFAA 4XUGA 3G8RA 1W0MA 3H53A 3VNDA 3NOEA 1FCBA 5CZSA 3TW6A 2DJXA 3FJ6A 2YW4A 3O6DA 1TREA 3W74A 1K7XA 3T40A 1SFJA 5F2IA 3IGSA 3N73A 4YMZA 4A3UA 3HIJA 4LWWA 4O28A 2ZA1A 3R12A 2V9DA 4YCPA 1VHCA 3FA5A 1SO6A 1GJPA 2B7NA 3JRKA 2P0OA 5AB3A 3G1VA 4PH6A 3DXIA 2VFGA 1SSDA 3FLUA 3LBCA 1YDVA 3MYPA 4FNQA 4K6AA 4TO8A 1Q6OA 3LHTA 3EX6A 1D3HA 2QCMA 3TC6A 1K03A 1WX0A 4AEOA 4JD4A 1S5WA 4OV9A 4XTIA 2V82A 5E93A 2FFCA 1G4TA 3OVQA 3HGRA 3LXAA 1G69A 3G3DA 2ZZ7A 1KBIA 4FX7A 4UTMA 3MHUA 4I7WA 1QCWA 2ZA2A 4Q4KA 4NJGA 4RJEA 3PVFA 1SO3A 2VEIA 1SZEA 1V5XA 1ONRA 3C61A 3HQ1A 4UTTA 5FI8A 1RQBA 4RX0A 4UFHA 2J9YA 3C56A 3W2KA 3NQ2A 1EP1A 1FXPA 1OFEA 1JUBA 3QYQA 1KM4A 3B05A 5LZLA 3H55A 4XKYA 4UXDA 1QOPA 1YTKA 3HPSA 2GJLA 3NM1A 2E68A 3VI2A 2DZWA 1FWNA 3A5VA 1VRDA 2QCLA 4OBTA 2F84A 3O07A 2ZZ6A 3UWWA 4HSNA 2OT0A 5FF3A 1H7OA 1XBZA 1KM3A 2ATMA 3G0SA 3KVJA 4WQ6A 2QAPA 4JY9A 4Z1BA 1RR2A 2EPHA 4EOUA 2GVGA 2V2HA 4H3DA 4X9SA 4JIQA 2P10A 4MJMA 5K9XA 3PF3A 1UBSA 1VZWA 1LOSA 3NPVA 3MYOA 3KVKA 5I3HA 1I45A 3OHIA 3GVGA 3B8DA 4GXMA 4FX6M 3E0IA 3UWZA 4MJZA 1F6PA 5BOOA 3S9YA 3O6YX 4WOZA 4QSHA 3QMSA 1HFBA 3S1WA 2FDSA 2NX9A 1PL9A 1SSGA 2CWNA 1AW1A 3GZ3A 3UXAA 2FPTA 3BARA 1X1ZA 1VS1A 1DL3A 2BLEA 4E0CA 3TFXA 1OFDA 3A21A 4TR9A 2XFWA 1GVRA 3M5ZA 1OK4A 3E9AA 7TIMA 4HSOA 1ME8A 5BRBA 2R94A 1H7RA 3L66A 4A2RA 1DJQA 5EMUA 3R8RA 3BGGA 3ZWSA 3NL2A 1EP2A 1R46A 3WK0A 4K39A 2ZZ4A 1FCUA 3W7JA 3MP5A 2Q3OA 3EXRA 1LBMA 1ZHAA 4LNYA 3HF3A 2PURA 1VCGA 3DH7A 4NX5A 3W7NA 2ISSA 3CWNA 3W1NA 5I3GA 2CLKA 2GUUA 3TSBA 3G0UA 3I7RA 4NNCA 1IXNA 2OT1A 4HKPA 4O0ZA 4LVDA 5AHIA 1X1OA 1OJXA 5DY3A 3IVSA 4LY8A 3BW3A 2TSYA 1GT8A 2A4AA 2QCDB 4IMDA 4JR5A 4OT7A 1VPXA 3MI6A 4ML9A 4IUOA 3W7DA 3CC1A 4DO4A 1JULA 2ISVA 1MZHA 5E1QA 4TIMA 3GR7A 1TQXA 4O0KA 5K3VA 2H90A 3LHZA 2WNQA 2ZZ1A 3M0ZA 1WOBA 1QFEA 4MPQA 4ADTA 4JX6A 3P61A 2WSQA 4HNVA 4BR1A 1KM5A 2C15A 4KKXA 3M43A 2Z6IA 1L2UA 1YPFA 3G3MA 2BXVA 1IF2A 2WQPA 3P81A 3OBKA 4HPXA 1S5VA 2GQAA 1KFEA 3C2RA 3EXSA 3DFTA 3MBFA 1ZAIA 2HS8A 2WNNA 5HR6A 2YCEA 3L67A 3BLFA 4IMGA 4UNKA 3FYPA 4JNMA 2Z2UA 1ZNNA 3P74A 5DXYA 4OGZA 1WYIA 1OX4B 5EPDA 1G7VA 1VYSX 1JQVA 3L0NA 5CG7A 3NPWA 3P8JA 4PL1A 4GC4A 2Y7DA 3WJZA 1VC4A 5CZTA 4AH7A 1Q6LA 3O16A 4LVGA 1SO5A 5A5WA 2YFOA 4KFPA 1T0OA 4C1KA 2Y7EA 5AHEA 3TMLA 4IX2A 4GBUA 3IRDA 3GXTA 4P61A 4UTWC 1DKWA 5DXXA 3PULA 4PC8A 3KFTA 4DQWA 3KX6A 4MUZA 2TYSA 1I2RA 3TAKA 4R7JA 2H8ZA 1G4PA 1P5BA 2Y85A 4IWWA 2J9ZA 1YXDA 1X8FA 4MZYA 3IIXA 3LRLA 1GOXA 3HJZA 1SR9A 2FJKA 2O7QA 1UB3A 4O15A 3GK0A 3L2IA 2ZBTA 4HIBA 4YXGA 3LLDA 1KFJA 2NXIA 1ALDA 1F2JA 1PS9A 1P1XA 1ZAJA 3UPWA 5EA9A 3BK0A 2DZUA 4N2YA 4S2CA 3RK8A 3LBMA 2EAWA 3V75A 4AXKA 2AQWA 4Z0SA 1XL9A 1WV2A 1KLYA 3GIYA 1YLVA 2PRHA 4S2BA 4QNEA 2E77A 3GDTA 3HG5A 4RXGA 4K36A 1RZMA 4AF0B 5J5RA 3NG3A 1VJIA 4JGDA 5CSSA 2E5CA 4O18A 3WJYA 2WKJA 3TNOA 4DBEA 3VE7A 2Q8ZA 4MY9A 1TB3A 1W8SA 5LGZA 3N19B 4FXSA 1QPNA 3W7IA 4NNAA 4JTFA 4ZQMA 1W31A 1A53A 5KTLA 2VFIA 3L9CA 1W56A 4IJBA 3W7HA 1XUZA 2J24A 2ZZ5A 3CIWA 4Y90A 4DEFA 3USBA 2CLIA 5C5YA 2DJLA 4Z0JA 3DFNA 2VXNA 5FESA 5D2XA 1W5OA 4WXZA 3VFLA 3NQDA 5F2GA 3W2MA 1NEYA 2ZRVA 2QF7A 1QDSA 3NQ8A 5DCDA 1Q6RA 4ZQRA 1R47A 2B0MA 4J9JA 5FF2A 2Y6ZA 4QNWA 3GXPA 3N9RA 3W3OA 2A5HA 1LRTA 3G18A 4RCXA 4RZ5A 3GAYA 5I3IA 1OFOA 4N9CA 3HOJA 5I3JA 4I7UA 5K9CA 1WXJA 4QJ1A 3NPUA 5BW6A 1Q6QA 4JX4A 2GPTA 1ZY9A 5GVJA 3CIXA 4NZFA 4CCEA 5HINA 1F74A 3I6RA 2VKZG 1LTDA 1O5KA 3IGXA 4FNPA 4WXYA 1D3GA 5AYZA 1H7PA 1EWDA 4WY0B 3QMRA 3HO8A 3ELFA 3FEMA 5G1YA 1LLWA 2ZRZA 4UIOA 1KV5A 3A24A 2QJIA 3ANYA 4LRTA 2FIQA 5LNRA 4IXHA 4ORMA 5CSRA 1YTDA 3EWBX 4DXVA 4EWND 5KZEA 2D73A 2CZDA 4GUHA 1A50A 2PC4A 1W5MA 1ML1A 1IXPA 1SZFA 3B0VC 1JCXA 1BEUA 3CPRA 1IXOA 3S1XA 2GQ9A 4ZL1A 2X1SA 3NDOA 4GUIA 3B0UX 3W87A 1QO5A 4IMEA 2Z1BA 2W79A 1H1YA 3QC3A 4JTEA 3DZ1A 1DQWA 1KV8A 3EB2A 1Z48A 3NA8A 5FF0A 4UCGA 1NSJA 2CFFA 2QR6A 1B57A 3DKJA 3LHWA 5IBXC 5K7JA 1JCMP 2R91A 3W71A 1X6UA 4QM1A 1WQ5A 2YX0A 4N02A 1KM6A 1QR7A 2A2IA 3MHGA 3SIZA 3CHVA 1JCJA 1QAPA 2WO5A 2Y7FA 5G2HA 1C9DA 2CLOA 3OA3A 