3PVQA

Crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
297
structure length
295
Chain Sequence
AYGVVHISVCNMRDEGKFTSGMSTQALLGMPVKVLQYTGWYEIQTPDDYTGWVHRMVITPMSKEKYDEWNRAEKIVVTSHYGFTYEKPDDDSQTVSDVVAGNRLKWEGSKGHFYKVSYPDGRQAYISRHISQPESKWRASLKQDAESIIKTAYTMIGIPYLWAGTSSKGVDSGLVRTVLFMHDIIIPRDASQQAYVGERIEIAPDFSNVQRGDLVFFGRKATADRKEGISHVGIYLGNKRFIHALGDVHISSFDPEDEYDEFNTGRLLFATRFLPYINKEKGMNTTDHNLYYLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Dipeptidyl-peptidase VI
total genus 82
structure length 295
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3pvqA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3pvqA02
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 3pvqA03
2KXCA 3EG1A 4RTWA 1GBRA 1Z9QA 1X2KA 1N5ZA 1K9AA 2J05A 2LJ0A 4HVUA 4Z8AA 1JXMA 1AZGB 1GFCA 2GTJA 4FSSA 1M3CA 4OMOA 4CSHA 1WXBA 2SEMA 1GCPA 1W6XA 3I5SA 3VS1A 3M0QA 2DNUA 2CSQA 2BZ8A 4FQBA 1X2QA 1T3LA 2DBKA 3SEMA 2YUPA 2CREA 2ROLA 2DM1A 1OOTA 1VYVA 3M0SA 4Z88A 2K6DA 1T3SA 3H0IA 2RN8A 2E5KA 1U5SA 2VPMA 2KROA 2D1XA 2ABLA 2X3XD 4Q4NA 1B07A 1KJWA 2NUZA 5I11A 3I35A 4X1VA 1M8MA 1SPKA 2IO7A 1VYUA 4JJBA 2DRMA 4RTZA 2J6KA 2LJ1A 4Q4GX 1G2BA 2HSPA 3PE0A 4J9EA 2EGEA 2AKLA 2DL8A 2F2WA 1QKXA 2HDAA 3C0CA 4CC7A 4WCIA 2OJ2A 1K0XA 2EYZA 1EFNA 2PNIA 2EKHA 3VS2A 1JU5C 1PWTA 1SSHA 1BK2A 2D8HA 4LE9A 2VVKA 3VS6A 4HCKA 4J9BA 2EBPA 4RTYA 4Y92A 2ECZA 2EVRA 1UECA 1K0SA 2A08A 4EIKA 2C0TA 4CT3A 1GL5A 2EYWA 1QCFA 2YUQA 1Z9ZA 2KRSA 2GTOA 2JMCA 4FGIA 3VS4A 4E6RA 1H8KA 3PBCA 1OPLA 3PVLA 3QWYA 3EG0A 2YSQA 2MIOA 2I0NA 3LH5A 1SRLA 1WX6A 1SEMA 2NWMA 2GGRA 4J9IA 2L3QA 1JEGA 2EYYA 1AOJA 1QLYA 2OAWA 1M3AA 3CQTA 2K9GA 2LQWA 2KEAA 5IXBA 1RLPC 2H8HA 4M4ZA 4OLKA 2VWFA 2AKKA 3I86A 4JJCA 1WLPB 2DL7A 2FG0A 2RQWA 3H41A 1ZLMA 2JM9A 2YUOA 4ESRA 2DLPA 2A28A 3NGPA 4A63B 4RUGA 1KIKA 2V1QA 4HXJA 4HVVA 4JJDA 4AFZC 1NEGA 2JM8A 1PKSA 4RTXA 5ECAA 1LCKA 3M0PA 4Q4TA 3NMZC 1B3QA 2GBQA 2EPDA 1MUZA 3S0QA 2QDLA 1ZBJA 1WA7A 1TUDA 2IF6A 4OMPA 2FEIA 3VRZA 2L3PA 1AZEA 2K1GA 1FMKA 2JS0A 1UJYA 4F0VA 2O9SA 1WXUA 2KE9A 1YWOA 2BZYA 1PRLC 1U06A 1AWJA 2YDLA 4LUDA 3REAB 1NLPC 1NYFA 4D8KA 2LMJA 3QWXX 4ORZA 1AVZC 2KT1A 4F0WA 3O98A 2LQNA 3UF4A 2DA9A 1GCQA 2C0IA 2KXDA 4IIMA 4LNPA 3EGUA 4RTVA 3I9QA 2KGTA 2HCKA 1FYNA 1T0HA 2M51A 1T0JA 4IIOA 2JT4A 3UA7A 1OV3A 4JXBA 1X43A 2GNCA 2VKNA 1VA7A 1YCSB 1X27A 1W1FA 2FPEA 4FGEA 1M3BA 2FRYA 3VS5A 4K11A 3VPIA 2F2XA 2J6OA 3GBQA 4J9CA 4RTUA 3UA6A 3M0TA 2RQTA 2L3SA 2KR3A 3VS3A 1NG2A 1TG0A 2LCSA 1UUEA 2LZ6B 1ZX6A 1E6HA 2DL4A 3M0RA 4JPBW 2ROTA 1I07A 2FPDA 2KRNA 3SHWA 1GCQC 1Y0MA 2IO9A 4Z89A 1G83A 2RNAA 4F17A 2HBWA 4DEXA 2K3AA 1NEBA 2CT4A 3NPFA 1K76A 2D0NA 2LRJA 2FPFA 1UDLA 3M0UA 4J9DA 2A37A 3RNJA 1GBQA 2O2OA 1M30A 2AK5A 1WYXA 2ENMA 1SHGA 2YT6A 1CSKA 2LNHB 3EHQA 2RPNA 4AFSC 4HVWA 4EOBA 4JZ3A 3KFVA 1YP5A 4FGDA 3PVQA 4LJ1A 2XIVA 1UTIA 2K3BA 1BU1A 3VS0A 2EW3A 1J3TA 2P4RA 5FWBA 2KYBA 1TUCA 3A30A 1PKTA 1H3HA 2O31A 1PNJA 1QWFA 2RMOA 1XOVA 2DYBA 5IHNA 1V1CA 1M27C 1IO6A 1OPKA 4RTTA 3A98A 3KW0A 4FDYA 3O5ZA 1QKWA 1E7OA 3VPJA 1U3OA 2L0AA 1VYTA 2CUDA 1AD5A 2DL3A 4ZNXA 2GQIA 1BB9A 3PBIA 2DBMA 2KYMA 2LJ3A 2O9VA 4OMMA 1HD3A 1AWWA 5L23A 1ZUYA 3ULRB 2DL5A 2J7IA 4EQAA 2DILA 3H0HA 2FRWA 2J6FA 1H92A 2XMFA 4HZBA 1YNZA 2KT8A 5FWCA 2MOXA 2RQRA 2O88A 1I1JA 1I0CA 4GLMA 4F4MA 1WFWA 1X6GA 3ZL7C 4AG2C 4DEYA 3EHRA 2CH4W 2AZSA 3I5RA 2K79A 2B86A 5IH2A 2W0ZA 3VS7A 1GRIA 1CKBA 2AZVA 3TVTA 2CH4A 2G6FX 2DX1A 2EQIA 2KRMA 2LP5A 1HJDA 3NE0A 2PTKA 2SRCA 2CSIA 1WIEA 2PZ1A 5HCKA 2DVJA 4LN2A 3VRYA 1QWEA 1S1NA 2JTEA 2L2PA 2JW4A 1UHCA 2DRKA 4EQ8A 1AWXA 2CDTA 1SHFA 1ZUUA 2JMAA 1Y57A 1WDXA 1A0NB 2IIMA 3TSWA 4FQAA 1JO8A 2KNBB 2V1RA 2CT3A 1X69A 2J06A 5IXFA 2JS2A 5GJVB 4LUEA 1ABQA 1PHTA 2OI3A 2VOBA 4HPEA 2EGAA 4AG1C 2MCNA 2ESWA 4CC4B 1X6BA 4CC2A 1KFZA 4J9HA 1KSWA 3H0FA 1YN8A 1ARKA 1AEYA 2ED1A 2RQUA 5EC7A 2IO8A 4KRTA 4OMNA 5I22A 3A2ZA 1YWPA 4AFQC 3EG3A 2IOAA 3REBB 3U23A 2DMOA 3RBBB 4GBQA 2K7AA 2DE0X 1NLOC 2EYXA 2IOBA 4OMQA 1BBZA 2BTTA 3M1UA 2YUNA 1UE9A 2LX7A 2EGCA 1ZUKA 1AWOA 2FO0A 5GJWB 1W70A 1ABOA 4F14A 3A2YA 3EG2A 1MV0B 1K4US 1ZSGA 3JV3A 4D8DA 2W10A 1MV3A 1K1ZA 3TSZA 1RUWA 4J9GA 3NHNA 1NYGA 1UJ0A 1PRMC 1UHFA 4HZ9A 2RQVA 1OEBA 1WI7A 3UATA 2M0YA 3GT2A 4J9FA 1GFDA 2RF0A 1JXOA 4R0KA 4JZ4A 5FW9A 1JQQA 2DJQA 1RLQC 2VPSA 2C0OA 4AFUC 2BZXA 2KBTA 1CKAA 2D8JA 1E6GA 2DF6A 2K2MA 3FJ5A 5IHKA 2ED0A 1UGVA 1HSQA 4F16A 1UFFA 1SRMA 3R6NA 2CUBA 2HEQA 1UG1A 2X3WD 1WXTA 2A36A 4CC3A 4OMLA 5IHIA 3IQLA 2JXBA 2F2VA 4QT7A 3THKA 4CGKA 1NM7A 1RI9A
chains in the Genus database with same CATH superfamily
1QVGS 5LJ3h 2QEXT 1K73R 2DZ9A 3SB2A 1X2KA 4MMKA 3CC4T 4CI0C 1JXMA 3CCQQ 1IRXA 3CXCA 2DXTA 2PVGB 4D6WA 2FZKB 4OMOA 5CVIA 4ME7A 4JS4A 3G71A 2SEMA 3HL8A 1GCPA 4KH1B 3OB9A 3MP1A 4M78A 1VOMA 4EMHA 2DBKA 4PJOC 4FIBA 1M2OA 1Q81R 1OOTA 2QQSA 2VASA 2MWPA 2LCLA 3M0SA 1KD1C 1X6OA 5KYYA 3MKDA 1VQPA 4RCCA 3F70A 4RG2A 4Q4NA 1KJWA 1P92A 1M8MA 4N0AA 4DOVA 4M78G 1SPKA 3SWNB 1LJOA 2HQEA 2MK5A 2HL5C 2O01E 3H9NA 4M78C 3DB4A 3CCLT 1YJWT 1ZBXA 2PNIA 3QJ6A 1SSHA 1BK2A 2D8HA 4LE9A 1YI2T 3CPFA 4E7HA 3CCEA 2CZ7B 4LD6A 3VS6A 1M1KC 4HCKA 4J9BA 4RTYA 4Y92A 2ECZA 2CZ1B 1K0SA 4A4EA 1G3TA 1I8FA 2EYWA 2D0QB 2DPPB 4MDWA 4LDYA 5HK3A 3G4SA 4FYYB 3JCMf 3EG9B 3HSBA 2GTOA 2QA4Q 2DFUA 5CIUA 1VQ5Q 4M75E 3EG0A 1OULA 2I0NA 1VIEA 3M55A 4J9IA 1QLYA 3CQTA 2K9GA 2KEAA 3OBYA 5IXBA 2RK1A 2COYA 4C5IA 4FU6A 1RAIB 3MP6A 2E3HA 2XDPA 2DD5A 3E19A 3H41A 1ZLMA 1TTHB 2X35A 2PUKB 2VGNA 1XNIA 4EMKC 2V1QA 2XICA 4HVVA 4JJDA 4AFZC 4HCCA 1VQ9A 5ECAA 2PU9B 1EZZB 1LCKA 3M0PA 4C5GA 1B3QA 3HP9A 2HD0A 2QDYB 1VQOT 3DB3A 1FMKA 2KE9A 4ZGJB 2CP2A 1U06A 2MAMA 1OX8A 4LUDA 1Y71A 1N8RR 1NYFA 2IPOB 2HKQB 4F7UA 1BI2A 1I5OB 4ORZA 3I56Q 3EGXA 2LQNA 4M77C 3UF4A 3CCLQ 3FC3A 1YJWQ 4LNPA 3EGUA 3CCJT 1TOVA 3CC2T 2HCKA 3QIIA 4IIOA 1T0JA 2JT4A 3UA7A 3ER0A 4HA8A 1WJQA 5KYWB 1X43A 4EMKA 2JNGA 5EG2A 3GIBA 2QQ9A 8ATCB 3VS5A 2NUTA 5KYXA 4EMKB 3GPLA 1Q81U 1TSFA 3S3OA 4M7AF 3JCMW 1VQKQ 1UUEA 3VU3C 1KQ1A 1SSFA 2DL4A 5KE2A 3CPWS 3OSVA 3J80E 3UPUA 3V8JA 4DA4A 3SHWA 1QVGP 3CC7A 3CCRT 2RJCA 3HRTA 4F17A 4DEXA 4PJJA 4B9WA 2ZPEB 1UEBA 3PTAA 3OYKA 2JVVA 3RNJA 1UDLA 3M0UA 2V26A 2O2OA 2CP5A 3FDRA 1M30A 2K5IA 4XU1A 2P84A 1SHGA 2GFAA 1CSKA 4M7AA 2LNHB 3EHQA 4AFSC 4HVWA 4JZ3A 3KFVA 1SF9A 1D3BA 4J7IA 4LJ1A 2V8KA 1BYMA 2XIVA 1Q82U 2XHCA 1TUCA 4MZTA 1PKTA 5HY6A 3A30A 4L5GA 2XI9A 3S3MA 3A8HB 5IHNA 1OPKA 4M7AG 5M9OA 3KW0A 3OYFA 1E7OA 3RMSA 1VYTA 2CUDA 1AD5A 2DL3A 4ZNXA 3MP8A 3SWNC 2DBMA 