3PW9A

Structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
153
Chain Sequence
SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKLRLNFITVRKLTSKADAFEYADQVLEKWYPSIEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional assays of AtTLP18.3 identify its novel acid phosphatase activity in thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords UPF0603 protein At1g54780, chloroplastic
total genus 56
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3pw9A00
2MPBA 2LT2A 3PW9A 3PTJA 5ANPA 4OA3A 3PVHA 2KW7A 2KPTA
chains in the Genus database with same CATH superfamily
2QB8A 2Q9HA 3FVEA 4J9XA 5H2GA 1SDJA 2EB0A 1U1XA 1U0KA 1WPMA 2ZVFA 4JD7A 1U1WA 2KW7A 4LG3A 4RPAA 1K20A 1QYAA 3W5WA 4LB0A 5H2YA 4JUUA 4JBDA 2OTNA 2GKEA 3EKMA 1S7JA 1BWZA 1XUAA 2GKJA 2AZPA 4K7GB 2Q9JA 3ICJA 2YMAA 2LT2A 4Q60A 3PW9A 5ANPA 3PTJA 3IGHX 2ZXRA 2HAWA 1XUBA 2QB6A 1W62A 3DEVA 4IJZA 2ZXOA 4PY9A 3PVHA 3G7KA 4IK0A 4K8LA 1WPPA 1IR6A 1QY9A 2H9FA 4LS9A 3EJXA 1U1VA 4K7XA 4DUNA 3WQZA 4GL6A 2MPBA 2PVZA 5HA4A 4OA3A 5IWEA 4Q2HA 1YM5A 2KPTA 3G98A 2ENXA 2IW4A 1W61A 4JCIA 2PW0A 1I74A 2QB7A 3EDNA 4J9WA 5M47A 1T6KA 1TM0A 2ZXPA 1K23A 1GQZA
chains in the Genus database with same CATH topology
2QB8A 2Q9HA 3FVEA 4J9XA 5H2GA 1SDJA 2EB0A 1U1XA 1U0KA 1WPMA 2ZVFA 4JD7A 1U1WA 2KW7A 4LG3A 4RPAA 1K20A 1QYAA 3W5WA 4LB0A 5H2YA 4JUUA 4JBDA 2OTNA 2GKEA 3EKMA 1S7JA 1BWZA 1XUAA 2GKJA 2AZPA 4K7GB 2Q9JA 3ICJA 2YMAA 2LT2A 4Q60A 3PW9A 5ANPA 3PTJA 3IGHX 2ZXRA 2HAWA 1XUBA 2QB6A 1W62A 3DEVA 4IJZA 2ZXOA 4PY9A 3PVHA 3G7KA 4IK0A 4K8LA 1WPPA 1IR6A 1QY9A 2H9FA 4LS9A 3EJXA 1U1VA 4K7XA 4DUNA 3WQZA 4GL6A 2MPBA 2PVZA 5HA4A 4OA3A 5IWEA 4Q2HA 1YM5A 2KPTA 3G98A 2ENXA 2IW4A 1W61A 4JCIA 2PW0A 1I74A 2QB7A 3EDNA 4J9WA 5M47A 1T6KA 1TM0A 2ZXPA 1K23A 1GQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPB A;  2LT2 A;  3PW9 A;  3PTJ A;  5ANP A;  4OA3 A;  3PVH A;  2KW7 A;  2KPT A; 
#chains in the Genus database with same CATH topology
 2QB8 A;  2Q9H A;  3FVE A;  4J9X A;  5H2G A;  1SDJ A;  2EB0 A;  1U1X A;  1U0K A;  1WPM A;  2ZVF A;  4JD7 A;  1U1W A;  2KW7 A;  4LG3 A;  4RPA A;  1K20 A;  1QYA A;  3W5W A;  4LB0 A;  5H2Y A;  4JUU A;  4JBD A;  2OTN A;  2GKE A;  3EKM A;  1S7J A;  1BWZ A;  1XUA A;  2GKJ A;  2AZP A;  4K7G B;  2Q9J A;  3ICJ A;  2YMA A;  2LT2 A;  4Q60 A;  3PW9 A;  5ANP A;  3PTJ A;  3IGH X;  2ZXR A;  2HAW A;  1XUB A;  2QB6 A;  1W62 A;  3DEV A;  4IJZ A;  2ZXO A;  4PY9 A;  3PVH A;  3G7K A;  4IK0 A;  4K8L A;  1WPP A;  1IR6 A;  1QY9 A;  2H9F A;  4LS9 A;  3EJX A;  1U1V A;  4K7X A;  4DUN A;  3WQZ A;  4GL6 A;  2MPB A;  2PVZ A;  5HA4 A;  4OA3 A;  5IWE A;  4Q2H A;  1YM5 A;  2KPT A;  3G98 A;  2ENX A;  2IW4 A;  1W61 A;  4JCI A;  2PW0 A;  1I74 A;  2QB7 A;  3EDN A;  4J9W A;  5M47 A;  1T6K A;  1TM0 A;  2ZXP A;  1K23 A;  1GQZ A; 
#chains in the Genus database with same CATH homology
 2QB8 A;  2Q9H A;  3FVE A;  4J9X A;  5H2G A;  1SDJ A;  2EB0 A;  1U1X A;  1U0K A;  1WPM A;  2ZVF A;  4JD7 A;  1U1W A;  2KW7 A;  4LG3 A;  4RPA A;  1K20 A;  1QYA A;  3W5W A;  4LB0 A;  5H2Y A;  4JUU A;  4JBD A;  2OTN A;  2GKE A;  3EKM A;  1S7J A;  1BWZ A;  1XUA A;  2GKJ A;  2AZP A;  4K7G B;  2Q9J A;  3ICJ A;  2YMA A;  2LT2 A;  4Q60 A;  3PW9 A;  5ANP A;  3PTJ A;  3IGH X;  2ZXR A;  2HAW A;  1XUB A;  2QB6 A;  1W62 A;  3DEV A;  4IJZ A;  2ZXO A;  4PY9 A;  3PVH A;  3G7K A;  4IK0 A;  4K8L A;  1WPP A;  1IR6 A;  1QY9 A;  2H9F A;  4LS9 A;  3EJX A;  1U1V A;  4K7X A;  4DUN A;  3WQZ A;  4GL6 A;  2MPB A;  2PVZ A;  5HA4 A;  4OA3 A;  5IWE A;  4Q2H A;  1YM5 A;  2KPT A;  3G98 A;  2ENX A;  2IW4 A;  1W61 A;  4JCI A;  2PW0 A;  1I74 A;  2QB7 A;  3EDN A;  4J9W A;  5M47 A;  1T6K A;  1TM0 A;  2ZXP A;  1K23 A;  1GQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...