3PVQA

Crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
297
structure length
295
Chain Sequence
AYGVVHISVCNMRDEGKFTSGMSTQALLGMPVKVLQYTGWYEIQTPDDYTGWVHRMVITPMSKEKYDEWNRAEKIVVTSHYGFTYEKPDDDSQTVSDVVAGNRLKWEGSKGHFYKVSYPDGRQAYISRHISQPESKWRASLKQDAESIIKTAYTMIGIPYLWAGTSSKGVDSGLVRTVLFMHDIIIPRDASQQAYVGERIEIAPDFSNVQRGDLVFFGRKATADRKEGISHVGIYLGNKRFIHALGDVHISSFDPEDEYDEFNTGRLLFATRFLPYINKEKGMNTTDHNLYYLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Dipeptidyl-peptidase VI
total genus 82
structure length 295
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3pvqA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3pvqA02
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 3pvqA03
1K9AA 4HZBA 3U23A 2LNHB 3I5RA 4HPEA 1AVZC 1X6BA 1K0XA 1KFZA 1FMKA 1NM7A 2CSIA 1H3HA 1RLPC 1X2QA 4F14A 1U3OA 2K2MA 4KRTA 2CDTA 2MIOA 3EG0A 3VRYA 2ECZA 1WDXA 1SEMA 1PKSA 2D1XA 5ECAA 1OPLA 1WLPB 2IO7A 2L2PA 1E7OA 3H41A 3PVLA 1NYFA 3VS7A 4F17A 2IOBA 4CT3A 2VKNA 2ESWA 3QWXX 2RNAA 3M0SA 4J9CA 4X1VA 2V1QA 1VYVA 4RUGA 3IQLA 4RTUA 1NEGA 1UHFA 2EYXA 2RQRA 3M1UA 3M0RA 2EKHA 4QT7A 4E6RA 2HCKA 4WCIA 2FPFA 1M3AA 2EBPA 1M3CA 5IHNA 2FRWA 4CGKA 1TUCA 2DBMA 1YCSB 4F0WA 1UDLA 2IOAA 2HEQA 1GFCA 1X69A 4GBQA 4JZ3A 2DL7A 2PTKA 2ABLA 2EVRA 4FGEA 1HSQA 5IXFA 2JMAA 1M8MA 3RBBB 3UATA 2RPNA 2GTJA 1AWOA 1VYTA 3LH5A 4CC3A 4OMMA 1N5ZA 4Y92A 3R6NA 4AG2C 2YDLA 2YUPA 1NEBA 2M0YA 3EG3A 3H0FA 4J9IA 4R0KA 2PNIA 4IIOA 3I9QA 4EIKA 1ZUYA 4JJBA 3KW0A 1UJ0A 1FYNA 5GJWB 1RLQC 4Q4TA 1E6HA 1JXOA 1PNJA 2KNBB 2YUQA 1MV0B 2FPEA 2DMOA 4AFSC 2VWFA 4OMQA 2FEIA 2DNUA 1M27C 1NG2A 4OMLA 4RTVA 1GFDA 1ZSGA 1ZX6A 4RTTA 3VS0A 2L0AA 1K0SA 1CKBA 1W70A 1ZUKA 2SEMA 2K79A 2CUDA 1TG0A 1RI9A 2ROLA 4CSHA 2ED0A 4FSSA 2ENMA 3NE0A 4LE9A 4OMNA 4EQ8A 1BBZA 2C0OA 1UECA 1RUWA 4RTYA 4LN2A 3M0UA 1AWXA 2YSQA 3JV3A 4M4ZA 2MCNA 3VS1A 1UTIA 1JEGA 3UF4A 4F0VA 5EC7A 2L3QA 4HVVA 2LJ0A 2KBTA 1E6GA 2QDLA 2JMCA 5IHIA 2O9SA 4CC2A 4A63B 2DLPA 1QCFA 5FW9A 3RNJA 2C0IA 2LJ1A 5I11A 2B86A 1GCQC 4AG1C 4OMOA 1OPKA 2O9VA 3VPJA 3VS3A 2DM1A 1PKTA 2RQWA 2OJ2A 1GBRA 1PRLC 1I1JA 5FWCA 3H0IA 3TVTA 1QWFA 2GNCA 1WX6A 2KXDA 3UA7A 1WFWA 1OEBA 1SRMA 3NPFA 2KRNA 2RQUA 1X27A 2LX7A 2DRKA 3SEMA 1HD3A 1ZUUA 2A36A 4FGDA 2SRCA 2AK5A 1YWPA 4J9GA 1ARKA 2VPSA 2EGAA 1KIKA 3H0HA 3EG2A 3SHWA 2DE0X 2DF6A 2PZ1A 1T0JA 4LNPA 3TSWA 1JXMA 1AWWA 1JO8A 1AD5A 2K6DA 4IIMA 2LQNA 1WXBA 2EPDA 4J9BA 1UE9A 2D8HA 1M30A 2K9GA 2KT1A 2G6FX 2JXBA 1ZBJA 1LCKA 2JW4A 4FQAA 4JXBA 5FWBA 3ULRB 4OLKA 2RQVA 2GBQA 1Z9QA 2GTOA 5GJVB 1ABQA 2X3WD 4LJ1A 2J05A 1OOTA 4D8DA 1OV3A 2LMJA 2W10A 1QKWA 4FGIA 1K76A 1EFNA 1B07A 2C0TA 1U06A 2RQTA 4Q4GX 1AZEA 1YP5A 1SSHA 1S1NA 2E5KA 4J9HA 4Q4NA 2KRMA 1G83A 2KROA 1TUDA 3S0QA 4LUEA 1WYXA 2EYWA 2ED1A 3FJ5A 1PRMC 2P4RA 4FDYA 1KJWA 3I35A 2CT4A 1CKAA 4DEXA 2EQIA 2F2XA 2NUZA 2D0NA 2A08A 1AEYA 1GCQA 3TSZA 1B3QA 1WI7A 1QLYA 3PBIA 2IO9A 1IO6A 2IF6A 1QKXA 1I07A 3CQTA 1SPKA 3PE0A 4OMPA 4HCKA 1XOVA 3A30A 2J6KA 2AZVA 5HCKA 4J9DA 1UFFA 1WXUA 1T3LA 4CC4B 1WXTA 1ABOA 4F4MA 2VVKA 2RN8A 3EGUA 3NMZC 4J9EA 3REAB 2O31A 3VS4A 3C0CA 2EGEA 1VA7A 2DA9A 2JT4A 3I5SA 4CC7A 4RTWA 1PWTA 2HSPA 2EGCA 2FO0A 1Y0MA 2BZ8A 1Y57A 1AOJA 1V1CA 1AZGB 2JS2A 4FQBA 1JQQA 2KYMA 3VS6A 3M0PA 4D8KA 2VOBA 1X2KA 3GBQA 1BK2A 2ROTA 1CSKA 2CT3A 3ZL7C 1KSWA 4ZNXA 4ESRA 2BZYA 4HZ9A 2XMFA 3EG1A 2DJQA 3A98A 1H8KA 2JM8A 1ZLMA 1YWOA 4EQAA 2J7IA 5L23A 3REBB 1UJYA 2KR3A 2A28A 1HJDA 2LCSA 1GL5A 4AFZC 1YNZA 4AFQC 2M51A 2KEAA 3VPIA 2W0ZA 4JJCA 2H8HA 1UGVA 2KYBA 2F2VA 2K3AA 1MV3A 5IHKA 1GBQA 2DBKA 2KT8A 1AWJA 2IO8A 3GT2A 4RTXA 3A2YA 2CREA 4JJDA 3THKA 2A37A 1K4US 1WA7A 1QWEA 2AKLA 3VRZA 1YN8A 2EYZA 1SHFA 2I0NA 2DVJA 1W6XA 3I86A 2YT6A 1A0NB 1U5SA 1JU5C 2F2WA 4HVWA 4F16A 1X43A 2MOXA 4AFUC 2RF0A 4JZ4A 2DL8A 4JPBW 1X6GA 2K7AA 2DRMA 1T0HA 2EYYA 3EHRA 3PVQA 4HXJA 3A2ZA 2DILA 3NHNA 1SRLA 2DL5A 1BU1A 2JM9A 5I22A 4ORZA 2O2OA 2DL3A 4GLMA 2JS0A 2OI3A 3M0QA 2GGRA 2KRSA 2CSQA 2K1GA 2DX1A 3VS5A 4LUDA 1Z9ZA 2LQWA 3EHQA 1H92A 2HDAA 1GRIA 1UG1A 2DYBA 2BTTA 2KE9A 4RTZA 2NWMA 1I0CA 3O98A 2CH4A 2L3SA 4EOBA 2IIMA 3M0TA 1M3BA 2J06A 2GQIA 2L3PA 1G2BA 1K1ZA 2XIVA 3UA6A 1UUEA 1UHCA 2KXCA 2RMOA 1PHTA 1WIEA 1W1FA 2CH4W 2D8JA 2J6FA 1T3SA 1J3TA 4Z8AA 2LP5A 2LJ3A 2OAWA 4Z88A 2JTEA 1SHGA 4Z89A 3O5ZA 2VPMA 4K11A 3KFVA 2LZ6B 1BB9A 2K3BA 2BZXA 2AKKA 1NLOC 2J6OA 2YUOA 2AZSA 2FRYA 4HVUA 2FPDA 2YUNA 5IH2A 2DL4A 3QWYA 5IXBA 1NYGA 2HBWA 2EW3A 2V1RA 3PBCA 3NGPA 2LRJA 2CUBA 1GCPA 1NLPC 1VYUA 3VS2A 2O88A 2X3XD 4DEYA 2FG0A 4J9FA 2KGTA 1MUZA
chains in the Genus database with same CATH superfamily
2M9UA 1K9AA 3U23A 3I5RA 2HZYA 4HPEA 4AT1B 1AVZC 1PSFA 3A8HB 5IN1A 1X6BA 2X4WA 1FMKA 2MYSA 1NM7A 1VQ8Q 2E3IA 4JLIA 5GANh 1X2QA 1RABB 1U3OA 2K2MA 1VQNQ 5FROA 2CDTA 5C0MA 2CZ0B 3RMSA 1KQ1A 1SEMA 1Y96A 1PKSA 1PD1A 1WLPB 5ECAA 4FT4A 4ZGDB 1E7OA 4BY6B 4F17A 4F7UB 3OYDA 3V8JA 2OTLA 2QTVA 4OB0B 1O75A 2RNAA 4J9CA 3VYGA 1IZ6A 3G71A 2R5AA 1KQSP 1VYVA 4RUGA 4RTUA 3HHTB 2DD4A 2O4XB 2YLCA 3CCLT 3JCMV 4XK8E 1M3CA 5KYXA 2P0QA 4X34A 5GANj 5HKCA 5GAN2 4CGKA 2DK3A 3I55Q 2IOAA 4GBQA 4JZ3A 2JTMA 2DL7A 2PTKA 4JS5A 5IXFA 3CCJA 2Y4YA 3EAEA 5GAN4 3CC7T 2NUTB 4KT0E 2JMAA 4J6YA 3L2RA 2GTJA 3JCMQ 2LX9A 3V8LA 3KXTA 1LOJA 1OU9A 4GLKA 3JCMh 5CIUA 3RERA 1N5ZA 1MNEA 1VQ5T 3FIFA 4AG2C 2LC4A 3RKXA 3HTRA 4KBMB 4XQ3A 4R0KA 2PNIA 2OTLQ 3I9QA 3V8KA 4EIKA 5GAN8 2KDSA 5GAMj 1UGQB 1FYNA 2E41A 5GJWB 4FYXB 4BI4A 5CR2A 4IKFA 1RLQC 2F5KA 4Q4TA 1K8AU 3DB4A 2K2VA 4EMKA 3A8OB 1Q82R 3O8VA 5GMKi 2KNBB 4FU6A 3NTKA 3OW2A 2X51A 1M90R 3T9NA 2JN0A 5CKHA 1IB8A 3CCUA 4OMLA 4ZN3A 4C8QG 1ZSGA 1ZX6A 2RO0A 1UB4A 1WJRA 1YI2Q 2RH2A 1M4ZA 1CKBA 1G3YA 2L5QA 1VQ9Q 3ZFJA 4QKUA 1ZUKA 1YJNT 2SEMA 5LJ5d 3CBOA 3A8GB 3VYHB 1QMCA 3OYIA 4FSSA 1VQ8T 3RKWA 3CC2A 1UGRB 3GLXA 1SF9A 3CCRQ 4HKEA 1VQKQ 4LN2A 3M0UA 2NYSA 3EGDB 4QVZA 3I56A 4M4ZA 5CVIA 2MCNA 2RB6A 4MMLA 1XJWB 1PSEA 1BIBA 3QG1A 4NL2A 5IHIA 4IUPA 3WVEB 1KK7A 2DLPA 3RR6A 3CCQQ 5FW9A 2QEXA 2CGHA 1R0BG 3QUIA 2C0IA 3G1JA 4PJOA 3CPWA 1GCQC 1VQNA 1KHIA 1Q86U 4OMOA 4KGVB 3VPJA 3PFSA 4QVDA 2OJ2A 1PRLC 2QQAA 2GNCA 1WX6A 2KXDA 1Q82C 2XK0A 2COZA 2Y90A 2KRNA 2RQUA 2HD0A 3C94A 2LX7A 4R55A 1ZUUA 4FGDA 2SRCA 2R5MA 1YWPA 3CC7Q 2VPSA 2EGAA 3OYFA 1KIKA 3H0HA 3KUFA 1X75C 2DF6A 3QDFA 3OBWA 5GANd 5AT1B 2E5QA 1T0JA 4LNPA 2DFUA 4C92C 4QVCA 1JXMA 1K9MR 3J80E 1JO8A 1VQ5A 5GAMh 2LQNA 2X9HA 2EPDA 2COYA 4HT8A 1M30A 2LQKA 2QGGA 3BDUA 2COWA 2O01E 4JXBA 1K9MU 1Y71A 1OX8A 3Q1JA 3ULRB 4OLKA 2D0QB 1Q81U 2GTOA 5GJVB 5KE3A 3WXMB 