3PVQA

Crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
297
structure length
295
Chain Sequence
AYGVVHISVCNMRDEGKFTSGMSTQALLGMPVKVLQYTGWYEIQTPDDYTGWVHRMVITPMSKEKYDEWNRAEKIVVTSHYGFTYEKPDDDSQTVSDVVAGNRLKWEGSKGHFYKVSYPDGRQAYISRHISQPESKWRASLKQDAESIIKTAYTMIGIPYLWAGTSSKGVDSGLVRTVLFMHDIIIPRDASQQAYVGERIEIAPDFSNVQRGDLVFFGRKATADRKEGISHVGIYLGNKRFIHALGDVHISSFDPEDEYDEFNTGRLLFATRFLPYINKEKGMNTTDHNLYYLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl-peptidase VI
publication title Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 82
structure length 295
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3pvqA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3pvqA02
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 3pvqA03
1QKWA 2DL8A 1TUCA 2K2MA 1T0HA 3M0SA 1M8MA 3U23A 1AZGB 4M4ZA 1TG0A 2MIOA 4JXBA 2LJ3A 1LCKA 4LE9A 1ZUUA 1YNZA 1MV0B 2J6KA 1WLPB 1UE9A 4JPBW 2RQWA 1WFWA 1SHGA 4EQ8A 2EYWA 2DL3A 2OI3A 3JV3A 4J9EA 2EYYA 1I1JA 1UFFA 2F2VA 1Y57A 4LJ1A 4F17A 1OPLA 1WA7A 2CH4A 2K79A 5FW9A 4JJCA 1NYFA 3M1UA 1UDLA 2EBPA 1QWFA 4EQAA 2IO7A 4LUEA 2K6DA 3M0TA 2J6OA 3VS2A 1T3SA 1T0JA 2LZ6B 1AWWA 3H0FA 1SRLA 4GLMA 3PBIA 3UA7A 1PHTA 3RNJA 3VS1A 1KFZA 2KT8A 4HCKA 3M0UA 3QWXX 5EC7A 2HDAA 1OPKA 2KXCA 1KSWA 4JJDA 2KEAA 1M27C 1N5ZA 1TUDA 2XIVA 2D8HA 3IQLA 2A08A 4FGEA 4J9IA 3ZL7C 2JW4A 1Z9QA 4HVVA 1RLPC 1AOJA 4RTUA 2EYXA 2ROLA 3VPIA 4AFSC 2CDTA 5FWCA 2CREA 2L2PA 2ESWA 3KFVA 4JZ4A 4AFQC 2L3PA 1WXBA 4RTXA 1PWTA 1MUZA 1ZLMA 5IHNA 3VS4A 3R6NA 1PRLC 1UG1A 3UA6A 3QWYA 2GTJA 2CSIA 2RMOA 2DVJA 1MV3A 2KROA 3EHRA 1YP5A 1UTIA 1GCPA 1QWEA 1RUWA 1PNJA 2FRWA 1VYVA 2M0YA 2OJ2A 1U06A 2FPDA 2EKHA 2BZ8A 3UF4A 2OAWA 1AEYA 2RQUA 3I9QA 4CC4B 1UUEA 2RQTA 2LCSA 3NMZC 1X2KA 5IXBA 4J9GA 3EGUA 1A0NB 2F2XA 1GBQA 1WXTA 3M0PA 4FDYA 2EYZA 2JM9A 2L0AA 3H41A 5GJVB 3TVTA 2JMAA 2DL7A 2AZSA 2GGRA 2AK5A 3TSWA 1QCFA 4JJBA 2JMCA 2FEIA 2YT6A 1GCQA 2IOAA 1NEGA 2D0NA 1W6XA 4EIKA 1H8KA 2FG0A 1K0SA 1JXOA 3H0IA 4HXJA 1ZUKA 2KRMA 3TSZA 2F2WA 1WIEA 1I0CA 1PKTA 3SHWA 5IXFA 4KRTA 2IO9A 1E6HA 4D8DA 4J9FA 2FO0A 2LMJA 1K76A 2KR3A 1W70A 2DA9A 2EGAA 3VS5A 4J9CA 1ABQA 2H8HA 3PVLA 2JXBA 3I35A 1YCSB 4RTTA 3NHNA 1X2QA 2BZYA 4HZBA 1OOTA 2LQNA 4HZ9A 2LRJA 1ZBJA 2DJQA 2VOBA 4CSHA 2YUPA 4RTWA 2O9SA 2J7IA 4QT7A 1U5SA 2O88A 3GT2A 2DBMA 4J9BA 4RTZA 3NE0A 3C0CA 2PNIA 1S1NA 5FWBA 5HCKA 1U3OA 1CKBA 1AWXA 5ECAA 2CH4W 3O98A 2LQWA 2EGEA 2YUOA 2KBTA 1GCQC 1ZSGA 1X6BA 4K11A 1K4US 2KRNA 1NYGA 1KJWA 3SEMA 2CUDA 1GRIA 2ROTA 1M30A 2K9GA 4AG1C 1X69A 1GFDA 1XOVA 2IIMA 3VRYA 1I07A 3A30A 1CSKA 1UGVA 1OV3A 2PZ1A 1YWPA 4Q4TA 3I86A 1H92A 4D8KA 2DL5A 4FGDA 2KNBB 4Y92A 3UATA 3VS3A 1UHCA 2YSQA 4F0WA 1PRMC 1M3AA 3EG3A 4AFUC 2DRKA 2B86A 1BU1A 1AVZC 2LJ1A 1AZEA 4HPEA 2KXDA 4IIOA 1ARKA 4ESRA 2LNHB 4OMOA 2VVKA 2FPEA 4ZNXA 2EPDA 2HCKA 1K1ZA 1ABOA 2FPFA 3LH5A 1WI7A 2J06A 2GQIA 2JT4A 1VYUA 1NLOC 2JS2A 4GBQA 1NEBA 2RQVA 2LX7A 2JTEA 1GFCA 1Z9ZA 4R0KA 2K3BA 2RF0A 2L3QA 1RLQC 5I11A 2VPSA 1X27A 2SEMA 2X3XD 4RTVA 1AWJA 1W1FA 2BTTA 2MCNA 5I22A 3A98A 2VWFA 2ABLA 1FYNA 4DEYA 1CKAA 3PE0A 1J3TA 2DRMA 3RBBB 1WYXA 2JM8A 1B07A 2A37A 2EGCA 2HBWA 4AG2C 2L3SA 2RNAA 1UJYA 3REBB 1JQQA 3PVQA 2KGTA 1T3LA 2DILA 1K9AA 1RI9A 1G2BA 4IIMA 2C0OA 2VKNA 2QDLA 4Q4GX 3H0HA 1NLPC 1AWOA 1NG2A 4FQAA 2IF6A 2P4RA 2G6FX 3M0QA 4DEXA 2X3WD 2FRYA 3PBCA 2I0NA 2C0TA 1HD3A 3VS7A 3CQTA 4LN2A 2JS0A 4J9HA 2RQRA 1JO8A 2XMFA 4Z8AA 2AKLA 1E7OA 1M3BA 1UJ0A 1YN8A 2KYMA 4E6RA 1SEMA 2CT3A 2M51A 4ORZA 2YDLA 3O5ZA 2DE0X 4FQBA 2GBQA 4Z89A 5IHKA 3VS6A 4FGIA 4Q4NA 2KE9A 1SRMA 2DF6A 1HSQA 1NM7A 2DL4A 1YWOA 1JEGA 1HJDA 2KYBA 2LJ0A 3EG0A 2O2OA 1QKXA 1Y0MA 2HEQA 2DX1A 1SPKA 1UHFA 3THKA 4OMMA 1UECA 2DLPA 2HSPA 4EOBA 4OMPA 4LNPA 4RTYA 3VS0A 1VA7A 2DNUA 2K3AA 2IO8A 2BZXA 2NUZA 2ED0A 3I5RA 2LP5A 2MOXA 2CT4A 1WX6A 4CC7A 5IH2A 2AKKA 1K0XA 4FSSA 4F0VA 1ZX6A 1KIKA 1BBZA 1OEBA 2DMOA 2DYBA 2D8JA 2SRCA 4A63B 1JU5C 2D1XA 1QLYA 1FMKA 4CC2A 2ENMA 4CC3A 2YUQA 3VPJA 2VPMA 2EW3A 4JZ3A 2DM1A 4F14A 4F4MA 2RN8A 3REAB 2KRSA 2CSQA 3FJ5A 4WCIA 1BK2A 1G83A 2O9VA 1VYTA 4AFZC 2J6FA 3GBQA 3A2ZA 2EVRA 2YUNA 5IHIA 4RUGA 1E6GA 4LUDA 5GJWB 3NPFA 4OMNA 2ECZA 1M3CA 3EHQA 2GTOA 1BB9A 1EFNA 4J9DA 2W10A 4F16A 1GBRA 3A2YA 4Z88A 1GL5A 2NWMA 4OLKA 1ZUYA 3EG2A 2O31A 1AD5A 2K1GA 1B3QA 2RPNA 1H3HA 3KW0A 1X43A 2AZVA 3VRZA 4OMQA 2ED1A 2A36A 4CT3A 2J05A 1WDXA 1WXUA 2K7AA 4CGKA 2CUBA 2DBKA 1SHFA 2GNCA 1SSHA 1IO6A 2EQIA 4HVUA 4X1VA 1JXMA 4OMLA 2E5KA 1V1CA 5L23A 1PKSA 4HVWA 3I5SA 3S0QA 3EG1A 1X6GA 3ULRB 3M0RA 2C0IA 2V1RA 2IOBA 2PTKA 2KT1A 2V1QA 3NGPA 2W0ZA 2A28A
chains in the Genus database with same CATH superfamily
2DL8A 4M77G 2K2MA 3VYGA 3M0SA 4N4IA 2RJFA 4ZGEB 3U23A 4M4ZA 4JXBA 3HHTB 2X4XA 5KYXB 1G3YA 3OW2S 3GOXA 4JPBW 4DBQA 4WTOB 1VOMA 5D6XA 3RKYA 4EQ8A 4J9EA 2YWWA 1S72Q 2LT1A 5KYWA 4C0GA 3KXTA 3SDZA 3OW2P 1WA7A 1NYFA 3M1UA 4MMKA 5FU7C 5GAMf 4RG8A 4DOWA 2K6DA 1C1AA 4FYWB 4E7IA 3L2WA 1MMGA 4LDVA 1T3SA 5LJ3f 1AWWA 1SRLA 2E6ZA 5AT1B 1KC8U 1KQ1A 1PHTA 5CCAA 3C12A 4NL2A 5FU6B 1VQLT 3CCJQ 2EYQA 2QEXQ 4XTUA 2E4HA 1N5ZA 4FM4B 3V8KA 2E1HA 4OB1B 4C92D 4PKCC 4JRPA 1M2VA 4C92B 4AFSC 2VC8A 2CDTA 3PMIA 1YJNA 1WXBA 3OBYA 4C92F 1B34A 4RTXA 4HCZA 3CCLT 1PWTA 3JCMJ 1G5VA 3CCSQ 4E7SA 3X24B 1VQNA 2ZPGB 1VQPQ 1IHWA 2HMAA 3CC4T 2FZKB 3EHRA 5A0GA 1YITT 1YP5A 1UTIA 4XU3A 1QWEA 1G8XA 3M57A 3PGGA 3A8MB 1Q7YU 2K5FA 3UF4A 3S3OA 2OAWA 2HZYA 4KT0E 1MMNA 1YJWT 1F1BB 2DXCA 1UUEA 1BKBA 2P84A 2QTVA 1OULA 4II1A 2CZ6B 3CC7T 3OS1A 4M7DD 3VKIA 2VGNA 1WXTA 4M7DB 2JM9A 3TVTA 1YHQQ 1ZA2B 3I56T 1TTHB 2DVEA 1BI2A 1RACB 4IUVA 3HSBA 4M7DF 2JMCA 2V8IA 1OU8A 2IOAA 3LWHA 1H8KA 3CCRT 5KH6A 4XU1A 4NOYA 4EMGA 1TUGB 4QVDA 1I0CA 2ZCFB 1WZOA 3C4SA 1YJNQ 5IXFA 4PJOE 1IRXA 3JCMe 1Y96A 1IZ6A 2DA9A 2EGAA 1Q81U 3LLRA 2H8HA 1RAIB 2VXEA 1PSEA 4N0AA 2LQNA 2LRJA 4B9XA 1N6AA 4PJOG 3VUZA 4CSHA 4QT7A 2O88A 3GIBA 5FLXE 3CXCA 4RTZA 2KQWA 5D6YA 5CVIA 1S1NA 5FWBA 1CKBA 2EFIA 4C5HA 4CRIA 2RHXA 2DXBA 1VQ9A 4A4EA 4KULA 3HRTA 1JJ2S 4K11A 2HQXA 1K4US 3E9GA 3G6EA 3SEMA 2DD4A 4AG1C 4EMKB 1D1CA 2QXFA 1XOVA 3VRYA 4HKEA 1LOJA 3G7ZA 1G3SA 2KDSA 1UEBA 1IREB 4MDWA 2A0FB 1OV3A 4ANJA 1JJ2P 1UGPB 3JSCA 4NS5A 3CCVQ 1AT1B 1OX9A 4FGDA 3M53A 2JUFA 1R0BG 5GMKj 4BE2A 2QASA 1I81A 3CCEA 2K5IA 2DRKA 2B86A 2RH2A 3OMCA 1QCOA 2QGFB 4N4GA 3X28B 4C0DB 5L8RE 2JN0A 4KGXB 2KXDA 5KYYB 4IIOA 2X51A 1M9SA 3QSUA 3I55Q 2LNHB 4OMOA 5D6WA 3OS2A 2GQIA 2JT4A 2MMPA 1VQ9Q 3OB9A 4JLIA 2DPPB 2JTEA 2XDPA 3EGDA 5KE2A 5CIUA 3G6EQ 3RKXA 2L3QA 3OYLA 4M78B 2SEMA 