5D33A 1H7NA 4DPQA 3WK2A 4UTIA 3TSMA 3W22A 2YSWA 4MIMA 3TA6A 1XI3A 1X7FA 1EWEA 4JXCA 3MP3A 5KINA 1ZJIA 3LHYA 3TC7A 1TPC1 3FJLA 2CZ5A 3I65A 3E96A 3BPWA 3NQVA 3LX9A 1JRBA 1OVDA 5BMXA 4BI6A 3GDLA 1KFLA 5D37A 5ABTA 2ZRWA 1LRNA 3UXDA 1OHLA 4L4MA 3VCRA 2FLIA 3PBVA 4O1AA 3BG5A 3C0JA 3M5VA 1EIXA 1FQ0A 3W7QA 3HG3A 4FX8A 4L4LA 2KZHA 5DN1A 4RLIA 2C18A 3QF0A 4WY0F 2ABBA 5H2ZA 3OVPA 2X30A 3B03A 5CKSA 4DPPA 1GVOA 4LVAA 3LI0A 4GJ1A 4JTJA 5T26A 2A1YA 4FEZA 4M19A 5HR7A 3G1SA 3U2OA 3EX1A 3P67A 5F4WA 1CI1A 4I9AA 3LRMA 1EX5A 5D2TA 5L9FA 3PS7A 2EKCA 2LLEA 3W7PA 5DCBA 3S5OA 3FFSA 3G1FA 3EWUA 3Q37A 3W1MA 3WK1A 3WJXA 1IIHA 2CZFA 1TPEA 1YXYA 5DCEA 3W72A 1C29A 3MBDA 5LHFA 1CX9A 2QCDA 4O57A 2NLIA 2C19A 3RF9A 2V0TA 2E6YA 3QEZA 4MFEA 3T4CA 3EKZA 5FEZA 4JEQA 1T8XA 5EY5A 3QM3A 5D09A 1EP3A 3ZS4A 4ZQPA 3Q94A 4JTGA 3M44A 5AC7A 2QAFA 2VELA 4LS2A 2Y63A 4O19A 3S6DA 4WD0A 5IM51 1ZCOA 4NJKA 6TIMA 5G1TA 4NQ1A 3PBUA 2FQIA 3T44A 4O1BA 3HMJG 4HT3A 4M5PA 1N55A 2VOMA 3SY5A 4JTIA 2AGKA 3EWWA 3NYZA 3KVMA 1LLZA 2B7OA 5AHFA 4S1FA 4O8RA 2E5DA 2X16A 3LHVA 4R34A 3LB0A 1OX4A 4Y96A 1SZNA 1DHPA 3GAKA 1L6SA 2QEZA 3SECA 1H63A 3N14A 3NEVA 4HN4A 4LRSA 4UTUA 3QRHA 1TPH1 3MWAA 3STFA 3TQVA 3DFOA 1I2NA 3O15A 3TSDA 2NUWA 3M1ZA 1AW5A 4O13A 3U8GA 4XBSA 4BI5A 4BK9A 2J88A 2NX3A 3S8HA 3KXQA 1MEIA 4R53A 3T78A 1PE1A 3MO7A 1TPUA 1V7YA 4KFOA 1K02A 1MEHA 1KM2A 1VH7A 5D2WA 5LKYA 1SPQA 2OJPA 3SI9A 1VYRA 4QAIA 4C1LA 3LCIA 1IXQA 4AWSA 2E1DA 1WBJA 3W86A 3DI0A 3UWUA 5G5IA 3L68A 1OYCA
chains in the Genus database with same CATH superfamily
1G4SA 2E40A 3WNNA 3RM8A 4BQ5A 1KGUA 2XIMA 1KRBC 2CLFA 2ZZ2A 2WK2A 4L9XA 3S47A 3WENA 5K9DA 1R3WA 3H7UA 4HSHA 1XIFA 4AD3A 1ITUA 5G4WA 3ALGA 4XZNX 1GQKA 3W0KA 3GR8A 1BWLA 4N9EA 1P6CA 3RLHA 3BLIA 5JXQA 4EKJA 4WSHA 2J9XA 3MPGA 2BXYA 4GXWA 4C91A 4EE9A 1XIJA 1T96A 3FKKA 2GJRA 3GDRA 3SN4A 5DT7A 3E0FA 3P82A 2PODA 4A8LA 4Q7BA 4GJJA 2A7RA 3TU9A 5CPNA 2D1ZA 1W3JA 1SYTA 5JBDA 2ACRA 3DC8A 4DO7A 4CNOA 4IPJA 3CLWA 4TU1A 3CZGA 3W23A 4TX9A 1FWWA 3KOYA 4C6QA 1JYXA 1B4EA 1Z42A 3C2YA 2GFTA 1TVLA 3STCA 2CEQA 4UUIA 4DJFC 4H04A 2XVKA 2CC0A 4CD8A 3E02A 4GFSA 4XO7A 3CO8A 3WCZA 4P5UA 2O9TA 1ADSA 4UTHA 3B04A 4LUIA 1XP3A 4WY0A 3CGTA 4OU1A 4JHMA 1KD0A 4W7WA 4CQ8A 1A4MA 2HNHA 4JL2A 4BHYA 2PZ0A 3H2AA 3GM8A 2EG7A 1EB3A 4V1YA 3OYXA 3ARUA 5CZJA 3B97A 3A47A 4DO6A 3C2EA 3JS3A 4BCEA 3WMLA 3SFKA 3TC3A 4QX4A 4GX9A 5DANA 4BWLC 5ABEA 2A3LA 4E38A 1UHVA 1BRLB 2GGIA 1TWDA 4CNTA 4KRTA 3BLEA 3LHUA 4H7VA 2E25A 1SZGA 1CXEA 1R6WA 3HQNA 1OFBA 4KS0A 1MW0A 1W2VA 1G01A 1WUFA 1GVFA 3U2EA 4M29A 1Y0EA 1M53A 1A3XA 3W6MA 5GJNA 3O6CA 1YDYA 1VFSA 2GDUA 1H1ZA 3M0HA 5LHEA 1BVWA 3A9IA 5KZ6A 2V5LA 3AU6A 5AYYA 1LL6A 1G7UA 3SCVA 2QCCA 4O1CA 5T8GA 2DY3A 5HUPA 3KHJA 4XZMX 1HQTA 1EPVA 4NRRA 3BDKA 3N2XA 3ZLGA 4S3DA 4KCUA 2GGJA 3UJFA 3C52A 2VO5A 2OYKA 4J3WA 1DWFM 1GHRA 5AOUA 3EEGA 4N0RA 4O4VA 1KBKA 1SW3A 4PEKA 3G1XA 4HHHA 4HK6A 1TIWA 3KOXA 1P0BA 3R5EA 2R9RA 1ZZMA 3N6QA 4N6EA 3ABXA 3MKVA 3A4WA 8RUCA 2WMIB 5E9AA 1ZS2A 4BQ2A 3F4CA 4NAFA 3E12A 5U4NA 3V3WA 1XKJA 5F4XA 3STGA 1KFCA 3KCLA 1DQXA 1IGWA 3FGCA 2WM1A 3CUHA 1DIOA 3EYPA 5IHRA 3MUIA 4KWVA 2E4TA 4WRHA 3M7SA 2WKGA 4TV6A 2R24A 1PDYA 3FSTA 2PU0A 3QV6A 1IZJA 1PIGA 2Z2AA 3AIVA 1HJUA 4E2BA 3OZYA 4GHRA 4H00A 4S3KA 1RHCA 3WLRA 4DNHA 2DSWA 5I6SA 2OX1A 4XZHA 3NL3A 4GRSA 1EX1A 1RA0A 3H2OA 4IGHA 3PSWA 1E6PA 5KMYA 2WZMA 3E49A 2WCGA 4CEXC 2QXWA 3EPOA 3WF4A 3UY8A 1LORA 4M6QA 1YE6A 2J77A 3WBEA 1VAHA 4QISA 3W82A 4OQVA 3OG3A 1AH3A 1XSJA 3TAOA 3TROA 3N13A 4Q4OA 4OOZA 5FJRA 3KTSA 3AU2A 1L6YA 3VK5A 1K77A 3TTEA 3HGJA 3Q2DA 1TJ1A 3H2MA 1CGYA 2TMDA 2V2CA 1AK5A 3N29A 3NNTA 2EEXA 5KZMA 2TRSA 4LCRA 1DWGM 3WF3A 5LGXA 2VGFA 4FALA 1JNEA 2DDXA 3UETA 1QRQA 2QHAA 1V0MA 5C9ZA 3WBAA 3W1UA 4JIPA 3KVLA 4ZO6A 4MDOA 2VL4A 3WEZA 2GK1B 3NQFA 1LROA 3GNRA 3D47A 4ZEPA 4HPGA 4DVOA 3H6OA 3O63A 4GGHA 3IVUA 4I90A 1V0NA 3NPXA 4KESA 4QP0A 1WKDA 3MDWA 3SIMA 3Q67A 4LH8A 3GTXA 4L9YA 3CXOA 4JBRA 2G96A 2REQA 4G7EA 2XIIA 1OX5A 1CDGA 2BFGA 3R11A 3F4VA 4L1XA 1BG9A 2INFA 