4BB7A 4OMMA 5CO7A 5LJ3f 4PJOE 5L23A 1ZUYA 3ULRB 1NE8A 3FLGA 2YHTA 3M58A 1WHLA 1Q95G 2EQMA 2J7IA 3LX7A 2NYSA 1IB8A 2FRWA 2J6FA 5D6YA 3CD6A 1RABB 3V8KA 1S72T 2QTVA 1G3SA 3CCET 1Q7YC 2RHZA 3M53A 2QGFB 2WSEE 6AT1B 2D6FA 3HTRA 5GAN3 5I2SA 3CBPA 2QGGA 1VQ6T 4RKUE 4C8QA 3L2WA 1YCYA 5CKFA 1YHQQ 1MHNA 3VS7A 1KQSA 5CKEA 3FB9A 1VQPQ 1IREB 4PLLA 3BDUA 4MMLA 2LP5A 3A5ZB 2MPXC 5CKBA 1K8AR 3NE0A 3WVEB 3SWNA 2BUDA 3VRYA 2DRKA 4E7ZA 3VUZA 1NBEB 1ZUUA 2K5FA 3QZ9B 4NOYA 5KYYB 1A0NB 1VQKT 2GFUA 1RAEB 3OW2A 3I55A 5J39A 1PD1A 1MNDA 3C94A 4M77A 3GLXA 1ABQA 4PJOF 2NUTB 4J30A 5GANe 4QVDA 3C95A 4IUPA 1JB0E 4JS5A 3OMGA 4CC4B 4GY5A 3V7SA 1M1KU 1KFZA 4N4GA 1YN8A 3QPHA 2K3XA 2ED1A 4E7LA 4JJNK 1FMWA 3ASKA 3M9QA 2IO8A 3FEOA 4KRTA 3I56T 4AFQC 3REBB 2DMOA 2K7AA 1D1BA 2EYXA 3T9NA 2IOBA 1BBZA 3CCMQ 2M9UA 3BFMA 3NTHA 5LJ5g 2FO0A 2AIRB 3A2YA 2EAYA 1K4US 1ZSGA 1K1ZA 4UC4A 4J8OA 4F7UF 1UJ0A 1PRMC 1UHFA 4HZ9A 1FXXA 3UATA 3GT2A 5GMKl 1JXOA 2RJDA 2DAQA 4PJMA 1RLQC 2C0OA 5LJ3d 5GMKi 2OTJQ 1MGQA 2QQAA 3JCMV 1JRIA 1QVFP 2K2VA 2DF6A 2RD1A 2K5LA 5GAN6 2ED0A 2B8AA 2DIGA 3ME9A 1UFFA 2HEQA 1UG1A 2H3EB 3N5BB 3MEVA 2A36A 4A4FA 1G5VA 2F2VA 2OTJA 3THKA 2DEUA 1PG5B 4C0ZA 1VQ7A 3E2UA 2X4XA 2CP0A 1N5ZA 1K8AU 3MEAA 1D09B 2LJ0A 4HVUA 4Z8AA 1GFCA 3EGDB 2F5TX 1WXBA 3JB9F 1W6XA 3M0QA 3X25B 4BE1A 4V2SA 2DNUA 2BZ8A 2KY9A 4FQBA 1X2QA 1T3LA 1UGRB 2ROLA 2DD4A 4HT8A 3CCJQ 2ATCB 5C6SA 1QVPA 3QG1A 5GAN4 2RI2A 2HQHA 2X3XD 3ZEHA 5I11A 4FT2A 2BIVA 4X1VA 4XTVA 3S3NA 3PT9A 1VQOQ 2IO7A 4LDWA 3OYDA 5J3BA 2I2LA 3UWNA 4JJBA 4FCYA 1S72A 4RTZA 1VQPT 1G2BA 2XKOC 3PIOA 4KUIA 2DVEA 5CCAA 3OW2S 4J9EA 2GQVA 3OBWA 2F2WA 2IVWA 1QKXA 2HDAA 4CC7A 4BDYA 4BD3A 4WCIA 5LJ3e 2VC8A 1K0XA 3EFOB 2WACA 3LGLA 2EKHA 3GNFB 2HZYA 3CXCP 4KT0E 3OYMA 1KC8C 1QP2A 2FHDA 3JSCA 3CCQT 4QVZA 1C1AA 3JCMb 2R57A 5GAOp 1K8AC 3JB9G 1N27A 1HYOA 1LVKA 4II1A 4XK8E 2EJGA 1R8OB 4FGIA 2QK0A 3OSSC 1H8KA 4C92A 4C8QF 3PVLA 3VYGA 3L42A 5KH6A 2X4YA 3LH5A 5KE3A 2PVOB 1PCXA 2QA4T 4J83A 2GGRA 1Q86U 3L2QA 2EYYA 4EPCA 2R5AA 4PKCC 2OAWA 4BACA 1M3AA 3RR6A 2DETA 2AT1B 4HFKA 2VWFA 4E7SA 2RHIA 3I86A 4JJCA 4E2FB 3E1SA 2FG0A 2RM4A 1Y7XA 2RQWA 2VXFA 2EKOA 3WXMB 4DBFA 2JM9A 2YUOA 2R58A 4KULA 3ZFJA 2KQWA 1C0MA 4RUGA 3ZBDA 1KIKA 4QQGA 1LPLA 5CAIA 2OTLA 3I56A 1MUZA 3CCST 3PGGA 1X01A 2QDLA 1WA7A 1VQ7Q 2ZAEA 4OMPA 3D7SB 3OYYA 3A8OB 1M1FA 4C8QC 2L3PA 1VQLT 2K1GA 3HRSA 2O9SA 1KK7A 2F69A 1AWJA 2YDLA 3REAB 3CC4A 4DBRA 1YJ9A 2HAXA 1TU0B 3QWXX 4KGZB 3O98A 2DA9A 4IIMA 3G71T 2Y4XA 3FRNA 5FRMA 1QCOA 2KGTA 1T0HA 2Y90A 3AHUA 1FMVA 1XTDA 1OU9A 1FX7A 2HBPA 1D0YA 1QVFS 2LT4A 2COZA 1RAAB 4PJOB 5HKCA 2KSSA 4QKUA 1VQKA 3M0TA 2RQTA 2L3SA 4LDVA 4QQ6A 1IHVA 2YWWA 1IGQA 3QBYA 1I5LA 3VS3A 5FROA 2YXYA 2OTLT 2NUPA 3L1AA 2YRCA 4DQ2A 3OYCA 1D0ZA 3EAEA 4Z89A 2RHYA 1JJ2P 2QA4A 2A7YA 5FU7C 4IURA 5LJ5d 2F1LA 1X75C 2OX7A 3CCMT 1YITT 2ZPIB 4GLKA 2AK5A 1WYXA 3DKMA 3C4SA 1D1AA 4FYXB 3VV0A 2ENMA 2RPNA 3PFSA 5GAN2 4FGDA 2QQRA 4NS5A 3PVQA 2LDMA 3RESA 5KYUA 3NTKA 4XTWA 2P4RA 3H8ZA 1O9SA 1TWBA 1BKBA 2E65A 1QP3A 5AYFA 3OS5A 2DYBA 4OP0A 4X9DA 7AT1B 3CCVQ 2RI5A 4NL2A 4C0GA 3JCMJ 4M75B 1VQLA 2L0AA 1RAHB 1OZ3A 3CCUA 3M4YA 2KYMA 2O9VA 2KVQG 3OS2A 4IUVA 2P0KA 4KUDK 4PNOA 2DILA 3H0HA 3KBGA 1MMNA 1HXDA 2V8IA 2PUOB 1D1CA 4M77F 1WQ7A 5FWCA 2RQRA 2EYQA 2OTJT 1WFWA 1YBYA 3OYBA 3ZL7C 1NJIC 2RH2A 3EHRA 3QYGB 2K79A 1GRIA 3P8DA 1TXQA 3A8LB 2M0OA 2DX1A 1KG1A 2E5QA 3HKSA 1B7TA 2PTKA 2SRCA 2JJ9A 3OYHA 1WIEA 2PZ1A 5HCKA 2EJFA 1NZ9A 1LNXA 2E3IA 2L89A 4M75F 4RCBA 1QCNA 2JTEA 4C8QE 1UHCA 4EQ8A 2L3RA 2CDTA 1SHFA 2P4TA 4OB3B 2LX9A 1OI1A 2Z0WA 2IIMA 3TSWA 2D9TA 3QDRB 2KNBB 4OB0B 2V1RA 1OZ2A 4HCBA 1YIJA 3MCAB 3GOXA 4M7DC 2OI3A 2DZCA 3CCVT 2H3JA 2VOBA 4HPEA 3SDZA 4AG1C 5GAOm 2LTOA 3QXEB 1U8RA 4BY6C 2DYIA 4OF1A 1EIFA 1KD1R 2LQ8A 3TU4K 4P5NA 3QYHB 4HKEA 1YJ9T 4M7DD 5EC7A 1Q86R 4E7IA 2IOAA 3EG3A 3RBBB 4GBQA 1VQOA 2DE0X 4M77B 1M2VA 1Y96B 2BTTA 2DKGA 2LX7A 1ZSZC 1ZUKA 2E41A 4KH0B 1JBMA 5GJWB 1W70A 4JUVA 4C8QD 2RJFA 3CCUQ 2XG8D 2WP7A 2E4HA 3BW1A 5FU6C 2M16A 5CQXA 1YHQA 1MV3A 1U1TA 2K4YA 4JRQA 2EWNA 2MWOA 4BE2A 1RUWA 5CK9A 3GP8A 1ZQ1A 2OTLQ 3M4GA 1HK9A 3QUIA 2RQVA 1WI7A 1YI2A 5LL6S 2RF0A 4JZ4A 4PJLA 3OYAA 9ATCB 2JTMA 4AT1B 3JCMd 2BZXA 1VQ8T 3CCEQ 1K73C 1E6GA 1UGPB 5IHKA 2OAUA 2QI2A 5GAN8 1AHJB 2K57A 2X3WD 3CPWA 2LC4A 3LLRA 4DBQA 4ZN3A 4OMLA 3OYIA 3IQLA 3VYHB 4QT7A 2O4XA 1N9RA 3RMQA 1GXIE 3CC2Q 1BI1A 1RAGB 2KXCA 1VQMQ 3CMAT 5GAOn 2JUFA 3EG1A 1MNEA 4ZTFA 1GBRA 1YJWA 3CCLA 5J26A 3OMCA 2CKKA 2J05A 2DEQA 2LCCA 2VXEA 4J5YA 1SKUB 3PNWC 1AZGB 3CMEA 4FSSA 1BCOA 4JURA 1V76A 1D0XA 1VQ7T 4CSHA 3CCRA 3I5SA 4R56A 3CCSQ 1WHJA 2DXCA 2XIDA 5GAMj 2DTOA 4DBHA 3NTIA 3P8HA 4C0DB 4MDXA 2YUPA 2CREA 3G1JA 4Z88A 2K6DA 5L8RE 5IT9E 2DXBA 2RN8A 2E5KA 3JRZA 1N9SA 5I21A 1B07A 1W2BP 2G3RA 1M90U 1M90C 3PMIA 3INZA 4JRKA 1NJIR 3O8VA 1S72Q 3OY9A 3JB9H 2DXUA 1VYUA 4C92C 2DRMA 2J6KA 3OYLA 3EG9A 3JCMe 4O5VA 1OQKA 3S6WA 4OMFB 4FM4B 4RG8A 2AKLA 3AT1B 2XDDA 3C0CA 4OB2B 1MMGA 2OJ2A 5A0DA 2M02A 1VUBA 2O4XB 1EFNA 4A54A 3LWIA 3CMET 1YITA 5KCHA 2C06A 1BIAA 2EIFA 3CBOA 2VVKA 4J7FA 2EBPA 1R77A 1UECA 2A08A 1RL2A 4EIKA 4KGXB 3OYGA 1GL5A 4CT3A 1N8RU 3E9FA 4Y28E 3X24B 4M7AB 4ANJA 1YI2Q 2KRSA 2HMAA 1C6VX 2QAZA 4IUTA 2JMCA 1M9SA 4E6RA 1LOJA 4M7DG 1OU8A 3QWYA 2MIOA 1TH7A 3M57A 1SRLA 1WX6A 1VQ6A 2KK4A 5KYWA 1AOJA 3URGA 4JLGA 4PFOA 4M7AD 1RLPC 2H8HA 4M4ZA 4OLKA 3CCUT 1WLPB 5IN1A 3R6OA 1N6AA 2QG9B 3EGXB 4LDXA 4M78B 3CCRQ 2DLPA 2A28A 3A8GB 2RK2A 3NGPA 4A63B 4XQ3A 4HXJA 2JM8A 4BI4A 2JZ2A 2ZZDA 4BDZA 1M1KR 4Q4TA 1VQ4Q 2GBQA 2EPDA 4NL3A 3X28B 3S0QA 2E1HA 1ZBJA 4M7AC 3CC2A 3OYJA 1U1SA 3VRZA 1AZEA 1Q7YU 1YWOA 2DERA 2QEXQ 2E10A 4C5EA 1VQ9T 3CMEQ 1AVZC 4OGCA 3G6ET 2YLCA 1YFNA 1GCQA 4RTVA 3I9QA 1RADB 4XU2A 4EDUA 1DJ7B 2Y4YA 1OV3A 3EFSA 1PD0A 4JXBA 2GNCA 2VKNA 2XU8A 1YCSB 1ACMB 1X27A 1W1FA 4FGEA 4PFZA 4M78D 1K73U 2P0PA 2FRYA 1WHKA 2QYZA 1PM3A 4KGVB 4J9CA 1KQSP 4M77D 5KCOA 1YJNA 4XTYA 4JDSA 4EMGA 3OA6A 2R5MA 2KR3A 1NG2A 1TG0A 2LZ6B 1ZX6A 1E6HA 2X51A 3M0RA 2ROTA 1ZA1B 2FPDA 4OGEA 2KRNA 2P0QA 1VQ4A 3CCSA 1GCQC 4N4IA 2IO9A 1ZA2B 3P8BB 3KXTA 2HBWA 2RO0A 5A0GA 5GAMh 1VQ9Q 3EBQA 3GNGA 5AT1B 2L5QA 2ZCFB 1NEBA 2CT4A 1K76A 5DLQE 2D0NA 4A4GA 2FPFA 5GANf 4J9DA 2A37A 4ZGDB 3CC7Q 2LT1A 1KQSS 2YT6A 2ZPBB 2V8JA 4Z02A 4M7DF 5LJ3j 1YP5A 2JTFA 1QQJA 3META 1UTIA 3G71Q 2K3BA 5FU6B 3VS0A 1J3TA 5FWBA 2KYBA 4ELZC 2LVMA 1R0BG 3MHXA 2E6NA 2O31A 5CKDA 1PNJA 1QWFA 2MMPA 2RMOA 3BY7A 4N4HA 2GCXA 1VQ8Q 1IO6A 4RTTA 4ZN1A 2RHUA 3O5ZA 1I81A 