1KHCA 2X3XD 1N8RR 3L2QA 2MCNA 2AIRB 2PUOB 2VWFA 4RG2A 2LCCA 1WJRA 5GAOl 1FYNA 4QQ6A 3GP8A 2H3JA 4BE0A 2DTIA 4PJOA 3RBBB 2RI3A 3WVDB 2A37A 2EGCA 4OB2B 5FRNA 2DIQA 3EG9B 2RNAA 3G71A 1JQQA 3PVQA 5GMKe 1WHLA 1T3LA 3OQ5A 2DILA 3R6OA 4IUPA 2HKNA 4PLIA 2CP7A 2VKNA 3DLLA 1NLPC 1YFNA 1Y71A 2FRYA 3EFOA 4XQ3A 2I0NA 2DTOA 4GLKA 2O01E 2GF7A 2R5AA 4Z8AA 1KQSA 1M3BA 1UJ0A 2CZ7B 1YN8A 1SEMA 4BUGA 1X01A 1VQNT 2XDDA 4ORZA 2YDLA 4M7AC 2QG9B 4OP0A 4FQBA 2OTLA 3M4GA 3HP9A 3VS6A 2HD0A 1HYOA 2YHTA 1SRMA 1JEGA 4QW2A 4M7DA 1SPKA 2DLPA 3DB4A 4N4HA 4CI0C 4J8OA 4LNPA 3CXCP 3M58A 1OYXA 3CCMQ 3CCUA 3G4SQ 4RTYA 3OYJA 3VS0A 1VA7A 4L5GA 5LJ5j 2ZAEA 2BUDA 2CYZB 2VYTA 2IO8A 4XU0A 2K5LA 3G71Q 2LP5A 2MOXA 2ZPFB 2FHDA 3FJPA 1K0XA 1ZSZA 1K9MR 3EH2A 1EX4A 4BDZA 1VIEA 1W2BS 1SG5A 1QVPA 1NJIC 1RABB 2LTOA 3J7AF 4A63B 3HPWA 1FMKA 4BE1A 2QQAA 1M4ZA 1XTDA 2HBPA 2EW3A 5CR2A 1WGSA 2RN8A 1VQ6T 1VYTA 1W2BP 1IGQA 4ZGJB 5LJ3g 1OX8A 4YTLA 2J6FA 4PL6A 1VQ8A 3QJ6A 4JJNK 3NPFA 4OMNA 2ECZA 3EHQA 2M02A 1V76A 2PVDB 3BFMA 1D0YA 2YRVA 1GBRA 2CP5A 3T9NA 3OSVA 5KYWB 3ZFJA 3EG2A 2RA2A 2RPNA 2JNGA 1IHVA 5LJ5e 2HKQB 4OMQA 2ED1A 2A36A 1LJOA 1WDXA 2QYZA 2CUBA 1SHFA 3RERA 1SSHA 3QJYA 1IO6A 1H3ZA 4X1VA 5LJ3h 5J3BA 2PVOB 3SWNC 2CP0A 4IKFA 2KI7A 2QA4T 4C8QE 2V1RA 4FL6A 5M9OA 2V1QA 2XKOC 4DBRA 1T0HA 5KYYA 3QXEB 2LQKA 3CCET 2MIOA 1KQSS 3CCLA 1LCKA 1YNZA 1WJQA 5GANd 4OF1A 1EZZB 5CO7A 3QKJA 5A0DA 4PFOA 1PSFA 2M9UA 1WQ7A 2EYWA 2OI3A 1B34B 2MF2A 2XIDA 3A8LB 5GMKm 3RESA 4LJ1A 1KQSP 4F17A 2K79A 2FB7A 4JJCA 5FW9A 3A8HB 1I5OB 4M77D 2YLBA 3EBQA 3CC7A 4LUEA 2D6FA 4M77B 5DY9A 1KK7A 1VQLQ 3EG9A 2V8KA 3CPWS 4BI4A 3VYHB 2ZPBB 3H0FA 4M77F 4OGEA 4ZTFA 2QQSA 4IUQA 4KH0B 2XU8A 2FL7A 2DD5A 3X26B 5EC7A 2HDAA 1OPKA 2P0QA 4E7JA 2KEAA 1NE8A 2JVVA 2EQUA 3CEYA 3PIOA 2V8JA 1TUDA 4KUIA 1YI2A 2XIVA 2D8HA 2A08A 4X9CA 5GAN7 4R55A 2NUPB 4IURA 4EDUA 2IG0A 2DO3A 1AOJA 3CCLQ 3QUIA 3HRSA 2XHCA 3SB2A 2MI6A 2L2PA 3CC4Q 1M8VA 1R77A 1YITQ 3BE3A 1Y96B 3VS4A 4E7KA 3Q1JA 2OTLT 2KROA 3MP1A 2HSEB 1YJWQ 1IXDA 3OYBA 2RM4A 2RHIA 2M0YA 3CC7Q 1U06A 2FPDA 2WP7A 1AEYA 3CCQT 4BY6B 4LDXA 3JCMd 5GAMj 3I9QA 1M5Q1 3QIIA 2LX9A 4RCCA 3I56Q 4C8QA 2LCSA 3CCUT 1Q82R 4J9GA 3EGUA 1VQ7T 1B7TA 3CCRQ 5GANj 3PNWC 3TSWA 2R58A 4LD9K 3H6ZA 4JJBA 2OX7A 1VQKA 1NJIU 1JXOA 3PT9A 2KAFA 4Y28E 3TQ7P 1BCOA 1ZUKA 3TSZA 3JB9J 3SHWA 4XK8E 2DTHA 4KRTA 4D8DA 3FDRA 4R56A 3V8JA 3VS5A 4J9CA 1ABQA 1M90R 1I5LA 2Z0WA 3RKWA 1VQ8T 2RHYA 5FROA 5C6SA 3FEOA 5CKBA 3M54A 2VOBA 1JBMA 3MHXA 1V29B 5FU6C 3TEEA 4B9WA 3OYHA 1U5SA 5GAMe 3GT2A 2DBMA 2P0KA 3C0CA 2QQRA 3WXMB 4E7LA 3MCAB 1O75A 1DJ7B 4KH1B 3VUBA 1R0CB 2CH4W 3P8HA 2LQWA 1RADB 2E3IA 2F5TX 1JJ2A 3DB3A 1GCQC 5HK3A 1ZSGA 5GANe 3GNFB 3V8LA 1N8RC 1KJWA 2OAUA 4C92C 3EGDB 1GRIA 4HT9A 1M30A 2EJ9A 4MZTA 3JCMb 3A1PA 2IIMA 1VIFA 5GMKi 4PJOD 1ZHIA 2PZ1A 3JB9I 1YWPA 3HTRA 4PJOB 4Q4TA 3KUFA 3I86A 1D0ZA 4EMHA 4PJNA 1H92A 4D8KA 2VXFA 4Y92A 1QP3A 4O5VA 3UATA 4PJOF 1VQ4A 1WJSA 1PRMC 2P4TA 2MWPA 4A4GA 4J7FA 2LQ8A 1BU1A 3EFOB 2LJ1A 3OS0A 1QCNA 2EPDA 2VGMA 1ABOA 4M77A 2FPFA 1BI0A 2F69A 1WI7A 3LH5A 2JTFA 2RHZA 3WVEB 1M1KR 2KVQG 2A7YA 1ZQ1A 2COWA 2RQVA 3RMSA 2DZCA 4BI3A 4LDUA 4R0KA 1RLQC 2VPSA 4J83A 2BTTA 4MMLA 4DEYA 2NUPA 1J3TA 4LDYA 3L2ZA 2JM8A 2LDMA 2F5KA 2HBWA 2F1LA 1PD1A 1YI2T 3M9QA 1K9MC 2KGTA 1UGQB 1OU9A 1G2BA 3OA6A 1VQOA 1ZSZB 2QDLA 3DLMA 3RDVA 4Q4GX 1AWOA 3O8VA 2IF6A 1K73U 1D09B 5DLQE 1VQ6A 3MKDA 1VQNQ 3PBCA 2PVGB 3H9NA 3VS7A 2LC4A 4IUUA 2KYMA 2DEQA 2EIFA 2AHJB 2K4YA 2OTJA 3O5ZA 3OYFA 2DXUA 2DE0X 4EMKC 2GBQA 3CBOA 5IHKA 4FGIA 1AHJB 2RI5A 2KE9A 1QP2A 2DF6A 2DKGA 5LJ5g 2DL4A 1YWOA 1HJDA 3JRZA 3EG0A 1Y0MA 3MO8A 3EFSA 2E65A 4OMMA 3MEUA 3EAEA 4EOBA 7AT1B 2RJDA 1TOVA 4A4HA 2GFUA 5I2SA 5KCOA 2NUZA 2ED0A 1WX6A 3JCMW 4OB0B 5IH2A 2QA4A 4FSSA 1KG1A 1W2BA 1VQKT 1BBZA 3DKMA 1LVKA 2DMOA 3EFRA 2D8JA 1VQ6Q 3A8GB 4M75C 2M16A 1QLYA 1FX7A 4CC2A 5LJ5d 2YUQA 2VPMA 4MDXA 4JZ3A 2DM1A 4WCIA 1BK2A 3CMEA 3M56A 4M78C 3H8ZA 2EVRA 4QQGA 5AYFA 1E6GA 1BIAA 1U8RA 2QK0A 2LVMA 1EFNA 1PM3A 2W10A 3FRNA 4F16A 4Z88A 4F04B 3OYIA 1GL5A 2NWMA 4OLKA 2DYIA 2D9TA 3M5AA 1AD5A 2K1GA 3TU4K 1X43A 4JRQA 1N8RU 4CT3A 4FIBA 2DXTA 4CGKA 4JUVA 1WHGA 2JOYA 3HFOA 2DBKA 2E41A 5LL6S 1D3BA 4J5YA 3S6WA 4PJLA 2QA4Q 1FMVA 3S3NA 4HVUA 4OMLA 1G3TA 4HCBA 1YIJT 5GAN4 2E5KA 3OYDA 3E2UA 4HVWA 5GAOp 2YXYA 3BY7A 3CCEQ 3NTKA 1VQ4T 1QKWA 3LWIA 3RIRA 3L1AA 2CZ0B 3QHSA 1AZGB 2HL5C 4IUTA 2DIGA 1ACMB 2IVWA 1ZUUA 1MV0B 2J6KA 3JB9G 4XU2A 3UDCA 2EQMA 3LGFA 1VQ5T 2DETA 2DL3A 2DJZA 2ZGWA 2F2VA 2QGGA 2E10A 3CCQA 2CH4A 4E7HA 1UDLA 2EBPA 1QVGA 1U1SA 1Y07A 2IO7A 1O9SA 3CPWA 4A53A 2MPXC 1Q82C 3M0TA 1VQ7A 3MEWA 2LZ6B 4C8QD 3META 4M75E 4XTXA 1TS9A 4C8QB 3VS1A 1KFZA 3JB9H 3CMAT 2WSCE 1KSWA 1KD1R 1VUBA 4C8QF 1K9MU 5GAN5 1TWBA 4M78E 1XQHA 1VQOT 4M75G 4J9IA 1PD0A 3HRUA 3RUXA 2JW4A 2DEUA 1Z9QA 3S3MA 2IPOB 4RTUA 2EYXA 1OZ2A 3VPIA 1X75C 2JZ2A 5FWCA 2OTLQ 2CREA 4M78G 2ESWA 3KFVA 4JZ4A 3GLXA 4JDSA 1M1GA 1M90C 2VB6A 1JB0E 1MUZA 5IHNA 2OTJT 1PRLC 1TSFA 1UG1A 3UA6A 2CSIA 1MV3A 3CCQQ 1GCPA 1K8AR 1RUWA 3LX7A 2VV5A 1Q95G 3CCUQ 1VYVA 2BZ8A 2EKHA 5GANg 2CP2A 1I8FA 4NL3A 1VQ7Q 4JURA 1RI0A 4VUBA 1Q86R 4CC4B 1PC0A 2RQTA 4Y91A 4EPCA 1OQKA 2X4JA 2E70A 5IXBA 2HQEA 4PFPA 1A0NB 3JCMV 3M0PA 4FDYA 5GAOn 2EYZA 2AT1B 2CP3A 4TVRA 2DL7A 2AZSA 2GGRA 4FT4A 5LJ5f 4M7AE 1MHNA 2FEIA 5GAMd 2ZPHB 1NEGA 3FLGA 2D0NA 1W6XA 2X9HA 4HCCA 2FG0A 1K0SA 3L2UA 4FW1A 2KRMA 1MMAA 2F2WA 3OYEA 1RAEB 4QVCA 2A3LA 1VQ8Q 3INZA 4M7AG 4BB7A 3FB9A 4J9FA 1TXQA 3CMET 2LMJA 1NPRA 3CD6T 2KR3A 1W70A 3PVLA 4RTTA 3OYKA 1KQ2A 3NHNA 4JRKA 1IB8A 2EJFA 1OOTA 3X20B 1ZBJA 2DJQA 3VV0A 2YUPA 2O9SA 4WF2A 2J7IA 3NE0A 2YRCA 2QI2A 2PNIA 4ATOA 3NTHA 2CZ1B 1QVGS 1M1KC 4JS5A 2LNVA 2EGEA 4L59A 2YUOA 1QVFS 2KRNA 2FZCB 5HK0A 1X69A 3VJPA 1QVGP 1I07A 3CPWP 3C94A 1CSKA 1UGVA 3J81E 1C0MA 2XICA 1NBEB 3JCMg 3ER0A 4OMFB 3OYAA 2DL5A 1U1TA 3V7RA 4N0AC 3VS3A 1QW1A 1UHCA 4OGCA 3E9FA 4F0WA 2HL3A 1VQMT 2RO0A 4J7IA 4F7UE 1QMCA 3EG3A 4BY6C 3LH0A 1AVZC 1QQJA 2O4XB 4J32A 1AZEA 2E12A 4HPEA 1ARKA 4ESRA 1MNEA 4PFZA 1WHJA 2VVKA 2L3RA 4F7UG 2EQKA 1OI1A 1UGRB 5HY6A 1YCYA 1NLOC 5CK9A 3JCMh 4E47A 2LX7A 3MP6A 4M7AA 4O6JA 4J6XA 2K3BA 5LJ3j 2RF0A 2RI2A 5DM7R 3UPUA 1Q82U 1D0XA 1ZBXA 2ZPEB 4RTVA 3JCMQ 1AWJA 1W1FA 5I22A 2BE7D 4OVAA 3EGXB 4FYVB 2ABLA 1YI2Q 1WNLA 3QZ9B 4AMCA 2DRMA 2NUTB 1WYXA 1ZA1B 3A5ZB 1B07A 4BI8B 5A0LA 3REBB 1M2OA 1R8OB 4L6V5 1RI9A 2WSEE 3CCJA 4IIMA 2C0OA 2QQBA 5IN1A 2EAYA 3H0HA 5GAN2 8ATCB 2QEXA 2B8AA 2P4RA 3M0QA 4DEXA 1XJWB 2K3YA 1MMDA 