4H2HA 2I17A 1KNWA 2B81A 3RLVA 2H8XA 4PSPA 2NT0A 4JTRA 4US6A 2FHFA 3FK4A 1MXDA 4FIRA 1V3KA 5TIMA 1S2WA 3TJXA 4F9JA 1TZ9A 5FAJA 4UB9A 3BOXA 5CZKA 3L65A 3ARWA 1EA0A 3PK7A 1DJGA 2Y24A 2C3ZA 2D0GA 3LCXA 5I00A 4UR7A 3IVTA 2FZBA 3C0QA 4QS5A 1GZGA 2DZSA 1ZSXA 4EAMA 1AVAA 5JH2A 4LANA 3THQA 1OYAA 4H7ZA 4K37A 1DWAM 3NDYA 3WD2A 2OOFA 4UR9A 4NP7A 4BEUA 3NCOA 3KZSA 3BUVA 3PPFA 2G3MA 3CMJA 3GNPA 1DJWA 1GYNA 1A0DA 1DQUA 4P7NA 3OW1A 1K6WA 4DRSA 3M7WA 1A4LA 1K4GA 4WSKA 3TX9A 4GE8A 2NLYA 2G97A 3WD4A 3SGGA 5DRCA 2YBUA 1VKFA 3KBSA 2DUZA 4K1WA 4F0MA 1SFLA 1UCWA 1RK6A 2J75A 3RJYA 3VIHA 2X05A 5DMMA 3WNKA 1OABA 3IIOA 4PSRA 3LYEA 4GYPA 3GU2A 1W9VA 3RX2A 5JMUA 1Q7MA 3GKFA 2PLCA 4IFKA 5FSDC 3IGHX 1M03A 3QXBA 1F9CA 1R86A 5A6AA 3ITGA 1AMKA 2GSJA 2XN2A 3FA3A 3QPZA 4PUKA 3BQ6A 3UG5A 3WQCA 3P3BA 4OUIA 4AHOA 2YA0A 3SCPA 3W7OA 4XZ9A 4AWUA 3QFEA 2HK1A 2XH2A 3KM8A 3R58A 5CEWA 1GQNA 2C16A 2FZMA 1NWSA 5EMYA 4C7GA 3WQWA 4J35A 3HB9A 3STPA 1QTWA 2WOQA 3N2BA 4IM4A 3CU2A 2WWDA 4EIVA 1GVSA 3R6IA 3CQHA 3HBLA 4CLMA 1VBHA 1HN1A 1O95A 3BV4A 3R2GA 1LOLA 4QE4A 1TJPA 4S3FA 3OOQA 4DM1A 2HEJA 4KF1A 1YBQB 3ZJ7A 3CHEA 1VBRA 3R13A 3SY1A 1GHSA 2Q09A 2VZUA 4Y9PA 3Q4DA 1OC6A 1UR1A 4MY1A 3OQ8A 3ZR6A 1J0KA 4ENLA 4H2CA 4LC6A 3DBPA 3KP1A 3IV8A 4DUVA 1UH3A 2WYSA 3WDJA 3QKZA 3ABRA 2DUXA 2EF9A 1XYAA 1H49A 4YNGA 3DIPA 4Q6XA 4AZHA 2QNEA 3LXBA 4JTCA 3T05A 2DZXA 2PTXA 3PZQA 3SUUA 3QR3A 3CQIA 3OYZA 3UERA 1I2QA 1CGVA 4PTWA 3KBVA 3WK3A 4IMCA 1FHVA 2VEKA 1LRQA 4NRSA 3ENLA 4XIMA 1HP4A 5A6TC 2TAAA 3EX3A 5GNZA 2WVUA 3A5FA 4ACYA 2WBGA 1BWKA 4G6CA 2A3EA 3MI3A 1Z69A 2X40A 1REQA 4GQ0A 4QEEA 4YHGA 1VB9A 2WPGA 4PODA 3NQGA 4E4FA 1KFBA 5I3KA 3L0GA 4AWTA 4ICCX 2YA2A 4CVWA 5J5DA 5CPSA 3M0MA 2GJNA 3SUWA 4E5TA 1VD6A 3W1XA 3IEBA 4KEMA 1TUFA 1GPFA 5HANA 3GKAA 4U2YA 3K8LA 1KB3A 2PDWA 1TTIA 2QCFA 4TMCA 3VNLA 3B06A 1XINA 1E0XA 1F4HA 4CN4A 4JTAA 5DELA 5IFTA 3MJMA 3SSJA 3SGUA 2Z6JA 4NNBA 2PDJA 1UR8A 3WQGA 3GTFA 5CJMA 1E6RA 1QWKA 4EF8A 4R88A 5KETA 1ZQ5A 1UA3A 4PCTA 3A3WA 2IPGA 4D6IA 2DFAA 1FFRA 1UZ1A 5AHMA 3GNDA 3WF2A 1NIUA 1J2WA 5EMMA 3B8IA 4QG6A 3DFYA 4C6KA 2VFEA 4OFCA 1TWWA 5LNVA 4JZ5A 4NXSA 3DOPA 1DJNA 3CL8A 3RG6A 1WOAA 3GHRA 3VPLA 1A5MC 3ANUA 4NI8A 4DO5A 1E9IA 1LBLA 4KGJA 3VGGA 2CLLA 1JVNA 3CQKA 4LQ1A 2OYLA 1ZBVA 5FEXA 2VFFA 4BS0A 1G0CA 1AJ2A 4ZCWA 3N34A 5C9RA 2ZRXA 1YPIA 3M5YA 1X6NA 3UY7A 1BD0A 3TLLA 3ARZA 4ERAA 3ZVHB 3RGTA 4IJCA 4R33A 2OB3A 5FD0A 5EMLA 3LG3A 3O2LA 1GQLA 3NZ1A 3CLMA 3N4EA 3CTTA 4AXNA 1VFTA 4XO6A 1ONWA 3VDHA 1S5NA 1W1IE 1UD4A 4AWEA 3WL1A 4BEQA 4D6GA 2AL1A 4QG9A 1VLWA 5FF4A 1TV8A 3AHXA 1FHDA 3GUWA 4OKDA 3T55A 3T8QA 4MHBA 2JGQA 1L6GA 3OLGA 3TVAA 2PWFA 2ZE3A 4H9ZA 2BOGX 3PZGA 3NL6A 4CU8A 4MYAA 4M7TA 2YB1A 4GQRA 1DP0A 2WMJA 4AHQA 2YL6A 3LV5A 2F61A 1MEWA 2AMXA 4PTNA 1ZTVA 4PR4A 4WJEA 1E0WA 3TJLA 3R25A 1P7TB 3VNJA 2OWXA 1XIIA 3IUDA 2E9LA 5REQA 1ECQA 4AU0A 1W54A 1NWRA 5I5RA 2YCIX 1FWTA 4XD4A 2X7VA 4N4PA 3NQCA 2PDXA 1GEHA 1MSSA 2Z7KA 3EZ4A 4L6OA 1ZJBA 3SGZA 2ACSA 2EJ1A 3ZLFA 1P6BA 3R79A 4ICMA 5EBUA 2EG8A 4GUFA 1BQGA 1US3A 3PSVA 1GYLA 3CV1A 2YL8A 3TYEA 3VNYA 2CBVA 3VIJA 4ATWA 3M0KA 1U83A 2OLHA 4INFA 4IOTA 4LVFA 1R3YA 1GWJA 2YYTA 3TYDA 4XAYA 1LQ2A 4E8DA 2W66A 4QQ3A 5BU6A 3KHDA 3U5YA 1XH1A 2MNRA 1RUSA 3DG6A 3B9AA 2VC6A 4A8NA 3UR2A 1UUMA 2Z1XA 3PBYA 4DYKA 2OELA 2HSAA 3QSTA 5FF7A 4HQVA 3O9NA 4AYGA 5FSEC 3DI1A 4GH1A 4GFIA 4TVUA 5BU9A 1D9EA 2FYMA 4Z2HA 1TA3A 5AZ1A 2C0AA 2NQ5A 2J27A 3RM4A 3VOFA 5CPMA 1SUXA 1JDAA 3S2NA 4AVNA 3HPZA 3TQ0A 3LN3A 4LCSA 2A7NA 3VKJA 1VRXA 4BI7A 1ITCA 4GO8A 4QLKA 3GLCA 1UP3A 1JUEA 1XUUA 4H4IA 2HQAA 2W0UA 1JPDX 3M16A 4ACZA 4JYEA 5D32A 4A6GA 3WFLA 1OGBA 2ZRUA 4Q4QA 3WD3A 3SRHA 1T8QA 3WFAA 2J8FA 2IXVA 3G8RA 5CZSA 1PKYA 3TW6A 3SQMA 3FJ6A 1PEZA 2WVVB 4W88A 3O6DA 1C92A 1SFJA 2ESCA 2NQHA 5BWFA 3IUHA 3T2QA 2QIWA 4L4PA 2XYLA 2PS2A 3GYCA 4A3UA 3LM3A 1IWAA 3FA5A 3M0YA 2B7NA 1YNYA 1CGXA 1F8MA 1YE4A 2QPUA 3LNMA 1WCGA 3MYPA 3K1DA 1AZ1A 2D0HA 4FNQA 3LA4A 1CNVA 2WHJA 1WX0A 1FHUA 1S5WA 2GJPA 4OV9A 4XTIA 1G69A 2WBKA 4JHOA 3ITXA 3DFHA 