3PVQA

Crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
297
structure length
295
Chain Sequence
b'AYGVVHISVCNMRDEGKFTSGMSTQALLGMPVKVLQYTGWYEIQTPDDYTGWVHRMVITPMSKEKYDEWNRAEKIVVTSHYGFTYEKPDDDSQTVSDVVAGNRLKWEGSKGHFYKVSYPDGRQAYISRHISQPESKWRASLKQDAESIIKTAYTMIGIPYLWAGTSSKGVDSGLVRTVLFMHDIIIPRDASQQAYVGERIEIAPDFSNVQRGDLVFFGRKATADRKEGISHVGIYLGNKRFIHALGDVHISSFDPEDEYDEFNTGRLLFATRFLPYINKEKGMNTTDHNLYYLHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl-peptidase VI
publication title Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 82
structure length 295
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3pvqA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3pvqA02
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 3pvqA03
4Z89A 2W10A 1U06A 2AZSA 3O98A 1NYGA 2LCSA 4CT3A 2EBPA 3UF4A 3I5SA 3KFVA 5GJWB 1UJYA 4FDYA 1OPKA 2DE0X 3SHWA 1X43A 2KT1A 1T3LA 4J9FA 5FWBA 1I07A 2AK5A 2M0YA 1GFDA 2RNAA 1UDLA 2C0TA 2J05A 4FGIA 3GT2A 3RNJA 2RPNA 4FGEA 2M51A 3M0UA 4LE9A 2DILA 3H41A 1AWJA 4CC7A 1K4US 2BZ8A 3S0QA 1M27C 4Q4NA 4RUGA 3A30A 4D8DA 1WFWA 3VS4A 3FJ5A 5IHIA 2GGRA 2KNBB 2HSPA 4RTYA 1WA7A 2ESWA 1GBQA 1Y57A 3ULRB 4J9HA 4J9GA 2O9SA 1JEGA 3M1UA 1M3BA 2DJQA 4OMOA 2ED0A 2KRMA 3PVQA 1PKSA 3EHRA 2F2WA 3VS2A 2LP5A 2MIOA 2NUZA 2OI3A 5HCKA 1SSHA 5L23A 1CKBA 2LQNA 3NMZC 3VS5A 3IQLA 3H0IA 1GL5A 2OAWA 3O5ZA 5ECAA 1W70A 1RUWA 2CT3A 1WI7A 4AFQC 4JXBA 1BB9A 1G2BA 3VS3A 2DL4A 2C0OA 3EG3A 1UHFA 4JJDA 5IHNA 4RTUA 4GBQA 3VRYA 3ZL7C 3UATA 4DEXA 1X2QA 5GJVB 2IO7A 2JT4A 1H92A 4HZBA 2YUQA 2GTOA 4J9BA 2EYXA 1W1FA 2JTEA 2EYZA 3CQTA 1ABQA 4OLKA 4RTVA 1VYVA 2GNCA 2YT6A 1VA7A 1QWEA 2EYWA 3I35A 2EGEA 2FEIA 4K11A 3M0QA 4Q4GX 2L2PA 1YP5A 4CC2A 2IO9A 1HSQA 1VYUA 2X3WD 2F2XA 2DYBA 3H0FA 2W0ZA 2CUBA 2E5KA 2RN8A 2EKHA 1BK2A 4HXJA 2F2VA 1AVZC 2P4RA 2YUNA 3PBIA 4OMPA 3REAB 1WDXA 1Y0MA 1X2KA 1FMKA 2SEMA 2LZ6B 4OMQA 1B07A 2KRSA 1NYFA 2LQWA 2YUOA 3THKA 1SEMA 1AWOA 2KYMA 1YN8A 3I5RA 4CSHA 2A37A 2DL7A 2GTJA 1I1JA 2G6FX 3A2YA 2CH4W 4JZ4A 2D0NA 2K9GA 1V1CA 4F16A 2V1QA 4X1VA 1YNZA 1K0XA 1MV3A 4KRTA 2K6DA 2VOBA 2JM9A 4AG2C 1GRIA 1KSWA 1E7OA 1JQQA 2FRYA 1ZUKA 2VVKA 2RQWA 2YSQA 3UA7A 4HVWA 1U5SA 2EYYA 1SRMA 4CC4B 4DEYA 2LJ1A 2J6KA 2JMAA 2PZ1A 1GFCA 1T0JA 2J7IA 2AKKA 2KXDA 2CH4A 2ENMA 1KFZA 1K76A 4FQBA 4J9IA 1OOTA 2D8HA 4JZ3A 1OV3A 2EGAA 2LMJA 1W6XA 3QWYA 1WLPB 1K0SA 3EG1A 4GLMA 3JV3A 2CUDA 2DBKA 2DRKA 1X69A 1GCPA 1TUCA 2ECZA 2FPFA 1M3CA 2VKNA 1A0NB 1UTIA 2KEAA 2EQIA 4EIKA 3H0HA 1QLYA 4JPBW 2DMOA 2J6OA 2FPDA 1Z9ZA 1NLPC 4F0WA 2V1RA 3R6NA 1UHCA 1QWFA 2K2MA 2CSIA 2KRNA 2YUPA 2HDAA 3C0CA 3VS6A 1AEYA 3UA6A 4HCKA 4F14A 2J06A 1YWOA 3EGUA 2DLPA 1ARKA 1UG1A 1T0HA 1AOJA 1N5ZA 2EPDA 2QDLA 3VPIA 3EG0A 1GBRA 3VPJA 4HVVA 1AWXA 1QCFA 2DBMA 3KW0A 3GBQA 2IIMA 2KXCA 3REBB 3SEMA 2O88A 2DVJA 1ZUYA 2K79A 4M4ZA 1WXBA 2C0IA 2CREA 3NE0A 1SHFA 1TG0A 3PVLA 2JS0A 2L0AA 2MOXA 2JM8A 4Z88A 2LNHB 3TSZA 1QKWA 2OJ2A 3NPFA 2IF6A 2YDLA 1M3AA 2A08A 1BU1A 2B86A 2RQUA 3PBCA 2D1XA 2HEQA 2HCKA 4ORZA 1G83A 2JW4A 3EG2A 1I0CA 2IO8A 2DL5A 1SPKA 2DF6A 2LJ0A 1EFNA 2RQVA 2D8JA 2FG0A 2CSQA 2L3QA 2PTKA 4RTXA 4F4MA 4A63B 1ABOA 1QKXA 2I0NA 2FPEA 1AD5A 1E6HA 3EHQA 1AWWA 3VS0A 1H3HA 2AZVA 2IOBA 4LUEA 2L3PA 2EGCA 1UECA 3TSWA 1OPLA 2GQIA 3U23A 1CKAA 2DL3A 1WYXA 2KBTA 3LH5A 2H8HA 4RTZA 1B3QA 1PNJA 2RMOA 1M8MA 2VPMA 2O9VA 4J9EA 2HBWA 2DX1A 1UUEA 4IIOA 2MCNA 5FW9A 2LRJA 2DM1A 2FO0A 1MV0B 2KGTA 1WIEA 2DRMA 3M0SA 1JU5C 1SHGA 3M0PA 1ZSGA 2KE9A 1OEBA 4EQAA 5FWCA 4R0KA 2KYBA 2ED1A 2DA9A 4EOBA 1X6BA 4QT7A 2RF0A 1JO8A 4CGKA 4F17A 1UFFA 1RLQC 2XMFA 1JXMA 2KROA 4RTTA 5IXBA 2KT8A 3M0RA 2A36A 2FRWA 1BBZA 5IXFA 1AZGB 2BTTA 1U3OA 4Z8AA 2O31A 2K7AA 1PRMC 4IIMA 1CSKA 2ABLA 3M0TA 2K1GA 2BZYA 5IH2A 1NM7A 3NHNA 1MUZA 2GBQA 1YCSB 2A28A 4D8KA 2JS2A 3A98A 1H8KA 2NWMA 1IO6A 1FYNA 4RTWA 1WXUA 2JMCA 2RQTA 4AG1C 4HZ9A 1GCQA 1ZUUA 2LJ3A 4HPEA 1NEGA 3VRZA 4J9DA 1GCQC 1NEBA 4LN2A 1TUDA 1HD3A 5I11A 2IOAA 2EVRA 1YWPA 4Y92A 3RBBB 2ROLA 1M30A 4ZNXA 1KIKA 3VS7A 1X27A 2DNUA 1UE9A 2AKLA 2CT4A 1E6GA 4OMMA 3QWXX 1K1ZA 3TVTA 4E6RA 5EC7A 1SRLA 4CC3A 2CDTA 2LX7A 1PRLC 4JJCA 1X6GA 1XOVA 4HVUA 4ESRA 1KJWA 2PNIA 4FSSA 2L3SA 1HJDA 4J9CA 4AFUC 2XIVA 1UJ0A 2ROTA 4FGDA 4LJ1A 2JXBA 4AFZC 1AZEA 2K3AA 2EW3A 1NG2A 4FQAA 5I22A 4JJBA 2J6FA 2BZXA 2KR3A 1WXTA 1UGVA 2RQRA 1PKTA 4OMLA 1T3SA 4AFSC 4F0VA 1RI9A 1J3TA 1LCKA 2VPSA 1Z9QA 1S1NA 2SRCA 5IHKA 2VWFA 1ZX6A 1JXOA 1RLPC 2O2OA 3VS1A 4LUDA 3I86A 4LNPA 4EQ8A 1ZLMA 1WX6A 1VYTA 4OMNA 1PWTA 1NLOC 2X3XD 3A2ZA 3NGPA 3I9QA 1PHTA 1K9AA 2K3BA 4Q4TA 4WCIA 2DL8A 3PE0A 1ZBJA
chains in the Genus database with same CATH superfamily
4N4GA 4MDXA 3HL8A 2E1HA 5FU7B 2CKKA 5LJ5h 1M8VA 2X4XA 3FLGA 4ANJA 1IHVA 2LCSA 4AMCA 2OTLA 4M77F 2EBPA 2CP3A 2HBPA 3MP8A 1OPKA 4E7KA 4BDYA 2MMPA 3EH2A 4J6WA 2KT1A 3CCEA 1BYMA 2DTHA 1I07A 5KE3A 2M0YA 1YJ9A 2YRDA 4OGEA 1Q7YR 2M51A 1K4US 2DD4A 4DBRA 2QEXT 4D8DA 1WFWA 1RI0A 3FJ5A 4L6V5 3M4YA 4EMKA 4RTYA 2JNGA 3M57A 4M78G 4N4IA 1JEGA 3EH1A 1OU9A 1PKSA 1BIAA 1VQ6A 4LDWA 2P84A 4M78D 1WHHA 4QVCA 3TQ7P 4CI0C 5L23A 3MKDA 1TXQA 1D0XA 2LQNA 2XDDA 1QCOA 2XU8A 4NL2A 1QCNA 3BDUA 1GL5A 1YJNQ 1VQ5T 4C5HA 1YITT 5ECAA 2CT3A 1WI7A 3CC4Q 3LGLA 4QVDA 1BB9A 2YRCA 1NJIU 3VS3A 3EG3A 1S72T 4EDUA 5IHNA 1NZ9A 4RTUA 2GFUA 4M75B 4GBQA 3CBOA 3ZL7C 1UGQB 1QVGS 4HZBA 3HPWA 2DXBA 4J9BA 5CKFA 2ZPIB 2EYXA 2FVUA 3OYMA 2VGMA 3CQTA 1ABQA 1VYVA 4BD3A 3OW2A 5IT9E 2GNCA 3J80E 1VA7A 2CP2A 1QWEA 3I35A 5GANj 3CCLT 2EGEA 2QA4Q 2MYSA 3ASKA 4LXCA 3MP6A 2L2PA 3CBPA 3G1JA 4C8QF 5A0LA 1HSQA 2X3WD 4FU6A 2E64A 2W0ZA 5GANh 2FZKB 4XTUA 3SDZA 2E5KA 2RN8A 2X4YA 2HQHA 2YUNA 4KH0B 2DD5A 2KRSA 1K8AR 3OW2P 1B7TA 3LWHA 3I5RA 4JLGA 4N4HA 4OB0B 3V7RA 2D0NA 3JCMQ 1V1CA 2KMTA 1YFNA 3RDVA 2CP5A 5LJ3g 5KYXA 3OYDA 3JB9H 1WPYA 1MV3A 2K6DA 4N0AC 2JM9A 4AG2C 2QEXQ 1AT1B 2BIVA 2EIFA 5AYFA 1E7OA 1JQQA 2DXCA 2FRYA 2VVKA 2LT4A 4RCBA 3UA7A 2ZPHB 2EYYA 1SRMA 1JB0E 1MGQA 1JRIA 1T0JA 5KYUB 1MHNA 4F7UE 4PJOG 2J7IA 2DXUA 1VQOT 4KBMB 4M75A 2RHUA 5GAN7 1YCYA 4PJOD 5L8RE 5GAMg 1X6OA 3OBYA 1LOJA 1TUCA 2ECZA 2R5MA 4AT1B 4JJNK 1VQ5Q 2MWOA 2L89A 1YITQ 4OMFB 1A0NB 1VQ9A 4IKFA 4XTVA 4JPBW 3E9GA 4F0WA 2H3EB 2EQMA 2VC8A 1NJIC 1S72Q 3QZ5B 3OB9A 2KI7A 1AEYA 1D3BB 3UA6A 1C6VX 1WGSA 2J06A 2V8IA 4KGVB 1Q86U 3OMGA 1M5Q1 3HRTA 1M1KR 3VPIA 4M7AG 5LJ5d 2QAZA 4HVVA 2QEXA 1I81A 2EQUA 3CCLQ 4M4ZA 5IAYA 2XDBA 4M7AD 1WXBA 2XD0A 4J32A 2VGNA 3MEWA 3N5BB 4CRIA 4OGCA 3EFSA 3QBYA 2MOXA 2D0QB 2LNHB 2QQ9A 4XTYA 1NPPA 1QVFP 2A08A 2LCLA 2WSCE 