3PVHA

Structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKLRLNFITVRKLTSKADAFEYADQVLEKWYPSIEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional assays of AtTLP18.3 identify its novel acid phosphatase activity in thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords UPF0603 protein At1g54780, chloroplastic
total genus 57
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3pvhA00
3PVHA 3PTJA 3PW9A 5ANPA 2KPTA 2MPBA 2LT2A 2KW7A 4OA3A
chains in the Genus database with same CATH superfamily
1K23A 2QB6A 4LB0A 4PY9A 4DUNA 1SDJA 1XUAA 3WQZA 5H2GA 4K7GB 4GL6A 3EJXA 1XUBA 1I74A 1W61A 3PVHA 4JCIA 2EB0A 2AZPA 1U0KA 1QY9A 5HA4A 1GQZA 1TM0A 3FVEA 5ANPA 2KPTA 1S7JA 2KW7A 3G98A 4IJZA 3PTJA 3W5WA 4J9WA 2QB8A 4J9XA 1T6KA 1WPMA 4Q60A 4IK0A 2ZXRA 3IGHX 3DEVA 2OTNA 5H2YA 2Q9HA 4LS9A 4JD7A 2HAWA 4JUUA 2ZVFA 3PW9A 2ENXA 2LT2A 4K7XA 2Q9JA 1K20A 1WPPA 2ZXOA 3EKMA 2MPBA 1YM5A 4OA3A 2GKEA 3G7KA 1W62A 4Q2HA 1BWZA 1IR6A 2PW0A 2QB7A 3EDNA 4JBDA 2PVZA 4LG3A 5IWEA 2GKJA 2IW4A 1U1WA 1U1XA 1QYAA 2H9FA 4K8LA 1U1VA 2YMAA 3ICJA 4RPAA 5M47A 2ZXPA
chains in the Genus database with same CATH topology
1K23A 2QB6A 4LB0A 4PY9A 4DUNA 1SDJA 1XUAA 3WQZA 5H2GA 4K7GB 4GL6A 3EJXA 1XUBA 1I74A 1W61A 3PVHA 4JCIA 2EB0A 2AZPA 1U0KA 1QY9A 5HA4A 1GQZA 1TM0A 3FVEA 5ANPA 2KPTA 1S7JA 2KW7A 3G98A 4IJZA 3PTJA 3W5WA 4J9WA 2QB8A 4J9XA 1T6KA 1WPMA 4Q60A 4IK0A 2ZXRA 3IGHX 3DEVA 2OTNA 5H2YA 2Q9HA 4LS9A 4JD7A 2HAWA 4JUUA 2ZVFA 3PW9A 2ENXA 2LT2A 4K7XA 2Q9JA 1K20A 1WPPA 2ZXOA 3EKMA 2MPBA 1YM5A 4OA3A 2GKEA 3G7KA 1W62A 4Q2HA 1BWZA 1IR6A 2PW0A 2QB7A 3EDNA 4JBDA 2PVZA 4LG3A 5IWEA 2GKJA 2IW4A 1U1WA 1U1XA 1QYAA 2H9FA 4K8LA 1U1VA 2YMAA 3ICJA 4RPAA 5M47A 2ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVH A;  3PTJ A;  3PW9 A;  5ANP A;  2KPT A;  2MPB A;  2LT2 A;  2KW7 A;  4OA3 A; 
#chains in the Genus database with same CATH topology
 1K23 A;  2QB6 A;  4LB0 A;  4PY9 A;  4DUN A;  1SDJ A;  1XUA A;  3WQZ A;  5H2G A;  4K7G B;  4GL6 A;  3EJX A;  1XUB A;  1I74 A;  1W61 A;  3PVH A;  4JCI A;  2EB0 A;  2AZP A;  1U0K A;  1QY9 A;  5HA4 A;  1GQZ A;  1TM0 A;  3FVE A;  5ANP A;  2KPT A;  1S7J A;  2KW7 A;  3G98 A;  4IJZ A;  3PTJ A;  3W5W A;  4J9W A;  2QB8 A;  4J9X A;  1T6K A;  1WPM A;  4Q60 A;  4IK0 A;  2ZXR A;  3IGH X;  3DEV A;  2OTN A;  5H2Y A;  2Q9H A;  4LS9 A;  4JD7 A;  2HAW A;  4JUU A;  2ZVF A;  3PW9 A;  2ENX A;  2LT2 A;  4K7X A;  2Q9J A;  1K20 A;  1WPP A;  2ZXO A;  3EKM A;  2MPB A;  1YM5 A;  4OA3 A;  2GKE A;  3G7K A;  1W62 A;  4Q2H A;  1BWZ A;  1IR6 A;  2PW0 A;  2QB7 A;  3EDN A;  4JBD A;  2PVZ A;  4LG3 A;  5IWE A;  2GKJ A;  2IW4 A;  1U1W A;  1U1X A;  1QYA A;  2H9F A;  4K8L A;  1U1V A;  2YMA A;  3ICJ A;  4RPA A;  5M47 A;  2ZXP A; 
#chains in the Genus database with same CATH homology
 1K23 A;  2QB6 A;  4LB0 A;  4PY9 A;  4DUN A;  1SDJ A;  1XUA A;  3WQZ A;  5H2G A;  4K7G B;  4GL6 A;  3EJX A;  1XUB A;  1I74 A;  1W61 A;  3PVH A;  4JCI A;  2EB0 A;  2AZP A;  1U0K A;  1QY9 A;  5HA4 A;  1GQZ A;  1TM0 A;  3FVE A;  5ANP A;  2KPT A;  1S7J A;  2KW7 A;  3G98 A;  4IJZ A;  3PTJ A;  3W5W A;  4J9W A;  2QB8 A;  4J9X A;  1T6K A;  1WPM A;  4Q60 A;  4IK0 A;  2ZXR A;  3IGH X;  3DEV A;  2OTN A;  5H2Y A;  2Q9H A;  4LS9 A;  4JD7 A;  2HAW A;  4JUU A;  2ZVF A;  3PW9 A;  2ENX A;  2LT2 A;  4K7X A;  2Q9J A;  1K20 A;  1WPP A;  2ZXO A;  3EKM A;  2MPB A;  1YM5 A;  4OA3 A;  2GKE A;  3G7K A;  1W62 A;  4Q2H A;  1BWZ A;  1IR6 A;  2PW0 A;  2QB7 A;  3EDN A;  4JBD A;  2PVZ A;  4LG3 A;  5IWE A;  2GKJ A;  2IW4 A;  1U1W A;  1U1X A;  1QYA A;  2H9F A;  4K8L A;  1U1V A;  2YMA A;  3ICJ A;  4RPA A;  5M47 A;  2ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...