3PVHA

Structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
b'SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKLRLNFITVRKLTSKADAFEYADQVLEKWYPSIEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0603 protein At1g54780, chloroplastic
publication title Structural and functional assays of AtTLP18.3 identify its novel acid phosphatase activity in thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 57
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3pvhA00
2KW7A 3PVHA 3PW9A 2KPTA 2MPBA 5ANPA 2LT2A 4OA3A 3PTJA
chains in the Genus database with same CATH superfamily
3PVHA 4LS9A 2AZPA 5IWEA 1XUBA 3EJXA 4IJZA 1SDJA 4JBDA 4LG3A 1YM5A 4JUUA 2OTNA 3ICJA 1WPPA 2MPBA 4J9WA 2QB8A 3IGHX 1U1WA 1WPMA 1QY9A 3W5WA 1S7JA 1U1XA 1K20A 4J9XA 2GKJA 4DUNA 2ZXRA 3PW9A 4Q2HA 2Q9JA 4PY9A 4LB0A 2EB0A 2KW7A 1U0KA 4K7XA 5HA4A 1W61A 1T6KA 4K8LA 4OA3A 3G7KA 2Q9HA 3PTJA 4RPAA 3G98A 2YMAA 1K23A 4JD7A 2HAWA 3FVEA 2KPTA 1W62A 4Q60A 1QYAA 1BWZA 2H9FA 3DEVA 2ZXOA 2GKEA 5H2YA 5H2GA 4GL6A 2PVZA 2ZXPA 1XUAA 4K7GB 1TM0A 5ANPA 2LT2A 4JCIA 1GQZA 2IW4A 2QB7A 3EDNA 2ZVFA 1IR6A 2ENXA 3WQZA 2QB6A 5M47A 4IK0A 2PW0A 1I74A 1U1VA 3EKMA
chains in the Genus database with same CATH topology
3PVHA 4LS9A 2AZPA 5IWEA 1XUBA 3EJXA 4IJZA 1SDJA 4JBDA 4LG3A 1YM5A 4JUUA 2OTNA 3ICJA 1WPPA 2MPBA 4J9WA 2QB8A 3IGHX 1U1WA 1WPMA 1QY9A 3W5WA 1S7JA 1U1XA 1K20A 4J9XA 2GKJA 4DUNA 2ZXRA 3PW9A 4Q2HA 2Q9JA 4PY9A 4LB0A 2EB0A 2KW7A 1U0KA 4K7XA 5HA4A 1W61A 1T6KA 4K8LA 4OA3A 3G7KA 2Q9HA 3PTJA 4RPAA 3G98A 2YMAA 1K23A 4JD7A 2HAWA 3FVEA 2KPTA 1W62A 4Q60A 1QYAA 1BWZA 2H9FA 3DEVA 2ZXOA 2GKEA 5H2YA 5H2GA 4GL6A 2PVZA 2ZXPA 1XUAA 4K7GB 1TM0A 5ANPA 2LT2A 4JCIA 1GQZA 2IW4A 2QB7A 3EDNA 2ZVFA 1IR6A 2ENXA 3WQZA 2QB6A 5M47A 4IK0A 2PW0A 1I74A 1U1VA 3EKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW7 A;  3PVH A;  3PW9 A;  2KPT A;  2MPB A;  5ANP A;  2LT2 A;  4OA3 A;  3PTJ A; 
#chains in the Genus database with same CATH topology
 3PVH A;  4LS9 A;  2AZP A;  5IWE A;  1XUB A;  3EJX A;  4IJZ A;  1SDJ A;  4JBD A;  4LG3 A;  1YM5 A;  4JUU A;  2OTN A;  3ICJ A;  1WPP A;  2MPB A;  4J9W A;  2QB8 A;  3IGH X;  1U1W A;  1WPM A;  1QY9 A;  3W5W A;  1S7J A;  1U1X A;  1K20 A;  4J9X A;  2GKJ A;  4DUN A;  2ZXR A;  3PW9 A;  4Q2H A;  2Q9J A;  4PY9 A;  4LB0 A;  2EB0 A;  2KW7 A;  1U0K A;  4K7X A;  5HA4 A;  1W61 A;  1T6K A;  4K8L A;  4OA3 A;  3G7K A;  2Q9H A;  3PTJ A;  4RPA A;  3G98 A;  2YMA A;  1K23 A;  4JD7 A;  2HAW A;  3FVE A;  2KPT A;  1W62 A;  4Q60 A;  1QYA A;  1BWZ A;  2H9F A;  3DEV A;  2ZXO A;  2GKE A;  5H2Y A;  5H2G A;  4GL6 A;  2PVZ A;  2ZXP A;  1XUA A;  4K7G B;  1TM0 A;  5ANP A;  2LT2 A;  4JCI A;  1GQZ A;  2IW4 A;  2QB7 A;  3EDN A;  2ZVF A;  1IR6 A;  2ENX A;  3WQZ A;  2QB6 A;  5M47 A;  4IK0 A;  2PW0 A;  1I74 A;  1U1V A;  3EKM A; 
#chains in the Genus database with same CATH homology
 3PVH A;  4LS9 A;  2AZP A;  5IWE A;  1XUB A;  3EJX A;  4IJZ A;  1SDJ A;  4JBD A;  4LG3 A;  1YM5 A;  4JUU A;  2OTN A;  3ICJ A;  1WPP A;  2MPB A;  4J9W A;  2QB8 A;  3IGH X;  1U1W A;  1WPM A;  1QY9 A;  3W5W A;  1S7J A;  1U1X A;  1K20 A;  4J9X A;  2GKJ A;  4DUN A;  2ZXR A;  3PW9 A;  4Q2H A;  2Q9J A;  4PY9 A;  4LB0 A;  2EB0 A;  2KW7 A;  1U0K A;  4K7X A;  5HA4 A;  1W61 A;  1T6K A;  4K8L A;  4OA3 A;  3G7K A;  2Q9H A;  3PTJ A;  4RPA A;  3G98 A;  2YMA A;  1K23 A;  4JD7 A;  2HAW A;  3FVE A;  2KPT A;  1W62 A;  4Q60 A;  1QYA A;  1BWZ A;  2H9F A;  3DEV A;  2ZXO A;  2GKE A;  5H2Y A;  5H2G A;  4GL6 A;  2PVZ A;  2ZXP A;  1XUA A;  4K7G B;  1TM0 A;  5ANP A;  2LT2 A;  4JCI A;  1GQZ A;  2IW4 A;  2QB7 A;  3EDN A;  2ZVF A;  1IR6 A;  2ENX A;  3WQZ A;  2QB6 A;  5M47 A;  4IK0 A;  2PW0 A;  1I74 A;  1U1V A;  3EKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...