2C0TA 1HD3A 2WSFE 3QDFA 2EJGA 2RQRA 5IT9E 1M90U 1E7OA 4E6RA 1KHIA 4KUDK 3NTIA 4XTWA 2CT3A 4ME7A 2M51A 3BDLA 1EIFA 4XTYA 3E1SA 4Z89A 3PFSA 4JLGA 4Q4NA 5LJ3e 5GAN8 3CCSA 1HSQA 2FYKA 3URGA 1VQPA 4A4KA 3JCMX 4PJOC 2HEQA 2DX1A 1SKUB 1UB4A 1UECA 3AHUA 2HSPA 2ZZDA 4LDWA 5I2MA 1FXXA 3ZEHA 4XTVA 3SFMA 2YLCA 1KC8R 4DQ2A 1VQKQ 4DBFA 5CKFA 3M55A 1YIJA 2LRQA 3I5RA 4F7UA 2CT4A 1YJ9T 4CC7A 1D3BB 2AKKA 2BE9B 5GANf 5KE3A 4F0VA 1KIKA 2EQJA 4PLLA 5FU7B 3OYCA 3JCMP 1YHQA 1Y7XA 4X34A 2SRCA 2D1XA 5J39A 2Y4XA 4CC3A 4F4MA 3SWNA 3FJ5A 4QKUA 1G83A 2RD1A 1VQ5A 4FYXB 4AFZC 4M7DC 3VU3C 3A2ZA 1P92A 2VASA 2K57A 5GMKh 4ZN3A 2YUNA 3QYHB 5IHIA 2DFUA 3PTAA 3TREA 1M3CA 4PJJA 1BB9A 2G3RA 4V2SA 2RK2A 1Q7YR 1ZUYA 5KCHA 1M1KU 2FVUA 2O31A 2DK3A 4FSXA 2DAQA 1H3HA 4BD3A 2AZVA 3A8OB 2RK1A 2GQVA 3CC2T 3FC3A 1ZSZC 2DZ9A 2J05A 4JS4A 1YIJQ 4E7ZA 1YBYA 3CMAA 2EQIA 1JXMA 1JRIA 4C5GA 1VQ4Q 3L2VA 1KD1C 2NLUA 5L23A 3J80E 1X6GA 3M0RA 2PTKA 3C95A 2O4XA 4EQAA 1TUCA 2CGHA 3BDUA 1M8MA 1VQ5Q 1TG0A 2LJ3A 2BKDN 3CCVA 4LE9A 3HL8A 1K73R 2K2VA 3FIFA 1Q81R 1WLPB 1UE9A 2MWOA 3JCMf 2RQWA 4C92E 2RJCA 2QQ9A 5KYUA 1WFWA 1SHGA 3JV3A 3P8DA 2EYYA 1I1JA 4GY5A 1UFFA 1Y57A 3QBYA 3L42A 1OPLA 1K8AC 2K3XA 1H641 3EGXA 3HFNA 1LPLA 4C92G 1S72T 3I55A 1QWFA 2E5QA 2NUTA 4KBMB 1Q86C 1FMWA 2J6OA 3VS2A 3ME9A 3CMAQ 1T0JA 4GLMA 3JB9D 3PBIA 2XDBA 3HKSA 3UA7A 4C0DC 3RNJA 2KT8A 4HCKA 3P8BB 1VQOQ 3ZBDA 3M0UA 3NFCA 2X4WA 3QWXX 2DERA 3TCJA 2KXCA 4JJDA 2QAZA 4A54A 1M27C 3JB9F 1RAFB 4Q5WA 4M7DE 3IQLA 1PCXA 3CCJT 4FGEA 5LJ5h 4C5EA 4HFKA 3ZL7C 2MK5A 4PK4A 3BW1A 3LYIA 2QEXT 4HVVA 1RLPC 5KYXA 2OTJQ 4DA4A 3CD6A 2ROLA 2KMTA 3D7SB 4M7DG 4AFQC 2L3PA 3OYMA 1XNIA 5GAN6 4J6YA 1ZLMA 4MZMA 2COZA 3R6NA 3QWYA 2GTJA 2RMOA 4X9DA 2DVJA 2E6NA 2CP6A 2I2LA 4DOVA 3CCST 1PNJA 2FRWA 3SD4A 4M75D 4C5IA 1VQPT 6AT1B 2OJ2A 3LW5E 4OB3B 4M75B 2RQUA 5C0MA 2XK0A 3NMZC 1X2KA 4M78D 4M75F 5GAOq 1C6VX 2F2XA 1GBQA 2X4YA 3UWNA 3QO3A 2L0AA 3CPFA 3H41A 5CQXA 5GJVB 5GMKl 2JMAA 3X25B 3JAME 1X6OA 4AT1B 4Z02A 1NZ9A 1OZ3A 2AK5A 1QCFA 3OY9A 4M78F 3CCMA 3G4SA 2YT6A 1GCQA 1HXDA 2JTMA 1PG5B 4EIKA 1YHQT 2HAXA 3QZ5B 4C92A 1RAGB 3H0IA 3CMEQ 4HXJA 4KGZB 3CD6Q 1VQMA 2JJ9A 1WIEA 1PKTA 2C06A 2IO9A 5A2QE 1MNDA 1E6HA 1N9SA 2KSSA 4C0ZA 2FO0A 1K76A 4FT2A 1N27A 4HFLA 2HQHA 5DLOA 3L2RA 2JXBA 3I35A 2R57A 1YCSB 1YJNT 3UT1A 3PMTA 1X2QA 2BZYA 4HZBA 4HZ9A 2Y90A 4QQDA 4J6WA 2E64A 2GFAA 5KYNA 4C8QC 4RTWA 2D0QB 4J9BA 8AT1B 4HT8A 2RJEA 2PQWA 3CXCS 1UGSB 5HCKA 1U3OA 1AWXA 3PIPA 5ECAA 3GPLA 1QVFA 3O98A 3JCMc 4BACA 3OYNA 4RKUE 4M7AD 2KBTA 1WHKA 4E2FB 1X6BA 3V7SA 1NYGA 4M7AB 2CUDA 2ROTA 2M1HA 2K9GA 2H3EB 1GFDA 4M7AF 3CBPA 3A30A 4JRIA 1KD1U 2P0PA 1VQMQ 2L89A 4ZTJA 1D1AA 3QYGB 2KNBB 5J26A 2MYSA 2YSQA 3N5BB 2EKOA 2CS7A 2X35A 1M3AA 1BI1A 3QDRB 3CCVT 5D7UA 4AFUC 2E3HA 2RB6A 5GAMg 2XI9A 5EG2A 3OYGA 4HFFA 2PUKB 3M59A 1RAAB 2FPEA 2V26A 2R5MA 4ZNXA 2HCKA 1K1ZA 5CKDA 1BI3A 4UC4A 1K8AU 2WACA 2J06A 3LGLA 1M1FA 5GAOr 1VYUA 1BYMA 2KY9A 2JS2A 3I55T 4FW2A 4GBQA 4LD6A 1NEBA 2GCXA 4HA8A 1GFCA 1Z9ZA 1Q86U 3MJXA 4EMKA 5I11A 3F70A 1X27A 1WHHA 1I4K1 3ASKA 2BIVA 1VQ9T 3A98A 4DBHA 2KK4A 1WPYA 4J30A 1KC8C 3G6ET 1CKAA 3PE0A 5CAIA 1YJ9A 3MPUB 1W4SA 5GAMh 1VQLA 4AG2C 2L3SA 2MAMA 1UJYA 4QVZA 5LJ3d 5GAN3 4F7UB 3MEVA 2FZGB 5IAYA 1K9AA 3QG1A 4B6MA 5GANh 1RAHB 4PJMA 1NG2A 4FQAA 2G6FX 4F7UF 1D1BA 2X3WD 4M77C 2ZPIB 3CQTA 4KGVB 4LN2A 2JS0A 4J9HA 1BIBA 1JO8A 2XMFA 2AKLA 5CQYA 3E19A 3MP8A 3KBGA 1MGQA 1HK9A 3SWNB 5GAOm 3OW2A 3GNGA 1M2VB 2LT4A 1N9RA 4C8QG 4M75A 2ATCB 4ELZC 2CKKA 4A4FA 1WQWA 2HNIA 4MZPA 2QDYB 3CC4A 3RR6A 1YITA 1NPPA 3G1JA 1NM7A 4RMOA 3OMGA 4M78A 4ZGDB 1Q7YC 2KYBA 2LJ0A 2L8DA 2O2OA 1QKXA 3GF5A 3CC2A 1UHFA 1TH7A 3THKA 2LCLA 1YJWA 5CKHA 4OMPA 4FU6A 1YJ9Q 1SF9A 4XTZA 5I21A 3OSSC 4BDYA 4P5NA 2DNUA 2K3AA 1QVFP 2BZXA 2NYSA 9ATCB 3I56A 1G3WA 3CCMT 2QTXA 3G4ST 1ZX6A 4C0FA 3AT1B 1OEBA 3G71T 3CCRA 3CBMA 2DYBA 1RL2A 1JU5C 3MEAA 2ENMA 3QPHA 3VPJA 3EH1A 4F14A 3OS5A 2YRDA 3REAB 2KRSA 2CSQA 1BCMA 2VUBA 4FYYB 2O9VA 1K73C 1Q81C 5FRMA 2M0OA 3GBQA 4D6WA 1GXIE 4RUGA 1TU0B 4LUDA 5GJWB 4LXCA 2GTOA 4J9DA 5KYUB 1S72A 5CKEA 3CC2Q 3A2YA 3OBWA 3RMQA 1B3QA 3KW0A 3VRZA 2COYA 3OYYA 1FWZA 2PU9B 1WHMA 1WXUA 2K7AA 1LNXA 2L5QA 4FCYA 2EWNA 2GNCA 3V7CA 4M77E 4ZN1A 2Y4YA 2XD0A 5HKCA 2RHUA 1V1CA 4XAXB 4RCBA 3M4YA 1PKSA 1SSFA 3I5SA 1IGUA 4PNOA 4ELYC 3EG1A 2XG8D 3ULRB 3S0QA 1NJIR 2C0IA 2IOBA 2KT1A 3NGPA 2W0ZA 2A28A
chains in the Genus database with same CATH topology
1QKWA 2DL8A 1TUCA 2K2MA 1T0HA 3M0SA 1M8MA 3U23A 1AZGB 4M4ZA 1TG0A 2MIOA 4JXBA 2LJ3A 1LCKA 4LE9A 1ZUUA 1YNZA 1MV0B 2J6KA 1WLPB 1UE9A 4JPBW 2RQWA 1WFWA 1SHGA 4EQ8A 2EYWA 2DL3A 2OI3A 3JV3A 4J9EA 2EYYA 1I1JA 1UFFA 2F2VA 1Y57A 4LJ1A 4F17A 1OPLA 1WA7A 2CH4A 2K79A 5FW9A 4JJCA 1NYFA 3M1UA 1UDLA 2EBPA 1QWFA 4EQAA 2IO7A 4LUEA 2K6DA 3M0TA 2J6OA 3VS2A 1T3SA 1T0JA 2LZ6B 1AWWA 3H0FA 1SRLA 4GLMA 3PBIA 3UA7A 1PHTA 3RNJA 3VS1A 1KFZA 2KT8A 4HCKA 3M0UA 3QWXX 5EC7A 2HDAA 1OPKA 2KXCA 1KSWA 4JJDA 2KEAA 1M27C 1N5ZA 1TUDA 2XIVA 2D8HA 3IQLA 2A08A 4FGEA 4J9IA 3ZL7C 2JW4A 1Z9QA 4HVVA 1RLPC 1AOJA 4RTUA 2EYXA 2ROLA 3VPIA 4AFSC 2CDTA 5FWCA 2CREA 2L2PA 2ESWA 3KFVA 4JZ4A 4AFQC 2L3PA 1WXBA 4RTXA 1PWTA 1MUZA 1ZLMA 5IHNA 3VS4A 3R6NA 1PRLC 1UG1A 3UA6A 3QWYA 2GTJA 2CSIA 2RMOA 2DVJA 1MV3A 2KROA 3EHRA 1YP5A 1UTIA 1GCPA 1QWEA 1RUWA 1PNJA 2FRWA 1VYVA 2M0YA 2OJ2A 1U06A 2FPDA 2EKHA 2BZ8A 3UF4A 2OAWA 1AEYA 2RQUA 3I9QA 4CC4B 1UUEA 2RQTA 2LCSA 3NMZC 1X2KA 5IXBA 4J9GA 3EGUA 1A0NB 2F2XA 1GBQA 1WXTA 3M0PA 4FDYA 2EYZA 2JM9A 2L0AA 3H41A 5GJVB 3TVTA 2JMAA 2DL7A 2AZSA 2GGRA 2AK5A 3TSWA 1QCFA 4JJBA 2JMCA 2FEIA 2YT6A 1GCQA 2IOAA 1NEGA 2D0NA 1W6XA 4EIKA 1H8KA 2FG0A 1K0SA 1JXOA 3H0IA 4HXJA 1ZUKA 2KRMA 3TSZA 2F2WA 1WIEA 1I0CA 1PKTA 3SHWA 5IXFA 4KRTA 2IO9A 1E6HA 4D8DA 4J9FA 2FO0A 2LMJA 1K76A 2KR3A 1W70A 2DA9A 2EGAA 3VS5A 4J9CA 1ABQA 2H8HA 3PVLA 2JXBA 3I35A 1YCSB 4RTTA 3NHNA 1X2QA 2BZYA 4HZBA 1OOTA 2LQNA 4HZ9A 2LRJA 1ZBJA 2DJQA 2VOBA 4CSHA 2YUPA 4RTWA 2O9SA 2J7IA 4QT7A 1U5SA 2O88A 3GT2A 2DBMA 4J9BA 4RTZA 3NE0A 3C0CA 2PNIA 1S1NA 5FWBA 5HCKA 1U3OA 1CKBA 1AWXA 5ECAA 2CH4W 3O98A 2LQWA 2EGEA 2YUOA 2KBTA 1GCQC 1ZSGA 1X6BA 4K11A 1K4US 2KRNA 1NYGA 1KJWA 3SEMA 2CUDA 1GRIA 2ROTA 1M30A 2K9GA 4AG1C 1X69A 1GFDA 1XOVA 2IIMA 3VRYA 1I07A 3A30A 1CSKA 1UGVA 1OV3A 2PZ1A 1YWPA 4Q4TA 3I86A 1H92A 4D8KA 2DL5A 4FGDA 2KNBB 4Y92A 3UATA 3VS3A 1UHCA 2YSQA 4F0WA 1PRMC 1M3AA 3EG3A 4AFUC 2DRKA 2B86A 1BU1A 1AVZC 2LJ1A 1AZEA 4HPEA 2KXDA 4IIOA 1ARKA 4ESRA 2LNHB 4OMOA 2VVKA 2FPEA 4ZNXA 2EPDA 