3CC7A 2HL3A 3JCMg 1VQLA 2DIGA 2JW4A 2DL5A 1M2VB 3JCMJ 1SPKA 1EFNA 1VQPT 3SFMA 3CC2T 2D8JA 2FG0A 4BACA 1Y96B 5GMKe 4A63B 1QKXA 4M77D 3A8HB 2Y4XA 1AD5A 1E6HA 4QW2A 2ZCFB 4ZTFA 1H3HA 2AZVA 3SWNC 2LX9A 3H8ZA 3U23A 1B3QA 3D7SB 4FYXB 1PNJA 1G3YA 2RMOA 3VYGA 2A0FB 3CMAA 1MMDA 2RHIA 4FM4B 4J9EA 3MCAB 4BDZA 2LRJA 4PLLA 1QW1A 2XICA 1VQ7A 1VQOQ 3OMCA 2F5KA 4LD9K 1D3BA 4PJNA 2WP7A 1JO8A 4CGKA 1HXDA 1RLQC 3S3OA 1WHGA 2XMFA 2KROA 2KT8A 4LDYA 4PL6A 2MAMA 2BTTA 1VQ8A 1G5VA 3FIFA 2DTOA 1PG5B 4IIMA 1WHLA 3C95A 4ZGEB 1BKBA 2K1GA 1NM7A 3NHNA 3CEYA 2GBQA 1YCSB 4QQDA 2JS2A 3A98A 1H8KA 2NWMA 1FYNA 3QKJA 1K9MR 3G4ST 1WXUA 2RQTA 1KQ2A 4AG1C 1Q86C 1ZUUA 2HL5C 4HPEA 1NEGA 1MMGA 4J9DA 1GCQC 1NEBA 5GANd 1M90R 1ZSZC 1TUDA 1M2VA 4OB2B 1BI0A 1UB4A 1Y96A 4HCZA 1KIKA 2X4JA 3CCST 3VS7A 1X27A 2AKLA 3OYBA 4OMMA 3QPHA 1K1ZA 3P8HA 4C8QG 2L5QA 2RK2A 2DXTA 2OTLT 1BCMA 1X6GA 4JJCA 4ESRA 3DKMA 1KJWA 1HJDA 4C8QD 2JXBA 1AZEA 3CCET 3OYAA 3NFCA 2K3AA 3OYEA 3CCQA 3LW5E 1VQPQ 1SG5A 4VUBA 4JJBA 2J6FA 2BZXA 3CC2Q 2DEUA 2KR3A 2MPXC 1BI3A 1YJ9T 3OQ5A 1WZOA 1RI9A 2HD0A 3MPUB 5KH6A 2O2OA 4DOWA 1R0CB 4O5VA 4F7UB 4OMNA 4M75F 1PSFA 2DKGA 4C0FA 1NLOC 4KGXB 4KH1B 4HA8A 3JSCA 4Z89A 4A53A 2LDMA 2COYA 2VYTA 3JCMb 4PJMA 2QQSA 2W10A 1VQ6T 4PFPA 1RAFB 2AZSA 4C92C 3O98A 2MF2A 1UEBA 2K5FA 2QDYB 3CBMA 1UJYA 1VQNA 4J6YA 4KUIA 1KC8R 7AT1B 1X43A 1M1FA 2RJDA 3RIRA 2DETA 4J9FA 5J39A 1O9SA 4N0AA 3A1PA 1GFDA 2C0TA 2GQVA 3RNJA 4FGEA 4OP0A 2EYQA 3JB9F 3H41A 2DAQA 4CC7A 2BZ8A 4O6JA 5CQYA 1ZHIA 3G4SQ 9ATCB 2XK0A 3VS4A 2GGRA 4C0DC 2KQWA 4XTZA 5D6YA 4J9HA 2O9SA 3M1UA 3DB3A 3SWNB 2X9HA 3UPUA 1OYXA 1G3WA 2KRMA 3CCSQ 5J3BA 3EHRA 3QDFA 2F2WA 1UGSB 1C0MA 3VS2A 3OYLA 2MIOA 3RESA 3MEUA 3EBQA 1QVGP 5GAN2 3A5ZB 2OTLQ 4F7UA 3L2WA 2QTXA 3NMZC 3ME9A 2WSFE 2M02A 4HFLA 1W70A 2LQKA 1RUWA 1OZ3A 1D1BA 3QXEB 3CCEQ 4E7HA 1DJ7B 2QG9B 4JXBA 1G2BA 2JZ2A 2DL4A 1YJ9Q 1X01A 3AT1B 4M7DE 3VRYA 3UATA 4XU0A 1Q95G 5GJVB 4R56A 2JT4A 4C5IA 4PJOE 2IO7A 3LX7A 1RACB 2EYZA 3BW1A 3FB9A 1VQKA 4FW1A 4OLKA 4RTVA 4ELZC 1C1AA 2YT6A 4D6WA 4M7AF 2EYWA 1KD1U 2RJFA 4IUVA 3NTKA 2ATCB 5FROA 2XG8D 1ZSZB 3QHSA 4M7DC 4J30A 3HRSA 1I5LA 3URGA 4FW2A 1VQ6Q 2F2VA 1AVZC 2P4RA 4FYYB 2QGFB 4FL6A 1WDXA 2NLUA 1X2KA 3PT9A 1Q81R 1NYFA 4MDWA 1YJWT 1SEMA 4QKUA 5LL6S 4KUDK 2VXEA 4CSHA 1VQ9T 2A37A 2DL7A 1VQ4A 2CH4W 2CZ7B 4RKUE 4E7LA 3S6WA 4F16A 2QASA 2VXFA 1K0XA 5M9OA 5GMKj 2EKOA 1IGUA 3V8KA 5KCOA 1M1GA 5GMKh 1ACMB 3RKXA 2RQWA 1K73U 3GIBA 3RR6A 4L5GA 2P0PA 3KBGA 4JUVA 1I8FA 1IRXA 1GFCA 4M77E 3JAME 3BDLA 2AKKA 2KXDA 2CH4A 1K76A 2YXYA 2CZ0B 3QYGB 1OOTA 4JZ3A 3WVDB 2EGAA 2LMJA 2XHCA 4B9WA 2XI9A 2EFIA 3EG1A 3CC7T 3JV3A 4X34A 1VQLT 2DRKA 1X69A 3Q1JA 2MK5A 4C92B 2EQIA 5KYWB 5KYYB 1MNDA 1F1BB 2FPDA 3FJPA 4M77C 2LVMA 4DOVA 1UHCA 2K2MA 1ZSZA 2KRNA 2YUPA 4XQ3A 1IZ6A 3E1SA 2P0KA 2JTFA 4F14A 3EGUA 1H3ZA 2DLPA 1T0HA 2OAUA 1N5ZA 2QDLA 2MWPA 3EG0A 2C06A 3EAEA 3MJXA 1GBRA 1AWXA 1Y71A 4BE0A 8ATCB 1OQKA 2PVGB 3CMAT 2RH2A 3G7ZA 3DLMA 1KD1C 3EGDB 1Q7YU 2OTJA 3VV0A 3GNFB 2DVJA 4M75G 2L8DA 3JB9I 2C0IA 2H3JA 2VV5A 4C0DB 3PVLA 2JS0A 2L0AA 1VQ7T 1WHJA 4Z88A 4FT4A 5J26A 1LJOA 4M75D 1I5OB 2OJ2A 1UGRB 3NPFA 1U1SA 3GP8A 5FRNA 2B86A 2RQUA 2HEQA 3CMEA 5CO7A 1G83A 3EG2A 4PK4A 2IO8A 2FB7A 5CK9A 1YJWQ 3QO3A 4J8OA 4MZPA 1VQ8T 1LPLA 4HFFA 1VQ9Q 4C0ZA 4RTXA 3WVEB 1ABOA 3JCMh 4LDVA 2FPEA 1HK9A 3EHQA 3MP1A 2QK0A 2YRVA 1D0YA 1AWWA 5LJ5g 4JRPA 2CP6A 3MEVA 3QZ9B 1PSEA 3JB9G 2LRQA 1KG1A 3S3MA 3L2ZA 1OPLA 5D6WA 4C8QE 2DL3A 2KBTA 2OX7A 3JCMX 3LH5A 2H8HA 4RTZA 5GAN5 2PVDB 4C92A 1K73C 5KYWA 5I2SA 1ZA1B 5KYYA 4BI3A 1IB8A 4IIOA 3JB9D 1IXDA 5FW9A 1RAHB 3F70A 1MNEA 2KDSA 1FXXA 1D09B 1SHGA 2KE9A 5FWCA 3V7SA 3R6OA 4GLKA 3HRUA 3OBWA 2QXFA 4NL3A 4EOBA 4ZN1A 1X6BA 4BI4A 2VASA 2RHZA 3UDCA 4F17A 4C8QC 3CC7Q 1VQLQ 4PNOA 5LJ3f 4NS5A 4M7DB 1JBMA 1GXIE 3CCQT 2O31A 3GOXA 3M0TA 2FZGB 1YJWA 1TSFA 1MUZA 2M1HA 4D8KA 2KAFA 2LJ3A 4FSXA 2LCCA 3C12A 5GAOp 5GAOn 4C5EA 4XU1A 3QJYA 2EVRA 4XAXB 3CMAQ 3A8MB 1WQ7A 1M30A 1Q7YC 4Y28E 4ZNXA 4Y91A 1RADB 5GAMf 2DNUA 1UE9A 3QUIA 1VQ7Q 4OB1B 2R5AA 1EX4A 5D7UA 4HVUA 1OZ2A 4EMHA 1VQNT 3WXMB 4FSSA 2L3SA 4J9CA 1N8RU 2ROTA 1XTDA 2HAXA 1NG2A 3LYIA 1VQ8Q 5I22A 2ZPFB 3BFMA 1NPRA 1UGVA 5GAN8 4J7FA 4X9DA 4F0VA 2JVVA 3NTHA 5GANg 1HYOA 2VPSA 5KYUA 1BIBA 4XU3A 3V8JA 2LQ8A 3JB9J 2VB6A 4PLIA 4M77B 1IREB 4LNPA 2K4YA 1ZLMA 4B9XA 4UC4A 4M7DA 3C4SA 3RKWA 2CGHA 2DEQA 3A2ZA 1AHJB 2Z0WA 3I9QA 1PHTA 1KK7A 4WCIA 5A0GA 3JCMf 6AT1B 1U06A 3VJPA 1M1KU 1NYGA 4PFZA 2RI3A 4CT3A 2WACA 4J5YA 5GJWB 3KFVA 4PKCC 4FDYA 4XU2A 2O01E 3SHWA 2HMAA 1T3LA 2JUFA 5FWBA 5FLXE 1ZQ1A 5GAMe 2E6NA 2M9UA 3CCQQ 3PFSA 1N27A 1EIFA 3E19A 4P5NA 4DQ2A 4LE9A 1AWJA 4QQ6A 3CXCA 3V8LA 3SD4A 4C5GA 3A30A 4FYWB 3CCJA 1VQKT 3M9QA 2G3RA 2KNBB 2HSPA 4JRKA 2ESWA 1GBQA 3NTIA 1Y57A 4FIBA 2COWA 3SB2A 3ULRB 5C0MA 4J9GA 4BE2A 1M3BA 2DJQA 1YI2A 2EQJA 3CPWA 2IVWA 3P8DA 1ZBXA 2LP5A 3EG9B 2NUZA 4QQGA 3H9NA 2LNVA 4BUGA 4QVZA 4BY6C 3JCMd 3FEOA 2RHYA 3IQLA 1VQNQ 2FHDA 2OAWA 2WSEE 3O5ZA 1N8RC 2YWWA 1VUBA 1PC0A 2NUTB 2ZPGB 3JCMe 1Y7XA 1VQ4T 2C0OA 1WHMA 4C8QB 5GAOl 4JJDA 2K5LA 4L59A 3ZBDA 4C92F 4ELYC 4DEXA 1X2QA 1Y07A 1H92A 4C0GA 2NUPB 2A7YA 2GF7A 2JTEA 1VIEA 1W1FA 3I55A 4M78E 2ZPEB 3KXTA 3OYYA 2QQRA 3CCUT 3OY9A 3L2UA 2FEIA 3X28B 4Q4GX 1I4K1 3MEAA 4CC2A 2EJ9A 2IO9A 2PUKB 4A4HA 1VYUA 1K9MU 2F2XA 2DYBA 2CUBA 3QIIA 4RMOA 4F7UG 1FX7A 2F5TX 3OYKA 2EKHA 1BK2A 1OI1A 1M1KC 3J7AF 4HXJA 4Z02A 3PBIA 4OMPA 3LLRA 4M78C 1ZA2B 4OMQA 3TU4K 2DK3A 3VUZA 2YUOA 2VUBA 4FYVB 1AWOA 2KYMA 3CCVT 3L42A 3LH0A 3M53A 2CP0A 1I1JA 2XKOC 1YIJA 1TWBA 2K9GA 1N9RA 1QMCA 4LD6A 2V1QA 3EG9A 2F1LA 1G3SA 2HQXA 1W2BS 4PJJA 4KRTA 3QJ6A 1YHQA 4PFOA 1LNXA 1KSWA 2MI6A 1VQKQ 4XTXA 2YSQA 2NUTA 2LT1A 1JJ2S 1TOVA 1U5SA 3BE3A 5GAN6 2OTJT 2J6KA 2BE7D 3PTAA 4KULA 2ENMA 3M5AA 4J9IA 4MMKA 3A8OB 2E4HA 2NUPA 1B34B 1W6XA 3QWYA 3CCMA 5GAN4 2K3YA 5GAOm 3CMET 2CUDA 4E7ZA 4MZMA 1GCPA 1W4SA 1M3CA 2VKNA 5I21A 3RMQA 4HFKA 2KEAA 5DM7R 1EZZB 1QLYA 3ZEHA 2DMOA 5I2MA 3HSBA 1Z9ZA 1VQ4Q 2V1RA 3R6NA 1QWFA 4IUQA 2CSIA 2AHJB 1VQMT 3VS6A 3X20B 1R0BG 4HCKA 5IN1A 1KC8U 3OYJA 4F04B 2JOYA 1ARKA 1UG1A 2EPDA 1AOJA 4EMGA 3CD6A 2E65A 1QCFA 3EGXB 1TS9A 2Y90A 2PUOB 2IIMA 2K57A 3CXCS 2KXCA 2E6ZA 3REBB 3CCUQ 2O88A 1IGQA 2K79A 3LGFA 3JCMV 4E7IA 2CREA 3NE0A 1K9MC 1SHFA 1TG0A 2DZCA 1R77A 1PM3A 1XNIA 1RAEB 3TSZA 1QKWA 4IUPA 2YDLA 1M3AA 4PJLA 3G6EA 1BU1A 3JRZA 2D1XA 2HCKA 3CPWS 1QQJA 1WJSA 1UGPB 3OYHA 4PJOC 3CCVQ 2RQVA 2CSQA 4JRIA 2M16A 4BY6B 2PTKA 4WTOB 2P0QA 2KSSA 1KHCA 1B34A 