3CC4Q 3DLMA 3VPJA 4PLIA 3M54A 3QKJA 1WNLA 1BB9A 3PBIA 1ZHIA 4FW2A 1HD3A 4F7UG 3CCJA 3HRUA 1SG5A 1W4SA 5GAMd 1YIJT 3J7AF 1H92A 2XMFA 1YNZA 2KT8A 4WF2A 2O88A 4GLMA 3SD4A 5LJ5f 4F4MA 1X6GA 1M2VB 4F7UB 1QMCA 1M90R 4AG2C 3RERA 2CH4W 2AZSA 5IH2A 4ELYC 3JB9J 4IUUA 2AZVA 3TVTA 1Q82R 3DLLA 2KRMA 4BY6B 4C0DC 2A0FB 1IZ6A 1G8XA 2CSIA 1VQNQ 2BE9B 2KMTA 1QWEA 1V29B 2L2PA 1WHMA 1AWXA 1KQ2A 3G7ZA 2DJZA 2KDSA 2JMAA 1Y57A 1WZOA 2K3YA 3CCQA 2YRVA 1VQ5T 1BI0A 4TVRA 4FQAA 4AMCA 4ATOA 2CT3A 3KUFA 4XU3A 5IXFA 3CXCS 2LRQA 3MEWA 2VGMA 2EQKA 4J32A 3G6EA 2XDBA 4QVCA 2ZPGB 2EGAA 2EFIA 3BE3A 2MCNA 2ESWA 1VQLQ 4CC2A 1X6BA 1KC8U 1VQ5A 3JB9I 4E7JA 1K9MR 4M77E 5D7UA 3H0FA 1WHGA 4PJOD 2WSFE 1Q82C 1WJSA 4HT9A 2FZCB 3HHTB 2HL3A 1YWPA 4F04B 1K9MU 3JB9D 4C92D 1YJNT 5GMKe 3JAME 4OMQA 3M1UA 2YUNA 4XTZA 2VUBA 4M78F 4XTXA 2ZPHB 4A4KA 3E9GA 1ABOA 4M75G 4F14A 1MV0B 4KBMB 3JV3A 3MPUB 4OB1B 4D8DA 2W10A 1Q7YR 3TSZA 3OS0A 4HFLA 4MZPA 2VV5A 1VQ8A 1MMAA 2DTIA 4J6XA 4O6JA 4PJNA 4C8QG 5LJ3g 4HFFA 2M0YA 3RIRA 4J9FA 2GF7A 4R0KA 2HKNA 2DJQA 2VPSA 3CCVA 4M75A 3CC7T 1N8RC 3HFNA 2KBTA 1CKAA 3QJYA 4PL6A 2K2MA 3FJ5A 3RKYA 1VQMA 1UGVA 1SRMA 3R6NA 4YTLA 4C92G 1M8VA 3HFOA 4CC3A 3CEYA 5IHIA 1R0CB 3L2ZA 3EFOA 2LNVA 1I4K1 1NM7A 3MJXA 1KHIA 4B6MA 1B34A 4RTWA 4LDUA 4M78E 1Z9QA 1K9AA 3MO8A 2GTJA 2FYKA 4M77G 1M3CA 4FL6A 5KYNA 1OX9A 2DK3A 3Q1JA 4M7DB 3VS1A 3A8MB 2CGHA 2CSQA 1Y07A 3J81E 3SEMA 2DM1A 3CCMA 1VYVA 5LJ5j 5GANj 1T3SA 3G6EQ 3H0IA 1U5SA 1XQHA 2KROA 5GMKm 1JJ2S 2VPMA 5GAN7 2D1XA 2ABLA 1XJWB 5HK0A 2NUZA 4RMOA 4X34A 3I35A 3V8LA 2L8DA 1PSFA 5FLXE 2LJ1A 4Q4GX 2QQBA 3QDFA 4J6WA 2LQKA 2HSPA 4A4HA 3PE0A 3JCMX 2EGEA 2DL8A 2CP6A 4BI8B 2EYZA 3CMAA 1WJRA 2HNIA 1UB4A 3VS2A 1JU5C 1PWTA 3M56A 4J6YA 3UDCA 3JCMg 3X26B 1QW1A 2EVRA 2KAFA 2C0TA 1YIJQ 1QCFA 1PC0A 5DM7R 4IKFA 2YUQA 5LJ5e 1Z9ZA 1VQMT 4LXCA 5GAOl 4N0AC 3H6ZA 3VS4A 5GAMe 3WVDB 4Q5WA 3G4SQ 3CPWP 1OPLA 3PBCA 2YSQA 3GF5A 2X9HA 4DOWA 1VQ6Q 3OQ5A 5CR2A 1SEMA 3M5AA 2NWMA 5DLOA 1JEGA 2FVUA 2L3QA 4VUBA 2KI7A 4C92E 4WTOB 2LQWA 2FZGB 1G3YA 2AKKA 3JCMQ 3LH0A 2DL7A 4JRPA 3QZ5B 1ZSZA 4ESRA 1WQWA 1KD1U 2RI3A 2MF2A 2EQUA 5GMKh 5CKHA 3BDLA 1NEGA 2BE7D 4L6V5 1PKSA 4RTXA 3NMZC 2X4WA 2M1HA 1B34B 3V7CA 3M59A 1TUDA 2IF6A 2A3LA 2RJEA 2FEIA 3NFCA 5GANg 2HQXA 2XK0A 1QVGA 1OYXA 3VUBA 1W2BS 2JS0A 1UJYA 4F0VA 1MMDA 1WXUA 1Y96A 2BZYA 1PRLC 1WPYA 2QXFA 2YLBA 1M5Q1 1NLPC 4D8KA 2LMJA 5A2QE 1W2BA 2X4JA 1ZSZB 2KT1A 4F0WA 2CZ6B 2C0IA 2KXDA 2NUPB 2E64A 4PK4A 1FYNA 2M51A 4QW2A 1KHCA 4C92F 3TCJA 4F7UE 4MZMA 1VA7A 2FPEA 1M3BA 1PSEA 8AT1B 4PJOA 4K11A 3VPIA 2F2XA 5D6XA 2J6OA 3GBQA 4RTUA 3UA6A 1TUGB 4A53A 5DY9A 1M4ZA 3I55T 4ZGEB 3OYNA 3FJPA 3QSUA 3QO3A 2LCSA 4JPBW 5LJ5h 1I07A 4BI3A 1YHQT 3HPWA 1Y0MA 1G83A 2RNAA 4PJOG 2K3AA 3NPFA 2LRJA 3V7RA 3JCMP 2MI6A 4X9CA 3EGDA 2CYZB 4XTUA 1GBQA 5CQYA 1AT1B 4FSXA 3EFRA 1VQ4T 2DTHA 4HCZA 2DO3A 4EOBA 1UGQB 1K9MC 3OW2P 3LW5E 2AHJB 4BUGA 5GMKj 3L2VA 3G4ST 1BU1A 1EX4A 2JN0A 2EW3A 2XD0A 2F5KA 4ZTJA 4M7AE 3RUXA 1NJIU 3X20B 1BI3A 3I55Q 3TQ7P 1H3HA 1RI0A 1TS9A 4PFPA 1XOVA 1V1CA 1F1BB 1M27C 4FDYA 2NLUA 3A98A 3PIPA 2MYSA 1QKWA 2QEXA 1U3OA 2ZGWA 2GQIA 4XAXB 5A0LA 3RDVA 2LJ3A 1VQNA 3UT1A 5GAMg 1AWWA 1YJ9Q 1RAFB 1UGSB 2RB6A 2DL5A 1D3BB 4FYWB 1FWZA 4EQAA 5I2MA 3RKXA 4HZBA 3OYEA 4FT4A 2CP7A 2MOXA 2YRDA 3PMTA 1I1JA 1I0CA 3LYIA 2WSCE 5GANd 1VQNT 1G3WA 3EH2A 4DEYA 3I5RA 5KYUB 2B86A 3OS1A 2W0ZA 4C0FA 1CKBA 3LWHA 3C12A 2IG0A 2CH4A 2G6FX 2CP3A 2EQIA 4M75D 1QVFA 4E7KA 5GAN5 1Q81C 4R55A 1HJDA 1O75A 2RHXA 1YITQ 2VB6A 4E47A 3JCMc 4Y91A 5FRNA 4IUQA 2DVJA 3EH1A 4LN2A 1BIBA 2COWA 2E6ZA 4C5HA 1S1NA 3QHSA 4CRIA 5KYXB 1NPRA 4L59A 3L2UA 3TREA 2JW4A 5IAYA 1Q86C 5GAOr 2PQWA 1NPPA 5GANh 1WDXA 4BE0A 2QTXA 3LGFA 4FW1A 5GAMf 1JO8A 3MEUA 1X69A 2J06A 4JRIA 4M7DE 2JS2A 2E70A 5GJVB 4LUEA 1PHTA 2DIQA 3CMAQ 4J9HA 1KSWA 1ARKA 2VYTA 2QASA 1AEYA 2BKDN 2PVDB 2RQUA 1JJ2A 1IXDA 3FIFA 3SFMA 4XU0A 4OMNA 1WGSA 1IGUA 5I22A 3A2ZA 4C8QB 4M75C 5D6WA 3U23A 4OVAA 1NLOC 4LD9K 2EJ9A 3L2RA 1UE9A 2EGCA 1AWOA 2HSEB 1BCMA 5GAOq 2EQJA 3EG2A 2ZPFB 1YJNQ 2CS7A 4JLIA 1IHWA 4J9GA 3TEEA 3NHNA 3VJPA 1VIFA 1H3ZA 1NYGA 3JCMh 1M1GA 1WHHA 3CBMA 4FYVB 1OEBA 1H641 3A1PA 1GFDA 1KC8R 4B9XA 5FW9A 3CD6Q 1JQQA 2FL7A 4AFUC 2CZ0B 2RA2A 2D8JA 3RKWA 3VKIA 1HSQA 1RACB 4F16A 2CUBA 4QQDA 3CD6T 4M7DA 1WXTA 2E12A 2FB7A 2JXBA 5C0MA 4C92B 5FU7B 4CGKA 2JOYA 1RI9A
chains in the Genus database with same CATH topology
2KXCA 3EG1A 4RTWA 1GBRA 1Z9QA 1X2KA 1N5ZA 1K9AA 2J05A 2LJ0A 4HVUA 4Z8AA 1JXMA 1AZGB 1GFCA 2GTJA 4FSSA 1M3CA 4OMOA 4CSHA 1WXBA 2SEMA 1GCPA 1W6XA 3I5SA 3VS1A 3M0QA 2DNUA 2CSQA 2BZ8A 4FQBA 1X2QA 1T3LA 2DBKA 3SEMA 2YUPA 2CREA 2ROLA 2DM1A 1OOTA 1VYVA 3M0SA 4Z88A 2K6DA 1T3SA 3H0IA 2RN8A 2E5KA 1U5SA 2VPMA 2KROA 2D1XA 2ABLA 2X3XD 4Q4NA 1B07A 1KJWA 2NUZA 5I11A 3I35A 4X1VA 1M8MA 1SPKA 2IO7A 1VYUA 4JJBA 2DRMA 4RTZA 2J6KA 2LJ1A 4Q4GX 1G2BA 2HSPA 3PE0A 4J9EA 2EGEA 2AKLA 2DL8A 2F2WA 1QKXA 2HDAA 3C0CA 4CC7A 4WCIA 2OJ2A 1K0XA 2EYZA 1EFNA 2PNIA 2EKHA 3VS2A 1JU5C 1PWTA 1SSHA 1BK2A 2D8HA 4LE9A 2VVKA 3VS6A 4HCKA 4J9BA 2EBPA 4RTYA 4Y92A 2ECZA 2EVRA 1UECA 1K0SA 2A08A 4EIKA 2C0TA 4CT3A 1GL5A 2EYWA 1QCFA 2YUQA 1Z9ZA 2KRSA 2GTOA 2JMCA 4FGIA 3VS4A 4E6RA 1H8KA 3PBCA 1OPLA 3PVLA 3QWYA 3EG0A 2YSQA 2MIOA 2I0NA 3LH5A 1SRLA 1WX6A 1SEMA 2NWMA 2GGRA 4J9IA 2L3QA 1JEGA 2EYYA 1AOJA 1QLYA 2OAWA 1M3AA 3CQTA 2K9GA 2LQWA 2KEAA 5IXBA 1RLPC 2H8HA 4M4ZA 4OLKA 2VWFA 2AKKA 3I86A 4JJCA 1WLPB 2DL7A 2FG0A 2RQWA 3H41A 1ZLMA 2JM9A 2YUOA 4ESRA 2DLPA 2A28A 3NGPA 4A63B 4RUGA 1KIKA 2V1QA 4HXJA 4HVVA 4JJDA 4AFZC 1NEGA 2JM8A 1PKSA 4RTXA 5ECAA 1LCKA 3M0PA 4Q4TA 3NMZC 1B3QA 2GBQA 2EPDA 1MUZA 3S0QA 2QDLA 1ZBJA 1WA7A 1TUDA 2IF6A 4OMPA 2FEIA 3VRZA 2L3PA 1AZEA 2K1GA 1FMKA 2JS0A 1UJYA 4F0VA 2O9SA 1WXUA 2KE9A 1YWOA 2BZYA 1PRLC 1U06A 1AWJA 2YDLA 4LUDA 3REAB 1NLPC 1NYFA 4D8KA 2LMJA 3QWXX 4ORZA 1AVZC 2KT1A 4F0WA 3O98A 2LQNA 3UF4A 2DA9A 1GCQA 2C0IA 2KXDA 4IIMA 4LNPA 3EGUA 4RTVA 3I9QA 2KGTA 2HCKA 1FYNA 1T0HA 2M51A 1T0JA 4IIOA 2JT4A 3UA7A 1OV3A 4JXBA 1X43A 2GNCA 2VKNA 1VA7A 1YCSB 1X27A 1W1FA 2FPEA 4FGEA 1M3BA 2FRYA 3VS5A 4K11A 3VPIA 2F2XA 2J6OA 3GBQA 4J9CA 4RTUA 3UA6A 3M0TA 2RQTA 2L3SA 2KR3A 3VS3A 1NG2A 1TG0A 2LCSA 1UUEA 2LZ6B 1ZX6A 1E6HA 2DL4A 3M0RA 4JPBW 2ROTA 1I07A 2FPDA 2KRNA 3SHWA 1GCQC 1Y0MA 2IO9A 4Z89A 1G83A 2RNAA 4F17A 2HBWA 4DEXA 2K3AA 1NEBA 2CT4A 3NPFA 1K76A 2D0NA 2LRJA 2FPFA 1UDLA 3M0UA 4J9DA 2A37A 3RNJA 1GBQA 2O2OA 1M30A 2AK5A 1WYXA 2ENMA 1SHGA 2YT6A 1CSKA 2LNHB 3EHQA 2RPNA 4AFSC 4HVWA 