4GX8A 4UTMA 3NZPA 3TYBA 2Q01A 3MHUA 1QCWA 3PVFA 3VOGA 1YNPA 3AROA 3V0TA 3C61A 2QJMA 2UBPC 4RX0A 3C56A 3NQ2A 3SRDA 2HVMA 3APGA 3PFRA 3IJDA 4HZ8A 1AFSA 5LXEA 4XKYA 4UXDA 3A4AA 4C6PA 4OBSA 6CGTA 3N4AA 3HPSA 1AQFA 1WAWA 4IQDA 3UVIA 1P0DA 1CB7B 1VRDA 4OBTA 3RITA 3O07A 3UWWA 5BOFA 3VA8A 4R7WA 3V18A 4G9PA 4EOUA 3BAKA 4JNZA 2V2HA 4H3DA 4S3BA 4JIQA 4MJMA 2OXNA 5K9XA 3NPVA 4GI4A 3MYOA 3V5OA 1OCBA 7REQB 3OHIA 3UEQA 2C8NA 3TTYA 3AMGA 1E0VA 1U33A 4Y9NA 3UWZA 2I5GA 3VD4A 4GH3A 4V15A 1KCXA 2CESA 2FDSA 3I6EA 3UJSA 5FIPA 2I9UA 4QCFA 3ARSA 3WH7A 1DL3A 1TVPA 5BYWA 2XFWA 4UQCA 3G5EA 3M5ZA 3GUGA 3E9AA 4GI9A 7TIMA 5BXTA 1H7RA 3L66A 1XWYA 3R8RA 3BGGA 2VURA 3UF9A 5AYIA 3VDBA 3AHZA 2VDIA 3XIMA 1V51A 1ONXA 2OEJA 1LBMA 2AL2A 4LNYA 2GGHA 1EJ7L 3CWNA 3W1NA 5I3GA 1SM9A 3I7RA 1ZU8A 2DSUA 3VVGA 2OT1A 1XYFA 4LVDA 4M81A 5LA2A 2GVYA 3PNZA 2V5CA 1HT6A 2A4AA 3PZNA 3DECA 4CD5A 4IUOA 2XM1A 3CC1A 4U3AA 4DO4A 5E1QA 3A13A 3VD7A 2R1LA 2BG5A 3U7BA 1TQXA 2H90A 3LHZA 2WNQA 4F2BA 3UJ2A 1IT8A 1DIEA 1DJIA 4H1ZA 4MWAD 1WOBA 1JPHA 4DJFD 4JFTA 4JX6A 2WSQA 3REQA 4KKXA 2ZXQA 4L65A 4HPHA 3JU2A 4FLSA 1IF2A 4HPXA 2WC7A 1S5VA 2GQAA 4D6FA 1KXQA 1KFEA 3EXSA 1RY8A 3EDEA 2YCEA 2E1WA 3LSBA 4JNMA 3AMLA 3R0KA 2IKGA 1ZNNA 4OGZA 1A3WA 1WYIA 1OX4B 1YMYA 5D4YA 1WXYA 5CG7A 4GC4A 1DWIM 1NFPA 2J47A 1KQYA 3VUSA 2X0SA 5A5WA 2AQVA 5AHEA 3BWWA 4IX2A 3IRDA 3GXTA 3LSCA 2DT3A 5AECA 3KFTA 2PTZA 4D1JA 1EA9C 1G4PA 2XIBA 3CZ8A 2FVLA 3XINA 4DJDD 2WC3A 3WNPA 4MZYA 4A35A 1G9HA 4J3SA 1QNQA 5H6HA 1SR9A 4GMEA 4GACA 2D22A 5D8ZA 2IKJA 2CHOA 1OCNA 1J0JA 2IKIA 1Q65A 3UFYA 4F66A 3MVIA 2NXIA 4QBXA 3R7MA 3UPWA 3BK0A 3V75A 2O0TA 1RP9A 3LBMA 5CPQA 4AXKA 3UR7A 5LIKX 4K68A 1UPMB 1A80A 1WV2A 4GLEA 4S2BA 4QNEA 5A1AA 1G94A 3V5FA 3HG5A 9CGTA 1FWBC 5M5DA 4HU0A 3WUGA 2WKJA 1TB3A 3TNBA 1W8SA 5LGZA 4CNSA 1X98A 1A5NC 1BGGA 3VNZA 4ZQMA 3PZUA 1A53A 4Q8VA 3RRAA 1XUZA 9RUBA 3CIWA 1WB0A 2PDKA 5C5YA 2DJLA 1CBGA 4I6VA 5PTDA 3DFNA 2VXNA 5FESA 2VZOA 1JD7A 1WPCA 5F2GA 1UWUA 1UD8A 3MSGA 2ZRVA 1MRAA 2QJNA 2VR4A 3BANA 1Q6RA 3PJXA 2OSXA 2Q02A 2VRKA 3VIPA 3WLTA 2IPFA 1QI0A 2Y6ZA 3VOCA 4C90A 2A5HA 4RCXA 4RZ5A 3ARPA 3GAYA 5I3IA 1OFOA 4N9CA 4I7UA 4Y9MA 4QJ1A 5FJJA 5BW6A 4AY8A 1JZ4A 1ZY9A 4H8UA 4D6CA 5HINA 2PBGA 1A5KC 2VKZG 3NIYA 4FNPA 4WXYA 4KWUA 4P7QA 1H7PA 2BGSA 2GUYA 1EWDA 4B9ZA 4WY0B 2PDCA 5G1YA 3FEMA 4FA3A 2WCAA 1KV5A 3DESA 3ANYA 2FIQA 4I5UA 1CLXA 1J9YA 4YVXA 4EXQA 4IXHA 2ZX8A 4F0LA 3EA3A 4GUHA 1D7FA 2J8TA 2W9MA 3UESA 2YDQA 3QYSA 1BFNA 1OG6A 1SZFA 3CPRA 3S1XA 4L1WA 3CZLA 2GQ9A 4ZL1A 2X1SA 5LIWX 3NDOA 2AGTA 3W87A 5E5CA 2Z1BA 1BAGA 4JTEA 2EPNA 4J2MA 1KV8A 1NJJA 3EB2A 3EKGA 1NSJA 4GZEA 3BAIA 1B57A 3DKJA 5A2AA 5C71A 2R91A 3WLNA 1RH9A 3W71A 1X6UA 1KM6A 1M3UA 1UYQA 3CHVA 1VFOA 2CZVA 1R87A 1QAPA 2VI0A 3C86A 3NXLA 3POCA 1O68A 2CLOA 1ODUA 4RE2A 3LK6A 5FJTA 3L4TA 4DZ5A 1TKKA 3TA6A 4MIMA 1E3XA 1X7FA 3T0TA 3MP3A 2X41A 1CENA 1NQ6A 3T81A 3I65A 3E96A 1UD2A 4I5XA 1JRBA 3K8MA 3VGHA 2ZE0A 4BI6A 1YHTA 3GC2A 2PWHA 5D37A 1OGGA 3VCRA 3H7VA 3QN3A 4OTKA 1WZKA 3C0JA 3M5VA 1EIXA 7TAAA 3AJ7A 3VGDA 1FQ0A 4D72A 4U5IA 4F9DA 5DN1A 1RVKA 2G4JA 5CKSA 2V3DA 2PWEA 3TN3A 3J7HA 4NAFB 3LI0A 1XJBA 4FEZA 1IZKA 3F5JA 3FGCB 2VUYA 3EX1A 3P67A 5F4WA 1DYSA 4I9AA 3TCSA 5CPTA 1FKWA 5D2TA 4WKAA 3GVRA 2W61A 1W1A1 3WEOA 1PX4A 2ZXBA 3PZVA 3G1FA 3C5QA 3GU9A 1YXYA 5A3HA 4XAZA 2O4QA 3MBDA 4H9TA 1Q6DA 2PCEA 1R3RA 3AICA 3QEZA 3FAXA 4JEQA 5E6YA 1QW7A 3KOWA 5D09A 2YZ5A 4J5NA 2GUBA 5AC7A 2QAFA 3HQOA 1S3TC 2Y63A 1L8PA 2HNEA 3T6CA 3S6DA 5DEZA 5IM51 4NJKA 5FCZA 1E40A 3PBUA 4Y7EA 3T8LA 2FQIA 3CUIA 3LMYA 1V6TA 2EO7A 4C6MA 2PDNA 1G1YA 4R85A 2J7GA 4QE5A 4QDWA 3ZSSA 1BPLB 3KTXA 1BRLA 3MCOA 4Y96A 4C7FA 4R5EA 3U48A 3WQDA 3GAKA 3SURA 1S5MA 1BKHA 1UR9A 4PYSA 5HPOA 3NEVA 4MWAA 3GU1A 4HN4A 4LRSA 3SSZA 4DJFA 1W3LA 2D20A 3TQVA 2ZX9A 3DFOA 2QT3A 3GVWA 5D8WA 4FI4A 1I2NA 3T08A 3GSMA 1AW5A 3WL0A 5DX7A 3WYZA 4A3QA 1UD3A 1OCJA 1GONA 2C7FA 3MO7A 2DH3A 4EPBC 4ZODA 4C6OA 1KM2A 4IIGA 5MF5A 1C3FA 3D5HA 2VHLA 2OJPA 4C1LA 2REQB 4AWSA 4NZ1A 4DM2A 3W86A 