1OU8A 2BUDA 3SWNA 4M7AE 2L3RA 4LUEA 2RI5A 4A4EA 2L3PA 1UECA 3EFRA 3TSWA 1CKAA 1WYXA 3M58A 4B6MA 3INZA 2O9VA 3META 2RM4A 5LJ3j 2EAYA 2HBWA 4XTWA 2DX1A 1UUEA 2MCNA 1TUGB 2OTJQ 2FO0A 1WIEA 1XQHA 2BKDN 5LJ3h 3CCUA 1JU5C 4ATOA 1ZSGA 1OEBA 1Q82U 1NJIR 3TCJA 5CAIA 2KYBA 4M7AC 2ED1A 1M4ZA 4QT7A 2CZ6B 2RF0A 2HNIA 3CCRA 1KQSS 4V2SA 3EGXA 4RTTA 3CMEQ 5IXBA 2B8AA 1AZGB 2PVOB 4IUTA 4Z8AA 2K7AA 1PRMC 3OS2A 1CSKA 2ABLA 5CKDA 5GAMj 3GLXA 5IH2A 1M2OA 1TTHB 4M78B 5DY9A 3CCVA 2A28A 2RA2A 4E7JA 1VQMQ 2EWNA 1IO6A 1WJQA 4RTWA 4YTLA 2JMCA 1Q81U 5GAMh 1KC8C 4HZ9A 1GCQA 2HKQB 1MMAA 4C92G 3QYHB 2EJFA 3I56A 4LN2A 1HD3A 5I11A 5A0DA 2IOAA 1YWPA 4Y92A 5KYXB 2EQKA 2ROLA 4C92D 3QWXX 3HTRA 4OB3B 2Y4YA 5EC7A 2CP7A 4CC3A 3OYIA 2LX7A 2AIRB 1PRLC 2DTIA 2XIVA 4AFUC 1UJ0A 4FGDA 4AFZC 5GMKi 2DIQA 4FQAA 1M9SA 1WQWA 1RL2A 5KYNA 3OYFA 2DZ9A 4OMLA 1T3SA 3QSUA 1J3TA 3P8BB 1LCKA 1Z9QA 1U1TA 2SRCA 5IHKA 2VWFA 5D6XA 1JXOA 1RLPC 3OSSC 5AT1B 1VQMA 3I86A 3CCJT 1N9SA 2X4WA 3PNWC 1VYTA 5CKBA 2D6FA 1PWTA 2ZGWA 3L2QA 2K2VA 3UWNA 1K9AA 2K3BA 2HKNA 3TEEA 3HKSA 8AT1B 2DL8A 3X25B 1YI2T 3PE0A 1V76A 4M78A 4ZGDB 3MHXA 1G8XA 1Q82C 4X9CA 4F7UF 1QP2A 3UF4A 3I5SA 3OYNA 3A8LB 1YJNA 2DE0X 1Q86R 3DB4A 5CVIA 2PU9B 3CC4A 5LJ5f 1BCOA 2QGGA 3VKIA 2AK5A 1OX8A 1UDLA 2RNAA 2J05A 3HP9A 4FGIA 3H6ZA 3GT2A 3ER0A 2RPNA 2ZAEA 3HFNA 3M0UA 2DILA 3EGDA 1V29B 3L2RA 3S0QA 4PJOB 1M27C 4Q4NA 1YBYA 4RUGA 4M7DG 1Q81C 1N8RR 3M56A 2KY9A 2DVEA 5IHIA 3I55T 1TU0B 3TREA 1WA7A 4ZN3A 3CPFA 1VOMA 4HKEA 2GFAA 5CIUA 2QA4A 5EG2A 3JCMW 1K8AU 1MMNA 4M7DD 5CCAA 4OMOA 2ED0A 3C94A 4HCCA 4IUUA 3PVQA 3GF5A 2JTMA 2OI3A 5HCKA 1SSHA 1CKBA 3E2UA 4DBFA 1KHIA 5HK3A 3VS5A 3H0IA 5FU6C 4AFQC 4M7AB 2E3HA 2E12A 1YIJT 1QVFA 1O75A 4JS4A 1BI1A 2DO3A 1UHFA 4FT2A 3S3NA 1SF9A 1W2BA 4JURA 2HSEB 3AHUA 2YUQA 2GTOA 1G3TA 4NOYA 1YHQT 5LJ3d 1P92A 5LJ5e 4DA4A 4Q5WA 3CCJQ 1VIFA 2V8JA 1JJ2A 4JDSA 2DJZA 2E41A 3E9FA 2RK1A 4K11A 5LJ3e 2R57A 3M0QA 2X35A 4ZGJB 1YP5A 3L1AA 1D1CA 1YI2Q 4OF1A 3JCMP 3H0FA 4A4GA 4M77G 2P4TA 4PJOA 1W2BP 2DFUA 2DERA 3CCMT 4R55A 3REAB 3X24B 1Y0MA 1FMKA 2SEMA 2LZ6B 3RUXA 1B07A 1VQ5A 2K5IA 2LQWA 3THKA 1YITA 5GANf 4HCBA 1YN8A 5GAMd 2E3IA 2RJCA 1JJ2P 2GTJA 5GAN3 2QYZA 2G6FX 3A2YA 4A4KA 4JZ4A 3KUFA 1XJWB 1S72A 3FC3A 3PGGA 2LTOA 4X1VA 4KT0E 2NYSA 1YNZA 2JJ9A 2VOBA 2CZ1B 4FCYA 2E70A 4DBQA 1GRIA 3M4GA 3CD6T 1ZUKA 3I55Q 4JRQA 3OW2S 2V26A 1SSFA 4HVWA 4BB7A 1NE8A 4MZTA 3CCLA 4M7AA 2RB6A 4CC4B 4DEYA 2LJ1A 3OS0A 2JMAA 1K8AC 2PZ1A 3PIPA 1PD1A 5GMKl 2A3LA 3UT1A 4WF2A 4EMKC 1KFZA 4FQBA 2QQAA 1WNLA 2D8HA 2BE9B 1OV3A 1WLPB 3RMSA 1K0SA 4KGZB 4GLMA 3G6ET 2F69A 1WHKA 1U8RA 2RJEA 2I2LA 1X75C 5CQXA 2DBKA 1RAGB 2FPFA 1RAAB 1UTIA 4J83A 3OYCA 3CXCP 4EIKA 3GNGA 1FMVA 3H0HA 2RHXA 4M77A 2J6OA 3G71T 1NLPC 1YIJQ 4E7SA 4EPCA 2HDAA 3C0CA 2O4XB 3OYGA 1FMWA 4BI8B 1YWOA 1WJRA 2LC4A 5GANe 1YHQQ 1LVKA 4M78F 2QI2A 3CPWP 5FU7C 3QDRB 3VPJA 2DBMA 3KW0A 3GBQA 5GAOq 5C6SA 3SEMA 2E5QA 3O8VA 3OS5A 2DPPB 3X26B 1OULA 1ZUYA 1VQOA 1IHWA 2YHTA 4A4FA 2JM8A 3EFOB 4JS5A 4TVRA 4RG2A 2IPOB 2IF6A 4RG8A 2EJGA 1KQSA 3CCMQ 3CCRT 4J6XA 3PBCA 4ORZA 1R8OB 1I0CA 1OX9A 4DBHA 1M90U 2DF6A 2LJ0A 4C92E 2L3QA 1D0ZA 2R58A 3VYHB 4F4MA 4XK8E 2ZPBB 2I0NA 3BY7A 3VS0A 5FU6B 2IOBA 5GMKm 1QVFS 3A8GB 2EGCA 1H641 3OS1A 4J7IA 3PMIA 2GQIA 1KQSP 2XIDA 5HKCA 1QP3A 3I56T 4HT8A 3CD6Q 4M75E 2IG0A 3J81E 2FL7A 5CKHA 1M8MA 2GCXA 2VPMA 1TH7A 5KE2A 3VUBA 2DM1A 1MV0B 2KGTA 2DRMA 2PQWA 3M0SA 2RO0A 2O4XA 3M0PA 3M54A 4MMLA 4E47A 3T9NA 4EQAA 3FDRA 4R0KA 4RCCA 2M0OA 3HHTB 2V8KA 3M59A 2DA9A 3M55A 1SKUB 2XDPA 1UFFA 4C8QA 3G6EQ 5A2QE 2D9TA 1JXMA 1PD0A 4A54A 2KK4A 4M75C 3M0RA 2A36A 5HY6A 2FRWA 3OA6A 1BBZA 5IXFA 1VQPA 1QVGA 1U3OA 3CC2A 2JN0A 5CR2A 4ME7A 1KD1R 3G71Q 1N6AA 2BZYA 5KCHA 4E2FB 3MO8A 5CKEA 1QVPA 4JLIA 2FYKA 3HFOA 3EFOA 3RERA 2YLBA 3VRZA 4OVAA 4M7DF 4ZTJA 4BE1A 4PJOF 3RBBB 2X51A 3PIOA 3JCMc 2QTVA 3RKYA 2HQEA 1RABB 2CS7A 5GAOr 2CYZB 2RD1A 2CT4A 1E6GA 3TVTA 4HT9A 3OSVA 4E6RA 2QQBA 1KQ1A 1SRLA 2HZYA 2YLCA 4LDUA 2CDTA 3QG1A 1XOVA 2FZCB 3VU3C 2PNIA 3CCRQ 1YJNT 5HK0A 4EMKB 4LJ1A 3L2VA 2COZA 1M90C 2EW3A 3CC4T 4II1A 1K73R 2K3XA 1WXTA 5DLOA 1Q82R 2RQRA 1FWZA 3FRNA 1PKTA 4AFSC 1RAIB 2AT1B 2RI2A 3G4SA 3G71A 1BI2A 1S1NA 1ZX6A 2KVQG 3ZFJA 1PCXA 3VS1A 4LUDA 4EQ8A 2ZZDA 2E10A 1NBEB 4IURA 5DLQE 3DLLA 1WX6A 4LDXA 4GY5A 3PMTA 3I56Q 3V7CA 3LWIA 2QA4T 2DYIA 2X3XD 5FRMA 3NGPA 1D1AA 5LJ5j 4Q4TA 3GPLA 3CCSA 1ZBJA
chains in the Genus database with same CATH topology
4Z89A 2W10A 1U06A 2AZSA 3O98A 1NYGA 2LCSA 4CT3A 2EBPA 3UF4A 3I5SA 3KFVA 5GJWB 1UJYA 4FDYA 1OPKA 2DE0X 3SHWA 1X43A 2KT1A 1T3LA 4J9FA 5FWBA 1I07A 2AK5A 2M0YA 1GFDA 2RNAA 1UDLA 2C0TA 2J05A 4FGIA 3GT2A 3RNJA 2RPNA 4FGEA 2M51A 3M0UA 4LE9A 2DILA 3H41A 1AWJA 4CC7A 1K4US 2BZ8A 3S0QA 1M27C 4Q4NA 4RUGA 3A30A 4D8DA 1WFWA 3VS4A 3FJ5A 5IHIA 2GGRA 2KNBB 2HSPA 4RTYA 1WA7A 2ESWA 1GBQA 1Y57A 3ULRB 4J9HA 4J9GA 2O9SA 1JEGA 3M1UA 1M3BA 2DJQA 4OMOA 2ED0A 2KRMA 3PVQA 1PKSA 3EHRA 2F2WA 3VS2A 2LP5A 2MIOA 2NUZA 2OI3A 5HCKA 1SSHA 5L23A 1CKBA 2LQNA 3NMZC 3VS5A 3IQLA 3H0IA 1GL5A 2OAWA 3O5ZA 5ECAA 1W70A 1RUWA 2CT3A 1WI7A 4AFQC 4JXBA 1BB9A 1G2BA 3VS3A 2DL4A 2C0OA 3EG3A 1UHFA 4JJDA 5IHNA 4RTUA 4GBQA 3VRYA 3ZL7C 3UATA 4DEXA 1X2QA 5GJVB 2IO7A 2JT4A 1H92A 4HZBA 2YUQA 2GTOA 4J9BA 2EYXA 1W1FA 2JTEA 2EYZA 3CQTA 1ABQA 4OLKA 4RTVA 1VYVA 2GNCA 2YT6A 1VA7A 1QWEA 2EYWA 3I35A 2EGEA 2FEIA 4K11A 3M0QA 4Q4GX 2L2PA 1YP5A 4CC2A 2IO9A 1HSQA 1VYUA 2X3WD 2F2XA 2DYBA 3H0FA 2W0ZA 2CUBA 2E5KA 2RN8A 2EKHA 1BK2A 4HXJA 2F2VA 1AVZC 2P4RA 2YUNA 3PBIA 4OMPA 3REAB 1WDXA 1Y0MA 1X2KA 1FMKA 2SEMA 2LZ6B 4OMQA 1B07A 2KRSA 1NYFA 2LQWA 2YUOA 3THKA 1SEMA 1AWOA 2KYMA 1YN8A 3I5RA 4CSHA 2A37A 2DL7A 2GTJA 1I1JA 2G6FX 3A2YA 2CH4W 4JZ4A 2D0NA 2K9GA 1V1CA 4F16A 2V1QA 4X1VA 1YNZA 1K0XA 1MV3A 4KRTA 2K6DA 2VOBA 2JM9A 4AG2C 1GRIA 1KSWA 1E7OA 1JQQA 2FRYA 1ZUKA 2VVKA 2RQWA 2YSQA 3UA7A 4HVWA 1U5SA 2EYYA 1SRMA 4CC4B 4DEYA 2LJ1A 2J6KA 2JMAA 2PZ1A 1GFCA 1T0JA 2J7IA 2AKKA 2KXDA 2CH4A 2ENMA 1KFZA 1K76A 4FQBA 4J9IA 1OOTA 2D8HA 4JZ3A 1OV3A 2EGAA 2LMJA 1W6XA 3QWYA 1WLPB 1K0SA 3EG1A 4GLMA 3JV3A 2CUDA 2DBKA 2DRKA 1X69A 1GCPA 1TUCA 2ECZA 2FPFA 1M3CA 2VKNA 1A0NB 1UTIA 2KEAA 2EQIA 4EIKA 3H0HA 1QLYA 4JPBW 2DMOA 2J6OA 2FPDA 1Z9ZA 1NLPC 4F0WA 2V1RA 3R6NA 1UHCA 1QWFA 2K2MA 2CSIA 2KRNA 2YUPA 2HDAA 3C0CA 3VS6A 1AEYA 3UA6A 4HCKA 4F14A 2J06A 1YWOA 3EGUA 2DLPA 1ARKA 1UG1A 1T0HA 1AOJA 1N5ZA 2EPDA 2QDLA 3VPIA 3EG0A 1GBRA 3VPJA 4HVVA 1AWXA 1QCFA 2DBMA 3KW0A 3GBQA 2IIMA 2KXCA 3REBB 3SEMA 2O88A 2DVJA 1ZUYA 