3PVHA

Structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKLRLNFITVRKLTSKADAFEYADQVLEKWYPSIEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional assays of AtTLP18.3 identify its novel acid phosphatase activity in thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords UPF0603 protein At1g54780, chloroplastic
total genus 57
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3pvhA00
2MPBA 3PTJA 4OA3A 2LT2A 3PW9A 5ANPA 3PVHA 2KW7A 2KPTA
chains in the Genus database with same CATH superfamily
1GQZA 1SDJA 3G98A 4IJZA 5HA4A 1BWZA 4JCIA 5M47A 1K23A 2GKEA 1I74A 1XUBA 1YM5A 4J9XA 2HAWA 2QB8A 3WQZA 2Q9JA 1TM0A 4K7XA 2QB6A 4Q2HA 1S7JA 3PVHA 3EJXA 2PW0A 5ANPA 1W61A 1XUAA 4PY9A 3EDNA 2Q9HA 3FVEA 3DEVA 3G7KA 3PTJA 1W62A 4LS9A 2ZXPA 4LG3A 2KPTA 2MPBA 5IWEA 4K8LA 4LB0A 5H2GA 2GKJA 4J9WA 2AZPA 1T6KA 1QY9A 2EB0A 4DUNA 3IGHX 4JBDA 5H2YA 2IW4A 1U1WA 2ZVFA 4GL6A 1IR6A 4OA3A 2OTNA 4Q60A 1U1XA 2ZXRA 4RPAA 1U0KA 4JUUA 1WPMA 3EKMA 3ICJA 3W5WA 2H9FA 2QB7A 1QYAA 2ZXOA 1K20A 1WPPA 2ENXA 2PVZA 2KW7A 4K7GB 2YMAA 1U1VA 2LT2A 3PW9A 4JD7A 4IK0A
chains in the Genus database with same CATH topology
1GQZA 1SDJA 3G98A 4IJZA 5HA4A 1BWZA 4JCIA 5M47A 1K23A 2GKEA 1I74A 1XUBA 1YM5A 4J9XA 2HAWA 2QB8A 3WQZA 2Q9JA 1TM0A 4K7XA 2QB6A 4Q2HA 1S7JA 3PVHA 3EJXA 2PW0A 5ANPA 1W61A 1XUAA 4PY9A 3EDNA 2Q9HA 3FVEA 3DEVA 3G7KA 3PTJA 1W62A 4LS9A 2ZXPA 4LG3A 2KPTA 2MPBA 5IWEA 4K8LA 4LB0A 5H2GA 2GKJA 4J9WA 2AZPA 1T6KA 1QY9A 2EB0A 4DUNA 3IGHX 4JBDA 5H2YA 2IW4A 1U1WA 2ZVFA 4GL6A 1IR6A 4OA3A 2OTNA 4Q60A 1U1XA 2ZXRA 4RPAA 1U0KA 4JUUA 1WPMA 3EKMA 3ICJA 3W5WA 2H9FA 2QB7A 1QYAA 2ZXOA 1K20A 1WPPA 2ENXA 2PVZA 2KW7A 4K7GB 2YMAA 1U1VA 2LT2A 3PW9A 4JD7A 4IK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPB A;  3PTJ A;  4OA3 A;  2LT2 A;  3PW9 A;  5ANP A;  3PVH A;  2KW7 A;  2KPT A; 
#chains in the Genus database with same CATH topology
 1GQZ A;  1SDJ A;  3G98 A;  4IJZ A;  5HA4 A;  1BWZ A;  4JCI A;  5M47 A;  1K23 A;  2GKE A;  1I74 A;  1XUB A;  1YM5 A;  4J9X A;  2HAW A;  2QB8 A;  3WQZ A;  2Q9J A;  1TM0 A;  4K7X A;  2QB6 A;  4Q2H A;  1S7J A;  3PVH A;  3EJX A;  2PW0 A;  5ANP A;  1W61 A;  1XUA A;  4PY9 A;  3EDN A;  2Q9H A;  3FVE A;  3DEV A;  3G7K A;  3PTJ A;  1W62 A;  4LS9 A;  2ZXP A;  4LG3 A;  2KPT A;  2MPB A;  5IWE A;  4K8L A;  4LB0 A;  5H2G A;  2GKJ A;  4J9W A;  2AZP A;  1T6K A;  1QY9 A;  2EB0 A;  4DUN A;  3IGH X;  4JBD A;  5H2Y A;  2IW4 A;  1U1W A;  2ZVF A;  4GL6 A;  1IR6 A;  4OA3 A;  2OTN A;  4Q60 A;  1U1X A;  2ZXR A;  4RPA A;  1U0K A;  4JUU A;  1WPM A;  3EKM A;  3ICJ A;  3W5W A;  2H9F A;  2QB7 A;  1QYA A;  2ZXO A;  1K20 A;  1WPP A;  2ENX A;  2PVZ A;  2KW7 A;  4K7G B;  2YMA A;  1U1V A;  2LT2 A;  3PW9 A;  4JD7 A;  4IK0 A; 
#chains in the Genus database with same CATH homology
 1GQZ A;  1SDJ A;  3G98 A;  4IJZ A;  5HA4 A;  1BWZ A;  4JCI A;  5M47 A;  1K23 A;  2GKE A;  1I74 A;  1XUB A;  1YM5 A;  4J9X A;  2HAW A;  2QB8 A;  3WQZ A;  2Q9J A;  1TM0 A;  4K7X A;  2QB6 A;  4Q2H A;  1S7J A;  3PVH A;  3EJX A;  2PW0 A;  5ANP A;  1W61 A;  1XUA A;  4PY9 A;  3EDN A;  2Q9H A;  3FVE A;  3DEV A;  3G7K A;  3PTJ A;  1W62 A;  4LS9 A;  2ZXP A;  4LG3 A;  2KPT A;  2MPB A;  5IWE A;  4K8L A;  4LB0 A;  5H2G A;  2GKJ A;  4J9W A;  2AZP A;  1T6K A;  1QY9 A;  2EB0 A;  4DUN A;  3IGH X;  4JBD A;  5H2Y A;  2IW4 A;  1U1W A;  2ZVF A;  4GL6 A;  1IR6 A;  4OA3 A;  2OTN A;  4Q60 A;  1U1X A;  2ZXR A;  4RPA A;  1U0K A;  4JUU A;  1WPM A;  3EKM A;  3ICJ A;  3W5W A;  2H9F A;  2QB7 A;  1QYA A;  2ZXO A;  1K20 A;  1WPP A;  2ENX A;  2PVZ A;  2KW7 A;  4K7G B;  2YMA A;  1U1V A;  2LT2 A;  3PW9 A;  4JD7 A;  4IK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...