4EOBA 4JZ3A 3KFVA 1YP5A 4FGDA 3PVQA 4LJ1A 2XIVA 1UTIA 2K3BA 1BU1A 3VS0A 2EW3A 1J3TA 2P4RA 5FWBA 2KYBA 1TUCA 3A30A 1PKTA 1H3HA 2O31A 1PNJA 1QWFA 2RMOA 1XOVA 2DYBA 5IHNA 1V1CA 1M27C 1IO6A 1OPKA 4RTTA 3A98A 3KW0A 4FDYA 3O5ZA 1QKWA 1E7OA 3VPJA 1U3OA 2L0AA 1VYTA 2CUDA 1AD5A 2DL3A 4ZNXA 2GQIA 1BB9A 3PBIA 2DBMA 2KYMA 2LJ3A 2O9VA 4OMMA 1HD3A 1AWWA 5L23A 1ZUYA 3ULRB 2DL5A 2J7IA 4EQAA 2DILA 3H0HA 2FRWA 2J6FA 1H92A 2XMFA 4HZBA 1YNZA 2KT8A 5FWCA 2MOXA 2RQRA 2O88A 1I1JA 1I0CA 4GLMA 4F4MA 1WFWA 1X6GA 3ZL7C 4AG2C 4DEYA 3EHRA 2CH4W 2AZSA 3I5RA 2K79A 2B86A 5IH2A 2W0ZA 3VS7A 1GRIA 1CKBA 2AZVA 3TVTA 2CH4A 2G6FX 2DX1A 2EQIA 2KRMA 2LP5A 1HJDA 3NE0A 2PTKA 2SRCA 2CSIA 1WIEA 2PZ1A 5HCKA 2DVJA 4LN2A 3VRYA 1QWEA 1S1NA 2JTEA 2L2PA 2JW4A 1UHCA 2DRKA 4EQ8A 1AWXA 2CDTA 1SHFA 1ZUUA 2JMAA 1Y57A 1WDXA 1A0NB 2IIMA 3TSWA 4FQAA 1JO8A 2KNBB 2V1RA 2CT3A 1X69A 2J06A 5IXFA 2JS2A 5GJVB 4LUEA 1ABQA 1PHTA 2OI3A 2VOBA 4HPEA 2EGAA 4AG1C 2MCNA 2ESWA 4CC4B 1X6BA 4CC2A 1KFZA 4J9HA 1KSWA 3H0FA 1YN8A 1ARKA 1AEYA 2ED1A 2RQUA 5EC7A 2IO8A 4KRTA 4OMNA 5I22A 3A2ZA 1YWPA 4AFQC 3EG3A 2IOAA 3REBB 3U23A 2DMOA 3RBBB 4GBQA 2K7AA 2DE0X 1NLOC 2EYXA 2IOBA 4OMQA 1BBZA 2BTTA 3M1UA 2YUNA 1UE9A 2LX7A 2EGCA 1ZUKA 1AWOA 2FO0A 5GJWB 1W70A 1ABOA 4F14A 3A2YA 3EG2A 1MV0B 1K4US 1ZSGA 3JV3A 4D8DA 2W10A 1MV3A 1K1ZA 3TSZA 1RUWA 4J9GA 3NHNA 1NYGA 1UJ0A 1PRMC 1UHFA 4HZ9A 2RQVA 1OEBA 1WI7A 3UATA 2M0YA 3GT2A 4J9FA 1GFDA 2RF0A 1JXOA 4R0KA 4JZ4A 5FW9A 1JQQA 2DJQA 1RLQC 2VPSA 2C0OA 4AFUC 2BZXA 2KBTA 1CKAA 2D8JA 1E6GA 2DF6A 2K2MA 3FJ5A 5IHKA 2ED0A 1UGVA 1HSQA 4F16A 1UFFA 1SRMA 3R6NA 2CUBA 2HEQA 1UG1A 2X3WD 1WXTA 2A36A 4CC3A 4OMLA 5IHIA 3IQLA 2JXBA 2F2VA 4QT7A 3THKA 4CGKA 1NM7A 1RI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXC A;  3EG1 A;  4RTW A;  1GBR A;  1Z9Q A;  1X2K A;  1N5Z A;  1K9A A;  2J05 A;  2LJ0 A;  4HVU A;  4Z8A A;  1JXM A;  1AZG B;  1GFC A;  2GTJ A;  4FSS A;  1M3C A;  4OMO A;  4CSH A;  1WXB A;  2SEM A;  1GCP A;  1W6X A;  3I5S A;  3VS1 A;  3M0Q A;  2DNU A;  2CSQ A;  2BZ8 A;  4FQB A;  1X2Q A;  1T3L A;  2DBK A;  3SEM A;  2YUP A;  2CRE A;  2ROL A;  2DM1 A;  1OOT A;  1VYV A;  3M0S A;  4Z88 A;  2K6D A;  1T3S A;  3H0I A;  2RN8 A;  2E5K A;  1U5S A;  2VPM A;  2KRO A;  2D1X A;  2ABL A;  2X3X D;  4Q4N A;  1B07 A;  1KJW A;  2NUZ A;  5I11 A;  3I35 A;  4X1V A;  1M8M A;  1SPK A;  2IO7 A;  1VYU A;  4JJB A;  2DRM A;  4RTZ A;  2J6K A;  2LJ1 A;  4Q4G X;  1G2B A;  2HSP A;  3PE0 A;  4J9E A;  2EGE A;  2AKL A;  2DL8 A;  2F2W A;  1QKX A;  2HDA A;  3C0C A;  4CC7 A;  4WCI A;  2OJ2 A;  1K0X A;  2EYZ A;  1EFN A;  2PNI A;  2EKH A;  3VS2 A;  1JU5 C;  1PWT A;  1SSH A;  1BK2 A;  2D8H A;  4LE9 A;  2VVK A;  3VS6 A;  4HCK A;  4J9B A;  2EBP A;  4RTY A;  4Y92 A;  2ECZ A;  2EVR A;  1UEC A;  1K0S A;  2A08 A;  4EIK A;  2C0T A;  4CT3 A;  1GL5 A;  2EYW A;  1QCF A;  2YUQ A;  1Z9Z A;  2KRS A;  2GTO A;  2JMC A;  4FGI A;  3VS4 A;  4E6R A;  1H8K A;  3PBC A;  1OPL A;  3PVL A;  3QWY A;  3EG0 A;  2YSQ A;  2MIO A;  2I0N A;  3LH5 A;  1SRL A;  1WX6 A;  1SEM A;  2NWM A;  2GGR A;  4J9I A;  2L3Q A;  1JEG A;  2EYY A;  1AOJ A;  1QLY A;  2OAW A;  1M3A A;  3CQT A;  2K9G A;  2LQW A;  2KEA A;  5IXB A;  1RLP C;  2H8H A;  4M4Z A;  4OLK A;  2VWF A;  2AKK A;  3I86 A;  4JJC A;  1WLP B;  2DL7 A;  2FG0 A;  2RQW A;  3H41 A;  1ZLM A;  2JM9 A;  2YUO A;  4ESR A;  2DLP A;  2A28 A;  3NGP A;  4A63 B;  4RUG A;  1KIK A;  2V1Q A;  4HXJ A;  4HVV A;  4JJD A;  4AFZ C;  1NEG A;  2JM8 A;  1PKS A;  4RTX A;  5ECA A;  1LCK A;  3M0P A;  4Q4T A;  3NMZ C;  1B3Q A;  2GBQ A;  2EPD A;  1MUZ A;  3S0Q A;  2QDL A;  1ZBJ A;  1WA7 A;  1TUD A;  2IF6 A;  4OMP A;  2FEI A;  3VRZ A;  2L3P A;  1AZE A;  2K1G A;  1FMK A;  2JS0 A;  1UJY A;  4F0V A;  2O9S A;  1WXU A;  2KE9 A;  1YWO A;  2BZY A;  1PRL C;  1U06 A;  1AWJ A;  2YDL A;  4LUD A;  3REA B;  1NLP C;  1NYF A;  4D8K A;  2LMJ A;  3QWX X;  4ORZ A;  1AVZ C;  2KT1 A;  4F0W A;  3O98 A;  2LQN A;  3UF4 A;  2DA9 A;  1GCQ A;  2C0I A;  2KXD A;  4IIM A;  4LNP A;  3EGU A;  4RTV A;  3I9Q A;  2KGT A;  2HCK A;  1FYN A;  1T0H A;  2M51 A;  1T0J A;  4IIO A;  2JT4 A;  3UA7 A;  1OV3 A;  4JXB A;  1X43 A;  2GNC A;  2VKN A;  1VA7 A;  1YCS B;  1X27 A;  1W1F A;  2FPE A;  4FGE A;  1M3B A;  2FRY A;  3VS5 A;  4K11 A;  3VPI A;  2F2X A;  2J6O A;  3GBQ A;  4J9C A;  4RTU A;  3UA6 A;  3M0T A;  2RQT A;  2L3S A;  2KR3 A;  3VS3 A;  1NG2 A;  1TG0 A;  2LCS A;  1UUE A;  2LZ6 B;  1ZX6 A;  1E6H A;  2DL4 A;  3M0R A;  4JPB W;  2ROT A;  1I07 A;  2FPD A;  2KRN A;  3SHW A;  1GCQ C;  1Y0M A;  2IO9 A;  4Z89 A;  1G83 A;  2RNA A;  4F17 A;  2HBW A;  4DEX A;  2K3A A;  1NEB A;  2CT4 A;  3NPF A;  1K76 A;  2D0N A;  2LRJ A;  2FPF A;  1UDL A;  3M0U A;  4J9D A;  2A37 A;  3RNJ A;  1GBQ A;  2O2O A;  1M30 A;  2AK5 A;  1WYX A;  2ENM A;  1SHG A;  2YT6 A;  1CSK A;  2LNH B;  3EHQ A;  2RPN A;  4AFS C;  4HVW A;  4EOB A;  4JZ3 A;  3KFV A;  1YP5 A;  4FGD A;  3PVQ A;  4LJ1 A;  2XIV A;  1UTI A;  2K3B A;  1BU1 A;  3VS0 A;  2EW3 A;  1J3T A;  2P4R A;  5FWB A;  2KYB A;  1TUC A;  3A30 A;  1PKT A;  1H3H A;  2O31 A;  1PNJ A;  1QWF A;  2RMO A;  1XOV A;  2DYB A;  5IHN A;  1V1C A;  1M27 C;  1IO6 A;  1OPK A;  4RTT A;  3A98 A;  3KW0 A;  4FDY A;  3O5Z A;  1QKW A;  1E7O A;  3VPJ A;  1U3O A;  2L0A A;  1VYT A;  2CUD A;  1AD5 A;  2DL3 A;  4ZNX A;  2GQI A;  1BB9 A;  3PBI A;  2DBM A;  2KYM A;  2LJ3 A;  2O9V A;  4OMM A;  1HD3 A;  1AWW A;  5L23 A;  1ZUY A;  3ULR B;  2DL5 A;  2J7I A;  4EQA A;  2DIL A;  3H0H A;  2FRW A;  2J6F A;  1H92 A;  2XMF A;  4HZB A;  1YNZ A;  2KT8 A;  5FWC A;  2MOX A;  2RQR A;  2O88 A;  1I1J A;  1I0C A;  4GLM A;  4F4M A;  1WFW A;  1X6G A;  3ZL7 C;  4AG2 C;  4DEY A;  3EHR A;  2CH4 W;  2AZS A;  3I5R A;  2K79 A;  2B86 A;  5IH2 A;  2W0Z A;  3VS7 A;  1GRI A;  1CKB A;  2AZV A;  3TVT A;  2CH4 A;  2G6F X;  2DX1 A;  2EQI A;  2KRM A;  2LP5 A;  1HJD A;  3NE0 A;  2PTK A;  2SRC A;  2CSI A;  1WIE A;  2PZ1 A;  5HCK A;  2DVJ A;  4LN2 A;  3VRY A;  1QWE A;  1S1N A;  2JTE A;  2L2P A;  2JW4 A;  1UHC A;  2DRK A;  4EQ8 A;  1AWX A;  2CDT A;  1SHF A;  1ZUU A;  2JMA A;  1Y57 A;  1WDX A;  1A0N B;  2IIM A;  3TSW A;  4FQA A;  1JO8 A;  2KNB B;  2V1R A;  2CT3 A;  1X69 A;  2J06 A;  5IXF A;  2JS2 A;  5GJV B;  4LUE A;  1ABQ A;  1PHT A;  2OI3 A;  2VOB A;  4HPE A;  2EGA A;  4AG1 C;  2MCN A;  2ESW A;  4CC4 B;  1X6B A;  4CC2 A;  1KFZ A;  4J9H A;  1KSW A;  3H0F A;  1YN8 A;  1ARK A;  1AEY A;  2ED1 A;  2RQU A;  5EC7 A;  2IO8 A;  4KRT A;  4OMN A;  5I22 A;  3A2Z A;  1YWP A;  4AFQ C;  3EG3 A;  2IOA A;  3REB B;  3U23 A;  2DMO A;  3RBB B;  4GBQ A;  2K7A A;  2DE0 X;  1NLO C;  2EYX A;  2IOB A;  4OMQ A;  1BBZ A;  2BTT A;  3M1U A;  2YUN A;  1UE9 A;  2LX7 A;  2EGC A;  1ZUK A;  1AWO A;  2FO0 A;  5GJW B;  1W70 A;  1ABO A;  4F14 A;  3A2Y A;  3EG2 A;  1MV0 B;  1K4U S;  1ZSG A;  3JV3 A;  4D8D A;  2W10 A;  1MV3 A;  1K1Z A;  3TSZ A;  1RUW A;  4J9G A;  3NHN A;  1NYG A;  1UJ0 A;  1PRM C;  1UHF A;  4HZ9 A;  2RQV A;  1OEB A;  1WI7 A;  3UAT A;  2M0Y A;  3GT2 A;  4J9F A;  1GFD A;  2RF0 A;  1JXO A;  4R0K A;  4JZ4 A;  5FW9 A;  1JQQ A;  2DJQ A;  1RLQ C;  2VPS A;  2C0O A;  4AFU C;  2BZX A;  2KBT A;  1CKA A;  2D8J A;  1E6G A;  2DF6 A;  2K2M A;  3FJ5 A;  5IHK A;  2ED0 A;  1UGV A;  1HSQ A;  4F16 A;  1UFF A;  1SRM A;  3R6N A;  2CUB A;  2HEQ A;  1UG1 A;  2X3W D;  1WXT A;  2A36 A;  4CC3 A;  4OML A;  5IHI A;  3IQL A;  2JXB A;  2F2V A;  4QT7 A;  3THK A;  4CGK A;  1NM7 A;  1RI9 A; 