3OY9A 4LJ1A 2DIGA 3C95A 3QDRB 3OSSC 3LYIA 2W10A 4EMGA 5CK9A 1KC8C 2NUPB 4FGIA 1H3ZA 3S3NA 1EFNA 3P8DA 1TU0B 3HSBA 1YHQT 1U06A 2RQTA 4Q4GX 1YBYA 3G71Q 1SSHA 2E5KA 1VQMT 4BE2A 4PJJA 2RI2A 2BE9B 1RI0A 1YJNQ 2F69A 1HK9A 5CKFA 1CKAA 3LLRA 2QEXQ 1MNDA 3X20B 5LJ5h 1GCQA 4O5VA 3TSZA 3A8MB 4PK4A 3GOXA 4M78F 1KQ2A 3MP8A 1M1KU 7AT1B 3LW5E 4IUUA 3CCSQ 2RD1A 1QKXA 1I4K1 4MZMA 1RACB 4KH0B 4HCCA 3CCRA 3JCMW 4J9DA 1UFFA 5LJ5g 1PM3A 1WXUA 2HQHA 1WXTA 3GF5A 5CAIA 4JRKA 3E9FA 4M78E 2IG0A 2RN8A 3S3OA 2E6NA 2KK4A 3CCVQ 1M9SA 2C06A 4BB7A 2HKQB 4C92F 1M1FA 2EGCA 1IHVA 1OI1A 3RESA 2DAQA 4M7DF 4LDVA 1AOJA 1V1CA 1AZGB 2JS2A 2RHXA 4PJLA 3M0PA 2EJFA 2E70A 4ELZC 1X2KA 3GBQA 1BK2A 4TVRA 3M56A 4ZNXA 1M2VA 4ESRA 2VC8A 4FYVB 3CCEQ 3R6OA 1YWOA 3VUBA 3MHXA 3MKDA 1UJYA 4C8QC 2A28A 1YNZA 2HKNA 2MK5A 4C8QA 3VPIA 2GQVA 2KYBA 2CP7A 3AHUA 4NOYA 3G4SQ 1OYXA 2DBKA 3M4GA 3I56T 1AWJA 4N0AA 1QQJA 3GT2A 4E7KA 2X35A 2CREA 3THKA 4MDWA 2ZCFB 2A37A 3ME9A 3JB9G 2AKLA 1YN8A 5KH6A 4M75B 2DVJA 2RK1A 4PJOF 1U5SA 4JRIA 1UEBA 4LDYA 8AT1B 3OS2A 1X43A 2MOXA 4AFUC 4JZ4A 1RAEB 4M77G 1PG5B 1X6GA 4F04B 1VQ4A 1KQSS 3CC2Q 3A2ZA 2AHJB 2DL5A 1BU1A 2JM9A 3CCST 1W2BA 3MP1A 5GMKj 4GLMA 4HCBA 3S3MA 2RHIA 1VQOA 3FLGA 1VIEA 2DX1A 2LQWA 2HDAA 4BDZA 1UG1A 2DYBA 4D6WA 2NWMA 2YWWA 1I0CA 1ACMB 4OGEA 4DBFA 4KGXB 4JLGA 2QA4T 5CQXA 1OU8A 1K1ZA 1UUEA 3NFCA 2CH4W 4JS4A 1J3TA 3HP9A 4BUGA 1KD1U 4Z8AA 2LP5A 2QDYB 1YJWA 4A54A 4JRQA 2QQRA 3X25B 3H8ZA 1Q7YR 3V7CA 4HT9A 3M58A 3QO3A 3CMEA 1NYGA 4B6MA 1W4SA 3CMET 1VYUA 4R56A 4J7FA 2X3XD 1NPRA 2EYQA 2M1HA 3HKSA 2YXYA 1MUZA 2MF2A 4YTLA 2DZCA 3NTIA 2HAXA 5I2MA 5DM7R 1K0XA 2JOYA 3I55A 1VQ8A 4PJOD 1H3HA 1RLPC 2DIQA 2XU8A 3EG0A 1VQ9A 1R0CB 2D1XA 2IO7A 3M9QA 3H41A 3G7ZA 1BYMA 2ESWA 3JCMd 2HL3A 4KGZB 3E2UA 3E9GA 2EYXA 4JUVA 3M0RA 5KYWB 2K5IA 2HCKA 4M75D 5GAOm 2EWNA 2FPFA 3OYCA 2K5LA 1YHQQ 1FMWA 1YHQA 2EBPA 5IHNA 3CCVA 2ZPHB 3CCQA 2DBMA 2QEXT 2X4YA 1GFCA 1NBEB 1R8OB 3SWNA 1NZ9A 1I81A 3GNGA 2RI3A 3QYHB 1HSQA 1P92A 4M7DD 1W2BS 1AWOA 3JCMJ 2XICA 3M59A 2KSSA 3BFMA 4Y92A 2H3EB 5AYFA 2EFIA 1D0ZA 1M1GA 3SDZA 3EGXB 3M57A 2DKGA 1K9MC 2Y4XA 1NEBA 3RIRA 4LD6A 1YI2A 2EQUA 4J9IA 4DOWA 1ZUYA 4JJBA 1VQOT 4UC4A 5GAMg 2VXEA 3L2UA 1JXOA 1PNJA 3JCMb 2MAMA 1MV0B 1G3WA 2FPEA 3G6ET 1VQ7A 2DXUA 3OQ5A 5KYYB 2EIFA 3X24B 1G3TA 1TOVA 4XTWA 4RTVA 3OMCA 2P4TA 2DTIA 1GFDA 3C12A 4KH1B 4RTTA 2L0AA 1K0SA 1W70A 2DXCA 4A4FA 1JJ2P 4J5YA 1TG0A 1IHWA 1ZA1B 1Q7YU 2E6ZA 3RMQA 4LDWA 5FU7B 3JCMe 4LE9A 3NE0A 4C0ZA 1BBZA 1VQMA 4NS5A 2MWOA 1AWXA 5IAYA 1UTIA 4HVVA 4HFFA 2KBTA 1E6GA 2DPPB 2QA4Q 1M1KR 1Q95G 3CCEA 5LJ3j 3A5ZB 4A63B 3L42A 1QCFA 1EIFA 3I55T 2QAZA 2DETA 4RMOA 5LJ5f 5I11A 9ATCB 2O9VA 2DM1A 1XTDA 3L2WA 3ASKA 2JZ2A 5FWCA 3TVTA 3OB9A 2FYKA 1WFWA 1SRMA 3NPFA 3JCMP 1HXDA 2DRKA 3UWNA 2LDMA 2AK5A 4A4HA 1QVFP 2JVVA 1K8AC 4N4HA 2DE0X 4PFPA 3TSWA 4EPCA 2YRVA 1WXBA 1D3BA 2RA2A 1YJWT 4J9BA 3VUZA 2KT1A 2A3LA 4DOVA 1ZBJA 2QG9B 2JW4A 2YHTA 2K4YA 5FWBA 5GAN6 4OVAA 4LXCA 1PC0A 4PJNA 3PGGA 1UGSB 1K73R 4M77E 5GAOn 1W2BP 1Z9QA 1ABQA 1FXXA 4C0DB 1M1KC 1SKUB 3OA6A 3L2VA 1OV3A 4MZPA 1I5LA 5FRNA 3ZEHA 5GANe 4M7AD 3HPWA 4BI3A 5FU7C 2VYTA 2EQMA 4Q4NA 1WGSA 1IREB 1SSFA 3S0QA 2JJ9A 3LWIA 2OAUA 3VV0A 1TWBA 1MMDA 4OMFB 2EYWA 2ED1A 3FJ5A 2YRCA 2FL7A 2P4RA 5KYUA 1IXDA 1KJWA 3CMAQ 4C0FA 4EMHA 2KVQG 5LJ3d 2F2XA 5LJ5j 2CP3A 3C4SA 2DYIA 1IO6A 2EKOA 1K73U 4Z02A 3CQTA 2D9TA 1XOVA 5D7UA 1JJ2S 2AZVA 2DXTA 3L1AA 2AIRB 1SG5A 4CC4B 4OF1A 1N27A 1NJIR 3NMZC 3QBYA 3CCET 1TSFA 3BDLA 2RJEA 3VS4A 5GMKe 2DVEA 1VA7A 2DA9A 3CCMA 3OBYA 2HSPA 3PMIA 2HSEB 3NTHA 3P8BB 5J39A 3MEWA 3N5BB 2E4HA 2JTFA 4FQBA 2KYMA 2VOBA 2ROTA 3EH1A 2CP0A 1KSWA 2LVMA 3LWHA 3EG1A 4DBRA 4C8QF 1ZLMA 2WSCE 2J7IA 1N8RR 2FZGB 3REBB 8ATCB 2KR3A 3G71T 1N9RA 1HYOA 1S72Q 2QK0A 4M78D 5CKBA 2PUOB 1KQSA 2CP6A 4JJCA 1YCYA 2K3AA 1GBQA 2IO8A 2DEQA 1QWEA 2EYZA 5KE2A 1NJIC 2I0NA 4J7IA 4M7DA 3GIBA 1W6XA 1VQ9T 2ZPIB 2YT6A 3I86A 4N0AC 1JU5C 2F2WA 4HVWA 3DLMA 4XU3A 4L5GA 4FYYB 2RF0A 2K3YA 1WHKA 2XIDA 1ZSZA 2DRMA 2B8AA 4XTZA 3CCRT 2EYYA 3LH0A 1Y07A 1JB0E 2QQBA 1SRLA 4J6XA 4E7JA 2E12A 2JUFA 4KUIA 1YJ9A 4RCBA 1LNXA 2O2OA 4FCYA 1ZBXA 3CPWP 1WHGA 1AHJB 1YIJA 3CCVT 2GGRA 2KRSA 3CCQT 2K1GA 4DA4A 1MMGA 4M77B 2MPXC 4M7AB 1VQNT 2KE9A 1WHLA 1O9SA 2QQ9A 2IIMA 4QW2A 3MJXA 1M3BA 2J06A 2L3PA 4LDUA 3UA6A 2KXCA 3OMGA 4M78A 4L59A 1JBMA 2J6FA 2LT1A 4RKUE 2XKOC 2OX7A 2DTOA 4K11A 4VUBA 2LZ6B 3CCMT 4M75E 2P84A 2AKKA 2L89A 2A7YA 5IH2A 2AT1B 2DL4A 5IXBA 1GXIE 2HBWA 2EW3A 3PBCA 2DERA 5KYYA 3L2QA 2FG0A 3EGXA 1VQ4Q 4P5NA 2KGTA 3HFOA 2PVOB 4X9DA 2FHDA 4KULA 4C92D 4HZBA 4HA8A 2LNHB 2PVDB 5KYNA 3G6EA 3L2ZA 5KCOA 1Q7YC 3HRUA 1N8RU 2G3RA 3JSCA 1G5VA 2CSIA 1YJWQ 4LDXA 5KCHA 3PIOA 5FU6B 4KRTA 2MIOA 3VRYA 4GY5A 1WDXA 3G4ST 4II1A 1QCNA 1RADB 2ZGWA 3VS7A 5LJ3f 1QVGA 2IOBA 2VASA 4CT3A 1QVGS 3QZ5B 4WF2A 2QI2A 3QXEB 3M0SA 2NUPA 5A0DA 4J8OA 2RM4A 3IQLA 1NEGA 2F1LA 3TEEA 3M1UA 2EKHA 4QT7A 2D6FA 4NL3A 1M3AA 4XU0A 1YITA 4L6V5 3CMAT 3CD6T 1YIJQ 1G3SA 3MO8A 1YITT 1TUCA 4MZTA 1YCSB 3CD6A 1UDLA 4V2SA 2DJZA 5CQYA 4C5GA 2EVRA 4ZGJB 4FGEA 1FWZA 3JB9D 2HNIA 2M16A 1M8MA 2RJFA 2RPNA 3KBGA 2VGNA 4CC3A 4M7AC 1VQKT 1C6VX 5I2SA 1M2OA 4M77D 1B7TA 2YDLA 1MMNA 2YUPA 3G4SA 3FDRA 2M0YA 2QA4A 3EG3A 3E1SA 3H0FA 3WVDB 5D6WA 4IIOA 3FEOA 2IPOB 3HRSA 3KW0A 5GAMd 5GAN7 1M90C 2H3JA 4BI8B 4WTOB 5GMKm 3JRZA 2K5FA 1E6HA 2YUQA 3AT1B 4KUDK 2V8KA 2DMOA 4AFSC 1BCOA 4C0GA 1WPYA 3CPWS 2HMAA 1VQ4T 3TU4K 2VV5A 1PD0A 1U8RA 1ZQ1A 2CUDA 2DXBA 4PJMA 1ZHIA 1RI9A 1TTHB 4CSHA 1I5OB 2ED0A 4OMNA 2E1HA 2BE7D 2C0OA 2L8DA 2PU9B 1UECA 2YSQA 1OZ3A 1V29B 1WJQA 3VS1A 1EX4A 3UF4A 5EC7A 4F0VA 4ATOA 2QDLA 4ELYC 1TXQA 1I8FA 1F1BB 2O9SA 4EMKC 1Q86R 3M55A 3VU3C 5KYWA 2LJ1A 2I2LA 4AG1C 3CCSA 2QXFA 2FZCB 4M7DE 5CKEA 1WHMA 3JB9H 3HFNA 3VS3A 2RI5A 4PLIA 1X01A 2CZ6B 3H0IA 4MMKA 3QKJA 2WSEE 3UA7A 3SWNB 1OEBA 4BDYA 1YJ9Q 4PLLA 3SEMA 2GFAA 2A36A 1ARKA 4E7LA 2CS7A 1YI2T 3SHWA 3INZA 1AWWA 1AD5A 2K6DA 4IIMA 3SB2A 4MDXA 3PTAA 1DJ7B 1D1AA 2OTJT 1UE9A 3QJ6A 1IGQA 5D6XA 1VQ7T 4FQAA 1VUBA 1IGUA 2PQWA 2XDDA 2MMPA 6AT1B 2RQVA 5GAMf 4M7DG 3OYLA 1K8AR 1VQLT 1WNLA 3H6ZA 1MHNA 3BW1A 1OOTA 2DEUA 2LMJA 1Q86C 1QP2A 1QKWA 4XTUA 1B07A 3QYGB 1VQ5Q 2FVUA 1AZEA 1YP5A 3EFOB 1D0XA 1G83A 1LVKA 2KROA 1TUDA 4LUEA 5I21A 2L3RA 2E65A 4IURA 4M77C 2RHZA 3LGLA 4FDYA 4ZN1A 3I35A 4E47A 2NUTA 4FW2A 3S6WA 2BIVA 5GAOp 2ZAEA 2D0NA 2A08A 4JRPA 2CYZB 1D0YA 1AEYA 1KG1A 5A0GA 1C0MA 1WI7A 3CCMQ 1MGQA 2IO9A 2QASA 2XDPA 3CPFA 2IF6A 4A4KA 1I07A 3PE0A 2V8IA 4JDSA 