2K79A 4M4ZA 1WXBA 2C0IA 2CREA 3NE0A 1SHFA 1TG0A 3PVLA 2JS0A 2L0AA 2MOXA 2JM8A 4Z88A 2LNHB 3TSZA 1QKWA 2OJ2A 3NPFA 2IF6A 2YDLA 1M3AA 2A08A 1BU1A 2B86A 2RQUA 3PBCA 2D1XA 2HEQA 2HCKA 4ORZA 1G83A 2JW4A 3EG2A 1I0CA 2IO8A 2DL5A 1SPKA 2DF6A 2LJ0A 1EFNA 2RQVA 2D8JA 2FG0A 2CSQA 2L3QA 2PTKA 4RTXA 4F4MA 4A63B 1ABOA 1QKXA 2I0NA 2FPEA 1AD5A 1E6HA 3EHQA 1AWWA 3VS0A 1H3HA 2AZVA 2IOBA 4LUEA 2L3PA 2EGCA 1UECA 3TSWA 1OPLA 2GQIA 3U23A 1CKAA 2DL3A 1WYXA 2KBTA 3LH5A 2H8HA 4RTZA 1B3QA 1PNJA 2RMOA 1M8MA 2VPMA 2O9VA 4J9EA 2HBWA 2DX1A 1UUEA 4IIOA 2MCNA 5FW9A 2LRJA 2DM1A 2FO0A 1MV0B 2KGTA 1WIEA 2DRMA 3M0SA 1JU5C 1SHGA 3M0PA 1ZSGA 2KE9A 1OEBA 4EQAA 5FWCA 4R0KA 2KYBA 2ED1A 2DA9A 4EOBA 1X6BA 4QT7A 2RF0A 1JO8A 4CGKA 4F17A 1UFFA 1RLQC 2XMFA 1JXMA 2KROA 4RTTA 5IXBA 2KT8A 3M0RA 2A36A 2FRWA 1BBZA 5IXFA 1AZGB 2BTTA 1U3OA 4Z8AA 2O31A 2K7AA 1PRMC 4IIMA 1CSKA 2ABLA 3M0TA 2K1GA 2BZYA 5IH2A 1NM7A 3NHNA 1MUZA 2GBQA 1YCSB 2A28A 4D8KA 2JS2A 3A98A 1H8KA 2NWMA 1IO6A 1FYNA 4RTWA 1WXUA 2JMCA 2RQTA 4AG1C 4HZ9A 1GCQA 1ZUUA 2LJ3A 4HPEA 1NEGA 3VRZA 4J9DA 1GCQC 1NEBA 4LN2A 1TUDA 1HD3A 5I11A 2IOAA 2EVRA 1YWPA 4Y92A 3RBBB 2ROLA 1M30A 4ZNXA 1KIKA 3VS7A 1X27A 2DNUA 1UE9A 2AKLA 2CT4A 1E6GA 4OMMA 3QWXX 1K1ZA 3TVTA 4E6RA 5EC7A 1SRLA 4CC3A 2CDTA 2LX7A 1PRLC 4JJCA 1X6GA 1XOVA 4HVUA 4ESRA 1KJWA 2PNIA 4FSSA 2L3SA 1HJDA 4J9CA 4AFUC 2XIVA 1UJ0A 2ROTA 4FGDA 4LJ1A 2JXBA 4AFZC 1AZEA 2K3AA 2EW3A 1NG2A 4FQAA 5I22A 4JJBA 2J6FA 2BZXA 2KR3A 1WXTA 1UGVA 2RQRA 1PKTA 4OMLA 1T3SA 4AFSC 4F0VA 1RI9A 1J3TA 1LCKA 2VPSA 1Z9QA 1S1NA 2SRCA 5IHKA 2VWFA 1ZX6A 1JXOA 1RLPC 2O2OA 3VS1A 4LUDA 3I86A 4LNPA 4EQ8A 1ZLMA 1WX6A 1VYTA 4OMNA 1PWTA 1NLOC 2X3XD 3A2ZA 3NGPA 3I9QA 1PHTA 1K9AA 2K3BA 4Q4TA 4WCIA 2DL8A 3PE0A 1ZBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z89 A;  2W10 A;  1U06 A;  2AZS A;  3O98 A;  1NYG A;  2LCS A;  4CT3 A;  2EBP A;  3UF4 A;  3I5S A;  3KFV A;  5GJW B;  1UJY A;  4FDY A;  1OPK A;  2DE0 X;  3SHW A;  1X43 A;  2KT1 A;  1T3L A;  4J9F A;  5FWB A;  1I07 A;  2AK5 A;  2M0Y A;  1GFD A;  2RNA A;  1UDL A;  2C0T A;  2J05 A;  4FGI A;  3GT2 A;  3RNJ A;  2RPN A;  4FGE A;  2M51 A;  3M0U A;  4LE9 A;  2DIL A;  3H41 A;  1AWJ A;  4CC7 A;  1K4U S;  2BZ8 A;  3S0Q A;  1M27 C;  4Q4N A;  4RUG A;  3A30 A;  4D8D A;  1WFW A;  3VS4 A;  3FJ5 A;  5IHI A;  2GGR A;  2KNB B;  2HSP A;  4RTY A;  1WA7 A;  2ESW A;  1GBQ A;  1Y57 A;  3ULR B;  4J9H A;  4J9G A;  2O9S A;  1JEG A;  3M1U A;  1M3B A;  2DJQ A;  4OMO A;  2ED0 A;  2KRM A;  3PVQ A;  1PKS A;  3EHR A;  2F2W A;  3VS2 A;  2LP5 A;  2MIO A;  2NUZ A;  2OI3 A;  5HCK A;  1SSH A;  5L23 A;  1CKB A;  2LQN A;  3NMZ C;  3VS5 A;  3IQL A;  3H0I A;  1GL5 A;  2OAW A;  3O5Z A;  5ECA A;  1W70 A;  1RUW A;  2CT3 A;  1WI7 A;  4AFQ C;  4JXB A;  1BB9 A;  1G2B A;  3VS3 A;  2DL4 A;  2C0O A;  3EG3 A;  1UHF A;  4JJD A;  5IHN A;  4RTU A;  4GBQ A;  3VRY A;  3ZL7 C;  3UAT A;  4DEX A;  1X2Q A;  5GJV B;  2IO7 A;  2JT4 A;  1H92 A;  4HZB A;  2YUQ A;  2GTO A;  4J9B A;  2EYX A;  1W1F A;  2JTE A;  2EYZ A;  3CQT A;  1ABQ A;  4OLK A;  4RTV A;  1VYV A;  2GNC A;  2YT6 A;  1VA7 A;  1QWE A;  2EYW A;  3I35 A;  2EGE A;  2FEI A;  4K11 A;  3M0Q A;  4Q4G X;  2L2P A;  1YP5 A;  4CC2 A;  2IO9 A;  1HSQ A;  1VYU A;  2X3W D;  2F2X A;  2DYB A;  3H0F A;  2W0Z A;  2CUB A;  2E5K A;  2RN8 A;  2EKH A;  1BK2 A;  4HXJ A;  2F2V A;  1AVZ C;  2P4R A;  2YUN A;  3PBI A;  4OMP A;  3REA B;  1WDX A;  1Y0M A;  1X2K A;  1FMK A;  2SEM A;  2LZ6 B;  4OMQ A;  1B07 A;  2KRS A;  1NYF A;  2LQW A;  2YUO A;  3THK A;  1SEM A;  1AWO A;  2KYM A;  1YN8 A;  3I5R A;  4CSH A;  2A37 A;  2DL7 A;  2GTJ A;  1I1J A;  2G6F X;  3A2Y A;  2CH4 W;  4JZ4 A;  2D0N A;  2K9G A;  1V1C A;  4F16 A;  2V1Q A;  4X1V A;  1YNZ A;  1K0X A;  1MV3 A;  4KRT A;  2K6D A;  2VOB A;  2JM9 A;  4AG2 C;  1GRI A;  1KSW A;  1E7O A;  1JQQ A;  2FRY A;  1ZUK A;  2VVK A;  2RQW A;  2YSQ A;  3UA7 A;  4HVW A;  1U5S A;  2EYY A;  1SRM A;  4CC4 B;  4DEY A;  2LJ1 A;  2J6K A;  2JMA A;  2PZ1 A;  1GFC A;  1T0J A;  2J7I A;  2AKK A;  2KXD A;  2CH4 A;  2ENM A;  1KFZ A;  1K76 A;  4FQB A;  4J9I A;  1OOT A;  2D8H A;  4JZ3 A;  1OV3 A;  2EGA A;  2LMJ A;  1W6X A;  3QWY A;  1WLP B;  1K0S A;  3EG1 A;  4GLM A;  3JV3 A;  2CUD A;  2DBK A;  2DRK A;  1X69 A;  1GCP A;  1TUC A;  2ECZ A;  2FPF A;  1M3C A;  2VKN A;  1A0N B;  1UTI A;  2KEA A;  2EQI A;  4EIK A;  3H0H A;  1QLY A;  4JPB W;  2DMO A;  2J6O A;  2FPD A;  1Z9Z A;  1NLP C;  4F0W A;  2V1R A;  3R6N A;  1UHC A;  1QWF A;  2K2M A;  2CSI A;  2KRN A;  2YUP A;  2HDA A;  3C0C A;  3VS6 A;  1AEY A;  3UA6 A;  4HCK A;  4F14 A;  2J06 A;  1YWO A;  3EGU A;  2DLP A;  1ARK A;  1UG1 A;  1T0H A;  1AOJ A;  1N5Z A;  2EPD A;  2QDL A;  3VPI A;  3EG0 A;  1GBR A;  3VPJ A;  4HVV A;  1AWX A;  1QCF A;  2DBM A;  3KW0 A;  3GBQ A;  2IIM A;  2KXC A;  3REB B;  3SEM A;  2O88 A;  2DVJ A;  1ZUY A;  2K79 A;  4M4Z A;  1WXB A;  2C0I A;  2CRE A;  3NE0 A;  1SHF A;  1TG0 A;  3PVL A;  2JS0 A;  2L0A A;  2MOX A;  2JM8 A;  4Z88 A;  2LNH B;  3TSZ A;  1QKW A;  2OJ2 A;  3NPF A;  2IF6 A;  2YDL A;  1M3A A;  2A08 A;  1BU1 A;  2B86 A;  2RQU A;  3PBC A;  2D1X A;  2HEQ A;  2HCK A;  4ORZ A;  1G83 A;  2JW4 A;  3EG2 A;  1I0C A;  2IO8 A;  2DL5 A;  1SPK A;  2DF6 A;  2LJ0 A;  1EFN A;  2RQV A;  2D8J A;  2FG0 A;  2CSQ A;  2L3Q A;  2PTK A;  4RTX A;  4F4M A;  4A63 B;  1ABO A;  1QKX A;  2I0N A;  2FPE A;  1AD5 A;  1E6H A;  3EHQ A;  1AWW A;  3VS0 A;  1H3H A;  2AZV A;  2IOB A;  4LUE A;  2L3P A;  2EGC A;  1UEC A;  3TSW A;  1OPL A;  2GQI A;  3U23 A;  1CKA A;  2DL3 A;  1WYX A;  2KBT A;  3LH5 A;  2H8H A;  4RTZ A;  1B3Q A;  1PNJ A;  2RMO A;  1M8M A;  2VPM A;  2O9V A;  4J9E A;  2HBW A;  2DX1 A;  1UUE A;  4IIO A;  2MCN A;  5FW9 A;  2LRJ A;  2DM1 A;  2FO0 A;  1MV0 B;  2KGT A;  1WIE A;  2DRM A;  3M0S A;  1JU5 C;  1SHG A;  3M0P A;  1ZSG A;  2KE9 A;  1OEB A;  4EQA A;  5FWC A;  4R0K A;  2KYB A;  2ED1 A;  2DA9 A;  4EOB A;  1X6B A;  4QT7 A;  2RF0 A;  1JO8 A;  4CGK A;  4F17 A;  1UFF A;  1RLQ C;  2XMF A;  1JXM A;  2KRO A;  4RTT A;  5IXB A;  2KT8 A;  3M0R A;  2A36 A;  2FRW A;  1BBZ A;  5IXF A;  1AZG B;  2BTT A;  1U3O A;  4Z8A A;  2O31 A;  2K7A A;  1PRM C;  4IIM A;  1CSK A;  2ABL A;  3M0T A;  2K1G A;  2BZY A;  5IH2 A;  1NM7 A;  3NHN A;  1MUZ A;  2GBQ A;  1YCS B;  2A28 A;  4D8K A;  2JS2 A;  3A98 A;  1H8K A;  2NWM A;  1IO6 A;  1FYN A;  4RTW A;  1WXU A;  2JMC A;  2RQT A;  4AG1 C;  4HZ9 A;  1GCQ A;  1ZUU A;  2LJ3 A;  4HPE A;  1NEG A;  3VRZ A;  4J9D A;  1GCQ C;  1NEB