1OYCA 1EDQA 1U1UA 4K8HA 1RP8A 3M41A 3S5SA 3BVJA 5TBOA 4ZOCA 1ZB5A 4US5D 1ENUA 2FH8A 1ZLPA 1CT5A 2OX4A 5LXXA 3N6JA 4JN6A 4L9ZA 3W1AA 3E74A 3WQEA 4RV8A 3S5YA 1PKMA 1TE1A 2G5WA 1WDSA 4DJDA 4AAJA 1H51A 4GABA 3WD1A 5CSYA 1U30A 4M51A 1GTEA 1UH2A 1H1NA 4QRNA 4XAGA 1HG3A 4YPJA 3A4JA 3HV8A 2YBVA 3VTRA 4DUWA 1OFPA 2ANUA 4GYPC 3DBNA 3GX9A 1YADA 1C9WA 1BF6A 2ZKMX 4JTHA 1TSIA 1JZ3A 1KRAC 1C8VA 1ECEA 3EWZA 3QGVA 3ARTA 5F1UA 4PMQA 1LWJA 2DIEA 4UQ9A 4JICA 1FWHC 4JTDA 4AISA 4DN1A 4X61A 2VENA 2E5BA 3HPXA 4C6CA 3CAQA 3P5YA 4Z08A 4EPDC 2I9EA 4WKHA 3VIFA 3EBVA 4W84A 2R14A 4RK8A 5DT5A 2O9PA 4M3PA 1AJZA 1HUVA 3GB6A 4UOQA 2J6VA 5C7VA 3K30A 3L5AA 1P4CA 3CK5A 3W2NA 4IP4A 3E5PA 1WP6A 3THCA 4JCMA 5I3FA 1C8QA 1T40A 3G24A 7PTDA 2O92A 4HTYA 1EOMA 2Y70A 4JFVA 3G1RA 1YKWA 4G1NA 4CNPA 4LALA 3F1QA 3GDKA 4TX6A 4UTFA 4IFKB 1J8VA 1KLZA 4MOZA 1NTHA 5FAGA 3P62A 4M1RA 2BWGA 1I75A 3PPGA 1TTPA 3UWEA 3B9EA 5E6ZA 4P7RA 2JQXA 3FIGA 4CCCA 3EKLA 3WJSA 4CVUA 4ZXLA 5A8PA 3SEPA 2QJHA 5HNUA 1X39A 2GK1A 1Z7AA 5BCAA 3EA2A 3CV7A 2CWXA 3VKDA 3NM3A 3DHUA 1K6AA 3AUJA 3SUVA 3CH9A 4RE4A 3I7QA 1RSCA 1BTMA 1V3HA 4GNKB 3MW7A 1NF7A 1OZQA 3GVVA 2A6LA 5F4SA 5LA1A 1R3VA 1F7BA 1HZYA 1HO4A 4UNLA 4X63A 3DUGA 3BCJA 2EPKX 4M7SA 4AZBA 3W7KA 4WCJA 2P5NA 1XCXA 5I7GA 3TCEA 3AXIA 3W1LA 2FH6A 4GY7A 3BW2A 4H6KA 1XFBA 2UWFA 3MHFA 3KLLA 3ZJKA 4S23A 2DV0A 4PMVA 3LI1A 1QNVA 2OZ8A 3IAQA 5H8UA 1B31A 4BF5A 3WH6A 5KZDA 1RJRA 5AHNA 1V0LA 6PTDA 4F4RA 3KL3A 1G6CA 1F73A 5MHBA 3W7EA 1RAKA 1ISZA 5EKYA 4AEFA 4W9TA 2DQXA 2OFJA 2PRMA 4ZR8A 2V5DA 4NJJA 4HNUA 5H1WA 2PTWA 1GCYA 5E0KA 3EWDA 1PHQA 3U4FA 8XIAA 3WZ0E 3HJEA 2FB2A 4NYUA 1NM9A 1XRFA 4M6PA 2F7FA 2WLZA 4HZ7A 2BV9A 1FA2A 1E0TA 1YTEA 2IS7A 3DHPA 1E55A 3CM4A 3QQ1A 3DGRA 2B7PA 1UBPC 4JS3A 4GY1A 4EX4A 2ZIDA 2RAGA 4A2SA 3VFCA 2D2OA 1VFFA 5BROA 4YIWA 2E6FA 1REQB 1WZMA 1QOQA 3WH8A 4WSJA 2HBVA 4AD1A 4ZB0A 3S9IA 4MMWA 4OJYA 4PCSA 2BY3A 4NILA 2H3DA 1R2RA 3S3GA 4U5KA 3EOUA 3IPWA 4GZIA 2RDWA 4IPIA 4LJ3A 1PX3A 1UWQA 2CHNA 1EH9A 4REQB 1U5JA 3TA9A 3TWAA 3AI0A 3EOSA 4HCDA 4GZ7A 2RHGA 3BGJA 2V8ZA 1W1TA 4CQAA 2ZRYA 2ALDA 2OVLA 3WUFA 2FPYA 4MPKA 1OFRA 3W2UA 3I3DA 3WMBA 3W70A 1TPVA 4YTQA 2VVSA 1S1RA 1GKQA 4C6DA 2F2KA 3OHMB 3TMQA 3LXCA 4FXJA 1GG1A 2ZUWA 3WLHA 4DBSA 2C6QA 2E7FA 3N2MA 4R9OA 4LU0A 1CGWA 4Q8UA 2J8GA 3LCFA 4ZO7A 4WX2A 4I8YA 1OG0A 1BQCA 4LAKA 2PDLA 3CHDA 4X60A 2VDHA 5DBUA 3OGVA 3CASA 3K2GA 1FUYA 3WBWA 3W2LA 2Y8UA 1OB0A 3AZTA 3B4YA 3WJWA 1B54A 1VR6A 3P6LA 2JBMA 3MI2A 5F1VA 1AMYA 3ZWTA 1GNXA 1X1NA 3PZMA 1R7AA 5FA5A 4XSLA 4LVBA 3URBA 4X22A 4O17A 2HWGA 2IMRA 3SZ8A 3GXNA 1YW1A 3ZO9A 3BAJA 3P14A 1MNZA 5D03A 2XIOA 3CJPA 3PWGA 2E6DA 1V0KA 2B4GA 1D8WA 5JH1A 1PIFA 3TOPA 4LF2A 1B3ZA 3IK4A 2FVKA 1P0KA 3E5BA 4US5A 1SMDA 1WDWA 4OV4A 1O6IA 2HXUA 2HMCA 1LLOA 3F03K 2OG9A 4ASTA 2X1UA 5FL1A 1WXZA 1R8LA 4G5DA 4Q7NA 4WDUA 1QPRA 3NSMA 3EWXA 4ZE5A 3UCQA 1W1ZA 2PEVA 5AVNA 3UD6A 5F2LA 4ZQOA 3UZJA 3GE7A 1HL9A 3B9OA 4DY1A 3E2QA 3MUY1 3T09A 2EKGA 4LUTA 3QQWA 1K7FA 5I03A 1IE7C 1QPQA 3B8UA 5CLWA 2A3BA 5G1MA 4N9DA 4NXKA 1P0NA 3MZ2A 2PF0A 3VDAA 3MZNA 2XU2A 1WO2A 4B5TA 3IJ8A 5REQB 3RO6A 3U2CA 3QHMA 3IJIA 4WK9A 4V28A 1PZ3A 2C14A 1OC7A 2YPIA 1D7KA 4UTLA 1KTBA 1QMLA 2PB1A 1UUOA 4DLMA 4DELA 3F4NA 1VEOA 1BYDA 3H70A 1VCFA 2I1OA 4UOJA 1B3XA 4C5YA 2I14A 3BG3A 5HMEA 2FMNA 3BH4A 3GD6A 1KC7A 2W92A 2XIQA 5HMDA 1UP2A 3WY1A 1EC7A 2ACUA 3DHFA 4IGMA 1A5AA 4ES4A 1QXLA 1JR1A 4EWJA 5A6LA 3I4KA 4Q8NA 3LU2A 4H6RA 4DYJA 5IOBA 4I9MA 4UMCA 1HKIA 2ZUNA 4FNRA 1CXKA 2PP3A 2PDYA 3OJGA 2QVHA 5I23A 3S1VA 3TDFA 2PU1A 3CUGA 1OF6A 4XZIA 3UT0A 3WN6A 4WR3A 1TJ2A 1TA3B 2UZ9A 5L6UA 1XSIA 3GG7A 2V69A 1OT2A 2I56A 3TLQA 2GSEA 1VYPX 3F5LA 5BRQA 3W85A 1ADOA 2ZZ3A 1XRTA 3WH9A 1W9DM 3ZM8A 1EC8A 4A05A 2XN1A 2CLMA 1BXBA 3DDMA 1JIBA 3E1F1 4B5NA 2YB4A 3LERA 3H54A 1FKXA 1TG7A 2BVYA 3LOTA 3VCNA 3AMCA 3UPBA 1VHNA 4FP1A 5A95A 3NQ7A 3UJRA 5TQLA 3VABA 3IIVA 4F0HA 3OZPA 3RU6A 3FA4A 4BF7A 2Z24A 1GKRA 4ACZB 4WUIA 2BSLA 2QGHA 2CU0A 3HM7A 2FGLA 2VFHA 2E28A 4N42A 4M6UA 2NWSA 4C60A 1ZBKA 4Q8MA 