#chains in the Genus database with same CATH topology
 1QVG S;  5LJ3 h;  2QEX T;  1K73 R;  2DZ9 A;  3SB2 A;  1X2K A;  4MMK A;  3CC4 T;  4CI0 C;  1JXM A;  3CCQ Q;  1IRX A;  3CXC A;  2DXT A;  2PVG B;  4D6W A;  2FZK B;  4OMO A;  5CVI A;  4ME7 A;  4JS4 A;  3G71 A;  2SEM A;  3HL8 A;  1GCP A;  4KH1 B;  3OB9 A;  3MP1 A;  4M78 A;  1VOM A;  4EMH A;  2DBK A;  4PJO C;  4FIB A;  1M2O A;  1Q81 R;  1OOT A;  2QQS A;  2VAS A;  2MWP A;  2LCL A;  3M0S A;  1KD1 C;  1X6O A;  5KYY A;  3MKD A;  1VQP A;  4RCC A;  3F70 A;  4RG2 A;  4Q4N A;  1KJW A;  1P92 A;  1M8M A;  4N0A A;  4DOV A;  4M78 G;  1SPK A;  3SWN B;  1LJO A;  2HQE A;  2MK5 A;  2HL5 C;  2O01 E;  3H9N A;  4M78 C;  3DB4 A;  3CCL T;  1YJW T;  1ZBX A;  2PNI A;  3QJ6 A;  1SSH A;  1BK2 A;  2D8H A;  4LE9 A;  1YI2 T;  3CPF A;  4E7H A;  3CCE A;  2CZ7 B;  4LD6 A;  3VS6 A;  1M1K C;  4HCK A;  4J9B A;  4RTY A;  4Y92 A;  2ECZ A;  2CZ1 B;  1K0S A;  4A4E A;  1G3T A;  1I8F A;  2EYW A;  2D0Q B;  2DPP B;  4MDW A;  4LDY A;  5HK3 A;  3G4S A;  4FYY B;  3JCM f;  3EG9 B;  3HSB A;  2GTO A;  2QA4 Q;  2DFU A;  5CIU A;  1VQ5 Q;  4M75 E;  3EG0 A;  1OUL A;  2I0N A;  1VIE A;  3M55 A;  4J9I A;  1QLY A;  3CQT A;  2K9G A;  2KEA A;  3OBY A;  5IXB A;  2RK1 A;  2COY A;  4C5I A;  4FU6 A;  1RAI B;  3MP6 A;  2E3H A;  2XDP A;  2DD5 A;  3E19 A;  3H41 A;  1ZLM A;  1TTH B;  2X35 A;  2PUK B;  2VGN A;  1XNI A;  4EMK C;  2V1Q A;  2XIC A;  4HVV A;  4JJD A;  4AFZ C;  4HCC A;  1VQ9 A;  5ECA A;  2PU9 B;  1EZZ B;  1LCK A;  3M0P A;  4C5G A;  1B3Q A;  3HP9 A;  2HD0 A;  2QDY B;  1VQO T;  3DB3 A;  1FMK A;  2KE9 A;  4ZGJ B;  2CP2 A;  1U06 A;  2MAM A;  1OX8 A;  4LUD A;  1Y71 A;  1N8R R;  1NYF A;  2IPO B;  2HKQ B;  4F7U A;  1BI2 A;  1I5O B;  4ORZ A;  3I56 Q;  3EGX A;  2LQN A;  4M77 C;  3UF4 A;  3CCL Q;  3FC3 A;  1YJW Q;  4LNP A;  3EGU A;  3CCJ T;  1TOV A;  3CC2 T;  2HCK A;  3QII A;  4IIO A;  1T0J A;  2JT4 A;  3UA7 A;  3ER0 A;  4HA8 A;  1WJQ A;  5KYW B;  1X43 A;  4EMK A;  2JNG A;  5EG2 A;  3GIB A;  2QQ9 A;  8ATC B;  3VS5 A;  2NUT A;  5KYX A;  4EMK B;  3GPL A;  1Q81 U;  1TSF A;  3S3O A;  4M7A F;  3JCM W;  1VQK Q;  1UUE A;  3VU3 C;  1KQ1 A;  1SSF A;  2DL4 A;  5KE2 A;  3CPW S;  3OSV A;  3J80 E;  3UPU A;  3V8J A;  4DA4 A;  3SHW A;  1QVG P;  3CC7 A;  3CCR T;  2RJC A;  3HRT A;  4F17 A;  4DEX A;  4PJJ A;  4B9W A;  2ZPE B;  1UEB A;  3PTA A;  3OYK A;  2JVV A;  3RNJ A;  1UDL A;  3M0U A;  2V26 A;  2O2O A;  2CP5 A;  3FDR A;  1M30 A;  2K5I A;  4XU1 A;  2P84 A;  1SHG A;  2GFA A;  1CSK A;  4M7A A;  2LNH B;  3EHQ A;  4AFS C;  4HVW A;  4JZ3 A;  3KFV A;  1SF9 A;  1D3B A;  4J7I A;  4LJ1 A;  2V8K A;  1BYM A;  2XIV A;  1Q82 U;  2XHC A;  1TUC A;  4MZT A;  1PKT A;  5HY6 A;  3A30 A;  4L5G A;  2XI9 A;  3S3M A;  3A8H B;  5IHN A;  1OPK A;  4M7A G;  5M9O A;  3KW0 A;  3OYF A;  1E7O A;  3RMS A;  1VYT A;  2CUD A;  1AD5 A;  2DL3 A;  4ZNX A;  3MP8 A;  3SWN C;  2DBM A;  4BB7 A;  4OMM A;  5CO7 A;  5LJ3 f;  4PJO E;  5L23 A;  1ZUY A;  3ULR B;  1NE8 A;  3FLG A;  2YHT A;  3M58 A;  1WHL A;  1Q95 G;  2EQM A;  2J7I A;  3LX7 A;  2NYS A;  1IB8 A;  2FRW A;  2J6F A;  5D6Y A;  3CD6 A;  1RAB B;  3V8K A;  1S72 T;  2QTV A;  1G3S A;  3CCE T;  1Q7Y C;  2RHZ A;  3M53 A;  2QGF B;  2WSE E;  6AT1 B;  2D6F A;  3HTR A;  5GAN 3;  5I2S A;  3CBP A;  2QGG A;  1VQ6 T;  4RKU E;  4C8Q A;  3L2W A;  1YCY A;  5CKF A;  1YHQ Q;  1MHN A;  3VS7 A;  1KQS A;  5CKE A;  3FB9 A;  1VQP Q;  1IRE B;  4PLL A;  3BDU A;  4MML A;  2LP5 A;  3A5Z B;  2MPX C;  5CKB A;  1K8A R;  3NE0 A;  3WVE B;  3SWN A;  2BUD A;  3VRY A;  2DRK A;  4E7Z A;  3VUZ A;  1NBE B;  1ZUU A;  2K5F A;  3QZ9 B;  4NOY A;  5KYY B;  1A0N B;  1VQK T;  2GFU A;  1RAE B;  3OW2 A;  3I55 A;  5J39 A;  1PD1 A;  1MND A;  3C94 A;  4M77 A;  3GLX A;  1ABQ A;  4PJO F;  2NUT B;  4J30 A;  5GAN e;  4QVD A;  3C95 A;  4IUP A;  1JB0 E;  4JS5 A;  3OMG A;  4CC4 B;  4GY5 A;  3V7S A;  1M1K U;  1KFZ A;  4N4G A;  1YN8 A;  3QPH A;  2K3X A;  2ED1 A;  4E7L A;  4JJN K;  1FMW A;  3ASK A;  3M9Q A;  2IO8 A;  3FEO A;  4KRT A;  3I56 T;  4AFQ C;  3REB B;  2DMO A;  2K7A A;  1D1B A;  2EYX A;  3T9N A;  2IOB A;  1BBZ A;  3CCM Q;  2M9U A;  3BFM A;  3NTH A;  5LJ5 g;  2FO0 A;  2AIR B;  3A2Y A;  2EAY A;  1K4U S;  1ZSG A;  1K1Z A;  4UC4 A;  4J8O A;  4F7U F;  1UJ0 A;  1PRM C;  1UHF A;  4HZ9 A;  1FXX A;  3UAT A;  3GT2 A;  5GMK l;  1JXO A;  2RJD A;  2DAQ A;  4PJM A;  1RLQ C;  2C0O A;  5LJ3 d;  5GMK i;  2OTJ Q;  1MGQ A;  2QQA A;  3JCM V;  1JRI A;  1QVF P;  2K2V A;  2DF6 A;  2RD1 A;  2K5L A;  5GAN 6;  2ED0 A;  2B8A A;  2DIG A;  3ME9 A;  1UFF A;  2HEQ A;  1UG1 A;  2H3E B;  3N5B B;  3MEV A;  2A36 A;  4A4F A;  1G5V A;  2F2V A;  2OTJ A;  3THK A;  2DEU A;  1PG5 B;  4C0Z A;  1VQ7 A;  3E2U A;  2X4X A;  2CP0 A;  1N5Z A;  1K8A U;  3MEA A;  1D09 B;  2LJ0 A;  4HVU A;  4Z8A A;  1GFC A;  3EGD B;  2F5T X;  1WXB A;  3JB9 F;  1W6X A;  3M0Q A;  3X25 B;  4BE1 A;  4V2S A;  2DNU A;  2BZ8 A;  2KY9 A;  4FQB A;  1X2Q A;  1T3L A;  1UGR B;  2ROL A;  2DD4 A;  4HT8 A;  3CCJ Q;  2ATC B;  5C6S A;  1QVP A;  3QG1 A;  5GAN 4;  2RI2 A;  2HQH A;  2X3X D;  3ZEH A;  5I11 A;  4FT2 A;  2BIV A;  4X1V A;  4XTV A;  3S3N A;  3PT9 A;  1VQO Q;  2IO7 A;  4LDW A;  3OYD A;  5J3B A;  2I2L A;  3UWN A;  4JJB A;  4FCY A;  1S72 A;  4RTZ A;  1VQP T;  1G2B A;  2XKO C;  3PIO A;  4KUI A;  2DVE A;  5CCA A;  3OW2 S;  4J9E A;  2GQV A;  3OBW A;  2F2W A;  2IVW A;  1QKX A;  2HDA A;  4CC7 A;  4BDY A;  4BD3 A;  4WCI A;  5LJ3 e;  2VC8 A;  1K0X A;  3EFO B;  2WAC A;  3LGL A;  2EKH