A;  4LN2 A;  1TUD A;  1HD3 A;  5I11 A;  2IOA A;  2EVR A;  1YWP A;  4Y92 A;  3RBB B;  2ROL A;  1M30 A;  4ZNX A;  1KIK A;  3VS7 A;  1X27 A;  2DNU A;  1UE9 A;  2AKL A;  2CT4 A;  1E6G A;  4OMM A;  3QWX X;  1K1Z A;  3TVT A;  4E6R A;  5EC7 A;  1SRL A;  4CC3 A;  2CDT A;  2LX7 A;  1PRL C;  4JJC A;  1X6G A;  1XOV A;  4HVU A;  4ESR A;  1KJW A;  2PNI A;  4FSS A;  2L3S A;  1HJD A;  4J9C A;  4AFU C;  2XIV A;  1UJ0 A;  2ROT A;  4FGD A;  4LJ1 A;  2JXB A;  4AFZ C;  1AZE A;  2K3A A;  2EW3 A;  1NG2 A;  4FQA A;  5I22 A;  4JJB A;  2J6F A;  2BZX A;  2KR3 A;  1WXT A;  1UGV A;  2RQR A;  1PKT A;  4OML A;  1T3S A;  4AFS C;  4F0V A;  1RI9 A;  1J3T A;  1LCK A;  2VPS A;  1Z9Q A;  1S1N A;  2SRC A;  5IHK A;  2VWF A;  1ZX6 A;  1JXO A;  1RLP C;  2O2O A;  3VS1 A;  4LUD A;  3I86 A;  4LNP A;  4EQ8 A;  1ZLM A;  1WX6 A;  1VYT A;  4OMN A;  1PWT A;  1NLO C;  2X3X D;  3A2Z A;  3NGP A;  3I9Q A;  1PHT A;  1K9A A;  2K3B A;  4Q4T A;  4WCI A;  2DL8 A;  3PE0 A;  1ZBJ A; 
#chains in the Genus database with same CATH topology
 4N4G A;  4MDX A;  3HL8 A;  2E1H A;  5FU7 B;  2CKK A;  5LJ5 h;  1M8V A;  2X4X A;  3FLG A;  4ANJ A;  1IHV A;  2LCS A;  4AMC A;  2OTL A;  4M77 F;  2EBP A;  2CP3 A;  2HBP A;  3MP8 A;  1OPK A;  4E7K A;  4BDY A;  2MMP A;  3EH2 A;  4J6W A;  2KT1 A;  3CCE A;  1BYM A;  2DTH A;  1I07 A;  5KE3 A;  2M0Y A;  1YJ9 A;  2YRD A;  4OGE A;  1Q7Y R;  2M51 A;  1K4U S;  2DD4 A;  4DBR A;  2QEX T;  4D8D A;  1WFW A;  1RI0 A;  3FJ5 A;  4L6V 5;  3M4Y A;  4EMK A;  4RTY A;  2JNG A;  3M57 A;  4M78 G;  4N4I A;  1JEG A;  3EH1 A;  1OU9 A;  1PKS A;  1BIA A;  1VQ6 A;  4LDW A;  2P84 A;  4M78 D;  1WHH A;  4QVC A;  3TQ7 P;  4CI0 C;  5L23 A;  3MKD A;  1TXQ A;  1D0X A;  2LQN A;  2XDD A;  1QCO A;  2XU8 A;  4NL2 A;  1QCN A;  3BDU A;  1GL5 A;  1YJN Q;  1VQ5 T;  4C5H A;  1YIT T;  5ECA A;  2CT3 A;  1WI7 A;  3CC4 Q;  3LGL A;  4QVD A;  1BB9 A;  2YRC A;  1NJI U;  3VS3 A;  3EG3 A;  1S72 T;  4EDU A;  5IHN A;  1NZ9 A;  4RTU A;  2GFU A;  4M75 B;  4GBQ A;  3CBO A;  3ZL7 C;  1UGQ B;  1QVG S;  4HZB A;  3HPW A;  2DXB A;  4J9B A;  5CKF A;  2ZPI B;  2EYX A;  2FVU A;  3OYM A;  2VGM A;  3CQT A;  1ABQ A;  1VYV A;  4BD3 A;  3OW2 A;  5IT9 E;  2GNC A;  3J80 E;  1VA7 A;  2CP2 A;  1QWE A;  3I35 A;  5GAN j;  3CCL T;  2EGE A;  2QA4 Q;  2MYS A;  3ASK A;  4LXC A;  3MP6 A;  2L2P A;  3CBP A;  3G1J A;  4C8Q F;  5A0L A;  1HSQ A;  2X3W D;  4FU6 A;  2E64 A;  2W0Z A;  5GAN h;  2FZK B;  4XTU A;  3SDZ A;  2E5K A;  2RN8 A;  2X4Y A;  2HQH A;  2YUN A;  4KH0 B;  2DD5 A;  2KRS A;  1K8A R;  3OW2 P;  1B7T A;  3LWH A;  3I5R A;  4JLG A;  4N4H A;  4OB0 B;  3V7R A;  2D0N A;  3JCM Q;  1V1C A;  2KMT A;  1YFN A;  3RDV A;  2CP5 A;  5LJ3 g;  5KYX A;  3OYD A;  3JB9 H;  1WPY A;  1MV3 A;  2K6D A;  4N0A C;  2JM9 A;  4AG2 C;  2QEX Q;  1AT1 B;  2BIV A;  2EIF A;  5AYF A;  1E7O A;  1JQQ A;  2DXC A;  2FRY A;  2VVK A;  2LT4 A;  4RCB A;  3UA7 A;  2ZPH B;  2EYY A;  1SRM A;  1JB0 E;  1MGQ A;  1JRI A;  1T0J A;  5KYU B;  1MHN A;  4F7U E;  4PJO G;  2J7I A;  2DXU A;  1VQO T;  4KBM B;  4M75 A;  2RHU A;  5GAN 7;  1YCY A;  4PJO D;  5L8R E;  5GAM g;  1X6O A;  3OBY A;  1LOJ A;  1TUC A;  2ECZ A;  2R5M A;  4AT1 B;  4JJN K;  1VQ5 Q;  2MWO A;  2L89 A;  1YIT Q;  4OMF B;  1A0N B;  1VQ9 A;  4IKF A;  4XTV A;  4JPB W;  3E9G A;  4F0W A;  2H3E B;  2EQM A;  2VC8 A;  1NJI C;  1S72 Q;  3QZ5 B;  3OB9 A;  2KI7 A;  1AEY A;  1D3B B;  3UA6 A;  1C6V X;  1WGS A;  2J06 A;  2V8I A;  4KGV B;  1Q86 U;  3OMG A;  1M5Q 1;  3HRT A;  1M1K R;  3VPI A;  4M7A G;  5LJ5 d;  2QAZ A;  4HVV A;  2QEX A;  1I81 A;  2EQU A;  3CCL Q;  4M4Z A;  5IAY A;  2XDB A;  4M7A D;  1WXB A;  2XD0 A;  4J32 A;  2VGN A;  3MEW A;  3N5B B;  4CRI A;  4OGC A;  3EFS A;  3QBY A;  2MOX A;  2D0Q B;  2LNH B;  2QQ9 A;  4XTY A;  1NPP A;  1QVF P;  2A08 A;  2LCL A;  2WSC E;  3CC7 A;  2HL3 A;  3JCM g;  1VQL A;  2DIG A;  2JW4 A;  2DL5 A;  1M2V B;  3JCM J;  1SPK A;  1EFN A;  1VQP T;  3SFM A;  3CC2 T;  2D8J A;  2FG0 A;  4BAC A;  1Y96 B;  5GMK e;  4A63 B;  1QKX A;  4M77 D;  3A8H B;  2Y4X A;  1AD5 A;  1E6H A;  4QW2 A;  2ZCF B;  4ZTF A;  1H3H A;  2AZV A;  3SWN C;  2LX9 A;  3H8Z A;  3U23 A;  1B3Q A;  3D7S B;  4FYX B;  1PNJ A;  1G3Y A;  2RMO A;  3VYG A;  2A0F B;  3CMA A;  1MMD A;  2RHI A;  4FM4 B;  4J9E A;  3MCA B;  4BDZ A;  2LRJ A;  4PLL A;  1QW1 A;  2XIC A;  1VQ7 A;  1VQO Q;  3OMC A;  2F5K A;  4LD9 K;  1D3B A;  4PJN A;  2WP7 A;  1JO8 A;  4CGK A;  1HXD A;  1RLQ C;  3S3O A;  1WHG A;  2XMF A;  2KRO A;  2KT8 A;  4LDY A;  4PL6 A;  2MAM A;  2BTT A;  1VQ8 A;  1G5V A;  3FIF A;  2DTO A;  1PG5 B;  4IIM A;  1WHL A;  3C95 A;  4ZGE B;  1BKB A;  2K1G A;  1NM7 A;  3NHN A;  3CEY A;  2GBQ A;  1YCS B;  4QQD A;  2JS2 A;  3A98 A;  1H8K A;  2NWM A;  1FYN A;  3QKJ A;  1K9M R;  3G4S T;  1WXU A;  2RQT A;  1KQ2 A;  4AG1 C;  1Q86 C;  1ZUU A;  2HL5 C;  4HPE A;  1NEG A;  1MMG A;  4J9D A;  1GCQ C;  1NEB A;  5GAN d;  1M90 R;  1ZSZ C;  1TUD A;  1M2V A;  4OB2 B;  1BI0 A;  1UB4 A;  1Y96 A;  4HCZ A;  1KIK A;  2X4J A;  3CCS T;  3VS7 A;  1X27 A;  2AKL A;  3OYB A;  4OMM A;  3QPH A;  1K1Z A;  3P8H A;  4C8Q G;  2L5Q A;  2RK2 A;  2DXT A;  2OTL T;  1BCM A;  1X6G A;  4JJC A;  4ESR A;  3DKM A;  1KJW A;  1HJD A;  4C8Q D;  2JXB A;  1AZE A;  3CCE T;  3OYA A;  3NFC A;  2K3A A;  3OYE A;  3CCQ A;  3LW5 E;  1VQP Q;  1SG5 A;  4VUB A;  4JJB A;  2J6F A;  2BZX A;  3CC2 Q;  2DEU A;  2KR3 A;  2MPX C;  1BI3 A;  1YJ9 T;  3OQ5 A;  1WZO A;  1RI9 A;  2HD0 A;  3MPU B;  5KH6 A;  2O2O A;  4DOW A;  1R0C B;  4O5V A;  4F7U B;  4OMN A;  4M75 F;  1PSF A;  2DKG A;  4C0F A;  1NLO C;  4KGX B;  4KH1 B;  4HA8 A;  3JSC A;  4Z89 A;  4A53 A;  2LDM A;  2COY A;  2VYT A;  3JCM b;  4PJM A;  2QQS A;  2W10 A;  1VQ6 T;  4PFP A;  1RAF B;  2AZS A;  4C92 C;  3O98 A;  2MF2 A;  1UEB A;  2K5F A;  2QDY B;  3CBM A;  1UJY A;  1VQN A;  4J6Y A;  4KUI A;  1KC8 R;  7AT1 B;  1X43 A;  1M1F A;  2RJD A;  3RIR A;  2DET A;  4J9F A;  5J39 A;  1O9S A;  4N0A A;  3A1P A;  1GFD A;  2C0T A;  2GQV A;  3RNJ A;  4FGE A;  4OP0 A;  2EYQ A;  3JB9 F;  3H41 A;  2DAQ A;  4CC7 A;  2BZ8 A;  4O6J A;  5CQY A;  1ZHI A;  3G4S Q;  9ATC B;  2XK0 A;  3VS4 A;  2GGR A;  4C0D C;  2KQW A;  4XTZ A;  5D6Y A;  4J9H A;  2O9S A;  3M1U A;  3DB3 A;  3SWN B;  2X9H A;  3UPU A;  1OYX A;  1G3W A;  2KRM A;  3CCS Q;  5J3B A;  3EHR A;  3QDF A;  2F2W A;  1UGS B;  1C0M A;  3VS2 A;  3OYL A;  2MIO A;  3RES A;  3MEU A;  3EBQ A;  1QVG P;  5GAN 2;  3A5Z B;  2OTL Q;  4F7U A;  3L2W A;  2QTX A;  