4PJOC 2FB7A 2J6KA 4BY6C 3CC4Q 4E7IA 1T3LA 2MI6A 1D3BB 4BD3A 1ABOA 5LJ3h 2VVKA 3CBPA 1ZSZB 2A0FB 1KD1C 3UPUA 2GCXA 2ZPFB 4J9EA 5GAOr 2O31A 3MEAA 4Y91A 3C0CA 3SWNC 5EG2A 4CC7A 3I5SA 3LX7A 4RTWA 1PWTA 5KYUB 3M5AA 1JJ2A 1Y0MA 2BZ8A 3F70A 3OYKA 3MP6A 4F7UE 3CC4A 4D8KA 4PL6A 1CSKA 3CCUQ 2CT3A 3CCJT 2KMTA 2BZYA 1WQ7A 1B34A 4OP0A 4B9WA 1VQPQ 2XMFA 4N4IA 5HK0A 1VQPA 3A98A 3EH2A 3CMAA 3EGDA 3CCUT 1HJDA 3CCJQ 1VQLA 2KEAA 4FL6A 2OTJA 2W0ZA 3META 2H8HA 4C0DC 1UGVA 4M7AA 1LJOA 3HL8A 2BKDN 4RTXA 2EAYA 3A2YA 4JJDA 3QJYA 1WJSA 2HL5C 3OYHA 1KC8U 4OGCA 1OZ2A 1KD1R 1SHFA 1N8RC 4ZGEB 1WQWA 3SFMA 3DB3A 3CCLQ 5GAMe 1OULA 2DL8A 4JPBW 2K7AA 1BI0A 3RDVA 1S72A 3PVQA 1U1SA 5C6SA 3J7AF 1Q82U 1D1CA 1UGPB 4M7AG 5I22A 4IUTA 3EG9A 1RAFB 4ORZA 2WP7A 2DL3A 4PJOB 2OI3A 3VKIA 4J83A 4M75F 2CKKA 2CSQA 4LUDA 1H92A 3EHQA 2BTTA 2CZ7B 2CH4A 3O98A 2CP2A 1VQ6A 4EOBA 2O4XA 2GQIA 1UHCA 4C8QD 1WIEA 2D8JA 2GF7A 3QIIA 5GAOq 2EQJA 3ER0A 3CC2T 2LJ3A 4Z88A 1VQKA 3MEUA 1SHGA 4Z89A 2VPMA 3KFVA 1BB9A 1BI1A 2EJ9A 2J6OA 2DO3A 4HVUA 2AZSA 4QQDA 5DLOA 1WHJA 2KY9A 3QWYA 1C1AA 4C92G 1QVFA 1YIJT 3CBMA 5HK3A 2ZPEB 3NGPA 2LRJA 1NLPC 2O88A 4DEYA 5GANg 2LRQA 3H9NA 4A4EA 3GP8A 2YRDA 4RG8A 1QVPA 5CKDA 4F7UG 2MWPA 2ZZDA 4O6JA 3OYNA 4A4GA 1KFZA 2WACA 4C92B 4C5IA 3CD6Q 3JCMX 4F14A 2ECZA 5FLXE 4Y28E 2R57A 4PKCC 1YFNA 4FW1A 2K3XA 2V26A 3URGA 2XD0A 1OPLA 4QQ6A 2L2PA 3QZ9B 1XQHA 3PVLA 1NYFA 4C8QE 2VKNA 3QWXX 2HBPA 5GAOl 4X1VA 2V1QA 1RL2A 1OQKA 1UHFA 2RQRA 4E6RA 5J3BA 3M54A 4XAXB 2QYZA 3OYGA 1YJNA 4WCIA 3CC7A 5A2QE 3PNWC 4M78G 4EMKB 2RJDA 2FRWA 3JB9I 2E10A 4F0WA 3P8HA 4OB3B 2VGMA 4BE1A 2HEQA 4LD9K 2IVWA 3EBQA 1X69A 1Q81C 3BY7A 4ME7A 1TS9A 2ABLA 4XTXA 2XG8D 1G8XA 3PIPA 3RBBB 3UATA 3PMTA 1M8VA 2CZ1B 1VYTA 2M0OA 3LH5A 4X9CA 4OMMA 4ANJA 1B34B 5LL6S 3CC4T 1Y96B 2DD5A 3R6NA 4F7UA 1ZSZC 4DBHA 3QHSA 5LJ5e 3EFRA 1D09B 2RHYA 3OS1A 4JJNK 3FB9A 1UJ0A 3CMEQ 2WSFE 3PT9A 3RKYA 2Z0WA 5KYXB 3TQ7P 3CXCS 3I56Q 1QW1A 2VWFA 4OMQA 2FEIA 4PFOA 2DNUA 1M27C 3FRNA 3V7RA 5M9OA 4BE0A 1NG2A 5LJ3e 1QVFS 3VS0A 3JCMc 1M5Q1 3OYAA 1RAAB 3EFOA 5FRMA 2X4JA 5GMKh 2K79A 1VQOQ 2E3HA 3GPLA 4C5EA 1Q81R 2ROLA 1BKBA 5CCAA 2ENMA 2XDBA 3OW2P 2OTJQ 1VQMQ 4EQ8A 4QQGA 1VQ6Q 3OS5A 4ZTJA 3OYJA 1RUWA 4RTYA 4Q5WA 3G6EQ 4HCZA 5J26A 3D7SB 3JV3A 1BIAA 2E64A 4OB1B 3JB9F 1PCXA 1JEGA 1XNIA 2L3QA 2LJ0A 4DQ2A 2JMCA 5LJ3g 3MCAB 4CC2A 2P0KA 3RNJA 1VOMA 4C92E 5GANf 4M77F 5DY9A 1YJ9T 1WZOA 2B86A 2XI9A 3RUXA 3A8LB 1OPKA 4XTVA 2BUDA 2RQWA 1PKTA 1GBRA 3CEYA 4CI0C 1N9SA 1I1JA 4OB2B 4M7DB 1QWFA 3JAME 1X6OA 4PFZA 1X27A 1HD3A 2VUBA 4J9GA 2XHCA 3EG2A 2HQXA 2PZ1A 2FZKB 2GFUA 1BCMA 3OSVA 1KC8R 4RCCA 1VQLQ 4M7DC 1JRIA 2D8HA 2JNGA 2K9GA 2G6FX 2JXBA 2RJCA 4E7SA 4M77A 1LCKA 4PNOA 1KHCA 3OYYA 2HQEA 2GBQA 1TH7A 2KI7A 4M78B 5GAN5 2X3WD 4IUVA 2J05A 3LGFA 5GAN3 5IT9E 1M90U 4D8DA 3M4YA 4FM4B 1K73C 3GNFB 2QQSA 3M53A 4DBQA 1K76A 2C0TA 2RHUA 1S1NA 1M2VB 4J9HA 2KRMA 1NPPA 2X4XA 1MMAA 3HRTA 2P0PA 2ATCB 3X26B 2OTLT 2KQWA 1WYXA 2LNVA 4FIBA 1PRMC 4M78C 2CT4A 4DEXA 3MEVA 2EQIA 2NUZA 1B3QA 3V7SA 3CCLA 1QLYA 3PBIA 5FU6C 1QVGP 1SPKA 4OMPA 4HCKA 4FSXA 3A30A 1S72T 5HCKA 1H641 2LCCA 2ZPBB 1R77A 3OYEA 4F7UF 4E2FB 3J81E 4E7ZA 2EJGA 4M75C 4F4MA 5GMKl 2V8JA 1VQPT 3EGUA 1ZA2B 3REAB 2EGEA 4XU2A 1U1TA 1QCOA 2JT4A 2R58A 5D6YA 2VB6A 3EG9B 4N4GA 2FO0A 1EZZB 3TREA 4PJOG 1VQ7Q 4XTYA 1Y57A 4A53A 4PJOE 3QSUA 4HFLA 1JQQA 3VS6A 1RAGB 4CRIA 5DLQE 1N6AA 3ZL7C 3OYBA 2M02A 1BI3A 1QP3A 1AT1B 1VQ6T 4M7AF 1Y7XA 4HZ9A 4BACA 2DJQA 1H8KA 2JM8A 2LT4A 4EQAA 1VIFA 4XU1A 5L23A 4E7HA 1IRXA 1LPLA 4M75G 3QPHA 4B9XA 3TCJA 4C5HA 3ZBDA 2ZPGB 2CP5A 4AMCA 3UDCA 2LQ8A 2LCSA 1GL5A 4AFZC 5CO7A 4AFQC 5A0LA 2M51A 1FMVA 3MPUB 3VJPA 2F2VA 1MV3A 5IHKA 2KT8A 3CXCA 2LCLA 1K4US 1WA7A 3VRZA 4IUQA 2PUKB 2QTXA 4HFKA 4FT2A 1A0NB 1NE8A 4F16A 2DTHA 2LTOA 4C92A 1BI2A 2F5TX 1FX7A 2PVGB 2VXFA 3JCMg 3DLLA 3JCMf 1T0HA 3EHRA 4HXJA 2DILA 3NHNA 4M7AE 3X28B 2RK2A 1TUGB 2DZ9A 3FC3A 3OW2S 3DKMA 1OX9A 4J32A 2JS0A 3SD4A 4C8QB 2NLUA 3M0QA 2K57A 3VS5A 1Z9ZA 1GRIA 4JURA 4RTZA 1RAHB 1NJIU 2L3SA 4EDUA 4FYWB 3M0TA 1D1BA 1G2BA 2XIVA 2RMOA 1PHTA 2EQKA 1W1FA 4J6WA 4M75A 1T3SA 3EFSA 3FJPA 2OAWA 2QGFB 3CXCP 5L8RE 2JTEA 1RAIB 3O5ZA 3JB9J 2KAFA 3A1PA 2K3BA 2BZXA 1NLOC 2YUOA 2FRYA 2FPDA 2YUNA 3OS0A 5HY6A 2V1RA 1YITQ 1WHHA 2CUBA 1GCPA 4RG2A 3VS2A 1V76A 2YLBA 3BE3A 4ZTFA 3E19A 4J9FA 3UT1A 3OYMA 4J30A
chains in the Genus database with same CATH topology
1K9AA 4HZBA 3U23A 2LNHB 3I5RA 4HPEA 1AVZC 1X6BA 1K0XA 1KFZA 1FMKA 1NM7A 2CSIA 1H3HA 1RLPC 1X2QA 4F14A 1U3OA 2K2MA 4KRTA 2CDTA 2MIOA 3EG0A 3VRYA 2ECZA 1WDXA 1SEMA 1PKSA 2D1XA 5ECAA 1OPLA 1WLPB 2IO7A 2L2PA 1E7OA 3H41A 3PVLA 1NYFA 3VS7A 4F17A 2IOBA 4CT3A 2VKNA 2ESWA 3QWXX 2RNAA 3M0SA 4J9CA 4X1VA 2V1QA 1VYVA 4RUGA 3IQLA 4RTUA 1NEGA 1UHFA 2EYXA 2RQRA 3M1UA 3M0RA 2EKHA 4QT7A 4E6RA 2HCKA 4WCIA 2FPFA 1M3AA 2EBPA 1M3CA 5IHNA 2FRWA 4CGKA 1TUCA 2DBMA 1YCSB 4F0WA 1UDLA 2IOAA 2HEQA 1GFCA 1X69A 4GBQA 4JZ3A 2DL7A 2PTKA 2ABLA 2EVRA 4FGEA 1HSQA 5IXFA 2JMAA 1M8MA 3RBBB 3UATA 2RPNA 2GTJA 1AWOA 1VYTA 3LH5A 4CC3A 4OMMA 1N5ZA 4Y92A 3R6NA 4AG2C 2YDLA 2YUPA 1NEBA 2M0YA 3EG3A 3H0FA 4J9IA 4R0KA 2PNIA 4IIOA 3I9QA 4EIKA 1ZUYA 4JJBA 3KW0A 1UJ0A 1FYNA 5GJWB 1RLQC 4Q4TA 1E6HA 1JXOA 1PNJA 2KNBB 2YUQA 1MV0B 2FPEA 2DMOA 4AFSC 2VWFA 4OMQA 2FEIA 2DNUA 1M27C 1NG2A 4OMLA 4RTVA 1GFDA 1ZSGA 1ZX6A 4RTTA 3VS0A 2L0AA 1K0SA 1CKBA 1W70A 1ZUKA 2SEMA 2K79A 2CUDA 1TG0A 1RI9A 2ROLA 4CSHA 2ED0A 4FSSA 2ENMA 3NE0A 4LE9A 4OMNA 4EQ8A 1BBZA 2C0OA 1UECA 1RUWA 4RTYA 4LN2A 3M0UA 1AWXA 2YSQA 3JV3A 4M4ZA 2MCNA 3VS1A 1UTIA 1JEGA 3UF4A 4F0VA 5EC7A 2L3QA 4HVVA 2LJ0A 2KBTA 1E6GA 2QDLA 2JMCA 5IHIA 2O9SA 4CC2A 4A63B 2DLPA 1QCFA 5FW9A 3RNJA 2C0IA 2LJ1A 5I11A 2B86A 1GCQC 4AG1C 4OMOA 1OPKA 2O9VA 3VPJA 3VS3A 2DM1A 1PKTA 2RQWA 2OJ2A 1GBRA 1PRLC 1I1JA 5FWCA 3H0IA 3TVTA 1QWFA 2GNCA 1WX6A 2KXDA 3UA7A 1WFWA 1OEBA 1SRMA 3NPFA 2KRNA 2RQUA 1X27A 2LX7A 2DRKA 3SEMA 1HD3A 1ZUUA 2A36A 4FGDA 2SRCA 2AK5A 1YWPA 4J9GA 1ARKA 2VPSA 2EGAA 1KIKA 3H0HA 3EG2A 3SHWA 2DE0X 2DF6A 2PZ1A 1T0JA 4LNPA 3TSWA 1JXMA 1AWWA 1JO8A 1AD5A 2K6DA 4IIMA 2LQNA 1WXBA 2EPDA 4J9BA 1UE9A 2D8HA 1M30A 2K9GA 2KT1A 2G6FX 2JXBA 1ZBJA 1LCKA 2JW4A 4FQAA 4JXBA 5FWBA 3ULRB 4OLKA 2RQVA 2GBQA 1Z9QA 2GTOA 5GJVB 1ABQA 2X3WD 4LJ1A 2J05A 1OOTA 4D8DA 1OV3A 2LMJA 2W10A 1QKWA 4FGIA 1K76A 1EFNA 1B07A 2C0TA 1U06A 2RQTA 4Q4GX 1AZEA 1YP5A 1SSHA 1S1NA 2E5KA 4J9HA 4Q4NA 2KRMA 1G83A 2KROA 1TUDA 3S0QA 4LUEA 1WYXA 2EYWA 2ED1A 3FJ5A 1PRMC 2P4RA 4FDYA 1KJWA 3I35A 2CT4A 