A;  3GNF B;  2HZY A;  3CXC P;  4KT0 E;  3OYM A;  1KC8 C;  1QP2 A;  2FHD A;  3JSC A;  3CCQ T;  4QVZ A;  1C1A A;  3JCM b;  2R57 A;  5GAO p;  1K8A C;  3JB9 G;  1N27 A;  1HYO A;  1LVK A;  4II1 A;  4XK8 E;  2EJG A;  1R8O B;  4FGI A;  2QK0 A;  3OSS C;  1H8K A;  4C92 A;  4C8Q F;  3PVL A;  3VYG A;  3L42 A;  5KH6 A;  2X4Y A;  3LH5 A;  5KE3 A;  2PVO B;  1PCX A;  2QA4 T;  4J83 A;  2GGR A;  1Q86 U;  3L2Q A;  2EYY A;  4EPC A;  2R5A A;  4PKC C;  2OAW A;  4BAC A;  1M3A A;  3RR6 A;  2DET A;  2AT1 B;  4HFK A;  2VWF A;  4E7S A;  2RHI A;  3I86 A;  4JJC A;  4E2F B;  3E1S A;  2FG0 A;  2RM4 A;  1Y7X A;  2RQW A;  2VXF A;  2EKO A;  3WXM B;  4DBF A;  2JM9 A;  2YUO A;  2R58 A;  4KUL A;  3ZFJ A;  2KQW A;  1C0M A;  4RUG A;  3ZBD A;  1KIK A;  4QQG A;  1LPL A;  5CAI A;  2OTL A;  3I56 A;  1MUZ A;  3CCS T;  3PGG A;  1X01 A;  2QDL A;  1WA7 A;  1VQ7 Q;  2ZAE A;  4OMP A;  3D7S B;  3OYY A;  3A8O B;  1M1F A;  4C8Q C;  2L3P A;  1VQL T;  2K1G A;  3HRS A;  2O9S A;  1KK7 A;  2F69 A;  1AWJ A;  2YDL A;  3REA B;  3CC4 A;  4DBR A;  1YJ9 A;  2HAX A;  1TU0 B;  3QWX X;  4KGZ B;  3O98 A;  2DA9 A;  4IIM A;  3G71 T;  2Y4X A;  3FRN A;  5FRM A;  1QCO A;  2KGT A;  1T0H A;  2Y90 A;  3AHU A;  1FMV A;  1XTD A;  1OU9 A;  1FX7 A;  2HBP A;  1D0Y A;  1QVF S;  2LT4 A;  2COZ A;  1RAA B;  4PJO B;  5HKC A;  2KSS A;  4QKU A;  1VQK A;  3M0T A;  2RQT A;  2L3S A;  4LDV A;  4QQ6 A;  1IHV A;  2YWW A;  1IGQ A;  3QBY A;  1I5L A;  3VS3 A;  5FRO A;  2YXY A;  2OTL T;  2NUP A;  3L1A A;  2YRC A;  4DQ2 A;  3OYC A;  1D0Z A;  3EAE A;  4Z89 A;  2RHY A;  1JJ2 P;  2QA4 A;  2A7Y A;  5FU7 C;  4IUR A;  5LJ5 d;  2F1L A;  1X75 C;  2OX7 A;  3CCM T;  1YIT T;  2ZPI B;  4GLK A;  2AK5 A;  1WYX A;  3DKM A;  3C4S A;  1D1A A;  4FYX B;  3VV0 A;  2ENM A;  2RPN A;  3PFS A;  5GAN 2;  4FGD A;  2QQR A;  4NS5 A;  3PVQ A;  2LDM A;  3RES A;  5KYU A;  3NTK A;  4XTW A;  2P4R A;  3H8Z A;  1O9S A;  1TWB A;  1BKB A;  2E65 A;  1QP3 A;  5AYF A;  3OS5 A;  2DYB A;  4OP0 A;  4X9D A;  7AT1 B;  3CCV Q;  2RI5 A;  4NL2 A;  4C0G A;  3JCM J;  4M75 B;  1VQL A;  2L0A A;  1RAH B;  1OZ3 A;  3CCU A;  3M4Y A;  2KYM A;  2O9V A;  2KVQ G;  3OS2 A;  4IUV A;  2P0K A;  4KUD K;  4PNO A;  2DIL A;  3H0H A;  3KBG A;  1MMN A;  1HXD A;  2V8I A;  2PUO B;  1D1C A;  4M77 F;  1WQ7 A;  5FWC A;  2RQR A;  2EYQ A;  2OTJ T;  1WFW A;  1YBY A;  3OYB A;  3ZL7 C;  1NJI C;  2RH2 A;  3EHR A;  3QYG B;  2K79 A;  1GRI A;  3P8D A;  1TXQ A;  3A8L B;  2M0O A;  2DX1 A;  1KG1 A;  2E5Q A;  3HKS A;  1B7T A;  2PTK A;  2SRC A;  2JJ9 A;  3OYH A;  1WIE A;  2PZ1 A;  5HCK A;  2EJF A;  1NZ9 A;  1LNX A;  2E3I A;  2L89 A;  4M75 F;  4RCB A;  1QCN A;  2JTE A;  4C8Q E;  1UHC A;  4EQ8 A;  2L3R A;  2CDT A;  1SHF A;  2P4T A;  4OB3 B;  2LX9 A;  1OI1 A;  2Z0W A;  2IIM A;  3TSW A;  2D9T A;  3QDR B;  2KNB B;  4OB0 B;  2V1R A;  1OZ2 A;  4HCB A;  1YIJ A;  3MCA B;  3GOX A;  4M7D C;  2OI3 A;  2DZC A;  3CCV T;  2H3J A;  2VOB A;  4HPE A;  3SDZ A;  4AG1 C;  5GAO m;  2LTO A;  3QXE B;  1U8R A;  4BY6 C;  2DYI A;  4OF1 A;  1EIF A;  1KD1 R;  2LQ8 A;  3TU4 K;  4P5N A;  3QYH B;  4HKE A;  1YJ9 T;  4M7D D;  5EC7 A;  1Q86 R;  4E7I A;  2IOA A;  3EG3 A;  3RBB B;  4GBQ A;  1VQO A;  2DE0 X;  4M77 B;  1M2V A;  1Y96 B;  2BTT A;  2DKG A;  2LX7 A;  1ZSZ C;  1ZUK A;  2E41 A;  4KH0 B;  1JBM A;  5GJW B;  1W70 A;  4JUV A;  4C8Q D;  2RJF A;  3CCU Q;  2XG8 D;  2WP7 A;  2E4H A;  3BW1 A;  5FU6 C;  2M16 A;  5CQX A;  1YHQ A;  1MV3 A;  1U1T A;  2K4Y A;  4JRQ A;  2EWN A;  2MWO A;  4BE2 A;  1RUW A;  5CK9 A;  3GP8 A;  1ZQ1 A;  2OTL Q;  3M4G A;  1HK9 A;  3QUI A;  2RQV A;  1WI7 A;  1YI2 A;  5LL6 S;  2RF0 A;  4JZ4 A;  4PJL A;  3OYA A;  9ATC B;  2JTM A;  4AT1 B;  3JCM d;  2BZX A;  1VQ8 T;  3CCE Q;  1K73 C;  1E6G A;  1UGP B;  5IHK A;  2OAU A;  2QI2 A;  5GAN 8;  1AHJ B;  2K57 A;  2X3W D;  3CPW A;  2LC4 A;  3LLR A;  4DBQ A;  4ZN3 A;  4OML A;  3OYI A;  3IQL A;  3VYH B;  4QT7 A;  2O4X A;  1N9R A;  3RMQ A;  1GXI E;  3CC2 Q;  1BI1 A;  1RAG B;  2KXC A;  1VQM Q;  3CMA T;  5GAO n;  2JUF A;  3EG1 A;  1MNE A;  4ZTF A;  1GBR A;  1YJW A;  3CCL A;  5J26 A;  3OMC A;  2CKK A;  2J05 A;  2DEQ A;  2LCC A;  2VXE A;  4J5Y A;  1SKU B;  3PNW C;  1AZG B;  3CME A;  4FSS A;  1BCO A;  4JUR A;  1V76 A;  1D0X A;  1VQ7 T;  4CSH A;  3CCR A;  3I5S A;  4R56 A;  3CCS Q;  1WHJ A;  2DXC A;  2XID A;  5GAM j;  2DTO A;  4DBH A;  3NTI A;  3P8H A;  4C0D B;  4MDX A;  2YUP A;  2CRE A;  3G1J A;  4Z88 A;  2K6D A;  5L8R E;  5IT9 E;  2DXB A;  2RN8 A;  2E5K A;  3JRZ A;  1N9S A;  5I21 A;  1B07 A;  1W2B P;  2G3R A;  1M90 U;  1M90 C;  3PMI A;  3INZ A;  4JRK A;  1NJI R;  3O8V A;  1S72 Q;  3OY9 A;  3JB9 H;  2DXU A;  1VYU A;  4C92 C;  2DRM A;  2J6K A;  3OYL A;  3EG9 A;  3JCM e;  4O5V A;  1OQK A;  3S6W A;  4OMF B;  4FM4 B;  4RG8 A;  2AKL A;  3AT1 B;  2XDD A;  3C0C A;  4OB2 B;  1MMG A;  2OJ2 A;  5A0D A;  2M02 A;  1VUB A;  2O4X B;  1EFN A;  4A54 A;  3LWI A;  3CME T;  1YIT A;  5KCH A;  2C06 A;  1BIA A;  2EIF A;  3CBO A;  2VVK A;  4J7F A;  2EBP A;  1R77 A;  1UEC A;  2A08 A;  1RL2 A;  4EIK A;  4KGX B;  3OYG A;  1GL5 A;  4CT3 A;  1N8R U;  3E9F A;  4Y28 E;  3X24 B;  4M7A B;  4ANJ A;  1YI2 Q;  2KRS A;  2HMA A;  1C6V X;  2QAZ A;  4IUT A;  2JMC A;  1M9S A;  4E6R A;  1LOJ A;  4M7D G;  1OU8 A;  3QWY A;  2MIO A;  1TH7 A;  3M57 A;  1SRL A;  1WX6 A;  1VQ6 A;  2KK4 A;  5KYW A;  1AOJ A;  3URG A;  4JLG A;  4PFO A;  4M7A D;  1RLP C;  2H8H A;  4M4Z A;  4OLK A;  3CCU T;  1WLP B;  5IN1 A;  3R6O A;  1N6A A;  2QG9 B;  3EGX B;  4LDX A;  4M78 B;  3CCR Q;  2DLP A;  2A28 A;  3A8G B;  2RK2 A;  3NGP A;  4A63 B;  4XQ3 A;  4HXJ A;  2JM8 A;  4BI4 A;  2JZ2 A;  2ZZD A;  4BDZ A;  1M1K R;  4Q4T A;  1VQ4 Q;  2GBQ A;  2EPD A;  4NL3 A;  3X28 B;  3S0Q A;  2E1H A;  1ZBJ A;  4M7A C;  3CC2 A;  3OYJ A;  1U1S A;  3VRZ A;  1AZE A;  1Q7Y U;  1YWO A;  2DER A;  2QEX Q;  2E10 A;  4C5E A;  1VQ9 T;  3CME Q;  1AVZ C;  4OGC A;  3G6E T;  2YLC A;  1YFN A;  1GCQ A;  4RTV A;  3I9Q A;  1RAD B;  4XU2 A;  4EDU A;  1DJ7 B;  2Y4Y A;  1OV3 A;  3EFS A;  1PD0 A;  4JXB A;  2GNC A;  2VKN A;  2XU8 A;  1YCS B;  1ACM B;  1X27 A;  1W1F A;  4FGE A;  4PFZ A;  4M78 D;  1K73 U;  2P0P A;  2FRY A;  1WHK A;  2QYZ A;  1PM3 A;  4KGV B;  4J9C A;  1KQS P;  4M77 D;  5KCO A;  1YJN A;  4XTY A;  4JDS A;  4EMG A;  3OA6 A;  2R5M A;  2KR3 A;  1NG2 A;  1TG0 A;  2LZ6 B;  1ZX6 A;  1E6H A;  2X51 A;  3M0R A;  2ROT A;  1ZA1 B;  2FPD A;  4OGE A;  2KRN A;  2P0Q A;  1VQ4 A;  3CCS A;  1GCQ C;  4N4I