3NMZ C;  3ME9 A;  2WSF E;  2M02 A;  4HFL A;  1W70 A;  2LQK A;  1RUW A;  1OZ3 A;  1D1B A;  3QXE B;  3CCE Q;  4E7H A;  1DJ7 B;  2QG9 B;  4JXB A;  1G2B A;  2JZ2 A;  2DL4 A;  1YJ9 Q;  1X01 A;  3AT1 B;  4M7D E;  3VRY A;  3UAT A;  4XU0 A;  1Q95 G;  5GJV B;  4R56 A;  2JT4 A;  4C5I A;  4PJO E;  2IO7 A;  3LX7 A;  1RAC B;  2EYZ A;  3BW1 A;  3FB9 A;  1VQK A;  4FW1 A;  4OLK A;  4RTV A;  4ELZ C;  1C1A A;  2YT6 A;  4D6W A;  4M7A F;  2EYW A;  1KD1 U;  2RJF A;  4IUV A;  3NTK A;  2ATC B;  5FRO A;  2XG8 D;  1ZSZ B;  3QHS A;  4M7D C;  4J30 A;  3HRS A;  1I5L A;  3URG A;  4FW2 A;  1VQ6 Q;  2F2V A;  1AVZ C;  2P4R A;  4FYY B;  2QGF B;  4FL6 A;  1WDX A;  2NLU A;  1X2K A;  3PT9 A;  1Q81 R;  1NYF A;  4MDW A;  1YJW T;  1SEM A;  4QKU A;  5LL6 S;  4KUD K;  2VXE A;  4CSH A;  1VQ9 T;  2A37 A;  2DL7 A;  1VQ4 A;  2CH4 W;  2CZ7 B;  4RKU E;  4E7L A;  3S6W A;  4F16 A;  2QAS A;  2VXF A;  1K0X A;  5M9O A;  5GMK j;  2EKO A;  1IGU A;  3V8K A;  5KCO A;  1M1G A;  5GMK h;  1ACM B;  3RKX A;  2RQW A;  1K73 U;  3GIB A;  3RR6 A;  4L5G A;  2P0P A;  3KBG A;  4JUV A;  1I8F A;  1IRX A;  1GFC A;  4M77 E;  3JAM E;  3BDL A;  2AKK A;  2KXD A;  2CH4 A;  1K76 A;  2YXY A;  2CZ0 B;  3QYG B;  1OOT A;  4JZ3 A;  3WVD B;  2EGA A;  2LMJ A;  2XHC A;  4B9W A;  2XI9 A;  2EFI A;  3EG1 A;  3CC7 T;  3JV3 A;  4X34 A;  1VQL T;  2DRK A;  1X69 A;  3Q1J A;  2MK5 A;  4C92 B;  2EQI A;  5KYW B;  5KYY B;  1MND A;  1F1B B;  2FPD A;  3FJP A;  4M77 C;  2LVM A;  4DOV A;  1UHC A;  2K2M A;  1ZSZ A;  2KRN A;  2YUP A;  4XQ3 A;  1IZ6 A;  3E1S A;  2P0K A;  2JTF A;  4F14 A;  3EGU A;  1H3Z A;  2DLP A;  1T0H A;  2OAU A;  1N5Z A;  2QDL A;  2MWP A;  3EG0 A;  2C06 A;  3EAE A;  3MJX A;  1GBR A;  1AWX A;  1Y71 A;  4BE0 A;  8ATC B;  1OQK A;  2PVG B;  3CMA T;  2RH2 A;  3G7Z A;  3DLM A;  1KD1 C;  3EGD B;  1Q7Y U;  2OTJ A;  3VV0 A;  3GNF B;  2DVJ A;  4M75 G;  2L8D A;  3JB9 I;  2C0I A;  2H3J A;  2VV5 A;  4C0D B;  3PVL A;  2JS0 A;  2L0A A;  1VQ7 T;  1WHJ A;  4Z88 A;  4FT4 A;  5J26 A;  1LJO A;  4M75 D;  1I5O B;  2OJ2 A;  1UGR B;  3NPF A;  1U1S A;  3GP8 A;  5FRN A;  2B86 A;  2RQU A;  2HEQ A;  3CME A;  5CO7 A;  1G83 A;  3EG2 A;  4PK4 A;  2IO8 A;  2FB7 A;  5CK9 A;  1YJW Q;  3QO3 A;  4J8O A;  4MZP A;  1VQ8 T;  1LPL A;  4HFF A;  1VQ9 Q;  4C0Z A;  4RTX A;  3WVE B;  1ABO A;  3JCM h;  4LDV A;  2FPE A;  1HK9 A;  3EHQ A;  3MP1 A;  2QK0 A;  2YRV A;  1D0Y A;  1AWW A;  5LJ5 g;  4JRP A;  2CP6 A;  3MEV A;  3QZ9 B;  1PSE A;  3JB9 G;  2LRQ A;  1KG1 A;  3S3M A;  3L2Z A;  1OPL A;  5D6W A;  4C8Q E;  2DL3 A;  2KBT A;  2OX7 A;  3JCM X;  3LH5 A;  2H8H A;  4RTZ A;  5GAN 5;  2PVD B;  4C92 A;  1K73 C;  5KYW A;  5I2S A;  1ZA1 B;  5KYY A;  4BI3 A;  1IB8 A;  4IIO A;  3JB9 D;  1IXD A;  5FW9 A;  1RAH B;  3F70 A;  1MNE A;  2KDS A;  1FXX A;  1D09 B;  1SHG A;  2KE9 A;  5FWC A;  3V7S A;  3R6O A;  4GLK A;  3HRU A;  3OBW A;  2QXF A;  4NL3 A;  4EOB A;  4ZN1 A;  1X6B A;  4BI4 A;  2VAS A;  2RHZ A;  3UDC A;  4F17 A;  4C8Q C;  3CC7 Q;  1VQL Q;  4PNO A;  5LJ3 f;  4NS5 A;  4M7D B;  1JBM A;  1GXI E;  3CCQ T;  2O31 A;  3GOX A;  3M0T A;  2FZG B;  1YJW A;  1TSF A;  1MUZ A;  2M1H A;  4D8K A;  2KAF A;  2LJ3 A;  4FSX A;  2LCC A;  3C12 A;  5GAO p;  5GAO n;  4C5E A;  4XU1 A;  3QJY A;  2EVR A;  4XAX B;  3CMA Q;  3A8M B;  1WQ7 A;  1M30 A;  1Q7Y C;  4Y28 E;  4ZNX A;  4Y91 A;  1RAD B;  5GAM f;  2DNU A;  1UE9 A;  3QUI A;  1VQ7 Q;  4OB1 B;  2R5A A;  1EX4 A;  5D7U A;  4HVU A;  1OZ2 A;  4EMH A;  1VQN T;  3WXM B;  4FSS A;  2L3S A;  4J9C A;  1N8R U;  2ROT A;  1XTD A;  2HAX A;  1NG2 A;  3LYI A;  1VQ8 Q;  5I22 A;  2ZPF B;  3BFM A;  1NPR A;  1UGV A;  5GAN 8;  4J7F A;  4X9D A;  4F0V A;  2JVV A;  3NTH A;  5GAN g;  1HYO A;  2VPS A;  5KYU A;  1BIB A;  4XU3 A;  3V8J A;  2LQ8 A;  3JB9 J;  2VB6 A;  4PLI A;  4M77 B;  1IRE B;  4LNP A;  2K4Y A;  1ZLM A;  4B9X A;  4UC4 A;  4M7D A;  3C4S A;  3RKW A;  2CGH A;  2DEQ A;  3A2Z A;  1AHJ B;  2Z0W A;  3I9Q A;  1PHT A;  1KK7 A;  4WCI A;  5A0G A;  3JCM f;  6AT1 B;  1U06 A;  3VJP A;  1M1K U;  1NYG A;  4PFZ A;  2RI3 A;  4CT3 A;  2WAC A;  4J5Y A;  5GJW B;  3KFV A;  4PKC C;  4FDY A;  4XU2 A;  2O01 E;  3SHW A;  2HMA A;  1T3L A;  2JUF A;  5FWB A;  5FLX E;  1ZQ1 A;  5GAM e;  2E6N A;  2M9U A;  3CCQ Q;  3PFS A;  1N27 A;  1EIF A;  3E19 A;  4P5N A;  4DQ2 A;  4LE9 A;  1AWJ A;  4QQ6 A;  3CXC A;  3V8L A;  3SD4 A;  4C5G A;  3A30 A;  4FYW B;  3CCJ A;  1VQK T;  3M9Q A;  2G3R A;  2KNB B;  2HSP A;  4JRK A;  2ESW A;  1GBQ A;  3NTI A;  1Y57 A;  4FIB A;  2COW A;  3SB2 A;  3ULR B;  5C0M A;  4J9G A;  4BE2 A;  1M3B A;  2DJQ A;  1YI2 A;  2EQJ A;  3CPW A;  2IVW A;  3P8D A;  1ZBX A;  2LP5 A;  3EG9 B;  2NUZ A;  4QQG A;  3H9N A;  2LNV A;  4BUG A;  4QVZ A;  4BY6 C;  3JCM d;  3FEO A;  2RHY A;  3IQL A;  1VQN Q;  2FHD A;  2OAW A;  2WSE E;  3O5Z A;  1N8R C;  2YWW A;  1VUB A;  1PC0 A;  2NUT B;  2ZPG B;  3JCM e;  1Y7X A;  1VQ4 T;  2C0O A;  1WHM A;  4C8Q B;  5GAO l;  4JJD A;  2K5L A;  4L59 A;  3ZBD A;  4C92 F;  4ELY C;  4DEX A;  1X2Q A;  1Y07 A;  1H92 A;  4C0G A;  2NUP B;  2A7Y A;  2GF7 A;  2JTE A;  1VIE A;  1W1F A;  3I55 A;  4M78 E;  2ZPE B;  3KXT A;  3OYY A;  2QQR A;  3CCU T;  3OY9 A;  3L2U A;  2FEI A;  3X28 B;  4Q4G X;  1I4K 1;  3MEA A;  4CC2 A;  2EJ9 A;  2IO9 A;  2PUK B;  4A4H A;  1VYU A;  1K9M U;  2F2X A;  2DYB A;  2CUB A;  3QII A;  4RMO A;  4F7U G;  1FX7 A;  2F5T X;  3OYK A;  2EKH A;  1BK2 A;  1OI1 A;  1M1K C;  3J7A F;  4HXJ A;  4Z02 A;  3PBI A;  4OMP A;  3LLR A;  4M78 C;  1ZA2 B;  4OMQ A;  3TU4 K;  2DK3 A;  3VUZ A;  2YUO A;  2VUB A;  4FYV B;  1AWO A;  2KYM A;  3CCV T;  3L42 A;  3LH0 A;  3M53 A;  2CP0 A;  1I1J A;  2XKO C;  1YIJ A;  1TWB A;  2K9G A;  1N9R A;  1QMC A;  4LD6 A;  2V1Q A;  3EG9 A;  2F1L A;  1G3S A;  2HQX A;  1W2B S;  4PJJ A;  4KRT A;  3QJ6 A;  1YHQ A;  4PFO A;  1LNX A;  1KSW A;  2MI6 A;  1VQK Q;  4XTX A;  2YSQ A;  2NUT A;  2LT1 A;  1JJ2 S;  1TOV A;  1U5S A;  3BE3 A;  5GAN 6;  2OTJ T;  2J6K A;  2BE7 D;  3PTA A;  4KUL A;  2ENM A;  3M5A A;  4J9I A;  4MMK A;  3A8O B;  2E4H A;  2NUP A;  1B34 B;  1W6X A;  3QWY A;  3CCM A;  5GAN 4;  2K3Y A;  5GAO m;  3CME T;  2CUD A;  4E7Z A;  4MZM A;  1GCP A;  1W4S A;  1M3C A;  2VKN A;  5I21 A;  3RMQ A;  4HFK A;  2KEA A;  5DM7 R;  1EZZ B;  1QLY A;  3ZEH A;  2DMO A;  5I2M A;  3HSB A;  1Z9Z A;  1VQ4 Q;  2V1R A;  3R6N A;  1QWF A;  4IUQ A;  2CSI A;  2AHJ B;  1VQM T;  3VS6 A;  3X20 B;  1R0B G;  4HCK A;  5IN1 A;  1KC8 U;  3OYJ A;  4F04 B;  2JOY A;  1ARK A;  1UG1 A;  