1CKAA 4DEXA 2EQIA 2F2XA 2NUZA 2D0NA 2A08A 1AEYA 1GCQA 3TSZA 1B3QA 1WI7A 1QLYA 3PBIA 2IO9A 1IO6A 2IF6A 1QKXA 1I07A 3CQTA 1SPKA 3PE0A 4OMPA 4HCKA 1XOVA 3A30A 2J6KA 2AZVA 5HCKA 4J9DA 1UFFA 1WXUA 1T3LA 4CC4B 1WXTA 1ABOA 4F4MA 2VVKA 2RN8A 3EGUA 3NMZC 4J9EA 3REAB 2O31A 3VS4A 3C0CA 2EGEA 1VA7A 2DA9A 2JT4A 3I5SA 4CC7A 4RTWA 1PWTA 2HSPA 2EGCA 2FO0A 1Y0MA 2BZ8A 1Y57A 1AOJA 1V1CA 1AZGB 2JS2A 4FQBA 1JQQA 2KYMA 3VS6A 3M0PA 4D8KA 2VOBA 1X2KA 3GBQA 1BK2A 2ROTA 1CSKA 2CT3A 3ZL7C 1KSWA 4ZNXA 4ESRA 2BZYA 4HZ9A 2XMFA 3EG1A 2DJQA 3A98A 1H8KA 2JM8A 1ZLMA 1YWOA 4EQAA 2J7IA 5L23A 3REBB 1UJYA 2KR3A 2A28A 1HJDA 2LCSA 1GL5A 4AFZC 1YNZA 4AFQC 2M51A 2KEAA 3VPIA 2W0ZA 4JJCA 2H8HA 1UGVA 2KYBA 2F2VA 2K3AA 1MV3A 5IHKA 1GBQA 2DBKA 2KT8A 1AWJA 2IO8A 3GT2A 4RTXA 3A2YA 2CREA 4JJDA 3THKA 2A37A 1K4US 1WA7A 1QWEA 2AKLA 3VRZA 1YN8A 2EYZA 1SHFA 2I0NA 2DVJA 1W6XA 3I86A 2YT6A 1A0NB 1U5SA 1JU5C 2F2WA 4HVWA 4F16A 1X43A 2MOXA 4AFUC 2RF0A 4JZ4A 2DL8A 4JPBW 1X6GA 2K7AA 2DRMA 1T0HA 2EYYA 3EHRA 3PVQA 4HXJA 3A2ZA 2DILA 3NHNA 1SRLA 2DL5A 1BU1A 2JM9A 5I22A 4ORZA 2O2OA 2DL3A 4GLMA 2JS0A 2OI3A 3M0QA 2GGRA 2KRSA 2CSQA 2K1GA 2DX1A 3VS5A 4LUDA 1Z9ZA 2LQWA 3EHQA 1H92A 2HDAA 1GRIA 1UG1A 2DYBA 2BTTA 2KE9A 4RTZA 2NWMA 1I0CA 3O98A 2CH4A 2L3SA 4EOBA 2IIMA 3M0TA 1M3BA 2J06A 2GQIA 2L3PA 1G2BA 1K1ZA 2XIVA 3UA6A 1UUEA 1UHCA 2KXCA 2RMOA 1PHTA 1WIEA 1W1FA 2CH4W 2D8JA 2J6FA 1T3SA 1J3TA 4Z8AA 2LP5A 2LJ3A 2OAWA 4Z88A 2JTEA 1SHGA 4Z89A 3O5ZA 2VPMA 4K11A 3KFVA 2LZ6B 1BB9A 2K3BA 2BZXA 2AKKA 1NLOC 2J6OA 2YUOA 2AZSA 2FRYA 4HVUA 2FPDA 2YUNA 5IH2A 2DL4A 3QWYA 5IXBA 1NYGA 2HBWA 2EW3A 2V1RA 3PBCA 3NGPA 2LRJA 2CUBA 1GCPA 1NLPC 1VYUA 3VS2A 2O88A 2X3XD 4DEYA 2FG0A 4J9FA 2KGTA 1MUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9A A;  4HZB A;  3U23 A;  2LNH B;  3I5R A;  4HPE A;  1AVZ C;  1X6B A;  1K0X A;  1KFZ A;  1FMK A;  1NM7 A;  2CSI A;  1H3H A;  1RLP C;  1X2Q A;  4F14 A;  1U3O A;  2K2M A;  4KRT A;  2CDT A;  2MIO A;  3EG0 A;  3VRY A;  2ECZ A;  1WDX A;  1SEM A;  1PKS A;  2D1X A;  5ECA A;  1OPL A;  1WLP B;  2IO7 A;  2L2P A;  1E7O A;  3H41 A;  3PVL A;  1NYF A;  3VS7 A;  4F17 A;  2IOB A;  4CT3 A;  2VKN A;  2ESW A;  3QWX X;  2RNA A;  3M0S A;  4J9C A;  4X1V A;  2V1Q A;  1VYV A;  4RUG A;  3IQL A;  4RTU A;  1NEG A;  1UHF A;  2EYX A;  2RQR A;  3M1U A;  3M0R A;  2EKH A;  4QT7 A;  4E6R A;  2HCK A;  4WCI A;  2FPF A;  1M3A A;  2EBP A;  1M3C A;  5IHN A;  2FRW A;  4CGK A;  1TUC A;  2DBM A;  1YCS B;  4F0W A;  1UDL A;  2IOA A;  2HEQ A;  1GFC A;  1X69 A;  4GBQ A;  4JZ3 A;  2DL7 A;  2PTK A;  2ABL A;  2EVR A;  4FGE A;  1HSQ A;  5IXF A;  2JMA A;  1M8M A;  3RBB B;  3UAT A;  2RPN A;  2GTJ A;  1AWO A;  1VYT A;  3LH5 A;  4CC3 A;  4OMM A;  1N5Z A;  4Y92 A;  3R6N A;  4AG2 C;  2YDL A;  2YUP A;  1NEB A;  2M0Y A;  3EG3 A;  3H0F A;  4J9I A;  4R0K A;  2PNI A;  4IIO A;  3I9Q A;  4EIK A;  1ZUY A;  4JJB A;  3KW0 A;  1UJ0 A;  1FYN A;  5GJW B;  1RLQ C;  4Q4T A;  1E6H A;  1JXO A;  1PNJ A;  2KNB B;  2YUQ A;  1MV0 B;  2FPE A;  2DMO A;  4AFS C;  2VWF A;  4OMQ A;  2FEI A;  2DNU A;  1M27 C;  1NG2 A;  4OML A;  4RTV A;  1GFD A;  1ZSG A;  1ZX6 A;  4RTT A;  3VS0 A;  2L0A A;  1K0S A;  1CKB A;  1W70 A;  1ZUK A;  2SEM A;  2K79 A;  2CUD A;  1TG0 A;  1RI9 A;  2ROL A;  4CSH A;  2ED0 A;  4FSS A;  2ENM A;  3NE0 A;  4LE9 A;  4OMN A;  4EQ8 A;  1BBZ A;  2C0O A;  1UEC A;  1RUW A;  4RTY A;  4LN2 A;  3M0U A;  1AWX A;  2YSQ A;  3JV3 A;  4M4Z A;  2MCN A;  3VS1 A;  1UTI A;  1JEG A;  3UF4 A;  4F0V A;  5EC7 A;  2L3Q A;  4HVV A;  2LJ0 A;  2KBT A;  1E6G A;  2QDL A;  2JMC A;  5IHI A;  2O9S A;  4CC2 A;  4A63 B;  2DLP A;  1QCF A;  5FW9 A;  3RNJ A;  2C0I A;  2LJ1 A;  5I11 A;  2B86 A;  1GCQ C;  4AG1 C;  4OMO A;  1OPK A;  2O9V A;  3VPJ A;  3VS3 A;  2DM1 A;  1PKT A;  2RQW A;  2OJ2 A;  1GBR A;  1PRL C;  1I1J A;  5FWC A;  3H0I A;  3TVT A;  1QWF A;  2GNC A;  1WX6 A;  2KXD A;  3UA7 A;  1WFW A;  1OEB A;  1SRM A;  3NPF A;  2KRN A;  2RQU A;  1X27 A;  2LX7 A;  2DRK A;  3SEM A;  1HD3 A;  1ZUU A;  2A36 A;  4FGD A;  2SRC A;  2AK5 A;  1YWP A;  4J9G A;  1ARK A;  2VPS A;  2EGA A;  1KIK A;  3H0H A;  3EG2 A;  3SHW A;  2DE0 X;  2DF6 A;  2PZ1 A;  1T0J A;  4LNP A;  3TSW A;  1JXM A;  1AWW A;  1JO8 A;  1AD5 A;  2K6D A;  4IIM A;  2LQN A;  1WXB A;  2EPD A;  4J9B A;  1UE9 A;  2D8H A;  1M30 A;  2K9G A;  2KT1 A;  2G6F X;  2JXB A;  1ZBJ A;  1LCK A;  2JW4 A;  4FQA A;  4JXB A;  5FWB A;  3ULR B;  4OLK A;  2RQV A;  2GBQ A;  1Z9Q A;  2GTO A;  5GJV B;  1ABQ A;  2X3W D;  4LJ1 A;  2J05 A;  1OOT A;  4D8D A;  1OV3 A;  2LMJ A;  2W10 A;  1QKW A;  4FGI A;  1K76 A;  1EFN A;  1B07 A;  2C0T A;  1U06 A;  2RQT A;  4Q4G X;  1AZE A;  1YP5 A;  1SSH A;  1S1N A;  2E5K A;  4J9H A;  4Q4N A;  2KRM A;  1G83 A;  2KRO A;  1TUD A;  3S0Q A;  4LUE A;  1WYX A;  2EYW A;  2ED1 A;  3FJ5 A;  1PRM C;  2P4R A;  4FDY A;  1KJW A;  3I35 A;  2CT4 A;  1CKA A;  4DEX A;  2EQI A;  2F2X A;  2NUZ A;  2D0N A;  2A08 A;  1AEY A;  1GCQ A;  3TSZ A;  1B3Q A;  1WI7 A;  1QLY A;  3PBI A;  2IO9 A;  1IO6 A;  2IF6 A;  1QKX A;  1I07 A;  3CQT A;  1SPK A;  3PE0 A;  4OMP A;  4HCK A;  1XOV A;  3A30 A;  2J6K A;  2AZV A;  5HCK A;  4J9D A;  1UFF A;  1WXU A;  1T3L A;  4CC4 B;  1WXT A;  1ABO A;  4F4M A;  2VVK A;  2RN8 A;  3EGU A;  3NMZ C;  4J9E A;  3REA B;  2O31 A;  3VS4 A;  3C0C A;  2EGE A;  1VA7 A;  2DA9 A;  2JT4 A;  3I5S A;  4CC7 A;  4RTW A;  1PWT A;  2HSP A;  2EGC A;  2FO0 A;  1Y0M A;  2BZ8 A;  1Y57 A;  1AOJ A;  1V1C A;  1AZG B;  2JS2 A;  4FQB A;  1JQQ A;  2KYM A;  3VS6 A;  3M0P A;  4D8K A;  2VOB A;  1X2K A;  3GBQ A;  1BK2 A;  2ROT A;  1CSK A;  2CT3 A;  3ZL7 C;  1KSW A;  4ZNX A;  4ESR A;  2BZY A;  4HZ9 A;  2XMF A;  3EG1 A;  2DJQ A;  3A98 A;  1H8K A;  2JM8 A;  1ZLM A;  1YWO A;  4EQA A;  2J7I A;  5L23 A;  3REB B;  1UJY A;  2KR3 A;  2A28 A;  1HJD A;  2LCS A;  1GL5 A;  4AFZ C;  1YNZ A;  4AFQ C;  2M51 A;  2KEA A;  3VPI A;  2W0Z A;  4JJC A;  2H8H A;  1UGV A;  2KYB A;  2F2V A;  2K3A A;  1MV3 A;  5IHK A;  1GBQ A;  2DBK A;  2KT8 A;  1AWJ A;  2IO8 A;  3GT2 A;  4RTX A;  3A2Y A;  2CRE A;  4JJD A;  3THK A;  2A37 A;  1K4U S;  1WA7 A;  1QWE A;  2AKL A;  3VRZ A;  1YN8 A;  2EYZ A;  1SHF A;  2I0N A;  2DVJ A;  1W6X A;  3I86 A;  2YT6 A;  1A0N B;  1U5S A;  1JU5 C;  2F2W A;  4HVW A;  4F16 A;  1X43 A;  2MOX A;  4AFU C;  2RF0 A;  4JZ4 A;  2DL8 A;  4JPB W;  1X6G A;  2K7A A;  2DRM A;  1T0H A;  2EYY A;  3EHR A;  3PVQ A;  4HXJ A;  3A2Z A;  2DIL A;  3NHN A;  1SRL A;  2DL5 A;  1BU1 A;  2JM9 A;  5I22 A;  4ORZ A;  2O2O A;  2DL3 A;  4GLM A;  2JS0 A;  2OI3 A;  3M0Q A;  2GGR A;  2KRS A;  2CSQ A;  2K1G A;  2DX1 A;  3VS5 A;  4LUD A;  1Z9Z A;  2LQW A;  3EHQ A;  1H92 A;  2HDA A;  1GRI A;  1UG1 A;  2DYB A;  2BTT A;  2KE9 A;  4RTZ A;  2NWM A;  1I0C A;  3O98 A;  2CH4 A;  2L3S A;  4EOB A;  2IIM A;  3M0T A;  1M3B A;  2J06 A;  2GQI A;  2L3P A;  1G2B A;  1K1Z A;  2XIV A;  3UA6 A;  1UUE A;  1UHC A;  2KXC A;  2RMO A;  1PHT A;  1WIE A;  1W1F A;  2CH4 W;  2D8J A;  2J6F A;  1T3S A;  1J3T A;  4Z8A A;  2LP5 A;  2LJ3 A;  2OAW A;  4Z88 A;  2JTE A;  1SHG A;  4Z89 A;  3O5Z A;  2VPM A;  4K11 A;  3KFV A;  2LZ6 B;  1BB9 A;  2K3B A;  2BZX A;  2AKK A;  1NLO C;  2J6O A;  2YUO A;  2AZS A;  2FRY A;  4HVU A;  2FPD A;  2YUN A;  5IH2 A;  2DL4 A;  3QWY A;  5IXB A;  1NYG A;  2HBW A;  2EW3 A;  2V1R A;  3PBC A;  3NGP A;  2LRJ A;  2CUB A;  1GCP A;  1NLP C;  1VYU A;  3VS2 A;  2O88 A;  2X3X D;  4DEY A;  2FG0 A;  4J9F A;  2KGT A;  1MUZ A; 