3L23A 3NGJA 3GVQA 1Q85A 2PMQA 1QHOA 1W6TA 2DP3A 3QV7A 2ZXDA 3FKRA 4FIQA 2UY4A 5E9XA 1S2AA 1QJWA 3NSNA 3TR2A 1EXPA 3LUTA 1GQJA 1CCWB 2E8YA 4FHAA 4LT9A 3NQMA 4GNVA 2ZICA 3MJYA 1E1CA 3P7YA 5CQ1A 4H19A 3W01A 4LFYA 2GDQA 5GPRA 1E51A 3TN5A 2WXDM 4WDWA 4DF1A 1E6SM 3FN9A 2VCBA 2GJXA 1TCDA 1TV7A 2RFGA 4GUJA 3E38A 3HTWA 4ROPA 3AS3A 4WKFA 1W37A 1LDCA 1UC4A 1IGSA 2P3ZA 1UWIA 2QCHA 2UY3A 3AHYA 2F6UA 2QCEA 2W27A 5HNNA 4NZ4A 2EBNA 1FHLA 2VGGA 1XHGA 4O53A 4NJHA 2QCNA 3CAKA 4XKYB 3KDNA 1RD5A 3RUBL 4MFDA 5FACA 2ZCGA 1UIOA 5C6MA 4KQNA 1HL8A 3H21A 3U6WA 3LPPA 1YDOA 2BTMA 3W1RA 2GVLA 3TE9A 3H2CA 3GH7A 1VBGA 4IPPA 5G2IA 1FBAA 3C6CA 4H9MA 3P0WA 4HP5A 3KOFA 1QI2A 3W6YA 5M3WA 1M6JA 3PUOA 4CQ9A 4DBWA 1XBYA 2PLJA 1IWPA 3TYCA 1VBJA 5CPOA 2PGEA 2AKMA 2OMAA 3BQ5A 1S3HA 1NAL1 4GZJA 3CTLA 2FTPA 3KS6A 3QKEA 1H5YA 1W3IA 1IIGA 3M0LA 2QULA 4GIYA 3FJNA 4PMUA 5HMSA 3OU8A 4WGHA 1I0BA 4I9JA 5AC5A 1GW9A 1S5TA 1DORA 3LMZA 2NZLA 3GG8A 2C79A 4YJ5A 2Q3RA 3ANVA 1O94A 1UWRA 5HULA 3ZJ8A 1V6XA 3IIZA 1MO0A 4A22A 4NAEB 2B7QA 3Q58A 1QATA 5FEPA 1F5ZA 4DB7A 3ZT7A 4HCLA 3UPMA 1HO1A 3S46A 3PTDA 2VEGA 1K1DA 2WNZA 3PBWA 3GTIA 4GG9A 2ZYFA 2WVVA 1AQ0A 2JGYA 3TKFA 1NARA 4X9YA 1W5PA 2AL2B 3O06A 4GC3A 3RU8X 3SAZA 1RCXB 1G5AA 3BLLA 4XISA 1LF1A 3D3FA 2VP8A 4G7FA 3MV01 1DJHA 3CO4A 5HK4A 1M5WA 4FZIA 3BO9A 2QV5A 1R3TA 2UY2A 3RPMA 1E6ZA 1TYGA 2NV9A 4RDVA 3QZEA 4ZA0A 4AY1A 2Y8VA 4GBDA 3DYMA 4DAFA 4UBPC 3FXYA 2YCKX 1XC6A 2GL5A 1E9ZB 1ZP3A 4GYFA 4XSMA 2UY5A 1U5VA 3W24A 3LGEA 3T42A 5AC8A 3DN5A 1TV4A 2W91A 3QJAA 3IIPA 4ZTXA 4FF7A 1TV5A 1LT8A 2DIJA 1DIKA 2BDQA 3P5ZA 1A5SA 4OUEA 5BOEA 1RD6A 1EUNA 5CBBA 1VGAA 3M4HA 1J5TA 3OB8A 3ZJ6A 2OZTA 4JKMA 3TYUA 2WJZA 2FGZA 2ZC1A 5D05A 3AOFA 1T5AA 4FB7A 4J7RA 4PL2A 2C13A 5ENLA 5FJPA 2G8ZA 5DY2A 4PTXA 4JY8A 3EPNA 3SW6A 1HXJA 2V6AA 1WA3A 5A8OA 5EYWA 3GW0A 1KR0A 3C2OA 3DFPA 3ABOA 1DJZA 1XLEA 2EG6A 5HWMA 3T1GA 3PB0A 3WKZA 1XW8A 2G3JA 1J0HA 1W3HA 4UQBA 4HHPA 3H4WA 1N8FA 2GOUA 4LS1A 4GWEA 4PCNA 1DOSA 3ITVA 1NQKA 3NZGA 1CXLA 1QNPA 2HE8A 4G8TA 2PBOA 1Q3NA 5D9PA 3VMOA 3BMVA 1J12A 1E9LA 3LTSA 5HUOA 3AMKA 4O54A 1TV2A 3AYSA 3SB0A 3MWCA 1DWJM 3AYRA 4I7VA 3ABZA 4UC5A 3N25A 4TMBA 4AIEA 3LZ5A 3RLUA 1CYGA 3VE9A 1JI2A 4DZAA 2DVTA 4ONVA 3A22A 4N4QA 4RKAA 3UBPC 1CXHA 2BS9A 1MYRA 5SWUA 3UWQA 1KM1A 4CU6A 3BE7A 3AS1A 3LPOA 2J78A 4J28A 4XUGA 1W0MA 4AZIA 3NOEA 1GZ1A 1TWZA 2YW4A 2PA6A 5TAOA 1TREA 4LYPA 1K7XA 4WDTA 2GDVA 2NT1A 4B3KA 4YMZA 1NU5A 4HU3A 4LWWA 4O28A 2ZA1A 5HBFA 1E15A 1BSIA 1SO6A 1R3SA 3F2BA 2VFGA 2WSKA 1SSDA 2YL9A 3IANA 3ARQA 4Q8PA 1F3EA 1YDVA 2BOFX 4XVEA 1V7AA 4K6AA 1Q6OA 3TC6A 2Y1HA 4PB5A 4ATLA 4AEOA 2PPGA 3F4DA 1UZ4A 3KS5A 2FFCA 1G4TA 3OVQA 3HGRA 4FX7A 4ZB2A 4AUBA 4NJGA 1X97A 3B8WA 4RJEA 3BLOA 1UH4A 1SO3A 1OCQA 1ELSA 1XG3A 2XSBA 4KH2A 4QXIA 3MC5A 1V5XA 3GG0A 3HQ1A 3I6TA 4UTTA 1UIPA 4GVIA 1EP1A 1FXPA 4FLQA 3QYQA 4AYSA 5IDIA 5LZLA 1OGSA 4ZTYA 3WUEA 3TYAA 4JNYA 3EMZA 3VDCA 3ARVA 1XIMA 1ZRQA 2E68A 2VJXA 5ECUA 5IFPA 4D6HA 3A5VA 4LX4A 4WF7A 1W9BM 1KM3A 3G0SA 3KVJA 4WVXA 1WDRA 2WMKA 3ZT5A 2WHKA 2R1NA 3KDOA 4AVOA 3FHQA 4X9SA 3WDRA 1EGZA 1KKRA 2P10A 4GCXA 4HA3A 3MKCA 4B4FA 3KVKA 1B9ZA 3E0LA 4IG2B 4GXMA 5AKQA 4MJZA 1F6PA 5BOOA 1CLVA 3O6YX 3S9YA 4JEJA 2Z25A 2QQ6A 1WKEA 1PL9A 4PMNA 3NTYA 3KEHA 3GZ3A 3OZOA 2D3NA 3BARA 3PJUA 4MB1A 1GOWA 1VS1A 3MMUA 3EOLA 1OFDA 3SUTA 4R9XA 1K9FA 3SCTA 2F2HA 3DG3A 1XLLA 1EF3A 4QJ3B 1ME8A 3GFYA 3CZEA 4HA4A 5EMUA 3PNUA 4XD3A 3NL2A 4DIAA 1XLGA 1W9UA 4KETA 4K39A 2E9MA 2Q3OA 3HF3A 3SCQA 2PURA 2X42A 3W7NA 4J3XA 2GUUA 3ITCA 3TSBA 3G0UA 3LEPA 3UXLA 2JF7A 1Q5MA 2VD8A 4HKPA 3NO3A 1BVZA 3B9DA 4I8DA 1R38A 4LUSA 3T0AA 4RE0A 3IVSA 2TSYA 1W1VA 4IMDA 4JR5A 4MWAC 2XFRA 2HE5A 1GOQA 3BGAA 4ML9A 3BMWA 3W7DA 4H6EA 4TIMA 1SMAA 1BYAA 2XGZA 2NQJA 1V6VA 4J2PA 4YTSA 3HA1A 5BXPA 4MPQA 4XIAA 3T2OA 3P61A 2GZXA 5GNYA 3CT2A 3QZAA 2WQPA 3P81A 1KXTA 1BLIA 2BOEX 1KXHA 1PSCA 1ZAIA 2WNNA 3QV8A 2YA1A 4QROA 5GJMA 2Y8KA 4LXFA 3CQJA 2WAGA 4JPGA 3L0NA 3NPWA 2F38A 3P8JA 3PTMA 1JXJA 1S38A 1PDZA 1HKMA 4MWAB 2RJHA 5CZTA 1Q6LA 