2EPD A;  1AOJ A;  4EMG A;  3CD6 A;  2E65 A;  1QCF A;  3EGX B;  1TS9 A;  2Y90 A;  2PUO B;  2IIM A;  2K57 A;  3CXC S;  2KXC A;  2E6Z A;  3REB B;  3CCU Q;  2O88 A;  1IGQ A;  2K79 A;  3LGF A;  3JCM V;  4E7I A;  2CRE A;  3NE0 A;  1K9M C;  1SHF A;  1TG0 A;  2DZC A;  1R77 A;  1PM3 A;  1XNI A;  1RAE B;  3TSZ A;  1QKW A;  4IUP A;  2YDL A;  1M3A A;  4PJL A;  3G6E A;  1BU1 A;  3JRZ A;  2D1X A;  2HCK A;  3CPW S;  1QQJ A;  1WJS A;  1UGP B;  3OYH A;  4PJO C;  3CCV Q;  2RQV A;  2CSQ A;  4JRI A;  2M16 A;  4BY6 B;  2PTK A;  4WTO B;  2P0Q A;  2KSS A;  1KHC A;  1B34 A;  1OU8 A;  2BUD A;  3SWN A;  4M7A E;  2L3R A;  4LUE A;  2RI5 A;  4A4E A;  2L3P A;  1UEC A;  3EFR A;  3TSW A;  1CKA A;  1WYX A;  3M58 A;  4B6M A;  3INZ A;  2O9V A;  3MET A;  2RM4 A;  5LJ3 j;  2EAY A;  2HBW A;  4XTW A;  2DX1 A;  1UUE A;  2MCN A;  1TUG B;  2OTJ Q;  2FO0 A;  1WIE A;  1XQH A;  2BKD N;  5LJ3 h;  3CCU A;  1JU5 C;  4ATO A;  1ZSG A;  1OEB A;  1Q82 U;  1NJI R;  3TCJ A;  5CAI A;  2KYB A;  4M7A C;  2ED1 A;  1M4Z A;  4QT7 A;  2CZ6 B;  2RF0 A;  2HNI A;  3CCR A;  1KQS S;  4V2S A;  3EGX A;  4RTT A;  3CME Q;  5IXB A;  2B8A A;  1AZG B;  2PVO B;  4IUT A;  4Z8A A;  2K7A A;  1PRM C;  3OS2 A;  1CSK A;  2ABL A;  5CKD A;  5GAM j;  3GLX A;  5IH2 A;  1M2O A;  1TTH B;  4M78 B;  5DY9 A;  3CCV A;  2A28 A;  2RA2 A;  4E7J A;  1VQM Q;  2EWN A;  1IO6 A;  1WJQ A;  4RTW A;  4YTL A;  2JMC A;  1Q81 U;  5GAM h;  1KC8 C;  4HZ9 A;  1GCQ A;  2HKQ B;  1MMA A;  4C92 G;  3QYH B;  2EJF A;  3I56 A;  4LN2 A;  1HD3 A;  5I11 A;  5A0D A;  2IOA A;  1YWP A;  4Y92 A;  5KYX B;  2EQK A;  2ROL A;  4C92 D;  3QWX X;  3HTR A;  4OB3 B;  2Y4Y A;  5EC7 A;  2CP7 A;  4CC3 A;  3OYI A;  2LX7 A;  2AIR B;  1PRL C;  2DTI A;  2XIV A;  4AFU C;  1UJ0 A;  4FGD A;  4AFZ C;  5GMK i;  2DIQ A;  4FQA A;  1M9S A;  1WQW A;  1RL2 A;  5KYN A;  3OYF A;  2DZ9 A;  4OML A;  1T3S A;  3QSU A;  1J3T A;  3P8B B;  1LCK A;  1Z9Q A;  1U1T A;  2SRC A;  5IHK A;  2VWF A;  5D6X A;  1JXO A;  1RLP C;  3OSS C;  5AT1 B;  1VQM A;  3I86 A;  3CCJ T;  1N9S A;  2X4W A;  3PNW C;  1VYT A;  5CKB A;  2D6F A;  1PWT A;  2ZGW A;  3L2Q A;  2K2V A;  3UWN A;  1K9A A;  2K3B A;  2HKN A;  3TEE A;  3HKS A;  8AT1 B;  2DL8 A;  3X25 B;  1YI2 T;  3PE0 A;  1V76 A;  4M78 A;  4ZGD B;  3MHX A;  1G8X A;  1Q82 C;  4X9C A;  4F7U F;  1QP2 A;  3UF4 A;  3I5S A;  3OYN A;  3A8L B;  1YJN A;  2DE0 X;  1Q86 R;  3DB4 A;  5CVI A;  2PU9 B;  3CC4 A;  5LJ5 f;  1BCO A;  2QGG A;  3VKI A;  2AK5 A;  1OX8 A;  1UDL A;  2RNA A;  2J05 A;  3HP9 A;  4FGI A;  3H6Z A;  3GT2 A;  3ER0 A;  2RPN A;  2ZAE A;  3HFN A;  3M0U A;  2DIL A;  3EGD A;  1V29 B;  3L2R A;  3S0Q A;  4PJO B;  1M27 C;  4Q4N A;  1YBY A;  4RUG A;  4M7D G;  1Q81 C;  1N8R R;  3M56 A;  2KY9 A;  2DVE A;  5IHI A;  3I55 T;  1TU0 B;  3TRE A;  1WA7 A;  4ZN3 A;  3CPF A;  1VOM A;  4HKE A;  2GFA A;  5CIU A;  2QA4 A;  5EG2 A;  3JCM W;  1K8A U;  1MMN A;  4M7D D;  5CCA A;  4OMO A;  2ED0 A;  3C94 A;  4HCC A;  4IUU A;  3PVQ A;  3GF5 A;  2JTM A;  2OI3 A;  5HCK A;  1SSH A;  1CKB A;  3E2U A;  4DBF A;  1KHI A;  5HK3 A;  3VS5 A;  3H0I A;  5FU6 C;  4AFQ C;  4M7A B;  2E3H A;  2E12 A;  1YIJ T;  1QVF A;  1O75 A;  4JS4 A;  1BI1 A;  2DO3 A;  1UHF A;  4FT2 A;  3S3N A;  1SF9 A;  1W2B A;  4JUR A;  2HSE B;  3AHU A;  2YUQ A;  2GTO A;  1G3T A;  4NOY A;  1YHQ T;  5LJ3 d;  1P92 A;  5LJ5 e;  4DA4 A;  4Q5W A;  3CCJ Q;  1VIF A;  2V8J A;  1JJ2 A;  4JDS A;  2DJZ A;  2E41 A;  3E9F A;  2RK1 A;  4K11 A;  5LJ3 e;  2R57 A;  3M0Q A;  2X35 A;  4ZGJ B;  1YP5 A;  3L1A A;  1D1C A;  1YI2 Q;  4OF1 A;  3JCM P;  3H0F A;  4A4G A;  4M77 G;  2P4T A;  4PJO A;  1W2B P;  2DFU A;  2DER A;  3CCM T;  4R55 A;  3REA B;  3X24 B;  1Y0M A;  1FMK A;  2SEM A;  2LZ6 B;  3RUX A;  1B07 A;  1VQ5 A;  2K5I A;  2LQW A;  3THK A;  1YIT A;  5GAN f;  4HCB A;  1YN8 A;  5GAM d;  2E3I A;  2RJC A;  1JJ2 P;  2GTJ A;  5GAN 3;  2QYZ A;  2G6F X;  3A2Y A;  4A4K A;  4JZ4 A;  3KUF A;  1XJW B;  1S72 A;  3FC3 A;  3PGG A;  2LTO A;  4X1V A;  4KT0 E;  2NYS A;  1YNZ A;  2JJ9 A;  2VOB A;  2CZ1 B;  4FCY A;  2E70 A;  4DBQ A;  1GRI A;  3M4G A;  3CD6 T;  1ZUK A;  3I55 Q;  4JRQ A;  3OW2 S;  2V26 A;  1SSF A;  4HVW A;  4BB7 A;  1NE8 A;  4MZT A;  3CCL A;  4M7A A;  2RB6 A;  4CC4 B;  4DEY A;  2LJ1 A;  3OS0 A;  2JMA A;  1K8A C;  2PZ1 A;  3PIP A;  1PD1 A;  5GMK l;  2A3L A;  3UT1 A;  4WF2 A;  4EMK C;  1KFZ A;  4FQB A;  2QQA A;  1WNL A;  2D8H A;  2BE9 B;  1OV3 A;  1WLP B;  3RMS A;  1K0S A;  4KGZ B;  4GLM A;  3G6E T;  2F69 A;  1WHK A;  1U8R A;  2RJE A;  2I2L A;  1X75 C;  5CQX A;  2DBK A;  1RAG B;  2FPF A;  1RAA B;  1UTI A;  4J83 A;  3OYC A;  3CXC P;  4EIK A;  3GNG A;  1FMV A;  3H0H A;  2RHX A;  4M77 A;  2J6O A;  3G71 T;  1NLP C;  1YIJ Q;  4E7S A;  4EPC A;  2HDA A;  3C0C A;  2O4X B;  3OYG A;  1FMW A;  4BI8 B;  1YWO A;  1WJR A;  2LC4 A;  5GAN e;  1YHQ Q;  1LVK A;  4M78 F;  2QI2 A;  3CPW P;  5FU7 C;  3QDR B;  3VPJ A;  2DBM A;  3KW0 A;  3GBQ A;  5GAO q;  5C6S A;  3SEM A;  2E5Q A;  3O8V A;  3OS5 A;  2DPP B;  3X26 B;  1OUL A;  1ZUY A;  1VQO A;  1IHW A;  2YHT A;  4A4F A;  2JM8 A;  3EFO B;  4JS5 A;  4TVR A;  4RG2 A;  2IPO B;  2IF6 A;  4RG8 A;  2EJG A;  1KQS A;  3CCM Q;  3CCR T;  4J6X A;  3PBC A;  4ORZ A;  1R8O B;  1I0C A;  1OX9 A;  4DBH A;  1M90 U;  2DF6 A;  2LJ0 A;  4C92 E;  2L3Q A;  1D0Z A;  2R58 A;  3VYH B;  4F4M A;  4XK8 E;  2ZPB B;  2I0N A;  3BY7 A;  3VS0 A;  5FU6 B;  2IOB A;  5GMK m;  1QVF S;  3A8G B;  2EGC A;  1H64 1;  3OS1 A;  4J7I A;  3PMI A;  2GQI A;  1KQS P;  2XID A;  5HKC A;  1QP3 A;  3I56 T;  4HT8 A;  3CD6 Q;  4M75 E;  2IG0 A;  3J81 E;  2FL7 A;  5CKH A;  1M8M A;  2GCX A;  2VPM A;  1TH7 A;  5KE2 A;  3VUB A;  2DM1 A;  1MV0 B;  2KGT A;  2DRM A;  2PQW A;  3M0S A;  2RO0 A;  2O4X A;  3M0P A;  3M54 A;  4MML A;  4E47 A;  3T9N A;  4EQA A;  3FDR A;  4R0K A;  4RCC A;  2M0O A;  3HHT B;  2V8K A;  3M59 A;  2DA9 A;  3M55 A;  1SKU B;  2XDP A;  1UFF A;  4C8Q A;  3G6E Q;  5A2Q E;  2D9T A;  1JXM A;  1PD0 A;  4A54 A;  2KK4 A;  4M75 C;  3M0R A;  2A36 A;  5HY6 A;  2FRW A;  3OA6 A;  1BBZ A;  5IXF A;  1VQP A;  1QVG A;  1U3O A;  3CC2 A;  2JN0 A;  5CR2 A;  4ME7 A;  1KD1 R;  3G71 Q;  1N6A A;  2BZY A;  5KCH A;  4E2F B;  3MO8 A;  5CKE A;  1QVP A;  4JLI A;  2FYK A;  3HFO A;  3EFO A;  3RER A;  2YLB A;  3VRZ A;  4OVA A;  4M7D F;  4ZTJ A;  4BE1 A;  4PJO F;  3RBB B;  2X51 A;  3PIO A;  3JCM c;  2QTV A;  3RKY A;  2HQE A;  1RAB B;  2CS7 A;  5GAO r;  2CYZ B;  2RD1 A;  2CT4 A;  1E6G A;  3TVT A;  4HT9 A;  3OSV A;  4E6R A;  2QQB A;  1KQ1 A;  1SRL A;  2HZY A;  2YLC A;  4LDU A;  2CDT A;  3QG1 A;  1XOV A;  2FZC B;  3VU3 C;  2PNI A;  3CCR Q;  1YJN T;  5HK0 A;  4EMK B;  4LJ1 A;  3L2V A;  2COZ A;  1M90 C;  2EW3 A;  3CC4 T;  4II1 A;  1K73 R;  2K3X A;  1WXT A;  5DLO A;  1Q82 R;  2RQR A;  1FWZ A;  3FRN A;  1PKT A;  4AFS C;  1RAI B;  2AT1 B;  2RI2 A;  3G4S A;  3G71 A;  1BI2 A;  1S1N A;  1ZX6 A;  2KVQ G;  3ZFJ A;  1PCX A;  3VS1 A;  4LUD A;  4EQ8 A;  2ZZD A;  2E10 A;  1NBE B;  4IUR A;  5DLQ E;  3DLL A;  1WX6 A;  4LDX A;  4GY5 A;  3PMT A;  3I56 Q;  3V7C A;  3LWI A;  2QA4 T;  2DYI A;  2X3X D;  5FRM A;  3NGP A;  1D1A A;  5LJ5 j;  4Q4T A;  3GPL A;  3CCS A;  1ZBJ A; 