#chains in the Genus database with same CATH topology
 2M9U A;  1K9A A;  3U23 A;  3I5R A;  2HZY A;  4HPE A;  4AT1 B;  1AVZ C;  1PSF A;  3A8H B;  5IN1 A;  1X6B A;  2X4W A;  1FMK A;  2MYS A;  1NM7 A;  1VQ8 Q;  2E3I A;  4JLI A;  5GAN h;  1X2Q A;  1RAB B;  1U3O A;  2K2M A;  1VQN Q;  5FRO A;  2CDT A;  5C0M A;  2CZ0 B;  3RMS A;  1KQ1 A;  1SEM A;  1Y96 A;  1PKS A;  1PD1 A;  1WLP B;  5ECA A;  4FT4 A;  4ZGD B;  1E7O A;  4BY6 B;  4F17 A;  4F7U B;  3OYD A;  3V8J A;  2OTL A;  2QTV A;  4OB0 B;  1O75 A;  2RNA A;  4J9C A;  3VYG A;  1IZ6 A;  3G71 A;  2R5A A;  1KQS P;  1VYV A;  4RUG A;  4RTU A;  3HHT B;  2DD4 A;  2O4X B;  2YLC A;  3CCL T;  3JCM V;  4XK8 E;  1M3C A;  5KYX A;  2P0Q A;  4X34 A;  5GAN j;  5HKC A;  5GAN 2;  4CGK A;  2DK3 A;  3I55 Q;  2IOA A;  4GBQ A;  4JZ3 A;  2JTM A;  2DL7 A;  2PTK A;  4JS5 A;  5IXF A;  3CCJ A;  2Y4Y A;  3EAE A;  5GAN 4;  3CC7 T;  2NUT B;  4KT0 E;  2JMA A;  4J6Y A;  3L2R A;  2GTJ A;  3JCM Q;  2LX9 A;  3V8L A;  3KXT A;  1LOJ A;  1OU9 A;  4GLK A;  3JCM h;  5CIU A;  3RER A;  1N5Z A;  1MNE A;  1VQ5 T;  3FIF A;  4AG2 C;  2LC4 A;  3RKX A;  3HTR A;  4KBM B;  4XQ3 A;  4R0K A;  2PNI A;  2OTL Q;  3I9Q A;  3V8K A;  4EIK A;  5GAN 8;  2KDS A;  5GAM j;  1UGQ B;  1FYN A;  2E41 A;  5GJW B;  4FYX B;  4BI4 A;  5CR2 A;  4IKF A;  1RLQ C;  2F5K A;  4Q4T A;  1K8A U;  3DB4 A;  2K2V A;  4EMK A;  3A8O B;  1Q82 R;  3O8V A;  5GMK i;  2KNB B;  4FU6 A;  3NTK A;  3OW2 A;  2X51 A;  1M90 R;  3T9N A;  2JN0 A;  5CKH A;  1IB8 A;  3CCU A;  4OML A;  4ZN3 A;  4C8Q G;  1ZSG A;  1ZX6 A;  2RO0 A;  1UB4 A;  1WJR A;  1YI2 Q;  2RH2 A;  1M4Z A;  1CKB A;  1G3Y A;  2L5Q A;  1VQ9 Q;  3ZFJ A;  4QKU A;  1ZUK A;  1YJN T;  2SEM A;  5LJ5 d;  3CBO A;  3A8G B;  3VYH B;  1QMC A;  3OYI A;  4FSS A;  1VQ8 T;  3RKW A;  3CC2 A;  1UGR B;  3GLX A;  1SF9 A;  3CCR Q;  4HKE A;  1VQK Q;  4LN2 A;  3M0U A;  2NYS A;  3EGD B;  4QVZ A;  3I56 A;  4M4Z A;  5CVI A;  2MCN A;  2RB6 A;  4MML A;  1XJW B;  1PSE A;  1BIB A;  3QG1 A;  4NL2 A;  5IHI A;  4IUP A;  3WVE B;  1KK7 A;  2DLP A;  3RR6 A;  3CCQ Q;  5FW9 A;  2QEX A;  2CGH A;  1R0B G;  3QUI A;  2C0I A;  3G1J A;  4PJO A;  3CPW A;  1GCQ C;  1VQN A;  1KHI A;  1Q86 U;  4OMO A;  4KGV B;  3VPJ A;  3PFS A;  4QVD A;  2OJ2 A;  1PRL C;  2QQA A;  2GNC A;  1WX6 A;  2KXD A;  1Q82 C;  2XK0 A;  2COZ A;  2Y90 A;  2KRN A;  2RQU A;  2HD0 A;  3C94 A;  2LX7 A;  4R55 A;  1ZUU A;  4FGD A;  2SRC A;  2R5M A;  1YWP A;  3CC7 Q;  2VPS A;  2EGA A;  3OYF A;  1KIK A;  3H0H A;  3KUF A;  1X75 C;  2DF6 A;  3QDF A;  3OBW A;  5GAN d;  5AT1 B;  2E5Q A;  1T0J A;  4LNP A;  2DFU A;  4C92 C;  4QVC A;  1JXM A;  1K9M R;  3J80 E;  1JO8 A;  1VQ5 A;  5GAM h;  2LQN A;  2X9H A;  2EPD A;  2COY A;  4HT8 A;  1M30 A;  2LQK A;  2QGG A;  3BDU A;  2COW A;  2O01 E;  4JXB A;  1K9M U;  1Y71 A;  1OX8 A;  3Q1J A;  3ULR B;  4OLK A;  2D0Q B;  1Q81 U;  2GTO A;  5GJV B;  5KE3 A;  3WXM B;  3OY9 A;  4LJ1 A;  2DIG A;  3C95 A;  3QDR B;  3OSS C;  3LYI A;  2W10 A;  4EMG A;  5CK9 A;  1KC8 C;  2NUP B;  4FGI A;  1H3Z A;  3S3N A;  1EFN A;  3P8D A;  1TU0 B;  3HSB A;  1YHQ T;  1U06 A;  2RQT A;  4Q4G X;  1YBY A;  3G71 Q;  1SSH A;  2E5K A;  1VQM T;  4BE2 A;  4PJJ A;  2RI2 A;  2BE9 B;  1RI0 A;  1YJN Q;  2F69 A;  1HK9 A;  5CKF A;  1CKA A;  3LLR A;  2QEX Q;  1MND A;  3X20 B;  5LJ5 h;  1GCQ A;  4O5V A;  3TSZ A;  3A8M B;  4PK4 A;  3GOX A;  4M78 F;  1KQ2 A;  3MP8 A;  1M1K U;  7AT1 B;  3LW5 E;  4IUU A;  3CCS Q;  2RD1 A;  1QKX A;  1I4K 1;  4MZM A;  1RAC B;  4KH0 B;  4HCC A;  3CCR A;  3JCM W;  4J9D A;  1UFF A;  5LJ5 g;  1PM3 A;  1WXU A;  2HQH A;  1WXT A;  3GF5 A;  5CAI A;  4JRK A;  3E9F A;  4M78 E;  2IG0 A;  2RN8 A;  3S3O A;  2E6N A;  2KK4 A;  3CCV Q;  1M9S A;  2C06 A;  4BB7 A;  2HKQ B;  4C92 F;  1M1F A;  2EGC A;  1IHV A;  1OI1 A;  3RES A;  2DAQ A;  4M7D F;  4LDV A;  1AOJ A;  1V1C A;  1AZG B;  2JS2 A;  2RHX A;  4PJL A;  3M0P A;  2EJF A;  2E70 A;  4ELZ C;  1X2K A;  3GBQ A;  1BK2 A;  4TVR A;  3M56 A;  4ZNX A;  1M2V A;  4ESR A;  2VC8 A;  4FYV B;  3CCE Q;  3R6O A;  1YWO A;  3VUB A;  3MHX A;  3MKD A;  1UJY A;  4C8Q C;  2A28 A;  1YNZ A;  2HKN A;  2MK5 A;  4C8Q A;  3VPI A;  2GQV A;  2KYB A;  2CP7 A;  3AHU A;  4NOY A;  3G4S Q;  1OYX A;  2DBK A;  3M4G A;  3I56 T;  1AWJ A;  4N0A A;  1QQJ A;  3GT2 A;  4E7K A;  2X35 A;  2CRE A;  3THK A;  4MDW A;  2ZCF B;  2A37 A;  3ME9 A;  3JB9 G;  2AKL A;  1YN8 A;  5KH6 A;  4M75 B;  2DVJ A;  2RK1 A;  4PJO F;  1U5S A;  4JRI A;  1UEB A;  4LDY A;  8AT1 B;  3OS2 A;  1X43 A;  2MOX A;  4AFU C;  4JZ4 A;  1RAE B;  4M77 G;  1PG5 B;  1X6G A;  4F04 B;  1VQ4 A;  1KQS S;  3CC2 Q;  3A2Z A;  2AHJ B;  2DL5 A;  1BU1 A;  2JM9 A;  3CCS T;  1W2B A;  3MP1 A;  5GMK j;  4GLM A;  4HCB A;  3S3M A;  2RHI A;  1VQO A;  3FLG A;  1VIE A;  2DX1 A;  2LQW A;  2HDA A;  4BDZ A;  1UG1 A;  2DYB A;  4D6W A;  2NWM A;  2YWW A;  1I0C A;  1ACM B;  4OGE A;  4DBF A;  4KGX B;  4JLG A;  2QA4 T;  5CQX A;  1OU8 A;  1K1Z A;  1UUE A;  3NFC A;  2CH4 W;  4JS4 A;  1J3T A;  3HP9 A;  4BUG A;  1KD1 U;  4Z8A A;  2LP5 A;  2QDY B;  1YJW A;  4A54 A;  4JRQ A;  2QQR A;  3X25 B;  3H8Z A;  1Q7Y R;  3V7C A;  4HT9 A;  3M58 A;  3QO3 A;  3CME A;  1NYG A;  4B6M A;  1W4S A;  3CME T;  1VYU A;  4R56 A;  4J7F A;  2X3X D;  1NPR A;  2EYQ A;  2M1H A;  3HKS A;  2YXY A;  1MUZ A;  2MF2 A;  4YTL A;  2DZC A;  3NTI A;  2HAX A;  5I2M A;  5DM7 R;  1K0X A;  2JOY A;  3I55 A;  1VQ8 A;  4PJO D;  1H3H A;  1RLP C;  2DIQ A;  2XU8 A;  3EG0 A;  1VQ9 A;  1R0C B;  2D1X A;  2IO7 A;  3M9Q A;  3H41 