2HCKA 1K1ZA 1ABOA 2FPFA 3LH5A 1WI7A 2J06A 2GQIA 2JT4A 1VYUA 1NLOC 2JS2A 4GBQA 1NEBA 2RQVA 2LX7A 2JTEA 1GFCA 1Z9ZA 4R0KA 2K3BA 2RF0A 2L3QA 1RLQC 5I11A 2VPSA 1X27A 2SEMA 2X3XD 4RTVA 1AWJA 1W1FA 2BTTA 2MCNA 5I22A 3A98A 2VWFA 2ABLA 1FYNA 4DEYA 1CKAA 3PE0A 1J3TA 2DRMA 3RBBB 1WYXA 2JM8A 1B07A 2A37A 2EGCA 2HBWA 4AG2C 2L3SA 2RNAA 1UJYA 3REBB 1JQQA 3PVQA 2KGTA 1T3LA 2DILA 1K9AA 1RI9A 1G2BA 4IIMA 2C0OA 2VKNA 2QDLA 4Q4GX 3H0HA 1NLPC 1AWOA 1NG2A 4FQAA 2IF6A 2P4RA 2G6FX 3M0QA 4DEXA 2X3WD 2FRYA 3PBCA 2I0NA 2C0TA 1HD3A 3VS7A 3CQTA 4LN2A 2JS0A 4J9HA 2RQRA 1JO8A 2XMFA 4Z8AA 2AKLA 1E7OA 1M3BA 1UJ0A 1YN8A 2KYMA 4E6RA 1SEMA 2CT3A 2M51A 4ORZA 2YDLA 3O5ZA 2DE0X 4FQBA 2GBQA 4Z89A 5IHKA 3VS6A 4FGIA 4Q4NA 2KE9A 1SRMA 2DF6A 1HSQA 1NM7A 2DL4A 1YWOA 1JEGA 1HJDA 2KYBA 2LJ0A 3EG0A 2O2OA 1QKXA 1Y0MA 2HEQA 2DX1A 1SPKA 1UHFA 3THKA 4OMMA 1UECA 2DLPA 2HSPA 4EOBA 4OMPA 4LNPA 4RTYA 3VS0A 1VA7A 2DNUA 2K3AA 2IO8A 2BZXA 2NUZA 2ED0A 3I5RA 2LP5A 2MOXA 2CT4A 1WX6A 4CC7A 5IH2A 2AKKA 1K0XA 4FSSA 4F0VA 1ZX6A 1KIKA 1BBZA 1OEBA 2DMOA 2DYBA 2D8JA 2SRCA 4A63B 1JU5C 2D1XA 1QLYA 1FMKA 4CC2A 2ENMA 4CC3A 2YUQA 3VPJA 2VPMA 2EW3A 4JZ3A 2DM1A 4F14A 4F4MA 2RN8A 3REAB 2KRSA 2CSQA 3FJ5A 4WCIA 1BK2A 1G83A 2O9VA 1VYTA 4AFZC 2J6FA 3GBQA 3A2ZA 2EVRA 2YUNA 5IHIA 4RUGA 1E6GA 4LUDA 5GJWB 3NPFA 4OMNA 2ECZA 1M3CA 3EHQA 2GTOA 1BB9A 1EFNA 4J9DA 2W10A 4F16A 1GBRA 3A2YA 4Z88A 1GL5A 2NWMA 4OLKA 1ZUYA 3EG2A 2O31A 1AD5A 2K1GA 1B3QA 2RPNA 1H3HA 3KW0A 1X43A 2AZVA 3VRZA 4OMQA 2ED1A 2A36A 4CT3A 2J05A 1WDXA 1WXUA 2K7AA 4CGKA 2CUBA 2DBKA 1SHFA 2GNCA 1SSHA 1IO6A 2EQIA 4HVUA 4X1VA 1JXMA 4OMLA 2E5KA 1V1CA 5L23A 1PKSA 4HVWA 3I5SA 3S0QA 3EG1A 1X6GA 3ULRB 3M0RA 2C0IA 2V1RA 2IOBA 2PTKA 2KT1A 2V1QA 3NGPA 2W0ZA 2A28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKW A;  2DL8 A;  1TUC A;  2K2M A;  1T0H A;  3M0S A;  1M8M A;  3U23 A;  1AZG B;  4M4Z A;  1TG0 A;  2MIO A;  4JXB A;  2LJ3 A;  1LCK A;  4LE9 A;  1ZUU A;  1YNZ A;  1MV0 B;  2J6K A;  1WLP B;  1UE9 A;  4JPB W;  2RQW A;  1WFW A;  1SHG A;  4EQ8 A;  2EYW A;  2DL3 A;  2OI3 A;  3JV3 A;  4J9E A;  2EYY A;  1I1J A;  1UFF A;  2F2V A;  1Y57 A;  4LJ1 A;  4F17 A;  1OPL A;  1WA7 A;  2CH4 A;  2K79 A;  5FW9 A;  4JJC A;  1NYF A;  3M1U A;  1UDL A;  2EBP A;  1QWF A;  4EQA A;  2IO7 A;  4LUE A;  2K6D A;  3M0T A;  2J6O A;  3VS2 A;  1T3S A;  1T0J A;  2LZ6 B;  1AWW A;  3H0F A;  1SRL A;  4GLM A;  3PBI A;  3UA7 A;  1PHT A;  3RNJ A;  3VS1 A;  1KFZ A;  2KT8 A;  4HCK A;  3M0U A;  3QWX X;  5EC7 A;  2HDA A;  1OPK A;  2KXC A;  1KSW A;  4JJD A;  2KEA A;  1M27 C;  1N5Z A;  1TUD A;  2XIV A;  2D8H A;  3IQL A;  2A08 A;  4FGE A;  4J9I A;  3ZL7 C;  2JW4 A;  1Z9Q A;  4HVV A;  1RLP C;  1AOJ A;  4RTU A;  2EYX A;  2ROL A;  3VPI A;  4AFS C;  2CDT A;  5FWC A;  2CRE A;  2L2P A;  2ESW A;  3KFV A;  4JZ4 A;  4AFQ C;  2L3P A;  1WXB A;  4RTX A;  1PWT A;  1MUZ A;  1ZLM A;  5IHN A;  3VS4 A;  3R6N A;  1PRL C;  1UG1 A;  3UA6 A;  3QWY A;  2GTJ A;  2CSI A;  2RMO A;  2DVJ A;  1MV3 A;  2KRO A;  3EHR A;  1YP5 A;  1UTI A;  1GCP A;  1QWE A;  1RUW A;  1PNJ A;  2FRW A;  1VYV A;  2M0Y A;  2OJ2 A;  1U06 A;  2FPD A;  2EKH A;  2BZ8 A;  3UF4 A;  2OAW A;  1AEY A;  2RQU A;  3I9Q A;  4CC4 B;  1UUE A;  2RQT A;  2LCS A;  3NMZ C;  1X2K A;  5IXB A;  4J9G A;  3EGU A;  1A0N B;  2F2X A;  1GBQ A;  1WXT A;  3M0P A;  4FDY A;  2EYZ A;  2JM9 A;  2L0A A;  3H41 A;  5GJV B;  3TVT A;  2JMA A;  2DL7 A;  2AZS A;  2GGR A;  2AK5 A;  3TSW A;  1QCF A;  4JJB A;  2JMC A;  2FEI A;  2YT6 A;  1GCQ A;  2IOA A;  1NEG A;  2D0N A;  1W6X A;  4EIK A;  1H8K A;  2FG0 A;  1K0S A;  1JXO A;  3H0I A;  4HXJ A;  1ZUK A;  2KRM A;  3TSZ A;  2F2W A;  1WIE A;  1I0C A;  1PKT A;  3SHW A;  5IXF A;  4KRT A;  2IO9 A;  1E6H A;  4D8D A;  4J9F A;  2FO0 A;  2LMJ A;  1K76 A;  2KR3 A;  1W70 A;  2DA9 A;  2EGA A;  3VS5 A;  4J9C A;  1ABQ A;  2H8H A;  3PVL A;  2JXB A;  3I35 A;  1YCS B;  4RTT A;  3NHN A;  1X2Q A;  2BZY A;  4HZB A;  1OOT A;  2LQN A;  4HZ9 A;  2LRJ A;  1ZBJ A;  2DJQ A;  2VOB A;  4CSH A;  2YUP A;  4RTW A;  2O9S A;  2J7I A;  4QT7 A;  1U5S A;  2O88 A;  3GT2 A;  2DBM A;  4J9B A;  4RTZ A;  3NE0 A;  3C0C A;  2PNI A;  1S1N A;  5FWB A;  5HCK A;  1U3O A;  1CKB A;  1AWX A;  5ECA A;  2CH4 W;  3O98 A;  2LQW A;  2EGE A;  2YUO A;  2KBT A;  1GCQ C;  1ZSG A;  1X6B A;  4K11 A;  1K4U S;  2KRN A;  1NYG A;  1KJW A;  3SEM A;  2CUD A;  1GRI A;  2ROT A;  1M30 A;  2K9G A;  4AG1 C;  1X69 A;  1GFD A;  1XOV A;  2IIM A;  3VRY A;  1I07 A;  3A30 A;  1CSK A;  1UGV A;  1OV3 A;  2PZ1 A;  1YWP A;  4Q4T A;  3I86 A;  1H92 A;  4D8K A;  2DL5 A;  4FGD A;  2KNB B;  4Y92 A;  3UAT A;  3VS3 A;  1UHC A;  2YSQ A;  4F0W A;  1PRM C;  1M3A A;  3EG3 A;  4AFU C;  2DRK A;  2B86 A;  1BU1 A;  1AVZ C;  2LJ1 A;  1AZE A;  4HPE A;  2KXD A;  4IIO A;  1ARK A;  4ESR A;  2LNH B;  4OMO A;  2VVK A;  2FPE A;  4ZNX A;  2EPD A;  2HCK A;  1K1Z A;  1ABO A;  2FPF A;  3LH5 A;  1WI7 A;  2J06 A;  2GQI A;  2JT4 A;  1VYU A;  1NLO C;  2JS2 A;  4GBQ A;  1NEB A;  2RQV A;  2LX7 A;  2JTE A;  1GFC A;  1Z9Z A;  4R0K A;  2K3B A;  2RF0 A;  2L3Q A;  1RLQ C;  5I11 A;  2VPS A;  1X27 A;  2SEM A;  2X3X D;  4RTV A;  1AWJ A;  1W1F A;  2BTT A;  2MCN A;  5I22 A;  3A98 A;  2VWF A;  2ABL A;  1FYN A;  4DEY A;  1CKA A;  3PE0 A;  1J3T A;  2DRM A;  3RBB B;  1WYX A;  2JM8 A;  1B07 A;  2A37 A;  2EGC A;  2HBW A;  4AG2 C;  2L3S A;  2RNA A;  1UJY A;  3REB B;  1JQQ A;  3PVQ A;  2KGT A;  1T3L A;  2DIL A;  1K9A A;  1RI9 A;  1G2B A;  4IIM A;  2C0O A;  2VKN A;  2QDL A;  4Q4G X;  3H0H A;  1NLP C;  1AWO A;  1NG2 A;  4FQA A;  2IF6 A;  2P4R A;  2G6F X;  3M0Q A;  4DEX A;  2X3W D;  2FRY A;  3PBC A;  2I0N A;  2C0T A;  1HD3 A;  3VS7 A;  3CQT A;  4LN2 A;  2JS0 A;  4J9H A;  2RQR A;  1JO8 A;  2XMF A;  4Z8A A;  2AKL A;  1E7O A;  1M3B A;  1UJ0 A;  1YN8 A;  2KYM A;  4E6R A;  1SEM A;  2CT3 A;  2M51 A;  4ORZ A;  2YDL A;  3O5Z A;  2DE0 X;  4FQB A;  2GBQ A;  4Z89 A;  5IHK A;  3VS6 A;  4FGI A;  4Q4N A;  2KE9 A;  1SRM A;  2DF6 A;  1HSQ A;  1NM7 A;  2DL4 A;  1YWO A;  1JEG A;  1HJD A;  2KYB A;  2LJ0 A;  3EG0 A;  2O2O A;  1QKX A;  1Y0M A;  2HEQ A;  2DX1 A;  1SPK A;  1UHF A;  3THK A;  4OMM A;  1UEC A;  2DLP A;  2HSP A;  4EOB A;  4OMP A;  4LNP A;  4RTY A;  3VS0 A;  1VA7 A;  2DNU A;  2K3A A;  2IO8 A;  2BZX A;  2NUZ A;  2ED0 A;  3I5R A;  2LP5 A;  2MOX A;  2CT4 A;  1WX6 A;  4CC7 A;  5IH2 A;  2AKK A;  1K0X A;  4FSS A;  4F0V A;  1ZX6 A;  1KIK A;  1BBZ A;  1OEB A;  2DMO A;  2DYB A;  2D8J A;  2SRC A;  4A63 B;  1JU5 