1QNRA 4LVGA 2YFOA 4C1KA 4DJDC 2ADAA 3RAOA 2G3NA 5I06A 4RL3A 3TMLA 1EEXA 2HISA 2XM2A 4Q3MA 5DXXA 1TWIA 1PUDA 4PC8A 4WEVX 3NURA 1TV3A 4I3GA 3EMCA 4MUZA 3JZEA 1EYEA 1I2RA 3QR0A 4R7JA 2YKKA 2GSHA 1P5BA 2Y85A 3LD5A 2J9ZA 3UZXA 4DWSD 1X8FA 4GJIA 3IIXA 1GOXA 2PGFA 1UR3M 3HJZA 1HW6A 4FLRA 2ISFA 5I24A 3GK0A 2ZBTA 3EDKA 4KCTA 4HIBA 4OZOA 4YXGA 1KFJA 2JALA 4V27A 3VINA 2BP1A 3POHA 4G2DA 3RK8A 2PWVA 4IISA 1BYCA 1KR1A 4AZ7A 4MNLA 1KXVA 1JD9A 4Z0SA 2BVTA 4ZO9A 2CETA 4RXGA 3P2VA 4K36A 4F40A 2VNCA 1RZMA 2A3AA 7A3HA 2VCAA 1VJIA 4JGDA 5CSSA 5HJXA 4LYQA 3RN6A 1VFLA 2Q8ZA 3GR4A 4MY9A 4M8UA 4FXSA 3GQYA 3VD5A 4NNAA 4JTFA 5KTLA 4XZBA 3L9CA 3NOYA 3W7HA 2OWWA 2W4XA 2ZZ5A 4KEUA 4DEFA 3USBA 4M80A 2CLIA 2XDFA 1XCWA 5D2XA 1W5OA 4WXZA 3QOMA 3CL7A 1PTDA 1J0YA 1V6WA 3W28A 3TZNA 1QDSA 3NQ8A 2XH4A 2W62A 3N1AA 5DCDA 4F0KA 1XYLA 1GOOA 5FF2A 2O56A 2PGWA 4WLCA 4W86A 3L4WA 4DYEA 3KBJA 1XYMA 4S3GA 4PRWA 2YLAA 3NPUA 2GPTA 3TW9A 1GJWA 3CL6A 3CIXA 4CCEA 3L4VA 5EMJA 1F74A 4ZSUA 3PFMA 3UJEA 5A6SA 1O5KA 1D3GA 5AYZA 4B16A 4PB3A 3EGJA 4L64A 1ESWA 3SCUA 3SRFA 1K9DA 3ELFA 3R4IA 3A24A 3PAOA 2QJIA 1XLHA 4E8CA 1Q6GA 2NSXA 2H9AB 1BF2A 3EWBX 4EWND 2KAUC 1EKOA 4HMNA 1W8GA 1LT7A 3E0VA 1IXPA 5TNVA 1QI4A 2NVDA 3UXKA 3B0VC 3GXDA 1IXOA 3N12A 4HBKA 4GUIA 1I9CB 5DO8A 4IMEA 4TTUA 2W79A 2J66A 4LAMA 3QC3A 1KCZA 4HMCA 5CJNA 3DZ1A 1DQWA 2F6XA 1GYMA 2O9RA 2BNJA 3LS9A 4UCGA 2QR6A 2CFFA 1QW9A 3E0WA 4TX8A 3SN0A 1NY1A 3TEVA 3MHGA 2ZX5A 1V3LA 1JCJA 2POTA 5A6KA 5C0QA 1XIDA 2BVDA 4Z17A 1H7NA 4DPQA 1EWEA 4JXCA 2X2YA 3PPCA 1WDDA 3VGBA 4GGBA 4RUBA 3TONA 1EGMA 2G4FA 4J40A 4RDWA 4XAPA 2J4GA 3UXDA 4C6JA 4TUFA 2QS8A 4KPLA 4O1AA 1HJQA 4PUNA 1P43A 3HG3A 4FX8A 4L4LA 4RLIA 2X09A 4LBUA 3NO1A 4H7CA 3QF0A 3WQ4A 4WY0F 1H4PA 1F3XA 1JFXA 1CZ1A 3PTQA 4GJ1A 4GI6A 4JTJA 2A1YA 1C93A 5G4HC 4IP5A 4JAWA 5T9CE 1X96A 3WDIA 1CI1A 4KEZA 2OO0A 3LRMA 4PTVA 1YQ2A 3AS2A 3E6EA 2LLEA 4A3YA 1AZ2A 3MANA 2J62A 3XISA 3L2MA 3WLIA 2PP0A 1TUXA 3WJXA 2CZFA 2IQ0A 5DCEA 1C29A 3PJTA 1CX9A 2QCDA 3RF9A 2V5KA 2V0TA 2E6YA 4MFEA 1AODA 4MGGA 1EIBA 4HYWA 1T8XA 1LL7A 2IUZA 2DGAA 2OGJA 3M44A 4Z2KA 1HNYA 3R1ZA 2J74A 4MNJA 2VELA 4HU8A 1UD5A 2WZTA 1CIUA 4WD0A 2G37A 2O55A 3T0BA 1TMLA 1A47A 1FWEC 1AQMA 1JPMA 3WLPA 3HMJG 4HT3A 1EO7A 5FKYA 4WDXA 2VOMA 2AGKA 3VU2A 5BZAA 2E5DA 3LHVA 4R34A 1ZJHA 2OQYA 4L6DA 4IQEA 1SZNA 1M04A 1DHPA 5M17A 4JFWA 4RV3A 1L6SA 2QEZA 4L1GA 1W1B1 1OD0A 3OBAA 3QRHA 1TPH1 2PSNA 3CPGA 4DUOA 1VENA 3O15A 3TTQA 7ENLA 3U8GA 4BI5A 4EP8C 2J88A 5CC6A 4H41A 2WKLA 1PE1A 3FVMA 1FWAC 1TPUA 1MEHA 3MQTA 5D2WA 1TZ7A 4DI9A 3DYPA 2E3ZA 4QAIA 3K4AA 2INZA 1IXQA 1IEXA 1J2BA 1KGWA 3UWUA 5G5IA 3EMQA 1JDDA 1GW1A 3ZVIA 1NP2A 4NVTA 4C6BA 2QUMA 3AJXA 5AN7A 3KWSA 4DHGA 3L21A 4PZVA 4HD5A 4D9PA 5FJIA 2JFEX 2P3EA 1FOBA 4JCLA 4NUWA 4HVXA 2VEMA 3A3XA 3QW4B 1CW2A 2X1TA 4UNIA 4ZQNA 4LW7A 4EK7A 4IHCA 4HTBA 4DWSA 2PRLA 4AF0A 4PA8A 1IEQA 4UTWA 1G67A 2ZDSA 3BZJA 5C2GA 2NV2A 2OCZA 2YYUA 4GY0A 4DJED 2PLMA 1J93A 3CIVA 2WJDA 1O1HA 1V6UA 1DIDA 2VFDA 4IPNB 1MFVA 1TELA 4QS6A 2X8RA 4ZE4A 1VPYA 1RPXA 4B3ZA 3RO8A 2RH9A 5D04C 3E2SA 3UW6A 1UKOA 4LGXA 3BAWA 5C9WA 2EPMX 4UMBA 4JTKA 1AL8A 4Q32A 3W00A 3LRKA 4QFUA 1PJ9A 4POCA 2KX9A 1TRDA 1KTCA 1ZPTA 1ICPA 1W3KA 2HV5A 4JYFA 2Q6ZA 4LUTB 3UYCA 3VAVA 1XLCA 1M9HA 3APTA 4CNUA 4D71A 4LSBA 1H60A 4Q8OA 3DERA 3FOKA 3T2PA 1XIGA 1C91A 5CBIA 5EMKA 4CU7A 2E6AA 3RX4A 4G1KA 1J0ZA 3HPAA 3W7LA 1OM0A 1W3TA 3UA3A 1MW1A 3AIRA 9XIMA 1J96A 1FWSA 4REQA 4CEUC 2NWRA 3CNYA 4GIEA 1RVGA 8XIMA 3M9YA 1JYVA 4W93A 3FW6A 1CGUA 4ADUA 2XHYA 4O16A 3WBYA 4P8XA 3N6HA 2FFIA 1R7OA 2OO6A 3M5XA 3TQKA 3O6AA 4MZ1A 4Z42C 3DFSA 4D2JA 1XS2A 5A8GA 4ZMGA 2PDBA 4JX5A 1AG1O 4EXBA 3ITYA 2XFYA 4D8ZA 4PRTA 1CXIA 2NSOA 2HK0A 4C1NB 3O7UA 1QOXA 4PTDA 1E6XM 2QUVA 3DU0A 2YDAA 1QT1A 2BX7A 2CKSA 4TTGA 2QPSA 1TTJA 4MLRA 3RDKA 5G4EA 4RZBA 3P60A 3A9BA 3W2JA 1HKKA 1I8JA 1B3OA 2CKRA 1XH0A 3ITTA 3S6OA 1JCLA 5HJLA 4U3CA 1H3GA 1TE6A 1Q63A 2YCLB 1JNDA 4DF2A 4EPKA 2ZUMA 4M0XA 2P0IA 1RPKA 4KWOA 5CBJA 2XWDA 1IEVA 5JQ9A 2WVSA 2FHCA 3LCLA 