A;  3G7Z A;  1BYM A;  2ESW A;  3JCM d;  2HL3 A;  4KGZ B;  3E2U A;  3E9G A;  2EYX A;  4JUV A;  3M0R A;  5KYW B;  2K5I A;  2HCK A;  4M75 D;  5GAO m;  2EWN A;  2FPF A;  3OYC A;  2K5L A;  1YHQ Q;  1FMW A;  1YHQ A;  2EBP A;  5IHN A;  3CCV A;  2ZPH B;  3CCQ A;  2DBM A;  2QEX T;  2X4Y A;  1GFC A;  1NBE B;  1R8O B;  3SWN A;  1NZ9 A;  1I81 A;  3GNG A;  2RI3 A;  3QYH B;  1HSQ A;  1P92 A;  4M7D D;  1W2B S;  1AWO A;  3JCM J;  2XIC A;  3M59 A;  2KSS A;  3BFM A;  4Y92 A;  2H3E B;  5AYF A;  2EFI A;  1D0Z A;  1M1G A;  3SDZ A;  3EGX B;  3M57 A;  2DKG A;  1K9M C;  2Y4X A;  1NEB A;  3RIR A;  4LD6 A;  1YI2 A;  2EQU A;  4J9I A;  4DOW A;  1ZUY A;  4JJB A;  1VQO T;  4UC4 A;  5GAM g;  2VXE A;  3L2U A;  1JXO A;  1PNJ A;  3JCM b;  2MAM A;  1MV0 B;  1G3W A;  2FPE A;  3G6E T;  1VQ7 A;  2DXU A;  3OQ5 A;  5KYY B;  2EIF A;  3X24 B;  1G3T A;  1TOV A;  4XTW A;  4RTV A;  3OMC A;  2P4T A;  2DTI A;  1GFD A;  3C12 A;  4KH1 B;  4RTT A;  2L0A A;  1K0S A;  1W70 A;  2DXC A;  4A4F A;  1JJ2 P;  4J5Y A;  1TG0 A;  1IHW A;  1ZA1 B;  1Q7Y U;  2E6Z A;  3RMQ A;  4LDW A;  5FU7 B;  3JCM e;  4LE9 A;  3NE0 A;  4C0Z A;  1BBZ A;  1VQM A;  4NS5 A;  2MWO A;  1AWX A;  5IAY A;  1UTI A;  4HVV A;  4HFF A;  2KBT A;  1E6G A;  2DPP B;  2QA4 Q;  1M1K R;  1Q95 G;  3CCE A;  5LJ3 j;  3A5Z B;  4A63 B;  3L42 A;  1QCF A;  1EIF A;  3I55 T;  2QAZ A;  2DET A;  4RMO A;  5LJ5 f;  5I11 A;  9ATC B;  2O9V A;  2DM1 A;  1XTD A;  3L2W A;  3ASK A;  2JZ2 A;  5FWC A;  3TVT A;  3OB9 A;  2FYK A;  1WFW A;  1SRM A;  3NPF A;  3JCM P;  1HXD A;  2DRK A;  3UWN A;  2LDM A;  2AK5 A;  4A4H A;  1QVF P;  2JVV A;  1K8A C;  4N4H A;  2DE0 X;  4PFP A;  3TSW A;  4EPC A;  2YRV A;  1WXB A;  1D3B A;  2RA2 A;  1YJW T;  4J9B A;  3VUZ A;  2KT1 A;  2A3L A;  4DOV A;  1ZBJ A;  2QG9 B;  2JW4 A;  2YHT A;  2K4Y A;  5FWB A;  5GAN 6;  4OVA A;  4LXC A;  1PC0 A;  4PJN A;  3PGG A;  1UGS B;  1K73 R;  4M77 E;  5GAO n;  1W2B P;  1Z9Q A;  1ABQ A;  1FXX A;  4C0D B;  1M1K C;  1SKU B;  3OA6 A;  3L2V A;  1OV3 A;  4MZP A;  1I5L A;  5FRN A;  3ZEH A;  5GAN e;  4M7A D;  3HPW A;  4BI3 A;  5FU7 C;  2VYT A;  2EQM A;  4Q4N A;  1WGS A;  1IRE B;  1SSF A;  3S0Q A;  2JJ9 A;  3LWI A;  2OAU A;  3VV0 A;  1TWB A;  1MMD A;  4OMF B;  2EYW A;  2ED1 A;  3FJ5 A;  2YRC A;  2FL7 A;  2P4R A;  5KYU A;  1IXD A;  1KJW A;  3CMA Q;  4C0F A;  4EMH A;  2KVQ G;  5LJ3 d;  2F2X A;  5LJ5 j;  2CP3 A;  3C4S A;  2DYI A;  1IO6 A;  2EKO A;  1K73 U;  4Z02 A;  3CQT A;  2D9T A;  1XOV A;  5D7U A;  1JJ2 S;  2AZV A;  2DXT A;  3L1A A;  2AIR B;  1SG5 A;  4CC4 B;  4OF1 A;  1N27 A;  1NJI R;  3NMZ C;  3QBY A;  3CCE T;  1TSF A;  3BDL A;  2RJE A;  3VS4 A;  5GMK e;  2DVE A;  1VA7 A;  2DA9 A;  3CCM A;  3OBY A;  2HSP A;  3PMI A;  2HSE B;  3NTH A;  3P8B B;  5J39 A;  3MEW A;  3N5B B;  2E4H A;  2JTF A;  4FQB A;  2KYM A;  2VOB A;  2ROT A;  3EH1 A;  2CP0 A;  1KSW A;  2LVM A;  3LWH A;  3EG1 A;  4DBR A;  4C8Q F;  1ZLM A;  2WSC E;  2J7I A;  1N8R R;  2FZG B;  3REB B;  8ATC B;  2KR3 A;  3G71 T;  1N9R A;  1HYO A;  1S72 Q;  2QK0 A;  4M78 D;  5CKB A;  2PUO B;  1KQS A;  2CP6 A;  4JJC A;  1YCY A;  2K3A A;  1GBQ A;  2IO8 A;  2DEQ A;  1QWE A;  2EYZ A;  5KE2 A;  1NJI C;  2I0N A;  4J7I A;  4M7D A;  3GIB A;  1W6X A;  1VQ9 T;  2ZPI B;  2YT6 A;  3I86 A;  4N0A C;  1JU5 C;  2F2W A;  4HVW A;  3DLM A;  4XU3 A;  4L5G A;  4FYY B;  2RF0 A;  2K3Y A;  1WHK A;  2XID A;  1ZSZ A;  2DRM A;  2B8A A;  4XTZ A;  3CCR T;  2EYY A;  3LH0 A;  1Y07 A;  1JB0 E;  2QQB A;  1SRL A;  4J6X A;  4E7J A;  2E12 A;  2JUF A;  4KUI A;  1YJ9 A;  4RCB A;  1LNX A;  2O2O A;  4FCY A;  1ZBX A;  3CPW P;  1WHG A;  1AHJ B;  1YIJ A;  3CCV T;  2GGR A;  2KRS A;  3CCQ T;  2K1G A;  4DA4 A;  1MMG A;  4M77 B;  2MPX C;  4M7A B;  1VQN T;  2KE9 A;  1WHL A;  1O9S A;  2QQ9 A;  2IIM A;  4QW2 A;  3MJX A;  1M3B A;  2J06 A;  2L3P A;  4LDU A;  3UA6 A;  2KXC A;  3OMG A;  4M78 A;  4L59 A;  1JBM A;  2J6F A;  2LT1 A;  4RKU E;  2XKO C;  2OX7 A;  2DTO A;  4K11 A;  4VUB A;  2LZ6 B;  3CCM T;  4M75 E;  2P84 A;  2AKK A;  2L89 A;  2A7Y A;  5IH2 A;  2AT1 B;  2DL4 A;  5IXB A;  1GXI E;  2HBW A;  2EW3 A;  3PBC A;  2DER A;  5KYY A;  3L2Q A;  2FG0 A;  3EGX A;  1VQ4 Q;  4P5N A;  2KGT A;  3HFO A;  2PVO B;  4X9D A;  2FHD A;  4KUL A;  4C92 D;  4HZB A;  4HA8 A;  2LNH B;  2PVD B;  5KYN A;  3G6E A;  3L2Z A;  5KCO A;  1Q7Y C;  3HRU A;  1N8R U;  2G3R A;  3JSC A;  1G5V A;  2CSI A;  1YJW Q;  4LDX A;  5KCH A;  3PIO A;  5FU6 B;  4KRT A;  2MIO A;  3VRY A;  4GY5 A;  1WDX A;  3G4S T;  4II1 A;  1QCN A;  1RAD B;  2ZGW A;  3VS7 A;  5LJ3 f;  1QVG A;  2IOB A;  2VAS A;  4CT3 A;  1QVG S;  3QZ5 B;  4WF2 A;  2QI2 A;  3QXE B;  3M0S A;  2NUP A;  5A0D A;  4J8O A;  2RM4 A;  3IQL A;  1NEG A;  2F1L A;  3TEE A;  3M1U A;  2EKH A;  4QT7 A;  2D6F A;  4NL3 A;  1M3A A;  4XU0 A;  1YIT A;  4L6V 5;  3CMA T;  3CD6 T;  1YIJ Q;  1G3S A;  3MO8 A;  1YIT T;  1TUC A;  4MZT A;  1YCS B;  3CD6 A;  1UDL A;  4V2S A;  2DJZ A;  5CQY A;  4C5G A;  2EVR A;  4ZGJ B;  4FGE A;  1FWZ A;  3JB9 D;  2HNI A;  2M16 A;  1M8M A;  2RJF A;  2RPN A;  3KBG A;  2VGN A;  4CC3 A;  4M7A C;  1VQK T;  1C6V X;  5I2S A;  1M2O A;  4M77 D;  1B7T A;  2YDL A;  1MMN A;  2YUP A;  3G4S A;  3FDR A;  2M0Y A;  2QA4 A;  3EG3 A;  3E1S A;  3H0F A;  3WVD B;  5D6W A;  4IIO A;  3FEO A;  2IPO B;  3HRS A;  3KW0 A;  5GAM d;  5GAN 7;  1M90 C;  2H3J A;  4BI8 B;  4WTO B;  5GMK m;  3JRZ A;  2K5F A;  1E6H A;  2YUQ A;  3AT1 B;  4KUD K;  2V8K A;  2DMO A;  4AFS C;  1BCO A;  4C0G A;  1WPY A;  3CPW S;  2HMA A;  1VQ4 T;  3TU4 K;  2VV5 A;  1PD0 A;  1U8R A;  1ZQ1 A;  2CUD A;  2DXB A;  4PJM A;  1ZHI A;  1RI9 A;  1TTH B;  4CSH A;  1I5O B;  2ED0 A;  4OMN A;  2E1H A;  2BE7 D;  2C0O A;  2L8D A;  2PU9 B;  1UEC A;  2YSQ A;  1OZ3 A;  1V29 B;  1WJQ A;  3VS1 A;  1EX4 A;  3UF4 A;  5EC7 A;  4F0V A;  4ATO A;  2QDL A;  4ELY C;  1TXQ A;  1I8F A;  1F1B B;  2O9S A;  4EMK C;  1Q86 R;  3M55 A;  3VU3 C;  5KYW A;  2LJ1 A;  2I2L A;  4AG1 C;  3CCS A;  2QXF A;  2FZC B;  4M7D E;  5CKE A;  1WHM A;  3JB9 H;  3HFN A;  3VS3 A;  2RI5 A;  4PLI A;  1X01 A;  2CZ6 B;  3H0I A;  4MMK A;  3QKJ A;  2WSE E;  3UA7 A;  3SWN B;  1OEB A;  4BDY A;  1YJ9 Q;  4PLL A;  3SEM A;  2GFA A;  2A36 A;  1ARK A;  4E7L A;  2CS7 A;  1YI2 T;  3SHW A;  3INZ A;  1AWW A;  1AD5 A;  2K6D A;  4IIM A;  3SB2 A;  4MDX A;  3PTA A;  1DJ7 B;  1D1A A;  2OTJ T;  1UE9 A;  3QJ6 A;  1IGQ A;  5D6X A;  1VQ7 T;  4FQA A;  1VUB A;  1IGU A;  2PQW A;  2XDD A;  2MMP A;  6AT1 B;  2RQV A;  5GAM