C;  2D1X A;  1QLY A;  1FMK A;  4CC2 A;  2ENM A;  4CC3 A;  2YUQ A;  3VPJ A;  2VPM A;  2EW3 A;  4JZ3 A;  2DM1 A;  4F14 A;  4F4M A;  2RN8 A;  3REA B;  2KRS A;  2CSQ A;  3FJ5 A;  4WCI A;  1BK2 A;  1G83 A;  2O9V A;  1VYT A;  4AFZ C;  2J6F A;  3GBQ A;  3A2Z A;  2EVR A;  2YUN A;  5IHI A;  4RUG A;  1E6G A;  4LUD A;  5GJW B;  3NPF A;  4OMN A;  2ECZ A;  1M3C A;  3EHQ A;  2GTO A;  1BB9 A;  1EFN A;  4J9D A;  2W10 A;  4F16 A;  1GBR A;  3A2Y A;  4Z88 A;  1GL5 A;  2NWM A;  4OLK A;  1ZUY A;  3EG2 A;  2O31 A;  1AD5 A;  2K1G A;  1B3Q A;  2RPN A;  1H3H A;  3KW0 A;  1X43 A;  2AZV A;  3VRZ A;  4OMQ A;  2ED1 A;  2A36 A;  4CT3 A;  2J05 A;  1WDX A;  1WXU A;  2K7A A;  4CGK A;  2CUB A;  2DBK A;  1SHF A;  2GNC A;  1SSH A;  1IO6 A;  2EQI A;  4HVU A;  4X1V A;  1JXM A;  4OML A;  2E5K A;  1V1C A;  5L23 A;  1PKS A;  4HVW A;  3I5S A;  3S0Q A;  3EG1 A;  1X6G A;  3ULR B;  3M0R A;  2C0I A;  2V1R A;  2IOB A;  2PTK A;  2KT1 A;  2V1Q A;  3NGP A;  2W0Z A;  2A28 A; 
#chains in the Genus database with same CATH topology
 2DL8 A;  4M77 G;  2K2M A;  3VYG A;  3M0S A;  4N4I A;  2RJF A;  4ZGE B;  3U23 A;  4M4Z A;  4JXB A;  3HHT B;  2X4X A;  5KYX B;  1G3Y A;  3OW2 S;  3GOX A;  4JPB W;  4DBQ A;  4WTO B;  1VOM A;  5D6X A;  3RKY A;  4EQ8 A;  4J9E A;  2YWW A;  1S72 Q;  2LT1 A;  5KYW A;  4C0G A;  3KXT A;  3SDZ A;  3OW2 P;  1WA7 A;  1NYF A;  3M1U A;  4MMK A;  5FU7 C;  5GAM f;  4RG8 A;  4DOW A;  2K6D A;  1C1A A;  4FYW B;  4E7I A;  3L2W A;  1MMG A;  4LDV A;  1T3S A;  5LJ3 f;  1AWW A;  1SRL A;  2E6Z A;  5AT1 B;  1KC8 U;  1KQ1 A;  1PHT A;  5CCA A;  3C12 A;  4NL2 A;  5FU6 B;  1VQL T;  3CCJ Q;  2EYQ A;  2QEX Q;  4XTU A;  2E4H A;  1N5Z A;  4FM4 B;  3V8K A;  2E1H A;  4OB1 B;  4C92 D;  4PKC C;  4JRP A;  1M2V A;  4C92 B;  4AFS C;  2VC8 A;  2CDT A;  3PMI A;  1YJN A;  1WXB A;  3OBY A;  4C92 F;  1B34 A;  4RTX A;  4HCZ A;  3CCL T;  1PWT A;  3JCM J;  1G5V A;  3CCS Q;  4E7S A;  3X24 B;  1VQN A;  2ZPG B;  1VQP Q;  1IHW A;  2HMA A;  3CC4 T;  2FZK B;  3EHR A;  5A0G A;  1YIT T;  1YP5 A;  1UTI A;  4XU3 A;  1QWE A;  1G8X A;  3M57 A;  3PGG A;  3A8M B;  1Q7Y U;  2K5F A;  3UF4 A;  3S3O A;  2OAW A;  2HZY A;  4KT0 E;  1MMN A;  1YJW T;  1F1B B;  2DXC A;  1UUE A;  1BKB A;  2P84 A;  2QTV A;  1OUL A;  4II1 A;  2CZ6 B;  3CC7 T;  3OS1 A;  4M7D D;  3VKI A;  2VGN A;  1WXT A;  4M7D B;  2JM9 A;  3TVT A;  1YHQ Q;  1ZA2 B;  3I56 T;  1TTH B;  2DVE A;  1BI2 A;  1RAC B;  4IUV A;  3HSB A;  4M7D F;  2JMC A;  2V8I A;  1OU8 A;  2IOA A;  3LWH A;  1H8K A;  3CCR T;  5KH6 A;  4XU1 A;  4NOY A;  4EMG A;  1TUG B;  4QVD A;  1I0C A;  2ZCF B;  1WZO A;  3C4S A;  1YJN Q;  5IXF A;  4PJO E;  1IRX A;  3JCM e;  1Y96 A;  1IZ6 A;  2DA9 A;  2EGA A;  1Q81 U;  3LLR A;  2H8H A;  1RAI B;  2VXE A;  1PSE A;  4N0A A;  2LQN A;  2LRJ A;  4B9X A;  1N6A A;  4PJO G;  3VUZ A;  4CSH A;  4QT7 A;  2O88 A;  3GIB A;  5FLX E;  3CXC A;  4RTZ A;  2KQW A;  5D6Y A;  5CVI A;  1S1N A;  5FWB A;  1CKB A;  2EFI A;  4C5H A;  4CRI A;  2RHX A;  2DXB A;  1VQ9 A;  4A4E A;  4KUL A;  3HRT A;  1JJ2 S;  4K11 A;  2HQX A;  1K4U S;  3E9G A;  3G6E A;  3SEM A;  2DD4 A;  4AG1 C;  4EMK B;  1D1C A;  2QXF A;  1XOV A;  3VRY A;  4HKE A;  1LOJ A;  3G7Z A;  1G3S A;  2KDS A;  1UEB A;  1IRE B;  4MDW A;  2A0F B;  1OV3 A;  4ANJ A;  1JJ2 P;  1UGP B;  3JSC A;  4NS5 A;  3CCV Q;  1AT1 B;  1OX9 A;  4FGD A;  3M53 A;  2JUF A;  1R0B G;  5GMK j;  4BE2 A;  2QAS A;  1I81 A;  3CCE A;  2K5I A;  2DRK A;  2B86 A;  2RH2 A;  3OMC A;  1QCO A;  2QGF B;  4N4G A;  3X28 B;  4C0D B;  5L8R E;  2JN0 A;  4KGX B;  2KXD A;  5KYY B;  4IIO A;  2X51 A;  1M9S A;  3QSU A;  3I55 Q;  2LNH B;  4OMO A;  5D6W A;  3OS2 A;  2GQI A;  2JT4 A;  2MMP A;  1VQ9 Q;  3OB9 A;  4JLI A;  2DPP B;  2JTE A;  2XDP A;  3EGD A;  5KE2 A;  5CIU A;  3G6E Q;  3RKX A;  2L3Q A;  3OYL A;  4M78 B;  2SEM A;  1KHC A;  2X3X D;  1N8R R;  3L2Q A;  2MCN A;  2AIR B;  2PUO B;  2VWF A;  4RG2 A;  2LCC A;  1WJR A;  5GAO l;  1FYN A;  4QQ6 A;  3GP8 A;  2H3J A;  4BE0 A;  2DTI A;  4PJO A;  3RBB B;  2RI3 A;  3WVD B;  2A37 A;  2EGC A;  4OB2 B;  5FRN A;  2DIQ A;  3EG9 B;  2RNA A;  3G71 A;  1JQQ A;  3PVQ A;  5GMK e;  1WHL A;  1T3L A;  3OQ5 A;  2DIL A;  3R6O A;  4IUP A;  2HKN A;  4PLI A;  2CP7 A;  2VKN A;  3DLL A;  1NLP C;  1YFN A;  1Y71 A;  2FRY A;  3EFO A;  4XQ3 A;  2I0N A;  2DTO A;  4GLK A;  2O01 E;  2GF7 A;  2R5A A;  4Z8A A;  1KQS A;  1M3B A;  1UJ0 A;  2CZ7 B;  1YN8 A;  1SEM A;  4BUG A;  1X01 A;  1VQN T;  2XDD A;  4ORZ A;  2YDL A;  4M7A C;  2QG9 B;  4OP0 A;  4FQB A;  2OTL A;  3M4G A;  3HP9 A;  3VS6 A;  2HD0 A;  1HYO A;  2YHT A;  1SRM A;  1JEG A;  4QW2 A;  4M7D A;  1SPK A;  2DLP A;  3DB4 A;  4N4H A;  4CI0 C;  4J8O A;  4LNP A;  3CXC P;  3M58 A;  1OYX A;  3CCM Q;  3CCU A;  3G4S Q;  4RTY A;  3OYJ A;  3VS0 A;  1VA7 A;  4L5G A;  5LJ5 j;  2ZAE A;  2BUD A;  2CYZ B;  2VYT A;  2IO8 A;  4XU0 A;  2K5L A;  3G71 Q;  2LP5 A;  2MOX A;  2ZPF B;  2FHD A;  3FJP A;  1K0X A;  1ZSZ A;  1K9M R;  3EH2 A;  1EX4 A;  4BDZ A;  1VIE A;  1W2B S;  1SG5 A;  1QVP A;  1NJI C;  1RAB B;  2LTO A;  3J7A F;  4A63 B;  3HPW A;  1FMK A;  4BE1 A;  2QQA A;  1M4Z A;  1XTD A;  2HBP A;  2EW3 A;  5CR2 A;  1WGS A;  2RN8 A;  1VQ6 T;  1VYT A;  1W2B P;  1IGQ A;  4ZGJ B;  5LJ3 g;  1OX8 A;  4YTL A;  2J6F A;  4PL6 A;  1VQ8 A;  3QJ6 A;  4JJN K;  3NPF A;  4OMN A;  2ECZ A;  3EHQ A;  2M02 A;  1V76 A;  2PVD B;  3BFM A;  1D0Y A;  2YRV A;  1GBR A;  2CP5 A;  3T9N A;  3OSV A;  5KYW B;  3ZFJ A;  3EG2 A;  2RA2 A;  2RPN A;  2JNG A;  1IHV A;  5LJ5 e;  2HKQ B;  4OMQ A;  2ED1 A;  2A36 A;  1LJO A;  1WDX A;  2QYZ A;  2CUB A;  1SHF A;  3RER A;  1SSH A;  3QJY A;  1IO6 A;  1H3Z A;  4X1V A;  5LJ3 h;  5J3B A;  2PVO B;  3SWN C;  2CP0 A;  4IKF A;  2KI7 A;  2QA4 T;  4C8Q E;  2V1R A;  4FL6 A;  5M9O A;  2V1Q A;  2XKO C;  4DBR A;  1T0H A;  5KYY A;  3QXE B;  2LQK A;  3CCE T;  2MIO A;  1KQS S;  3CCL A;  1LCK A;  1YNZ A;  1WJQ A;  5GAN d;  4OF1 A;  1EZZ B;  5CO7 A;  3QKJ A;  5A0D A;  4PFO A;  1PSF A;  2M9U A;  1WQ7 A;  2EYW A;  2OI3 A;  1B34 B;  2MF2 A;  2XID A;  3A8L B;  5GMK m;  3RES A;  4LJ1 A;  1KQS P;  4F17 A;  2K79 A;  2FB7 A;  4JJC A;  5FW9 A;  3A8H B;  1I5O B;  4M77 D;  2YLB A;  3EBQ A;  3CC7 A;  4LUE A;  2D6F A;  4M77 B;  5DY9 A;  1KK7 A;  1VQL Q;  3EG9 A;  2V8K A;  3CPW S;  4BI4 A;  3VYH B;  2ZPB B;  3H0F A;  4M77 F;  4OGE A;  4ZTF A;  2QQS A;  4IUQ A;  4KH0 B;  2XU8 A;  2FL7 A;  2DD5 A;  3X26 B;  5EC7 A;  2HDA A;  1OPK A;  2P0Q A;  4E7J A;  2KEA A;  