A;  2IO9 A;  1ZA2 B;  3P8B B;  3KXT A;  2HBW A;  2RO0 A;  5A0G A;  5GAM h;  1VQ9 Q;  3EBQ A;  3GNG A;  5AT1 B;  2L5Q A;  2ZCF B;  1NEB A;  2CT4 A;  1K76 A;  5DLQ E;  2D0N A;  4A4G A;  2FPF A;  5GAN f;  4J9D A;  2A37 A;  4ZGD B;  3CC7 Q;  2LT1 A;  1KQS S;  2YT6 A;  2ZPB B;  2V8J A;  4Z02 A;  4M7D F;  5LJ3 j;  1YP5 A;  2JTF A;  1QQJ A;  3MET A;  1UTI A;  3G71 Q;  2K3B A;  5FU6 B;  3VS0 A;  1J3T A;  5FWB A;  2KYB A;  4ELZ C;  2LVM A;  1R0B G;  3MHX A;  2E6N A;  2O31 A;  5CKD A;  1PNJ A;  1QWF A;  2MMP A;  2RMO A;  3BY7 A;  4N4H A;  2GCX A;  1VQ8 Q;  1IO6 A;  4RTT A;  4ZN1 A;  2RHU A;  3O5Z A;  1I81 A;  3CC4 Q;  3DLM A;  3VPJ A;  4PLI A;  3M54 A;  3QKJ A;  1WNL A;  1BB9 A;  3PBI A;  1ZHI A;  4FW2 A;  1HD3 A;  4F7U G;  3CCJ A;  3HRU A;  1SG5 A;  1W4S A;  5GAM d;  1YIJ T;  3J7A F;  1H92 A;  2XMF A;  1YNZ A;  2KT8 A;  4WF2 A;  2O88 A;  4GLM A;  3SD4 A;  5LJ5 f;  4F4M A;  1X6G A;  1M2V B;  4F7U B;  1QMC A;  1M90 R;  4AG2 C;  3RER A;  2CH4 W;  2AZS A;  5IH2 A;  4ELY C;  3JB9 J;  4IUU A;  2AZV A;  3TVT A;  1Q82 R;  3DLL A;  2KRM A;  4BY6 B;  4C0D C;  2A0F B;  1IZ6 A;  1G8X A;  2CSI A;  1VQN Q;  2BE9 B;  2KMT A;  1QWE A;  1V29 B;  2L2P A;  1WHM A;  1AWX A;  1KQ2 A;  3G7Z A;  2DJZ A;  2KDS A;  2JMA A;  1Y57 A;  1WZO A;  2K3Y A;  3CCQ A;  2YRV A;  1VQ5 T;  1BI0 A;  4TVR A;  4FQA A;  4AMC A;  4ATO A;  2CT3 A;  3KUF A;  4XU3 A;  5IXF A;  3CXC S;  2LRQ A;  3MEW A;  2VGM A;  2EQK A;  4J32 A;  3G6E A;  2XDB A;  4QVC A;  2ZPG B;  2EGA A;  2EFI A;  3BE3 A;  2MCN A;  2ESW A;  1VQL Q;  4CC2 A;  1X6B A;  1KC8 U;  1VQ5 A;  3JB9 I;  4E7J A;  1K9M R;  4M77 E;  5D7U A;  3H0F A;  1WHG A;  4PJO D;  2WSF E;  1Q82 C;  1WJS A;  4HT9 A;  2FZC B;  3HHT B;  2HL3 A;  1YWP A;  4F04 B;  1K9M U;  3JB9 D;  4C92 D;  1YJN T;  5GMK e;  3JAM E;  4OMQ A;  3M1U A;  2YUN A;  4XTZ A;  2VUB A;  4M78 F;  4XTX A;  2ZPH B;  4A4K A;  3E9G A;  1ABO A;  4M75 G;  4F14 A;  1MV0 B;  4KBM B;  3JV3 A;  3MPU B;  4OB1 B;  4D8D A;  2W10 A;  1Q7Y R;  3TSZ A;  3OS0 A;  4HFL A;  4MZP A;  2VV5 A;  1VQ8 A;  1MMA A;  2DTI A;  4J6X A;  4O6J A;  4PJN A;  4C8Q G;  5LJ3 g;  4HFF A;  2M0Y A;  3RIR A;  4J9F A;  2GF7 A;  4R0K A;  2HKN A;  2DJQ A;  2VPS A;  3CCV A;  4M75 A;  3CC7 T;  1N8R C;  3HFN A;  2KBT A;  1CKA A;  3QJY A;  4PL6 A;  2K2M A;  3FJ5 A;  3RKY A;  1VQM A;  1UGV A;  1SRM A;  3R6N A;  4YTL A;  4C92 G;  1M8V A;  3HFO A;  4CC3 A;  3CEY A;  5IHI A;  1R0C B;  3L2Z A;  3EFO A;  2LNV A;  1I4K 1;  1NM7 A;  3MJX A;  1KHI A;  4B6M A;  1B34 A;  4RTW A;  4LDU A;  4M78 E;  1Z9Q A;  1K9A A;  3MO8 A;  2GTJ A;  2FYK A;  4M77 G;  1M3C A;  4FL6 A;  5KYN A;  1OX9 A;  2DK3 A;  3Q1J A;  4M7D B;  3VS1 A;  3A8M B;  2CGH A;  2CSQ A;  1Y07 A;  3J81 E;  3SEM A;  2DM1 A;  3CCM A;  1VYV A;  5LJ5 j;  5GAN j;  1T3S A;  3G6E Q;  3H0I A;  1U5S A;  1XQH A;  2KRO A;  5GMK m;  1JJ2 S;  2VPM A;  5GAN 7;  2D1X A;  2ABL A;  1XJW B;  5HK0 A;  2NUZ A;  4RMO A;  4X34 A;  3I35 A;  3V8L A;  2L8D A;  1PSF A;  5FLX E;  2LJ1 A;  4Q4G X;  2QQB A;  3QDF A;  4J6W A;  2LQK A;  2HSP A;  4A4H A;  3PE0 A;  3JCM X;  2EGE A;  2DL8 A;  2CP6 A;  4BI8 B;  2EYZ A;  3CMA A;  1WJR A;  2HNI A;  1UB4 A;  3VS2 A;  1JU5 C;  1PWT A;  3M56 A;  4J6Y A;  3UDC A;  3JCM g;  3X26 B;  1QW1 A;  2EVR A;  2KAF A;  2C0T A;  1YIJ Q;  1QCF A;  1PC0 A;  5DM7 R;  4IKF A;  2YUQ A;  5LJ5 e;  1Z9Z A;  1VQM T;  4LXC A;  5GAO l;  4N0A C;  3H6Z A;  3VS4 A;  5GAM e;  3WVD B;  4Q5W A;  3G4S Q;  3CPW P;  1OPL A;  3PBC A;  2YSQ A;  3GF5 A;  2X9H A;  4DOW A;  1VQ6 Q;  3OQ5 A;  5CR2 A;  1SEM A;  3M5A A;  2NWM A;  5DLO A;  1JEG A;  2FVU A;  2L3Q A;  4VUB A;  2KI7 A;  4C92 E;  4WTO B;  2LQW A;  2FZG B;  1G3Y A;  2AKK A;  3JCM Q;  3LH0 A;  2DL7 A;  4JRP A;  3QZ5 B;  1ZSZ A;  4ESR A;  1WQW A;  1KD1 U;  2RI3 A;  2MF2 A;  2EQU A;  5GMK h;  5CKH A;  3BDL A;  1NEG A;  2BE7 D;  4L6V 5;  1PKS A;  4RTX A;  3NMZ C;  2X4W A;  2M1H A;  1B34 B;  3V7C A;  3M59 A;  1TUD A;  2IF6 A;  2A3L A;  2RJE A;  2FEI A;  3NFC A;  5GAN g;  2HQX A;  2XK0 A;  1QVG A;  1OYX A;  3VUB A;  1W2B S;  2JS0 A;  1UJY A;  4F0V A;  1MMD A;  1WXU A;  1Y96 A;  2BZY A;  1PRL C;  1WPY A;  2QXF A;  2YLB A;  1M5Q 1;  1NLP C;  4D8K A;  2LMJ A;  5A2Q E;  1W2B A;  2X4J A;  1ZSZ B;  2KT1 A;  4F0W A;  2CZ6 B;  2C0I A;  2KXD A;  2NUP B;  2E64 A;  4PK4 A;  1FYN A;  2M51 A;  4QW2 A;  1KHC A;  4C92 F;  3TCJ A;  4F7U E;  4MZM A;  1VA7 A;  2FPE A;  1M3B A;  1PSE A;  8AT1 B;  4PJO A;  4K11 A;  3VPI A;  2F2X A;  5D6X A;  2J6O A;  3GBQ A;  4RTU A;  3UA6 A;  1TUG B;  4A53 A;  5DY9 A;  1M4Z A;  3I55 T;  4ZGE B;  3OYN A;  3FJP A;  3QSU A;  3QO3 A;  2LCS A;  4JPB W;  5LJ5 h;  1I07 A;  4BI3 A;  1YHQ T;  3HPW A;  1Y0M A;  1G83 A;  2RNA A;  4PJO G;  2K3A A;  3NPF A;  2LRJ A;  3V7R A;  3JCM P;  2MI6 A;  4X9C A;  3EGD A;  2CYZ B;  4XTU A;  1GBQ A;  5CQY A;  1AT1 B;  4FSX A;  3EFR A;  1VQ4 T;  2DTH A;  4HCZ A;  2DO3 A;  4EOB A;  1UGQ B;  1K9M C;  3OW2 P;  3LW5 E;  2AHJ B;  4BUG A;  5GMK j;  3L2V A;  3G4S T;  1BU1 A;  1EX4 A;  2JN0 A;  2EW3 A;  2XD0 A;  2F5K A;  4ZTJ A;  4M7A E;  3RUX A;  1NJI U;  3X20 B;  1BI3 A;  3I55 Q;  3TQ7 P;  1H3H A;  1RI0 A;  1TS9 A;  4PFP A;  1XOV A;  1V1C A;  1F1B B;  1M27 C;  4FDY A;  2NLU A;  3A98 A;  3PIP A;  2MYS A;  1QKW A;  2QEX A;  1U3O A;  2ZGW A;  2GQI A;  4XAX B;  5A0L A;  3RDV A;  2LJ3 A;  1VQN A;  3UT1 A;  5GAM g;  1AWW A;  1YJ9 Q;  1RAF B;  1UGS B;  2RB6 A;  2DL5 A;  1D3B B;  4FYW B;  1FWZ A;  4EQA A;  5I2M A;  3RKX A;  4HZB A;  3OYE A;  4FT4 A;  2CP7 A;  2MOX A;  2YRD A;  3PMT A;  1I1J A;  1I0C A;  3LYI A;  2WSC E;  5GAN d;  1VQN T;  1G3W A;  3EH2 A;  4DEY A;  3I5R A;  5KYU B;  2B86 A;  3OS1 A;  2W0Z A;  4C0F A;  1CKB A;  3LWH A;  3C12 A;  2IG0 A;  2CH4 A;  2G6F X;  2CP3 A;  2EQI A;  4M75 D;  1QVF A;  4E7K A;  5GAN 5;  1Q81 C;  4R55 A;  1HJD A;  1O75 A;  2RHX A;  1YIT Q;  2VB6 A;  4E47 A;  3JCM c;  4Y91 A;  5FRN A;  4IUQ A;  2DVJ A;  3EH1 A;  4LN2 A;  1BIB A;  2COW A;  2E6Z A;  4C5H A;  1S1N A;  3QHS A;  4CRI A;  5KYX B;  1NPR A;  4L59 A;  3L2U A;  3TRE A;  2JW4 A;  5IAY A;  1Q86 C;  5GAO r;  2PQW A;  1NPP A;  5GAN h;  1WDX A;  4BE0 A;  2QTX A;  3LGF A;  4FW1 A;  5GAM f;  1JO8 A;  3MEU A;  1X69 A;  2J06 A;  4JRI A;  4M7D E;  2JS2 A;  2E70 A;  5GJV B;  4LUE A;  1PHT A;  2DIQ A;  3CMA Q;  4J9H A;  1KSW A;  1ARK A;  2VYT A;  2QAS A;  1AEY A;  2BKD N;  2PVD B;  2RQU A;  1JJ2 A;  1IXD A;  3FIF A;  3SFM A;  4XU0 A;  4OMN A;  1WGS A;  1IGU A;  5I22 A;  3A2Z A;  4C8Q B;  4M75 C;  5D6W A;  3U23 A;  4OVA A;  1NLO C;  4LD9 K;  2EJ9 A;  3L2R A;  1UE9 A;  2EGC A;  1AWO A;  2HSE B;  1BCM A;  5GAO q;  2EQJ A;  3EG2 A;  2ZPF B;  1YJN Q;  2CS7 A;  4JLI A;  1IHW A;  4J9G A;  3TEE A;  3NHN A;  3VJP A;  1VIF A;  1H3Z A;  1NYG A;  3JCM h;  1M1G A;  1WHH A;  3CBM A;  4FYV B;  1OEB A;  1H64 1;  3A1P A;  1GFD A;  1KC8 R;  4B9X A;  5FW9 A;  3CD6 Q;  1JQQ A;  2FL7 A;  4AFU C;  2CZ0 B;  2RA2 A;  2D8J A;  3RKW A;  3VKI A;  1HSQ A;  1RAC B;  4F16 A;  2CUB A;  4QQD A;  3CD6 T;  4M7D A;  1WXT A;  2E12 A;  2FB7 A;  2JXB A;  5C0M A;  4C92 B;  5FU7 B;  4CGK A;  2JOY A;  1RI9 A; 