f;  4M7D G;  3OYL A;  1K8A R;  1VQL T;  1WNL A;  3H6Z A;  1MHN A;  3BW1 A;  1OOT A;  2DEU A;  2LMJ A;  1Q86 C;  1QP2 A;  1QKW A;  4XTU A;  1B07 A;  3QYG B;  1VQ5 Q;  2FVU A;  1AZE A;  1YP5 A;  3EFO B;  1D0X A;  1G83 A;  1LVK A;  2KRO A;  1TUD A;  4LUE A;  5I21 A;  2L3R A;  2E65 A;  4IUR A;  4M77 C;  2RHZ A;  3LGL A;  4FDY A;  4ZN1 A;  3I35 A;  4E47 A;  2NUT A;  4FW2 A;  3S6W A;  2BIV A;  5GAO p;  2ZAE A;  2D0N A;  2A08 A;  4JRP A;  2CYZ B;  1D0Y A;  1AEY A;  1KG1 A;  5A0G A;  1C0M A;  1WI7 A;  3CCM Q;  1MGQ A;  2IO9 A;  2QAS A;  2XDP A;  3CPF A;  2IF6 A;  4A4K A;  1I07 A;  3PE0 A;  2V8I A;  4JDS A;  4PJO C;  2FB7 A;  2J6K A;  4BY6 C;  3CC4 Q;  4E7I A;  1T3L A;  2MI6 A;  1D3B B;  4BD3 A;  1ABO A;  5LJ3 h;  2VVK A;  3CBP A;  1ZSZ B;  2A0F B;  1KD1 C;  3UPU A;  2GCX A;  2ZPF B;  4J9E A;  5GAO r;  2O31 A;  3MEA A;  4Y91 A;  3C0C A;  3SWN C;  5EG2 A;  4CC7 A;  3I5S A;  3LX7 A;  4RTW A;  1PWT A;  5KYU B;  3M5A A;  1JJ2 A;  1Y0M A;  2BZ8 A;  3F70 A;  3OYK A;  3MP6 A;  4F7U E;  3CC4 A;  4D8K A;  4PL6 A;  1CSK A;  3CCU Q;  2CT3 A;  3CCJ T;  2KMT A;  2BZY A;  1WQ7 A;  1B34 A;  4OP0 A;  4B9W A;  1VQP Q;  2XMF A;  4N4I A;  5HK0 A;  1VQP A;  3A98 A;  3EH2 A;  3CMA A;  3EGD A;  3CCU T;  1HJD A;  3CCJ Q;  1VQL A;  2KEA A;  4FL6 A;  2OTJ A;  2W0Z A;  3MET A;  2H8H A;  4C0D C;  1UGV A;  4M7A A;  1LJO A;  3HL8 A;  2BKD N;  4RTX A;  2EAY A;  3A2Y A;  4JJD A;  3QJY A;  1WJS A;  2HL5 C;  3OYH A;  1KC8 U;  4OGC A;  1OZ2 A;  1KD1 R;  1SHF A;  1N8R C;  4ZGE B;  1WQW A;  3SFM A;  3DB3 A;  3CCL Q;  5GAM e;  1OUL A;  2DL8 A;  4JPB W;  2K7A A;  1BI0 A;  3RDV A;  1S72 A;  3PVQ A;  1U1S A;  5C6S A;  3J7A F;  1Q82 U;  1D1C A;  1UGP B;  4M7A G;  5I22 A;  4IUT A;  3EG9 A;  1RAF B;  4ORZ A;  2WP7 A;  2DL3 A;  4PJO B;  2OI3 A;  3VKI A;  4J83 A;  4M75 F;  2CKK A;  2CSQ A;  4LUD A;  1H92 A;  3EHQ A;  2BTT A;  2CZ7 B;  2CH4 A;  3O98 A;  2CP2 A;  1VQ6 A;  4EOB A;  2O4X A;  2GQI A;  1UHC A;  4C8Q D;  1WIE A;  2D8J A;  2GF7 A;  3QII A;  5GAO q;  2EQJ A;  3ER0 A;  3CC2 T;  2LJ3 A;  4Z88 A;  1VQK A;  3MEU A;  1SHG A;  4Z89 A;  2VPM A;  3KFV A;  1BB9 A;  1BI1 A;  2EJ9 A;  2J6O A;  2DO3 A;  4HVU A;  2AZS A;  4QQD A;  5DLO A;  1WHJ A;  2KY9 A;  3QWY A;  1C1A A;  4C92 G;  1QVF A;  1YIJ T;  3CBM A;  5HK3 A;  2ZPE B;  3NGP A;  2LRJ A;  1NLP C;  2O88 A;  4DEY A;  5GAN g;  2LRQ A;  3H9N A;  4A4E A;  3GP8 A;  2YRD A;  4RG8 A;  1QVP A;  5CKD A;  4F7U G;  2MWP A;  2ZZD A;  4O6J A;  3OYN A;  4A4G A;  1KFZ A;  2WAC A;  4C92 B;  4C5I A;  3CD6 Q;  3JCM X;  4F14 A;  2ECZ A;  5FLX E;  4Y28 E;  2R57 A;  4PKC C;  1YFN A;  4FW1 A;  2K3X A;  2V26 A;  3URG A;  2XD0 A;  1OPL A;  4QQ6 A;  2L2P A;  3QZ9 B;  1XQH A;  3PVL A;  1NYF A;  4C8Q E;  2VKN A;  3QWX X;  2HBP A;  5GAO l;  4X1V A;  2V1Q A;  1RL2 A;  1OQK A;  1UHF A;  2RQR A;  4E6R A;  5J3B A;  3M54 A;  4XAX B;  2QYZ A;  3OYG A;  1YJN A;  4WCI A;  3CC7 A;  5A2Q E;  3PNW C;  4M78 G;  4EMK B;  2RJD A;  2FRW A;  3JB9 I;  2E10 A;  4F0W A;  3P8H A;  4OB3 B;  2VGM A;  4BE1 A;  2HEQ A;  4LD9 K;  2IVW A;  3EBQ A;  1X69 A;  1Q81 C;  3BY7 A;  4ME7 A;  1TS9 A;  2ABL A;  4XTX A;  2XG8 D;  1G8X A;  3PIP A;  3RBB B;  3UAT A;  3PMT A;  1M8V A;  2CZ1 B;  1VYT A;  2M0O A;  3LH5 A;  4X9C A;  4OMM A;  4ANJ A;  1B34 B;  5LL6 S;  3CC4 T;  1Y96 B;  2DD5 A;  3R6N A;  4F7U A;  1ZSZ C;  4DBH A;  3QHS A;  5LJ5 e;  3EFR A;  1D09 B;  2RHY A;  3OS1 A;  4JJN K;  3FB9 A;  1UJ0 A;  3CME Q;  2WSF E;  3PT9 A;  3RKY A;  2Z0W A;  5KYX B;  3TQ7 P;  3CXC S;  3I56 Q;  1QW1 A;  2VWF A;  4OMQ A;  2FEI A;  4PFO A;  2DNU A;  1M27 C;  3FRN A;  3V7R A;  5M9O A;  4BE0 A;  1NG2 A;  5LJ3 e;  1QVF S;  3VS0 A;  3JCM c;  1M5Q 1;  3OYA A;  1RAA B;  3EFO A;  5FRM A;  2X4J A;  5GMK h;  2K79 A;  1VQO Q;  2E3H A;  3GPL A;  4C5E A;  1Q81 R;  2ROL A;  1BKB A;  5CCA A;  2ENM A;  2XDB A;  3OW2 P;  2OTJ Q;  1VQM Q;  4EQ8 A;  4QQG A;  1VQ6 Q;  3OS5 A;  4ZTJ A;  3OYJ A;  1RUW A;  4RTY A;  4Q5W A;  3G6E Q;  4HCZ A;  5J26 A;  3D7S B;  3JV3 A;  1BIA A;  2E64 A;  4OB1 B;  3JB9 F;  1PCX A;  1JEG A;  1XNI A;  2L3Q A;  2LJ0 A;  4DQ2 A;  2JMC A;  5LJ3 g;  3MCA B;  4CC2 A;  2P0K A;  3RNJ A;  1VOM A;  4C92 E;  5GAN f;  4M77 F;  5DY9 A;  1YJ9 T;  1WZO A;  2B86 A;  2XI9 A;  3RUX A;  3A8L B;  1OPK A;  4XTV A;  2BUD A;  2RQW A;  1PKT A;  1GBR A;  3CEY A;  4CI0 C;  1N9S A;  1I1J A;  4OB2 B;  4M7D B;  1QWF A;  3JAM E;  1X6O A;  4PFZ A;  1X27 A;  1HD3 A;  2VUB A;  4J9G A;  2XHC A;  3EG2 A;  2HQX A;  2PZ1 A;  2FZK B;  2GFU A;  1BCM A;  3OSV A;  1KC8 R;  4RCC A;  1VQL Q;  4M7D C;  1JRI A;  2D8H A;  2JNG A;  2K9G A;  2G6F X;  2JXB A;  2RJC A;  4E7S A;  4M77 A;  1LCK A;  4PNO A;  1KHC A;  3OYY A;  2HQE A;  2GBQ A;  1TH7 A;  2KI7 A;  4M78 B;  5GAN 5;  2X3W D;  4IUV A;  2J05 A;  3LGF A;  5GAN 3;  5IT9 E;  1M90 U;  4D8D A;  3M4Y A;  4FM4 B;  1K73 C;  3GNF B;  2QQS A;  3M53 A;  4DBQ A;  1K76 A;  2C0T A;  2RHU A;  1S1N A;  1M2V B;  4J9H A;  2KRM A;  1NPP A;  2X4X A;  1MMA A;  3HRT A;  2P0P A;  2ATC B;  3X26 B;  2OTL T;  2KQW A;  1WYX A;  2LNV A;  4FIB A;  1PRM C;  4M78 C;  2CT4 A;  4DEX A;  3MEV A;  2EQI A;  2NUZ A;  1B3Q A;  3V7S A;  3CCL A;  1QLY A;  3PBI A;  5FU6 C;  1QVG P;  1SPK A;  4OMP A;  4HCK A;  4FSX A;  3A30 A;  1S72 T;  5HCK A;  1H64 1;  2LCC A;  2ZPB B;  1R77 A;  3OYE A;  4F7U F;  4E2F B;  3J81 E;  4E7Z A;  2EJG A;  4M75 C;  4F4M A;  5GMK l;  2V8J A;  1VQP T;  3EGU A;  1ZA2 B;  3REA B;  2EGE A;  4XU2 A;  1U1T A;  1QCO A;  2JT4 A;  2R58 A;  5D6Y A;  2VB6 A;  3EG9 B;  4N4G A;  2FO0 A;  1EZZ B;  3TRE A;  4PJO G;  1VQ7 Q;  4XTY A;  1Y57 A;  4A53 A;  4PJO E;  3QSU A;  4HFL A;  1JQQ A;  3VS6 A;  1RAG B;  4CRI A;  5DLQ E;  1N6A A;  3ZL7 C;  3OYB A;  2M02 A;  1BI3 A;  1QP3 A;  1AT1 B;  1VQ6 T;  4M7A F;  1Y7X A;  4HZ9 A;  4BAC A;  2DJQ A;  1H8K A;  2JM8 A;  2LT4 A;  4EQA A;  1VIF A;  4XU1 A;  5L23 A;  4E7H A;  1IRX A;  1LPL A;  4M75 G;  3QPH A;  4B9X A;  3TCJ A;  4C5H A;  3ZBD A;  2ZPG B;  2CP5 A;  4AMC A;  3UDC A;  2LQ8 A;  2LCS A;  1GL5 A;  4AFZ C;  5CO7 A;  4AFQ C;  5A0L A;  2M51 A;  1FMV A;  3MPU B;  3VJP A;  2F2V A;  1MV3 A;  5IHK A;  2KT8 A;  3CXC A;  2LCL A;  1K4U S;  1WA7 A;  3VRZ A;  4IUQ A;  2PUK B;  2QTX A;  4HFK A;  4FT2 A;  1A0N B;  1NE8 A;  4F16 A;  2DTH A;  2LTO A;  4C92 A;  1BI2 A;  2F5T X;  1FX7 A;  2PVG B;  2VXF A;  3JCM g;  3DLL A;  3JCM f;  1T0H A;  3EHR A;  4HXJ A;  2DIL A;  3NHN A;  4M7A E;  3X28 B;  2RK2 A;  1TUG B;  2DZ9 A;  3FC3 A;  3OW2 S;  3DKM A;  1OX9 A;  4J32 A;  2JS0 A;  3SD4 A;  4C8Q B;  2NLU A;  3M0Q A;  2K57 A;  3VS5 A;  1Z9Z A;  1GRI A;  4JUR A;  4RTZ A;  1RAH B;  1NJI U;  2L3S A;  4EDU A;  4FYW B;  3M0T A;  1D1B A;  1G2B A;  2XIV A;  2RMO A;  1PHT A;  2EQK A;  1W1F A;  4J6W A;  4M75 A;  1T3S A;  3EFS A;  3FJP A;  2OAW A;  2QGF B;  3CXC P;  5L8R E;  2JTE A;  1RAI B;  3O5Z A;  3JB9 J;  2KAF A;  3A1P A;  2K3B A;  2BZX A;  1NLO C;  2YUO A;  2FRY A;  2FPD A;  2YUN A;  3OS0 A;  5HY6 A;  2V1R A;  1YIT Q;  1WHH A;  2CUB A;  1GCP A;  4RG2 A;  3VS2 A;  1V76 A;  2YLB A;  3BE3 A;  4ZTF A;  3E19 A;  4J9F A;  3UT1 A;  3OYM A;  4J30 A; 