1NE8 A;  2JVV A;  2EQU A;  3CEY A;  3PIO A;  2V8J A;  1TUD A;  4KUI A;  1YI2 A;  2XIV A;  2D8H A;  2A08 A;  4X9C A;  5GAN 7;  4R55 A;  2NUP B;  4IUR A;  4EDU A;  2IG0 A;  2DO3 A;  1AOJ A;  3CCL Q;  3QUI A;  3HRS A;  2XHC A;  3SB2 A;  2MI6 A;  2L2P A;  3CC4 Q;  1M8V A;  1R77 A;  1YIT Q;  3BE3 A;  1Y96 B;  3VS4 A;  4E7K A;  3Q1J A;  2OTL T;  2KRO A;  3MP1 A;  2HSE B;  1YJW Q;  1IXD A;  3OYB A;  2RM4 A;  2RHI A;  2M0Y A;  3CC7 Q;  1U06 A;  2FPD A;  2WP7 A;  1AEY A;  3CCQ T;  4BY6 B;  4LDX A;  3JCM d;  5GAM j;  3I9Q A;  1M5Q 1;  3QII A;  2LX9 A;  4RCC A;  3I56 Q;  4C8Q A;  2LCS A;  3CCU T;  1Q82 R;  4J9G A;  3EGU A;  1VQ7 T;  1B7T A;  3CCR Q;  5GAN j;  3PNW C;  3TSW A;  2R58 A;  4LD9 K;  3H6Z A;  4JJB A;  2OX7 A;  1VQK A;  1NJI U;  1JXO A;  3PT9 A;  2KAF A;  4Y28 E;  3TQ7 P;  1BCO A;  1ZUK A;  3TSZ A;  3JB9 J;  3SHW A;  4XK8 E;  2DTH A;  4KRT A;  4D8D A;  3FDR A;  4R56 A;  3V8J A;  3VS5 A;  4J9C A;  1ABQ A;  1M90 R;  1I5L A;  2Z0W A;  3RKW A;  1VQ8 T;  2RHY A;  5FRO A;  5C6S A;  3FEO A;  5CKB A;  3M54 A;  2VOB A;  1JBM A;  3MHX A;  1V29 B;  5FU6 C;  3TEE A;  4B9W A;  3OYH A;  1U5S A;  5GAM e;  3GT2 A;  2DBM A;  2P0K A;  3C0C A;  2QQR A;  3WXM B;  4E7L A;  3MCA B;  1O75 A;  1DJ7 B;  4KH1 B;  3VUB A;  1R0C B;  2CH4 W;  3P8H A;  2LQW A;  1RAD B;  2E3I A;  2F5T X;  1JJ2 A;  3DB3 A;  1GCQ C;  5HK3 A;  1ZSG A;  5GAN e;  3GNF B;  3V8L A;  1N8R C;  1KJW A;  2OAU A;  4C92 C;  3EGD B;  1GRI A;  4HT9 A;  1M30 A;  2EJ9 A;  4MZT A;  3JCM b;  3A1P A;  2IIM A;  1VIF A;  5GMK i;  4PJO D;  1ZHI A;  2PZ1 A;  3JB9 I;  1YWP A;  3HTR A;  4PJO B;  4Q4T A;  3KUF A;  3I86 A;  1D0Z A;  4EMH A;  4PJN A;  1H92 A;  4D8K A;  2VXF A;  4Y92 A;  1QP3 A;  4O5V A;  3UAT A;  4PJO F;  1VQ4 A;  1WJS A;  1PRM C;  2P4T A;  2MWP A;  4A4G A;  4J7F A;  2LQ8 A;  1BU1 A;  3EFO B;  2LJ1 A;  3OS0 A;  1QCN A;  2EPD A;  2VGM A;  1ABO A;  4M77 A;  2FPF A;  1BI0 A;  2F69 A;  1WI7 A;  3LH5 A;  2JTF A;  2RHZ A;  3WVE B;  1M1K R;  2KVQ G;  2A7Y A;  1ZQ1 A;  2COW A;  2RQV A;  3RMS A;  2DZC A;  4BI3 A;  4LDU A;  4R0K A;  1RLQ C;  2VPS A;  4J83 A;  2BTT A;  4MML A;  4DEY A;  2NUP A;  1J3T A;  4LDY A;  3L2Z A;  2JM8 A;  2LDM A;  2F5K A;  2HBW A;  2F1L A;  1PD1 A;  1YI2 T;  3M9Q A;  1K9M C;  2KGT A;  1UGQ B;  1OU9 A;  1G2B A;  3OA6 A;  1VQO A;  1ZSZ B;  2QDL A;  3DLM A;  3RDV A;  4Q4G X;  1AWO A;  3O8V A;  2IF6 A;  1K73 U;  1D09 B;  5DLQ E;  1VQ6 A;  3MKD A;  1VQN Q;  3PBC A;  2PVG B;  3H9N A;  3VS7 A;  2LC4 A;  4IUU A;  2KYM A;  2DEQ A;  2EIF A;  2AHJ B;  2K4Y A;  2OTJ A;  3O5Z A;  3OYF A;  2DXU A;  2DE0 X;  4EMK C;  2GBQ A;  3CBO A;  5IHK A;  4FGI A;  1AHJ B;  2RI5 A;  2KE9 A;  1QP2 A;  2DF6 A;  2DKG A;  5LJ5 g;  2DL4 A;  1YWO A;  1HJD A;  3JRZ A;  3EG0 A;  1Y0M A;  3MO8 A;  3EFS A;  2E65 A;  4OMM A;  3MEU A;  3EAE A;  4EOB A;  7AT1 B;  2RJD A;  1TOV A;  4A4H A;  2GFU A;  5I2S A;  5KCO A;  2NUZ A;  2ED0 A;  1WX6 A;  3JCM W;  4OB0 B;  5IH2 A;  2QA4 A;  4FSS A;  1KG1 A;  1W2B A;  1VQK T;  1BBZ A;  3DKM A;  1LVK A;  2DMO A;  3EFR A;  2D8J A;  1VQ6 Q;  3A8G B;  4M75 C;  2M16 A;  1QLY A;  1FX7 A;  4CC2 A;  5LJ5 d;  2YUQ A;  2VPM A;  4MDX A;  4JZ3 A;  2DM1 A;  4WCI A;  1BK2 A;  3CME A;  3M56 A;  4M78 C;  3H8Z A;  2EVR A;  4QQG A;  5AYF A;  1E6G A;  1BIA A;  1U8R A;  2QK0 A;  2LVM A;  1EFN A;  1PM3 A;  2W10 A;  3FRN A;  4F16 A;  4Z88 A;  4F04 B;  3OYI A;  1GL5 A;  2NWM A;  4OLK A;  2DYI A;  2D9T A;  3M5A A;  1AD5 A;  2K1G A;  3TU4 K;  1X43 A;  4JRQ A;  1N8R U;  4CT3 A;  4FIB A;  2DXT A;  4CGK A;  4JUV A;  1WHG A;  2JOY A;  3HFO A;  2DBK A;  2E41 A;  5LL6 S;  1D3B A;  4J5Y A;  3S6W A;  4PJL A;  2QA4 Q;  1FMV A;  3S3N A;  4HVU A;  4OML A;  1G3T A;  4HCB A;  1YIJ T;  5GAN 4;  2E5K A;  3OYD A;  3E2U A;  4HVW A;  5GAO p;  2YXY A;  3BY7 A;  3CCE Q;  3NTK A;  1VQ4 T;  1QKW A;  3LWI A;  3RIR A;  3L1A A;  2CZ0 B;  3QHS A;  1AZG B;  2HL5 C;  4IUT A;  2DIG A;  1ACM B;  2IVW A;  1ZUU A;  1MV0 B;  2J6K A;  3JB9 G;  4XU2 A;  3UDC A;  2EQM A;  3LGF A;  1VQ5 T;  2DET A;  2DL3 A;  2DJZ A;  2ZGW A;  2F2V A;  2QGG A;  2E10 A;  3CCQ A;  2CH4 A;  4E7H A;  1UDL A;  2EBP A;  1QVG A;  1U1S A;  1Y07 A;  2IO7 A;  1O9S A;  3CPW A;  4A53 A;  2MPX C;  1Q82 C;  3M0T A;  1VQ7 A;  3MEW A;  2LZ6 B;  4C8Q D;  3MET A;  4M75 E;  4XTX A;  1TS9 A;  4C8Q B;  3VS1 A;  1KFZ A;  3JB9 H;  3CMA T;  2WSC E;  1KSW A;  1KD1 R;  1VUB A;  4C8Q F;  1K9M U;  5GAN 5;  1TWB A;  4M78 E;  1XQH A;  1VQO T;  4M75 G;  4J9I A;  1PD0 A;  3HRU A;  3RUX A;  2JW4 A;  2DEU A;  1Z9Q A;  3S3M A;  2IPO B;  4RTU A;  2EYX A;  1OZ2 A;  3VPI A;  1X75 C;  2JZ2 A;  5FWC A;  2OTL Q;  2CRE A;  4M78 G;  2ESW A;  3KFV A;  4JZ4 A;  3GLX A;  4JDS A;  1M1G A;  1M90 C;  2VB6 A;  1JB0 E;  1MUZ A;  5IHN A;  2OTJ T;  1PRL C;  1TSF A;  1UG1 A;  3UA6 A;  2CSI A;  1MV3 A;  3CCQ Q;  1GCP A;  1K8A R;  1RUW A;  3LX7 A;  2VV5 A;  1Q95 G;  3CCU Q;  1VYV A;  2BZ8 A;  2EKH A;  5GAN g;  2CP2 A;  1I8F A;  4NL3 A;  1VQ7 Q;  4JUR A;  1RI0 A;  4VUB A;  1Q86 R;  4CC4 B;  1PC0 A;  2RQT A;  4Y91 A;  4EPC A;  1OQK A;  2X4J A;  2E70 A;  5IXB A;  2HQE A;  4PFP A;  1A0N B;  3JCM V;  3M0P A;  4FDY A;  5GAO n;  2EYZ A;  2AT1 B;  2CP3 A;  4TVR A;  2DL7 A;  2AZS A;  2GGR A;  4FT4 A;  5LJ5 f;  4M7A E;  1MHN A;  2FEI A;  5GAM d;  2ZPH B;  1NEG A;  3FLG A;  2D0N A;  1W6X A;  2X9H A;  4HCC A;  2FG0 A;  1K0S A;  3L2U A;  4FW1 A;  2KRM A;  1MMA A;  2F2W A;  3OYE A;  1RAE B;  4QVC A;  2A3L A;  1VQ8 Q;  3INZ A;  4M7A G;  4BB7 A;  3FB9 A;  4J9F A;  1TXQ A;  3CME T;  2LMJ A;  1NPR A;  3CD6 T;  2KR3 A;  1W70 A;  3PVL A;  4RTT A;  3OYK A;  1KQ2 A;  3NHN A;  4JRK A;  1IB8 A;  2EJF A;  1OOT A;  3X20 B;  1ZBJ A;  2DJQ A;  3VV0 A;  2YUP A;  2O9S A;  4WF2 A;  2J7I A;  3NE0 A;  2YRC A;  2QI2 A;  2PNI A;  4ATO A;  3NTH A;  2CZ1 B;  1QVG S;  1M1K C;  4JS5 A;  2LNV A;  2EGE A;  4L59 A;  2YUO A;  1QVF S;  2KRN A;  2FZC B;  5HK0 A;  1X69 A;  3VJP A;  1QVG P;  1I07 A;  3CPW P;  3C94 A;  1CSK A;  1UGV A;  3J81 E;  1C0M A;  2XIC A;  1NBE B;  3JCM g;  3ER0 A;  4OMF B;  3OYA A;  2DL5 A;  1U1T A;  3V7R A;  4N0A C;  3VS3 A;  1QW1 A;  1UHC A;  4OGC A;  3E9F A;  4F0W A;  2HL3 A;  1VQM T;  2RO0 A;  4J7I A;  4F7U E;  1QMC A;  3EG3 A;  4BY6 C;  3LH0 A;  1AVZ C;  1QQJ A;  2O4X B;  4J32 A;  1AZE A;  2E12 A;  4HPE A;  1ARK A;  4ESR A;  1MNE A;  4PFZ A;  1WHJ A;  2VVK A;  2L3R A;  4F7U G;  2EQK A;  1OI1 A;  1UGR B;  5HY6 A;  1YCY A;  1NLO C;  