#chains in the Genus database with same CATH homology
 4Z89 A;  2W10 A;  1U06 A;  2AZS A;  3O98 A;  1NYG A;  2LCS A;  4CT3 A;  2EBP A;  3UF4 A;  3I5S A;  3KFV A;  5GJW B;  1UJY A;  4FDY A;  1OPK A;  2DE0 X;  3SHW A;  1X43 A;  2KT1 A;  1T3L A;  4J9F A;  5FWB A;  1I07 A;  2AK5 A;  2M0Y A;  1GFD A;  2RNA A;  1UDL A;  2C0T A;  2J05 A;  4FGI A;  3GT2 A;  3RNJ A;  2RPN A;  4FGE A;  2M51 A;  3M0U A;  4LE9 A;  2DIL A;  3H41 A;  1AWJ A;  4CC7 A;  1K4U S;  2BZ8 A;  3S0Q A;  1M27 C;  4Q4N A;  4RUG A;  3A30 A;  4D8D A;  1WFW A;  3VS4 A;  3FJ5 A;  5IHI A;  2GGR A;  2KNB B;  2HSP A;  4RTY A;  1WA7 A;  2ESW A;  1GBQ A;  1Y57 A;  3ULR B;  4J9H A;  4J9G A;  2O9S A;  1JEG A;  3M1U A;  1M3B A;  2DJQ A;  4OMO A;  2ED0 A;  2KRM A;  3PVQ A;  1PKS A;  3EHR A;  2F2W A;  3VS2 A;  2LP5 A;  2MIO A;  2NUZ A;  2OI3 A;  5HCK A;  1SSH A;  5L23 A;  1CKB A;  2LQN A;  3NMZ C;  3VS5 A;  3IQL A;  3H0I A;  1GL5 A;  2OAW A;  3O5Z A;  5ECA A;  1W70 A;  1RUW A;  2CT3 A;  1WI7 A;  4AFQ C;  4JXB A;  1BB9 A;  1G2B A;  3VS3 A;  2DL4 A;  2C0O A;  3EG3 A;  1UHF A;  4JJD A;  5IHN A;  4RTU A;  4GBQ A;  3VRY A;  3ZL7 C;  3UAT A;  4DEX A;  1X2Q A;  5GJV B;  2IO7 A;  2JT4 A;  1H92 A;  4HZB A;  2YUQ A;  2GTO A;  4J9B A;  2EYX A;  1W1F A;  2JTE A;  2EYZ A;  3CQT A;  1ABQ A;  4OLK A;  4RTV A;  1VYV A;  2GNC A;  2YT6 A;  1VA7 A;  1QWE A;  2EYW A;  3I35 A;  2EGE A;  2FEI A;  4K11 A;  3M0Q A;  4Q4G X;  2L2P A;  1YP5 A;  4CC2 A;  2IO9 A;  1HSQ A;  1VYU A;  2X3W D;  2F2X A;  2DYB A;  3H0F A;  2W0Z A;  2CUB A;  2E5K A;  2RN8 A;  2EKH A;  1BK2 A;  4HXJ A;  2F2V A;  1AVZ C;  2P4R A;  2YUN A;  3PBI A;  4OMP A;  3REA B;  1WDX A;  1Y0M A;  1X2K A;  1FMK A;  2SEM A;  2LZ6 B;  4OMQ A;  1B07 A;  2KRS A;  1NYF A;  2LQW A;  2YUO A;  3THK A;  1SEM A;  1AWO A;  2KYM A;  1YN8 A;  3I5R A;  4CSH A;  2A37 A;  2DL7 A;  2GTJ A;  1I1J A;  2G6F X;  3A2Y A;  2CH4 W;  4JZ4 A;  2D0N A;  2K9G A;  1V1C A;  4F16 A;  2V1Q A;  4X1V A;  1YNZ A;  1K0X A;  1MV3 A;  4KRT A;  2K6D A;  2VOB A;  2JM9 A;  4AG2 C;  1GRI A;  1KSW A;  1E7O A;  1JQQ A;  2FRY A;  1ZUK A;  2VVK A;  2RQW A;  2YSQ A;  3UA7 A;  4HVW A;  1U5S A;  2EYY A;  1SRM A;  4CC4 B;  4DEY A;  2LJ1 A;  2J6K A;  2JMA A;  2PZ1 A;  1GFC A;  1T0J A;  2J7I A;  2AKK A;  2KXD A;  2CH4 A;  2ENM A;  1KFZ A;  1K76 A;  4FQB A;  4J9I A;  1OOT A;  2D8H A;  4JZ3 A;  1OV3 A;  2EGA A;  2LMJ A;  1W6X A;  3QWY A;  1WLP B;  1K0S A;  3EG1 A;  4GLM A;  3JV3 A;  2CUD A;  2DBK A;  2DRK A;  1X69 A;  1GCP A;  1TUC A;  2ECZ A;  2FPF A;  1M3C A;  2VKN A;  1A0N B;  1UTI A;  2KEA A;  2EQI A;  4EIK A;  3H0H A;  1QLY A;  4JPB W;  2DMO A;  2J6O A;  2FPD A;  1Z9Z A;  1NLP C;  4F0W A;  2V1R A;  3R6N A;  1UHC A;  1QWF A;  2K2M A;  2CSI A;  2KRN A;  2YUP A;  2HDA A;  3C0C A;  3VS6 A;  1AEY A;  3UA6 A;  4HCK A;  4F14 A;  2J06 A;  1YWO A;  3EGU A;  2DLP A;  1ARK A;  1UG1 A;  1T0H A;  1AOJ A;  1N5Z A;  2EPD A;  2QDL A;  3VPI A;  3EG0 A;  1GBR A;  3VPJ A;  4HVV A;  1AWX A;  1QCF A;  2DBM A;  3KW0 A;  3GBQ A;  2IIM A;  2KXC A;  3REB B;  3SEM A;  2O88 A;  2DVJ A;  1ZUY A;  2K79 A;  4M4Z A;  1WXB A;  2C0I A;  2CRE A;  3NE0 A;  1SHF A;  1TG0 A;  3PVL A;  2JS0 A;  2L0A A;  2MOX A;  2JM8 A;  4Z88 A;  2LNH B;  3TSZ A;  1QKW A;  2OJ2 A;  3NPF A;  2IF6 A;  2YDL A;  1M3A A;  2A08 A;  1BU1 A;  2B86 A;  2RQU A;  3PBC A;  2D1X A;  2HEQ A;  2HCK A;  4ORZ A;  1G83 A;  2JW4 A;  3EG2 A;  1I0C A;  2IO8 A;  2DL5 A;  1SPK A;  2DF6 A;  2LJ0 A;  1EFN A;  2RQV A;  2D8J A;  2FG0 A;  2CSQ A;  2L3Q A;  2PTK A;  4RTX A;  4F4M A;  4A63 B;  1ABO A;  1QKX A;  2I0N A;  2FPE A;  1AD5 A;  1E6H A;  3EHQ A;  1AWW A;  3VS0 A;  1H3H A;  2AZV A;  2IOB A;  4LUE A;  2L3P A;  2EGC A;  1UEC A;  3TSW A;  1OPL A;  2GQI A;  3U23 A;  1CKA A;  2DL3 A;  1WYX A;  2KBT A;  3LH5 A;  2H8H A;  4RTZ A;  1B3Q A;  1PNJ A;  2RMO A;  1M8M A;  2VPM A;  2O9V A;  4J9E A;  2HBW A;  2DX1 A;  1UUE A;  4IIO A;  2MCN A;  5FW9 A;  2LRJ A;  2DM1 A;  2FO0 A;  1MV0 B;  2KGT A;  1WIE A;  2DRM A;  3M0S A;  1JU5 C;  1SHG A;  3M0P A;  1ZSG A;  2KE9 A;  1OEB A;  4EQA A;  5FWC A;  4R0K A;  2KYB A;  2ED1 A;  2DA9 A;  4EOB A;  1X6B A;  4QT7 A;  2RF0 A;  1JO8 A;  4CGK A;  4F17 A;  1UFF A;  1RLQ C;  2XMF A;  1JXM A;  2KRO A;  4RTT A;  5IXB A;  2KT8 A;  3M0R A;  2A36 A;  2FRW A;  1BBZ A;  5IXF A;  1AZG B;  2BTT A;  1U3O A;  4Z8A A;  2O31 A;  2K7A A;  1PRM C;  4IIM A;  1CSK A;  2ABL A;  3M0T A;  2K1G A;  2BZY A;  5IH2 A;  1NM7 A;  3NHN A;  1MUZ A;  2GBQ A;  1YCS B;  2A28 A;  4D8K A;  2JS2 A;  3A98 A;  1H8K A;  2NWM A;  1IO6 A;  1FYN A;  4RTW A;  1WXU A;  2JMC A;  2RQT A;  4AG1 C;  4HZ9 A;  1GCQ A;  1ZUU A;  2LJ3 A;  4HPE A;  1NEG A;  3VRZ A;  4J9D A;  1GCQ C;  1NEB A;  4LN2 A;  1TUD A;  1HD3 A;  5I11 A;  2IOA A;  2EVR A;  1YWP A;  4Y92 A;  3RBB B;  2ROL A;  1M30 A;  4ZNX A;  1KIK A;  3VS7 A;  1X27 A;  2DNU A;  1UE9 A;  2AKL A;  2CT4 A;  1E6G A;  4OMM A;  3QWX X;  1K1Z A;  3TVT A;  4E6R A;  5EC7 A;  1SRL A;  4CC3 A;  2CDT A;  2LX7 A;  1PRL C;  4JJC A;  1X6G A;  1XOV A;  4HVU A;  4ESR A;  1KJW A;  2PNI A;  4FSS A;  2L3S A;  1HJD A;  4J9C A;  4AFU C;  2XIV A;  1UJ0 A;  2ROT A;  4FGD A;  4LJ1 A;  2JXB A;  4AFZ C;  1AZE A;  2K3A A;  2EW3 A;  1NG2 A;  4FQA A;  5I22 A;  4JJB A;  2J6F A;  2BZX A;  2KR3 A;  1WXT A;  1UGV A;  2RQR A;  1PKT A;  4OML A;  1T3S A;  4AFS C;  4F0V A;  1RI9 A;  1J3T A;  1LCK A;  2VPS A;  1Z9Q A;  1S1N A;  2SRC A;  5IHK A;  2VWF A;  1ZX6 A;  1JXO A;  1RLP C;  2O2O A;  3VS1 A;  4LUD A;  3I86 A;  4LNP A;  4EQ8 A;  1ZLM A;  1WX6 A;  1VYT A;  4OMN A;  1PWT A;  1NLO C;  2X3X D;  3A2Z A;  3NGP A;  3I9Q A;  1PHT A;  1K9A A;  2K3B A;  4Q4T A;  4WCI A;  2DL8 A;  3PE0 A;  1ZBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...