#chains in the Genus database with same CATH homology
 2KXC A;  3EG1 A;  4RTW A;  1GBR A;  1Z9Q A;  1X2K A;  1N5Z A;  1K9A A;  2J05 A;  2LJ0 A;  4HVU A;  4Z8A A;  1JXM A;  1AZG B;  1GFC A;  2GTJ A;  4FSS A;  1M3C A;  4OMO A;  4CSH A;  1WXB A;  2SEM A;  1GCP A;  1W6X A;  3I5S A;  3VS1 A;  3M0Q A;  2DNU A;  2CSQ A;  2BZ8 A;  4FQB A;  1X2Q A;  1T3L A;  2DBK A;  3SEM A;  2YUP A;  2CRE A;  2ROL A;  2DM1 A;  1OOT A;  1VYV A;  3M0S A;  4Z88 A;  2K6D A;  1T3S A;  3H0I A;  2RN8 A;  2E5K A;  1U5S A;  2VPM A;  2KRO A;  2D1X A;  2ABL A;  2X3X D;  4Q4N A;  1B07 A;  1KJW A;  2NUZ A;  5I11 A;  3I35 A;  4X1V A;  1M8M A;  1SPK A;  2IO7 A;  1VYU A;  4JJB A;  2DRM A;  4RTZ A;  2J6K A;  2LJ1 A;  4Q4G X;  1G2B A;  2HSP A;  3PE0 A;  4J9E A;  2EGE A;  2AKL A;  2DL8 A;  2F2W A;  1QKX A;  2HDA A;  3C0C A;  4CC7 A;  4WCI A;  2OJ2 A;  1K0X A;  2EYZ A;  1EFN A;  2PNI A;  2EKH A;  3VS2 A;  1JU5 C;  1PWT A;  1SSH A;  1BK2 A;  2D8H A;  4LE9 A;  2VVK A;  3VS6 A;  4HCK A;  4J9B A;  2EBP A;  4RTY A;  4Y92 A;  2ECZ A;  2EVR A;  1UEC A;  1K0S A;  2A08 A;  4EIK A;  2C0T A;  4CT3 A;  1GL5 A;  2EYW A;  1QCF A;  2YUQ A;  1Z9Z A;  2KRS A;  2GTO A;  2JMC A;  4FGI A;  3VS4 A;  4E6R A;  1H8K A;  3PBC A;  1OPL A;  3PVL A;  3QWY A;  3EG0 A;  2YSQ A;  2MIO A;  2I0N A;  3LH5 A;  1SRL A;  1WX6 A;  1SEM A;  2NWM A;  2GGR A;  4J9I A;  2L3Q A;  1JEG A;  2EYY A;  1AOJ A;  1QLY A;  2OAW A;  1M3A A;  3CQT A;  2K9G A;  2LQW A;  2KEA A;  5IXB A;  1RLP C;  2H8H A;  4M4Z A;  4OLK A;  2VWF A;  2AKK A;  3I86 A;  4JJC A;  1WLP B;  2DL7 A;  2FG0 A;  2RQW A;  3H41 A;  1ZLM A;  2JM9 A;  2YUO A;  4ESR A;  2DLP A;  2A28 A;  3NGP A;  4A63 B;  4RUG A;  1KIK A;  2V1Q A;  4HXJ A;  4HVV A;  4JJD A;  4AFZ C;  1NEG A;  2JM8 A;  1PKS A;  4RTX A;  5ECA A;  1LCK A;  3M0P A;  4Q4T A;  3NMZ C;  1B3Q A;  2GBQ A;  2EPD A;  1MUZ A;  3S0Q A;  2QDL A;  1ZBJ A;  1WA7 A;  1TUD A;  2IF6 A;  4OMP A;  2FEI A;  3VRZ A;  2L3P A;  1AZE A;  2K1G A;  1FMK A;  2JS0 A;  1UJY A;  4F0V A;  2O9S A;  1WXU A;  2KE9 A;  1YWO A;  2BZY A;  1PRL C;  1U06 A;  1AWJ A;  2YDL A;  4LUD A;  3REA B;  1NLP C;  1NYF A;  4D8K A;  2LMJ A;  3QWX X;  4ORZ A;  1AVZ C;  2KT1 A;  4F0W A;  3O98 A;  2LQN A;  3UF4 A;  2DA9 A;  1GCQ A;  2C0I A;  2KXD A;  4IIM A;  4LNP A;  3EGU A;  4RTV A;  3I9Q A;  2KGT A;  2HCK A;  1FYN A;  1T0H A;  2M51 A;  1T0J A;  4IIO A;  2JT4 A;  3UA7 A;  1OV3 A;  4JXB A;  1X43 A;  2GNC A;  2VKN A;  1VA7 A;  1YCS B;  1X27 A;  1W1F A;  2FPE A;  4FGE A;  1M3B A;  2FRY A;  3VS5 A;  4K11 A;  3VPI A;  2F2X A;  2J6O A;  3GBQ A;  4J9C A;  4RTU A;  3UA6 A;  3M0T A;  2RQT A;  2L3S A;  2KR3 A;  3VS3 A;  1NG2 A;  1TG0 A;  2LCS A;  1UUE A;  2LZ6 B;  1ZX6 A;  1E6H A;  2DL4 A;  3M0R A;  4JPB W;  2ROT A;  1I07 A;  2FPD A;  2KRN A;  3SHW A;  1GCQ C;  1Y0M A;  2IO9 A;  4Z89 A;  1G83 A;  2RNA A;  4F17 A;  2HBW A;  4DEX A;  2K3A A;  1NEB A;  2CT4 A;  3NPF A;  1K76 A;  2D0N A;  2LRJ A;  2FPF A;  1UDL A;  3M0U A;  4J9D A;  2A37 A;  3RNJ A;  1GBQ A;  2O2O A;  1M30 A;  2AK5 A;  1WYX A;  2ENM A;  1SHG A;  2YT6 A;  1CSK A;  2LNH B;  3EHQ A;  2RPN A;  4AFS C;  4HVW A;  4EOB A;  4JZ3 A;  3KFV A;  1YP5 A;  4FGD A;  3PVQ A;  4LJ1 A;  2XIV A;  1UTI A;  2K3B A;  1BU1 A;  3VS0 A;  2EW3 A;  1J3T A;  2P4R A;  5FWB A;  2KYB A;  1TUC A;  3A30 A;  1PKT A;  1H3H A;  2O31 A;  1PNJ A;  1QWF A;  2RMO A;  1XOV A;  2DYB A;  5IHN A;  1V1C A;  1M27 C;  1IO6 A;  1OPK A;  4RTT A;  3A98 A;  3KW0 A;  4FDY A;  3O5Z A;  1QKW A;  1E7O A;  3VPJ A;  1U3O A;  2L0A A;  1VYT A;  2CUD A;  1AD5 A;  2DL3 A;  4ZNX A;  2GQI A;  1BB9 A;  3PBI A;  2DBM A;  2KYM A;  2LJ3 A;  2O9V A;  4OMM A;  1HD3 A;  1AWW A;  5L23 A;  1ZUY A;  3ULR B;  2DL5 A;  2J7I A;  4EQA A;  2DIL A;  3H0H A;  2FRW A;  2J6F A;  1H92 A;  2XMF A;  4HZB A;  1YNZ A;  2KT8 A;  5FWC A;  2MOX A;  2RQR A;  2O88 A;  1I1J A;  1I0C A;  4GLM A;  4F4M A;  1WFW A;  1X6G A;  3ZL7 C;  4AG2 C;  4DEY A;  3EHR A;  2CH4 W;  2AZS A;  3I5R A;  2K79 A;  2B86 A;  5IH2 A;  2W0Z A;  3VS7 A;  1GRI A;  1CKB A;  2AZV A;  3TVT A;  2CH4 A;  2G6F X;  2DX1 A;  2EQI A;  2KRM A;  2LP5 A;  1HJD A;  3NE0 A;  2PTK A;  2SRC A;  2CSI A;  1WIE A;  2PZ1 A;  5HCK A;  2DVJ A;  4LN2 A;  3VRY A;  1QWE A;  1S1N A;  2JTE A;  2L2P A;  2JW4 A;  1UHC A;  2DRK A;  4EQ8 A;  1AWX A;  2CDT A;  1SHF A;  1ZUU A;  2JMA A;  1Y57 A;  1WDX A;  1A0N B;  2IIM A;  3TSW A;  4FQA A;  1JO8 A;  2KNB B;  2V1R A;  2CT3 A;  1X69 A;  2J06 A;  5IXF A;  2JS2 A;  5GJV B;  4LUE A;  1ABQ A;  1PHT A;  2OI3 A;  2VOB A;  4HPE A;  2EGA A;  4AG1 C;  2MCN A;  2ESW A;  4CC4 B;  1X6B A;  4CC2 A;  1KFZ A;  4J9H A;  1KSW A;  3H0F A;  1YN8 A;  1ARK A;  1AEY A;  2ED1 A;  2RQU A;  5EC7 A;  2IO8 A;  4KRT A;  4OMN A;  5I22 A;  3A2Z A;  1YWP A;  4AFQ C;  3EG3 A;  2IOA A;  3REB B;  3U23 A;  2DMO A;  3RBB B;  4GBQ A;  2K7A A;  2DE0 X;  1NLO C;  2EYX A;  2IOB A;  4OMQ A;  1BBZ A;  2BTT A;  3M1U A;  2YUN A;  1UE9 A;  2LX7 A;  2EGC A;  1ZUK A;  1AWO A;  2FO0 A;  5GJW B;  1W70 A;  1ABO A;  4F14 A;  3A2Y A;  3EG2 A;  1MV0 B;  1K4U S;  1ZSG A;  3JV3 A;  4D8D A;  2W10 A;  1MV3 A;  1K1Z A;  3TSZ A;  1RUW A;  4J9G A;  3NHN A;  1NYG A;  1UJ0 A;  1PRM C;  1UHF A;  4HZ9 A;  2RQV A;  1OEB A;  1WI7 A;  3UAT A;  2M0Y A;  3GT2 A;  4J9F A;  1GFD A;  2RF0 A;  1JXO A;  4R0K A;  4JZ4 A;  5FW9 A;  1JQQ A;  2DJQ A;  1RLQ C;  2VPS A;  2C0O A;  4AFU C;  2BZX A;  2KBT A;  1CKA A;  2D8J A;  1E6G A;  2DF6 A;  2K2M A;  3FJ5 A;  5IHK A;  2ED0 A;  1UGV A;  1HSQ A;  4F16 A;  1UFF A;  1SRM A;  3R6N A;  2CUB A;  2HEQ A;  1UG1 A;  2X3W D;  1WXT A;  2A36 A;  4CC3 A;  4OML A;  5IHI A;  3IQL A;  2JXB A;  2F2V A;  4QT7 A;  3THK A;  4CGK A;  1NM7 A;  1RI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...