5CK9 A;  3JCM h;  4E47 A;  2LX7 A;  3MP6 A;  4M7A A;  4O6J A;  4J6X A;  2K3B A;  5LJ3 j;  2RF0 A;  2RI2 A;  5DM7 R;  3UPU A;  1Q82 U;  1D0X A;  1ZBX A;  2ZPE B;  4RTV A;  3JCM Q;  1AWJ A;  1W1F A;  5I22 A;  2BE7 D;  4OVA A;  3EGX B;  4FYV B;  2ABL A;  1YI2 Q;  1WNL A;  3QZ9 B;  4AMC A;  2DRM A;  2NUT B;  1WYX A;  1ZA1 B;  3A5Z B;  1B07 A;  4BI8 B;  5A0L A;  3REB B;  1M2O A;  1R8O B;  4L6V 5;  1RI9 A;  2WSE E;  3CCJ A;  4IIM A;  2C0O A;  2QQB A;  5IN1 A;  2EAY A;  3H0H A;  5GAN 2;  8ATC B;  2QEX A;  2B8A A;  2P4R A;  3M0Q A;  4DEX A;  1XJW B;  2K3Y A;  1MMD A;  2C0T A;  1HD3 A;  2WSF E;  3QDF A;  2EJG A;  2RQR A;  5IT9 E;  1M90 U;  1E7O A;  4E6R A;  1KHI A;  4KUD K;  3NTI A;  4XTW A;  2CT3 A;  4ME7 A;  2M51 A;  3BDL A;  1EIF A;  4XTY A;  3E1S A;  4Z89 A;  3PFS A;  4JLG A;  4Q4N A;  5LJ3 e;  5GAN 8;  3CCS A;  1HSQ A;  2FYK A;  3URG A;  1VQP A;  4A4K A;  3JCM X;  4PJO C;  2HEQ A;  2DX1 A;  1SKU B;  1UB4 A;  1UEC A;  3AHU A;  2HSP A;  2ZZD A;  4LDW A;  5I2M A;  1FXX A;  3ZEH A;  4XTV A;  3SFM A;  2YLC A;  1KC8 R;  4DQ2 A;  1VQK Q;  4DBF A;  5CKF A;  3M55 A;  1YIJ A;  2LRQ A;  3I5R A;  4F7U A;  2CT4 A;  1YJ9 T;  4CC7 A;  1D3B B;  2AKK A;  2BE9 B;  5GAN f;  5KE3 A;  4F0V A;  1KIK A;  2EQJ A;  4PLL A;  5FU7 B;  3OYC A;  3JCM P;  1YHQ A;  1Y7X A;  4X34 A;  2SRC A;  2D1X A;  5J39 A;  2Y4X A;  4CC3 A;  4F4M A;  3SWN A;  3FJ5 A;  4QKU A;  1G83 A;  2RD1 A;  1VQ5 A;  4FYX B;  4AFZ C;  4M7D C;  3VU3 C;  3A2Z A;  1P92 A;  2VAS A;  2K57 A;  5GMK h;  4ZN3 A;  2YUN A;  3QYH B;  5IHI A;  2DFU A;  3PTA A;  3TRE A;  1M3C A;  4PJJ A;  1BB9 A;  2G3R A;  4V2S A;  2RK2 A;  1Q7Y R;  1ZUY A;  5KCH A;  1M1K U;  2FVU A;  2O31 A;  2DK3 A;  4FSX A;  2DAQ A;  1H3H A;  4BD3 A;  2AZV A;  3A8O B;  2RK1 A;  2GQV A;  3CC2 T;  3FC3 A;  1ZSZ C;  2DZ9 A;  2J05 A;  4JS4 A;  1YIJ Q;  4E7Z A;  1YBY A;  3CMA A;  2EQI A;  1JXM A;  1JRI A;  4C5G A;  1VQ4 Q;  3L2V A;  1KD1 C;  2NLU A;  5L23 A;  3J80 E;  1X6G A;  3M0R A;  2PTK A;  3C95 A;  2O4X A;  4EQA A;  1TUC A;  2CGH A;  3BDU A;  1M8M A;  1VQ5 Q;  1TG0 A;  2LJ3 A;  2BKD N;  3CCV A;  4LE9 A;  3HL8 A;  1K73 R;  2K2V A;  3FIF A;  1Q81 R;  1WLP B;  1UE9 A;  2MWO A;  3JCM f;  2RQW A;  4C92 E;  2RJC A;  2QQ9 A;  5KYU A;  1WFW A;  1SHG A;  3JV3 A;  3P8D A;  2EYY A;  1I1J A;  4GY5 A;  1UFF A;  1Y57 A;  3QBY A;  3L42 A;  1OPL A;  1K8A C;  2K3X A;  1H64 1;  3EGX A;  3HFN A;  1LPL A;  4C92 G;  1S72 T;  3I55 A;  1QWF A;  2E5Q A;  2NUT A;  4KBM B;  1Q86 C;  1FMW A;  2J6O A;  3VS2 A;  3ME9 A;  3CMA Q;  1T0J A;  4GLM A;  3JB9 D;  3PBI A;  2XDB A;  3HKS A;  3UA7 A;  4C0D C;  3RNJ A;  2KT8 A;  4HCK A;  3P8B B;  1VQO Q;  3ZBD A;  3M0U A;  3NFC A;  2X4W A;  3QWX X;  2DER A;  3TCJ A;  2KXC A;  4JJD A;  2QAZ A;  4A54 A;  1M27 C;  3JB9 F;  1RAF B;  4Q5W A;  4M7D E;  3IQL A;  1PCX A;  3CCJ T;  4FGE A;  5LJ5 h;  4C5E A;  4HFK A;  3ZL7 C;  2MK5 A;  4PK4 A;  3BW1 A;  3LYI A;  2QEX T;  4HVV A;  1RLP C;  5KYX A;  2OTJ Q;  4DA4 A;  3CD6 A;  2ROL A;  2KMT A;  3D7S B;  4M7D G;  4AFQ C;  2L3P A;  3OYM A;  1XNI A;  5GAN 6;  4J6Y A;  1ZLM A;  4MZM A;  2COZ A;  3R6N A;  3QWY A;  2GTJ A;  2RMO A;  4X9D A;  2DVJ A;  2E6N A;  2CP6 A;  2I2L A;  4DOV A;  3CCS T;  1PNJ A;  2FRW A;  3SD4 A;  4M75 D;  4C5I A;  1VQP T;  6AT1 B;  2OJ2 A;  3LW5 E;  4OB3 B;  4M75 B;  2RQU A;  5C0M A;  2XK0 A;  3NMZ C;  1X2K A;  4M78 D;  4M75 F;  5GAO q;  1C6V X;  2F2X A;  1GBQ A;  2X4Y A;  3UWN A;  3QO3 A;  2L0A A;  3CPF A;  3H41 A;  5CQX A;  5GJV B;  5GMK l;  2JMA A;  3X25 B;  3JAM E;  1X6O A;  4AT1 B;  4Z02 A;  1NZ9 A;  1OZ3 A;  2AK5 A;  1QCF A;  3OY9 A;  4M78 F;  3CCM A;  3G4S A;  2YT6 A;  1GCQ A;  1HXD A;  2JTM A;  1PG5 B;  4EIK A;  1YHQ T;  2HAX A;  3QZ5 B;  4C92 A;  1RAG B;  3H0I A;  3CME Q;  4HXJ A;  4KGZ B;  3CD6 Q;  1VQM A;  2JJ9 A;  1WIE A;  1PKT A;  2C06 A;  2IO9 A;  5A2Q E;  1MND A;  1E6H A;  1N9S A;  2KSS A;  4C0Z A;  2FO0 A;  1K76 A;  4FT2 A;  1N27 A;  4HFL A;  2HQH A;  5DLO A;  3L2R A;  2JXB A;  3I35 A;  2R57 A;  1YCS B;  1YJN T;  3UT1 A;  3PMT A;  1X2Q A;  2BZY A;  4HZB A;  4HZ9 A;  2Y90 A;  4QQD A;  4J6W A;  2E64 A;  2GFA A;  5KYN A;  4C8Q C;  4RTW A;  2D0Q B;  4J9B A;  8AT1 B;  4HT8 A;  2RJE A;  2PQW A;  3CXC S;  1UGS B;  5HCK A;  1U3O A;  1AWX A;  3PIP A;  5ECA A;  3GPL A;  1QVF A;  3O98 A;  3JCM c;  4BAC A;  3OYN A;  4RKU E;  4M7A D;  2KBT A;  1WHK A;  4E2F B;  1X6B A;  3V7S A;  1NYG A;  4M7A B;  2CUD A;  2ROT A;  2M1H A;  2K9G A;  2H3E B;  1GFD A;  4M7A F;  3CBP A;  3A30 A;  4JRI A;  1KD1 U;  2P0P A;  1VQM Q;  2L89 A;  4ZTJ A;  1D1A A;  3QYG B;  2KNB B;  5J26 A;  2MYS A;  2YSQ A;  3N5B B;  2EKO A;  2CS7 A;  2X35 A;  1M3A A;  1BI1 A;  3QDR B;  3CCV T;  5D7U A;  4AFU C;  2E3H A;  2RB6 A;  5GAM g;  2XI9 A;  5EG2 A;  3OYG A;  4HFF A;  2PUK B;  3M59 A;  1RAA B;  2FPE A;  2V26 A;  2R5M A;  4ZNX A;  2HCK A;  1K1Z A;  5CKD A;  1BI3 A;  4UC4 A;  1K8A U;  2WAC A;  2J06 A;  3LGL A;  1M1F A;  5GAO r;  1VYU A;  1BYM A;  2KY9 A;  2JS2 A;  3I55 T;  4FW2 A;  4GBQ A;  4LD6 A;  1NEB A;  2GCX A;  4HA8 A;  1GFC A;  1Z9Z A;  1Q86 U;  3MJX A;  4EMK A;  5I11 A;  3F70 A;  1X27 A;  1WHH A;  1I4K 1;  3ASK A;  2BIV A;  1VQ9 T;  3A98 A;  4DBH A;  2KK4 A;  1WPY A;  4J30 A;  1KC8 C;  3G6E T;  1CKA A;  3PE0 A;  5CAI A;  1YJ9 A;  3MPU B;  1W4S A;  5GAM h;  1VQL A;  4AG2 C;  2L3S A;  2MAM A;  1UJY A;  4QVZ A;  5LJ3 d;  5GAN 3;  4F7U B;  3MEV A;  2FZG B;  5IAY A;  1K9A A;  3QG1 A;  4B6M A;  5GAN h;  1RAH B;  4PJM A;  1NG2 A;  4FQA A;  2G6F X;  4F7U F;  1D1B A;  2X3W D;  4M77 C;  2ZPI B;  3CQT A;  4KGV B;  4LN2 A;  2JS0 A;  4J9H A;  1BIB A;  1JO8 A;  2XMF A;  2AKL A;  5CQY A;  3E19 A;  3MP8 A;  3KBG A;  1MGQ A;  1HK9 A;  3SWN B;  5GAO m;  3OW2 A;  3GNG A;  1M2V B;  2LT4 A;  1N9R A;  4C8Q G;  4M75 A;  2ATC B;  4ELZ C;  2CKK A;  4A4F A;  1WQW A;  2HNI A;  4MZP A;  2QDY B;  3CC4 A;  3RR6 A;  1YIT A;  1NPP A;  3G1J A;  1NM7 A;  4RMO A;  3OMG A;  4M78 A;  4ZGD B;  1Q7Y C;  2KYB A;  2LJ0 A;  2L8D A;  2O2O A;  1QKX A;  3GF5 A;  3CC2 A;  1UHF A;  1TH7 A;  3THK A;  2LCL A;  1YJW A;  5CKH A;  4OMP A;  4FU6 A;  1YJ9 Q;  1SF9 A;  4XTZ A;  5I21 A;  3OSS C;  4BDY A;  4P5N A;  2DNU A;  2K3A A;  1QVF P;  2BZX A;  2NYS A;  9ATC B;  3I56 A;  1G3W A;  3CCM T;  2QTX A;  3G4S T;  1ZX6 A;  4C0F A;  3AT1 B;  1OEB A;  3G71 T;  3CCR A;  3CBM A;  2DYB A;  1RL2 A;  1JU5 C;  3MEA A;  2ENM A;  3QPH A;  3VPJ A;  3EH1 A;  4F14 A;  3OS5 A;  2YRD A;  3REA B;  2KRS A;  2CSQ A;  1BCM A;  2VUB A;  4FYY B;  2O9V A;  1K73 C;  1Q81 C;  5FRM A;  2M0O A;  3GBQ A;  4D6W A;  1GXI E;  4RUG A;  1TU0 B;  4LUD A;  5GJW B;  4LXC A;  2GTO A;  4J9D A;  5KYU B;  1S72 A;  5CKE A;  3CC2 Q;  3A2Y A;  3OBW A;  3RMQ A;  1B3Q A;  3KW0 A;  3VRZ A;  2COY A;  3OYY A;  1FWZ A;  2PU9 B;  1WHM A;  1WXU A;  2K7A A;  1LNX A;  2L5Q A;  4FCY A;  2EWN A;  2GNC A;  3V7C A;  4M77 E;  4ZN1 A;  2Y4Y A;  2XD0 A;  5HKC A;  2RHU A;  1V1C A;  4XAX B;  4RCB A;  3M4Y A;  1PKS A;  1SSF A;  3I5S A;  1IGU A;  4PNO A;  4ELY C;  3EG1 A;  2XG8 D;  3ULR B;  3S0Q A;  1NJI R;  2C0I A;  2IOB A;  2KT1 A;  3NGP A;  2W0Z A;  2A28 A; 