#chains in the Genus database with same CATH homology
 1K9A A;  4HZB A;  3U23 A;  2LNH B;  3I5R A;  4HPE A;  1AVZ C;  1X6B A;  1K0X A;  1KFZ A;  1FMK A;  1NM7 A;  2CSI A;  1H3H A;  1RLP C;  1X2Q A;  4F14 A;  1U3O A;  2K2M A;  4KRT A;  2CDT A;  2MIO A;  3EG0 A;  3VRY A;  2ECZ A;  1WDX A;  1SEM A;  1PKS A;  2D1X A;  5ECA A;  1OPL A;  1WLP B;  2IO7 A;  2L2P A;  1E7O A;  3H41 A;  3PVL A;  1NYF A;  3VS7 A;  4F17 A;  2IOB A;  4CT3 A;  2VKN A;  2ESW A;  3QWX X;  2RNA A;  3M0S A;  4J9C A;  4X1V A;  2V1Q A;  1VYV A;  4RUG A;  3IQL A;  4RTU A;  1NEG A;  1UHF A;  2EYX A;  2RQR A;  3M1U A;  3M0R A;  2EKH A;  4QT7 A;  4E6R A;  2HCK A;  4WCI A;  2FPF A;  1M3A A;  2EBP A;  1M3C A;  5IHN A;  2FRW A;  4CGK A;  1TUC A;  2DBM A;  1YCS B;  4F0W A;  1UDL A;  2IOA A;  2HEQ A;  1GFC A;  1X69 A;  4GBQ A;  4JZ3 A;  2DL7 A;  2PTK A;  2ABL A;  2EVR A;  4FGE A;  1HSQ A;  5IXF A;  2JMA A;  1M8M A;  3RBB B;  3UAT A;  2RPN A;  2GTJ A;  1AWO A;  1VYT A;  3LH5 A;  4CC3 A;  4OMM A;  1N5Z A;  4Y92 A;  3R6N A;  4AG2 C;  2YDL A;  2YUP A;  1NEB A;  2M0Y A;  3EG3 A;  3H0F A;  4J9I A;  4R0K A;  2PNI A;  4IIO A;  3I9Q A;  4EIK A;  1ZUY A;  4JJB A;  3KW0 A;  1UJ0 A;  1FYN A;  5GJW B;  1RLQ C;  4Q4T A;  1E6H A;  1JXO A;  1PNJ A;  2KNB B;  2YUQ A;  1MV0 B;  2FPE A;  2DMO A;  4AFS C;  2VWF A;  4OMQ A;  2FEI A;  2DNU A;  1M27 C;  1NG2 A;  4OML A;  4RTV A;  1GFD A;  1ZSG A;  1ZX6 A;  4RTT A;  3VS0 A;  2L0A A;  1K0S A;  1CKB A;  1W70 A;  1ZUK A;  2SEM A;  2K79 A;  2CUD A;  1TG0 A;  1RI9 A;  2ROL A;  4CSH A;  2ED0 A;  4FSS A;  2ENM A;  3NE0 A;  4LE9 A;  4OMN A;  4EQ8 A;  1BBZ A;  2C0O A;  1UEC A;  1RUW A;  4RTY A;  4LN2 A;  3M0U A;  1AWX A;  2YSQ A;  3JV3 A;  4M4Z A;  2MCN A;  3VS1 A;  1UTI A;  1JEG A;  3UF4 A;  4F0V A;  5EC7 A;  2L3Q A;  4HVV A;  2LJ0 A;  2KBT A;  1E6G A;  2QDL A;  2JMC A;  5IHI A;  2O9S A;  4CC2 A;  4A63 B;  2DLP A;  1QCF A;  5FW9 A;  3RNJ A;  2C0I A;  2LJ1 A;  5I11 A;  2B86 A;  1GCQ C;  4AG1 C;  4OMO A;  1OPK A;  2O9V A;  3VPJ A;  3VS3 A;  2DM1 A;  1PKT A;  2RQW A;  2OJ2 A;  1GBR A;  1PRL C;  1I1J A;  5FWC A;  3H0I A;  3TVT A;  1QWF A;  2GNC A;  1WX6 A;  2KXD A;  3UA7 A;  1WFW A;  1OEB A;  1SRM A;  3NPF A;  2KRN A;  2RQU A;  1X27 A;  2LX7 A;  2DRK A;  3SEM A;  1HD3 A;  1ZUU A;  2A36 A;  4FGD A;  2SRC A;  2AK5 A;  1YWP A;  4J9G A;  1ARK A;  2VPS A;  2EGA A;  1KIK A;  3H0H A;  3EG2 A;  3SHW A;  2DE0 X;  2DF6 A;  2PZ1 A;  1T0J A;  4LNP A;  3TSW A;  1JXM A;  1AWW A;  1JO8 A;  1AD5 A;  2K6D A;  4IIM A;  2LQN A;  1WXB A;  2EPD A;  4J9B A;  1UE9 A;  2D8H A;  1M30 A;  2K9G A;  2KT1 A;  2G6F X;  2JXB A;  1ZBJ A;  1LCK A;  2JW4 A;  4FQA A;  4JXB A;  5FWB A;  3ULR B;  4OLK A;  2RQV A;  2GBQ A;  1Z9Q A;  2GTO A;  5GJV B;  1ABQ A;  2X3W D;  4LJ1 A;  2J05 A;  1OOT A;  4D8D A;  1OV3 A;  2LMJ A;  2W10 A;  1QKW A;  4FGI A;  1K76 A;  1EFN A;  1B07 A;  2C0T A;  1U06 A;  2RQT A;  4Q4G X;  1AZE A;  1YP5 A;  1SSH A;  1S1N A;  2E5K A;  4J9H A;  4Q4N A;  2KRM A;  1G83 A;  2KRO A;  1TUD A;  3S0Q A;  4LUE A;  1WYX A;  2EYW A;  2ED1 A;  3FJ5 A;  1PRM C;  2P4R A;  4FDY A;  1KJW A;  3I35 A;  2CT4 A;  1CKA A;  4DEX A;  2EQI A;  2F2X A;  2NUZ A;  2D0N A;  2A08 A;  1AEY A;  1GCQ A;  3TSZ A;  1B3Q A;  1WI7 A;  1QLY A;  3PBI A;  2IO9 A;  1IO6 A;  2IF6 A;  1QKX A;  1I07 A;  3CQT A;  1SPK A;  3PE0 A;  4OMP A;  4HCK A;  1XOV A;  3A30 A;  2J6K A;  2AZV A;  5HCK A;  4J9D A;  1UFF A;  1WXU A;  1T3L A;  4CC4 B;  1WXT A;  1ABO A;  4F4M A;  2VVK A;  2RN8 A;  3EGU A;  3NMZ C;  4J9E A;  3REA B;  2O31 A;  3VS4 A;  3C0C A;  2EGE A;  1VA7 A;  2DA9 A;  2JT4 A;  3I5S A;  4CC7 A;  4RTW A;  1PWT A;  2HSP A;  2EGC A;  2FO0 A;  1Y0M A;  2BZ8 A;  1Y57 A;  1AOJ A;  1V1C A;  1AZG B;  2JS2 A;  4FQB A;  1JQQ A;  2KYM A;  3VS6 A;  3M0P A;  4D8K A;  2VOB A;  1X2K A;  3GBQ A;  1BK2 A;  2ROT A;  1CSK A;  2CT3 A;  3ZL7 C;  1KSW A;  4ZNX A;  4ESR A;  2BZY A;  4HZ9 A;  2XMF A;  3EG1 A;  2DJQ A;  3A98 A;  1H8K A;  2JM8 A;  1ZLM A;  1YWO A;  4EQA A;  2J7I A;  5L23 A;  3REB B;  1UJY A;  2KR3 A;  2A28 A;  1HJD A;  2LCS A;  1GL5 A;  4AFZ C;  1YNZ A;  4AFQ C;  2M51 A;  2KEA A;  3VPI A;  2W0Z A;  4JJC A;  2H8H A;  1UGV A;  2KYB A;  2F2V A;  2K3A A;  1MV3 A;  5IHK A;  1GBQ A;  2DBK A;  2KT8 A;  1AWJ A;  2IO8 A;  3GT2 A;  4RTX A;  3A2Y A;  2CRE A;  4JJD A;  3THK A;  2A37 A;  1K4U S;  1WA7 A;  1QWE A;  2AKL A;  3VRZ A;  1YN8 A;  2EYZ A;  1SHF A;  2I0N A;  2DVJ A;  1W6X A;  3I86 A;  2YT6 A;  1A0N B;  1U5S A;  1JU5 C;  2F2W A;  4HVW A;  4F16 A;  1X43 A;  2MOX A;  4AFU C;  2RF0 A;  4JZ4 A;  2DL8 A;  4JPB W;  1X6G A;  2K7A A;  2DRM A;  1T0H A;  2EYY A;  3EHR A;  3PVQ A;  4HXJ A;  3A2Z A;  2DIL A;  3NHN A;  1SRL A;  2DL5 A;  1BU1 A;  2JM9 A;  5I22 A;  4ORZ A;  2O2O A;  2DL3 A;  4GLM A;  2JS0 A;  2OI3 A;  3M0Q A;  2GGR A;  2KRS A;  2CSQ A;  2K1G A;  2DX1 A;  3VS5 A;  4LUD A;  1Z9Z A;  2LQW A;  3EHQ A;  1H92 A;  2HDA A;  1GRI A;  1UG1 A;  2DYB A;  2BTT A;  2KE9 A;  4RTZ A;  2NWM A;  1I0C A;  3O98 A;  2CH4 A;  2L3S A;  4EOB A;  2IIM A;  3M0T A;  1M3B A;  2J06 A;  2GQI A;  2L3P A;  1G2B A;  1K1Z A;  2XIV A;  3UA6 A;  1UUE A;  1UHC A;  2KXC A;  2RMO A;  1PHT A;  1WIE A;  1W1F A;  2CH4 W;  2D8J A;  2J6F A;  1T3S A;  1J3T A;  4Z8A A;  2LP5 A;  2LJ3 A;  2OAW A;  4Z88 A;  2JTE A;  1SHG A;  4Z89 A;  3O5Z A;  2VPM A;  4K11 A;  3KFV A;  2LZ6 B;  1BB9 A;  2K3B A;  2BZX A;  2AKK A;  1NLO C;  2J6O A;  2YUO A;  2AZS A;  2FRY A;  4HVU A;  2FPD A;  2YUN A;  5IH2 A;  2DL4 A;  3QWY A;  5IXB A;  1NYG A;  2HBW A;  2EW3 A;  2V1R A;  3PBC A;  3NGP A;  2LRJ A;  2CUB A;  1GCP A;  1NLP C;  1VYU A;  3VS2 A;  2O88 A;  2X3X D;  4DEY A;  2FG0 A;  4J9F A;  2KGT A;  1MUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...