4AEEA 3OP2A 3PG9A 2CW6A 1OIMA 1OT1A 5A2CA 5T91A 1HKWA 3IJQA 4PBGA 1F6KA 4QEHA 4HJWA 5EL1A 2WSRA 1YXCA 2V68A 1F61A 2VD9A 6ENLA 2YW3A 1P0EA 3WG6A 3WLQA 3PUEA 1K8XA 2Y89A 3LGGA 4Q4SA 3FY1A 2ZTKA 4JIEA 1LZOA 1OX6A 3PWIA 3H8AA 4E2OA 1J18A 4C5ZA 4IQLA 3UG8A 4YVPA 2Z7GA 1Z6KA 4LS0A 3JR2A 5IHSA 2WPBA 4GO9A 2R1PA 2IQDA 2OR2A 1PIIA 1ZJAA 3WF0A 4Q33A 3U7VA 1E1CB 3TJIA 2XIJA 4O0QA 1B3YA 8TIMA 4BFAA 1MVYA 2WV8A 4QDMA 3N17A 2GJXB 3BLKA 4O4WA 2OZ0A 3KRSA 4FPSA 3VZYA 4MB3A 2O4MA 4YTTA 4HCHA 2QIIA 3Q45A 4NZJA 3GDBA 2GWNA 3SO7A 3MMWA 3N9SA 3UNDA 1JXKA 3KTCA 1UKPA 3TXVA 4RNHA 4H9VA 4MNKA 3ME3A 3UVAA 2JKPA 4HNNA 3GTHA 1UPPA 1FCQA 1CXFA 2E8ZA 3R10A 1L6WA 3GNNA 3C8NA 3RNDA 1XDLA 2WZIA 2JIEA 2Z1SA 3NFUA 1F6YA 4MLJA 2NX1A 3I68A 2CNCA 3FCPA 1A0CA 3F5KA 3T07A 3H12A 4TXEA 3AYVA 1K8ZA 4YTRA 5A69A 2VX5A 3H23A 1TR1A 3CH0A 4PMXA 2YDSA 1E3ZA 5I78A 1FY6A 4GQGA 2AAAA 4AD5A 1LWIA 2BASA 3KAOA 1KBBA 3A4XA 2AAMA 4ZFMA 2HTMA 2PGRA 3EEZA 3GDMA 3G8EA 3CAWA 2PDMA 3BAXA 2BZNA 2V2DA 4W89A 3L0KA 1JGIA 2C1GA 4IT1A 1ICSA 2NUXA 1B3WA 1RCQA 4RZ4A 2QW5A 2A0NA 3DAQA 3MDUA 3OEXA 5H91A 2ATSA 2R1MA 4FOJA 3MO4A 3W83A 1FH7A 2ODOA 3WNOA 3W84A 5BMWA 1GVIA 4XWUA 4MY8A 4MVAA 1UKTA 3IJ7A 1PX8A 2WANA 4PULA 4K7YA 1XYCA 3S42A 1MUCA 5C70A 1OYBA 2G41A 4NL1A 4F8XA 1HVQA 4DAIA 4NF7A 3F4WA 1KW1A 3NXFA 4IUGA 3L4YA 4CCDA 1LP6A 4LF1A 2HBXA 3NQAA 5K2ZA 1BWVA 1S2VA 3N9KA 4DJEA 3RCNA 3HG2A 2VEPA 3IARA 5HPCA 2RKXA 3W29A 4E3VA 1XLAA 4MWAE 4DF0A 3CWOX 1YDNA 3NQ6A 3W1PA 2VX7A 2DZBA 2I5IA 2YLLA 4M24A 2JK2A 3PWAA 4AZ6A 1A3HA 1ZENA 2OQLA 2ZDRA 1SFSA 4M56A 2WNWA 2EQDA 1Y65A 1JZ7A 3G1DA 9XIAA 4NSBA 1QVBA 2J7BA 2WHMA 4PRRA 5K4XA 4E8GA 4BA0A 2Y5JA 1OEPA 4N6FA 2VZVA 3BCDA 5FL0A 3H2EA 2QVNA 1WNOA 4YYFA 1PCKA 1LBFA 1HF6A 4Y9AA 4ERGA 1W5QA 3OVRA 5CGQA 1WDPA 3ID7A 1Q7QA 2BHYA 3ABQA 1OFAA 3LPFA 4JQ2A 5B7ZA 3C0LA 4KW2A 4NI3A 1QPOA 4YCOA 1MDLA 3M6YA 4YWIA 3CQ0A 1LYXA 2D23A 4LNCA 4H9YA 1FDYA 1UASA 3FS2A 4Y2WA 2YFNA 3BW4A 1VJZA 1X8CA 2FDMA 1ICQA 2BODX 5E70A 3STEA 2DORA 3EX2A 1V6YA 3EDFA 1ZUAX 3ZR5A 1LCOA 2FKPA 1TZZA 4CN1A 3AXKA 5G2WA 1W3NA 4QR6A 3QH2A 3UWYA 1QI5A 2J25A 3C8FA 3H24A 3WLLA 3UXIA 5DBTA 1ZALA 1I4NA 1UR0A 2OZ3A 3UQNA 1FCVA 4QG8A 1W5NA 1V08A 3R94A 1A0EA 4NIRA 3AWOA 4GOAA 1V77A 4JQAA 2W3ZA 5CPLA 5IDZA 3WLOA 4NAEA 4J3TA 1A5OC 3RIKA 1R85A 1RALA 4X2PA 2D2HA 3O1NA 3V36A 3C3NA 1M7PA 4JTUA 2P1FA 2D24A 3PM6A 2J13A 3QZ6A 1J10A 3RFAA 5I3DA 3PG8A 1XGEA 1QW8A 4HGXA 1W32A 4IGNA 4UTTC 2QYGA 3OLIA 2J6XA 3PAJA 5ECVA 5LNSA 4MSSA 3U0HA 1I60A 4WOQA 4EPEC 3HFTA 3W38A 2I16A 2WCSA 1VP5A 3OO2A 3AQUA 1H09A 2DPEA 3CZKA 1K8YA 4GIAA 2PDHA 2R82A 2ZTJA 2VR2A 3G1AA 1XDMA 1UJPA 1SW0A 1TPB1 3WLJA 4IXXA 1L8NA 1F05A 4PUJA 5M03A 4A29A 1PPIA 1ITXA 1S2TA 1R30A 1I2OA 3FDGA 2ZUUA 1UG6A 3IJ6A 5EB8A 3GIPA 2CBIA 2V81A 3PN8A 4PE8A 3ITOA 3RMJA 1EYWA 3WDQA 4O1DA 2H6RA 1HJVA 1HJXA 5D2YA 3CYJA 4J4KA 1C7SA 3NYDA 1IR1A 3QOKA 2OPJA 3BC9A 4BQ3A 1IT0A 5AHLA 1OINA 2OYMA 4BF9A 2HJPA 4JTSA 2GGEA 2X0HA 4LC8A 3CMGA 4GVFA 1PVNA 2ZUVA 3WQOA 3NO5A 2WLYA 1BXCA 3MUAA 1DVJA 2OKOA 5FEWA 3SBFA 1C8YA 1Z44A 2DZPA 4AIUA 4CKQA 5LNWA 1SW7A 1WAUA 3DG7A 1SZRA 1UZDA 4AHPA 3AC0A 4AQLA 5CC3A 2RDXA 1PCWA 5C8BB 3CHCA 6TAAA 1K7EA 4JN8A 1AW2A 1A5BA 4RR4A 2QJGA 4ALDA 2YXGA 4R7OA 3W73A 3KRZA 3WD0A 3H22A 2NV1A 1U2YA 1XRVA 3IK2A 1Z9AA 4FS9A 3ISIX 1XIEA 1KQZA 4DBDA 2WB5A 4LYRA 2A7PA 4HOZA 1Z3NA 3GWQA 2PE4A 1GJUA 1B9BA 3HGOA 2HVNA 4O11A 3MT1A 2X2GA 4Q7IA 3GZAA 3MCNA 5J8LA 1QWGA 3VOHA 4HU4A 1JRCA 4KRZA 3G6MA 1GOMA 1WKFA 1UP0A 1GOIA 4YU1A 1VQTA 1GUVA 1R2TA 4GISA 4NJIA 3BXWA 1PV8A 2OSWA 2FTWA 1RJQA 3LZ3A 2YR1A 4ZENA 2ZOXA 2ZFAA 4W8BA 2WMFA 5D9NA 2V63A 5F2MA 4OBRA 1LUCA 3GXFA 4QITA 2A85A 3TW7A 4B2DD 5HWNA 4QJ5B 2X1IA 5AYXA 3HN3A 4ZVJA 4A4AA 3OGSA 3PTKA 3VMPA 4Y9OA 4K1GA 1M7XA 1V79A 4NZCA 3UR8A 3DHDA 4PN2A 3INPA 4JQ1A 1GGOA 1S2UA 4NX0A 4LUSB 3WO8A 3B8TA 3ITLA 3MUXA 1O5XA 2UV8G 1UMYA 4YL2A 2V5BA 4OOUA 5C9UA 2IPJA 3K46A 4KFNA 2W6RA 4ROQA 5ABFA 4C6NA 4GXPA 1EDGA 1G4EA 6ALDA 5AVHA 1UA7A 3PZIA 1XLDA 3LBOA 4CQCA 3UNTA 3VKAA 4HPJA