#chains in the Genus database with same CATH homology
 1QKW A;  2DL8 A;  1TUC A;  2K2M A;  1T0H A;  3M0S A;  1M8M A;  3U23 A;  1AZG B;  4M4Z A;  1TG0 A;  2MIO A;  4JXB A;  2LJ3 A;  1LCK A;  4LE9 A;  1ZUU A;  1YNZ A;  1MV0 B;  2J6K A;  1WLP B;  1UE9 A;  4JPB W;  2RQW A;  1WFW A;  1SHG A;  4EQ8 A;  2EYW A;  2DL3 A;  2OI3 A;  3JV3 A;  4J9E A;  2EYY A;  1I1J A;  1UFF A;  2F2V A;  1Y57 A;  4LJ1 A;  4F17 A;  1OPL A;  1WA7 A;  2CH4 A;  2K79 A;  5FW9 A;  4JJC A;  1NYF A;  3M1U A;  1UDL A;  2EBP A;  1QWF A;  4EQA A;  2IO7 A;  4LUE A;  2K6D A;  3M0T A;  2J6O A;  3VS2 A;  1T3S A;  1T0J A;  2LZ6 B;  1AWW A;  3H0F A;  1SRL A;  4GLM A;  3PBI A;  3UA7 A;  1PHT A;  3RNJ A;  3VS1 A;  1KFZ A;  2KT8 A;  4HCK A;  3M0U A;  3QWX X;  5EC7 A;  2HDA A;  1OPK A;  2KXC A;  1KSW A;  4JJD A;  2KEA A;  1M27 C;  1N5Z A;  1TUD A;  2XIV A;  2D8H A;  3IQL A;  2A08 A;  4FGE A;  4J9I A;  3ZL7 C;  2JW4 A;  1Z9Q A;  4HVV A;  1RLP C;  1AOJ A;  4RTU A;  2EYX A;  2ROL A;  3VPI A;  4AFS C;  2CDT A;  5FWC A;  2CRE A;  2L2P A;  2ESW A;  3KFV A;  4JZ4 A;  4AFQ C;  2L3P A;  1WXB A;  4RTX A;  1PWT A;  1MUZ A;  1ZLM A;  5IHN A;  3VS4 A;  3R6N A;  1PRL C;  1UG1 A;  3UA6 A;  3QWY A;  2GTJ A;  2CSI A;  2RMO A;  2DVJ A;  1MV3 A;  2KRO A;  3EHR A;  1YP5 A;  1UTI A;  1GCP A;  1QWE A;  1RUW A;  1PNJ A;  2FRW A;  1VYV A;  2M0Y A;  2OJ2 A;  1U06 A;  2FPD A;  2EKH A;  2BZ8 A;  3UF4 A;  2OAW A;  1AEY A;  2RQU A;  3I9Q A;  4CC4 B;  1UUE A;  2RQT A;  2LCS A;  3NMZ C;  1X2K A;  5IXB A;  4J9G A;  3EGU A;  1A0N B;  2F2X A;  1GBQ A;  1WXT A;  3M0P A;  4FDY A;  2EYZ A;  2JM9 A;  2L0A A;  3H41 A;  5GJV B;  3TVT A;  2JMA A;  2DL7 A;  2AZS A;  2GGR A;  2AK5 A;  3TSW A;  1QCF A;  4JJB A;  2JMC A;  2FEI A;  2YT6 A;  1GCQ A;  2IOA A;  1NEG A;  2D0N A;  1W6X A;  4EIK A;  1H8K A;  2FG0 A;  1K0S A;  1JXO A;  3H0I A;  4HXJ A;  1ZUK A;  2KRM A;  3TSZ A;  2F2W A;  1WIE A;  1I0C A;  1PKT A;  3SHW A;  5IXF A;  4KRT A;  2IO9 A;  1E6H A;  4D8D A;  4J9F A;  2FO0 A;  2LMJ A;  1K76 A;  2KR3 A;  1W70 A;  2DA9 A;  2EGA A;  3VS5 A;  4J9C A;  1ABQ A;  2H8H A;  3PVL A;  2JXB A;  3I35 A;  1YCS B;  4RTT A;  3NHN A;  1X2Q A;  2BZY A;  4HZB A;  1OOT A;  2LQN A;  4HZ9 A;  2LRJ A;  1ZBJ A;  2DJQ A;  2VOB A;  4CSH A;  2YUP A;  4RTW A;  2O9S A;  2J7I A;  4QT7 A;  1U5S A;  2O88 A;  3GT2 A;  2DBM A;  4J9B A;  4RTZ A;  3NE0 A;  3C0C A;  2PNI A;  1S1N A;  5FWB A;  5HCK A;  1U3O A;  1CKB A;  1AWX A;  5ECA A;  2CH4 W;  3O98 A;  2LQW A;  2EGE A;  2YUO A;  2KBT A;  1GCQ C;  1ZSG A;  1X6B A;  4K11 A;  1K4U S;  2KRN A;  1NYG A;  1KJW A;  3SEM A;  2CUD A;  1GRI A;  2ROT A;  1M30 A;  2K9G A;  4AG1 C;  1X69 A;  1GFD A;  1XOV A;  2IIM A;  3VRY A;  1I07 A;  3A30 A;  1CSK A;  1UGV A;  1OV3 A;  2PZ1 A;  1YWP A;  4Q4T A;  3I86 A;  1H92 A;  4D8K A;  2DL5 A;  4FGD A;  2KNB B;  4Y92 A;  3UAT A;  3VS3 A;  1UHC A;  2YSQ A;  4F0W A;  1PRM C;  1M3A A;  3EG3 A;  4AFU C;  2DRK A;  2B86 A;  1BU1 A;  1AVZ C;  2LJ1 A;  1AZE A;  4HPE A;  2KXD A;  4IIO A;  1ARK A;  4ESR A;  2LNH B;  4OMO A;  2VVK A;  2FPE A;  4ZNX A;  2EPD A;  2HCK A;  1K1Z A;  1ABO A;  2FPF A;  3LH5 A;  1WI7 A;  2J06 A;  2GQI A;  2JT4 A;  1VYU A;  1NLO C;  2JS2 A;  4GBQ A;  1NEB A;  2RQV A;  2LX7 A;  2JTE A;  1GFC A;  1Z9Z A;  4R0K A;  2K3B A;  2RF0 A;  2L3Q A;  1RLQ C;  5I11 A;  2VPS A;  1X27 A;  2SEM A;  2X3X D;  4RTV A;  1AWJ A;  1W1F A;  2BTT A;  2MCN A;  5I22 A;  3A98 A;  2VWF A;  2ABL A;  1FYN A;  4DEY A;  1CKA A;  3PE0 A;  1J3T A;  2DRM A;  3RBB B;  1WYX A;  2JM8 A;  1B07 A;  2A37 A;  2EGC A;  2HBW A;  4AG2 C;  2L3S A;  2RNA A;  1UJY A;  3REB B;  1JQQ A;  3PVQ A;  2KGT A;  1T3L A;  2DIL A;  1K9A A;  1RI9 A;  1G2B A;  4IIM A;  2C0O A;  2VKN A;  2QDL A;  4Q4G X;  3H0H A;  1NLP C;  1AWO A;  1NG2 A;  4FQA A;  2IF6 A;  2P4R A;  2G6F X;  3M0Q A;  4DEX A;  2X3W D;  2FRY A;  3PBC A;  2I0N A;  2C0T A;  1HD3 A;  3VS7 A;  3CQT A;  4LN2 A;  2JS0 A;  4J9H A;  2RQR A;  1JO8 A;  2XMF A;  4Z8A A;  2AKL A;  1E7O A;  1M3B A;  1UJ0 A;  1YN8 A;  2KYM A;  4E6R A;  1SEM A;  2CT3 A;  2M51 A;  4ORZ A;  2YDL A;  3O5Z A;  2DE0 X;  4FQB A;  2GBQ A;  4Z89 A;  5IHK A;  3VS6 A;  4FGI A;  4Q4N A;  2KE9 A;  1SRM A;  2DF6 A;  1HSQ A;  1NM7 A;  2DL4 A;  1YWO A;  1JEG A;  1HJD A;  2KYB A;  2LJ0 A;  3EG0 A;  2O2O A;  1QKX A;  1Y0M A;  2HEQ A;  2DX1 A;  1SPK A;  1UHF A;  3THK A;  4OMM A;  1UEC A;  2DLP A;  2HSP A;  4EOB A;  4OMP A;  4LNP A;  4RTY A;  3VS0 A;  1VA7 A;  2DNU A;  2K3A A;  2IO8 A;  2BZX A;  2NUZ A;  2ED0 A;  3I5R A;  2LP5 A;  2MOX A;  2CT4 A;  1WX6 A;  4CC7 A;  5IH2 A;  2AKK A;  1K0X A;  4FSS A;  4F0V A;  1ZX6 A;  1KIK A;  1BBZ A;  1OEB A;  2DMO A;  2DYB A;  2D8J A;  2SRC A;  4A63 B;  1JU5 C;  2D1X A;  1QLY A;  1FMK A;  4CC2 A;  2ENM A;  4CC3 A;  2YUQ A;  3VPJ A;  2VPM A;  2EW3 A;  4JZ3 A;  2DM1 A;  4F14 A;  4F4M A;  2RN8 A;  3REA B;  2KRS A;  2CSQ A;  3FJ5 A;  4WCI A;  1BK2 A;  1G83 A;  2O9V A;  1VYT A;  4AFZ C;  2J6F A;  3GBQ A;  3A2Z A;  2EVR A;  2YUN A;  5IHI A;  4RUG A;  1E6G A;  4LUD A;  5GJW B;  3NPF A;  4OMN A;  2ECZ A;  1M3C A;  3EHQ A;  2GTO A;  1BB9 A;  1EFN A;  4J9D A;  2W10 A;  4F16 A;  1GBR A;  3A2Y A;  4Z88 A;  1GL5 A;  2NWM A;  4OLK A;  1ZUY A;  3EG2 A;  2O31 A;  1AD5 A;  2K1G A;  1B3Q A;  2RPN A;  1H3H A;  3KW0 A;  1X43 A;  2AZV A;  3VRZ A;  4OMQ A;  2ED1 A;  2A36 A;  4CT3 A;  2J05 A;  1WDX A;  1WXU A;  2K7A A;  4CGK A;  2CUB A;  2DBK A;  1SHF A;  2GNC A;  1SSH A;  1IO6 A;  2EQI A;  4HVU A;  4X1V A;  1JXM A;  4OML A;  2E5K A;  1V1C A;  5L23 A;  1PKS A;  4HVW A;  3I5S A;  3S0Q A;  3EG1 A;  1X6G A;  3ULR B;  3M0R A;  2C0I A;  2V1R A;  2IOB A;  2PTK A;  2KT1 A;  2V1Q A;  3NGP A;  2W0Z A;  2A28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...