3PW9A

Structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
153
Chain Sequence
SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKLRLNFITVRKLTSKADAFEYADQVLEKWYPSIEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional assays of AtTLP18.3 identify its novel acid phosphatase activity in thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords UPF0603 protein At1g54780, chloroplastic
total genus 56
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3pw9A00
3PW9A 3PVHA 2LT2A 2KW7A 5ANPA 3PTJA 2KPTA 2MPBA 4OA3A
chains in the Genus database with same CATH superfamily
2LT2A 2AZPA 2HAWA 4JUUA 1XUBA 1S7JA 2OTNA 3G98A 4GL6A 3IGHX 5H2GA 1BWZA 1K20A 4Q2HA 5ANPA 1U1XA 2IW4A 1TM0A 5HA4A 1U1WA 2PW0A 4DUNA 4PY9A 2GKEA 3EKMA 3ICJA 1WPPA 1QY9A 2ZXRA 2ZVFA 4K7GB 3DEVA 2ZXOA 3W5WA 2Q9HA 2PVZA 1U0KA 1GQZA 2QB7A 1K23A 1XUAA 1YM5A 1U1VA 3PTJA 2QB6A 1QYAA 3G7KA 2YMAA 4JCIA 4LB0A 4J9WA 3PW9A 2QB8A 5H2YA 5M47A 4JBDA 2H9FA 4JD7A 3WQZA 2KW7A 2ZXPA 4RPAA 1W62A 4LG3A 1SDJA 1W61A 3FVEA 1T6KA 2GKJA 3PVHA 3EJXA 4IK0A 2KPTA 4K7XA 4K8LA 3EDNA 4LS9A 1I74A 2EB0A 4IJZA 1WPMA 4OA3A 2ENXA 4Q60A 1IR6A 2Q9JA 5IWEA 2MPBA 4J9XA
chains in the Genus database with same CATH topology
2LT2A 2AZPA 2HAWA 4JUUA 1XUBA 1S7JA 2OTNA 3G98A 4GL6A 3IGHX 5H2GA 1BWZA 1K20A 4Q2HA 5ANPA 1U1XA 2IW4A 1TM0A 5HA4A 1U1WA 2PW0A 4DUNA 4PY9A 2GKEA 3EKMA 3ICJA 1WPPA 1QY9A 2ZXRA 2ZVFA 4K7GB 3DEVA 2ZXOA 3W5WA 2Q9HA 2PVZA 1U0KA 1GQZA 2QB7A 1K23A 1XUAA 1YM5A 1U1VA 3PTJA 2QB6A 1QYAA 3G7KA 2YMAA 4JCIA 4LB0A 4J9WA 3PW9A 2QB8A 5H2YA 5M47A 4JBDA 2H9FA 4JD7A 3WQZA 2KW7A 2ZXPA 4RPAA 1W62A 4LG3A 1SDJA 1W61A 3FVEA 1T6KA 2GKJA 3PVHA 3EJXA 4IK0A 2KPTA 4K7XA 4K8LA 3EDNA 4LS9A 1I74A 2EB0A 4IJZA 1WPMA 4OA3A 2ENXA 4Q60A 1IR6A 2Q9JA 5IWEA 2MPBA 4J9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PW9 A;  3PVH A;  2LT2 A;  2KW7 A;  5ANP A;  3PTJ A;  2KPT A;  2MPB A;  4OA3 A; 
#chains in the Genus database with same CATH topology
 2LT2 A;  2AZP A;  2HAW A;  4JUU A;  1XUB A;  1S7J A;  2OTN A;  3G98 A;  4GL6 A;  3IGH X;  5H2G A;  1BWZ A;  1K20 A;  4Q2H A;  5ANP A;  1U1X A;  2IW4 A;  1TM0 A;  5HA4 A;  1U1W A;  2PW0 A;  4DUN A;  4PY9 A;  2GKE A;  3EKM A;  3ICJ A;  1WPP A;  1QY9 A;  2ZXR A;  2ZVF A;  4K7G B;  3DEV A;  2ZXO A;  3W5W A;  2Q9H A;  2PVZ A;  1U0K A;  1GQZ A;  2QB7 A;  1K23 A;  1XUA A;  1YM5 A;  1U1V A;  3PTJ A;  2QB6 A;  1QYA A;  3G7K A;  2YMA A;  4JCI A;  4LB0 A;  4J9W A;  3PW9 A;  2QB8 A;  5H2Y A;  5M47 A;  4JBD A;  2H9F A;  4JD7 A;  3WQZ A;  2KW7 A;  2ZXP A;  4RPA A;  1W62 A;  4LG3 A;  1SDJ A;  1W61 A;  3FVE A;  1T6K A;  2GKJ A;  3PVH A;  3EJX A;  4IK0 A;  2KPT A;  4K7X A;  4K8L A;  3EDN A;  4LS9 A;  1I74 A;  2EB0 A;  4IJZ A;  1WPM A;  4OA3 A;  2ENX A;  4Q60 A;  1IR6 A;  2Q9J A;  5IWE A;  2MPB A;  4J9X A; 
#chains in the Genus database with same CATH homology
 2LT2 A;  2AZP A;  2HAW A;  4JUU A;  1XUB A;  1S7J A;  2OTN A;  3G98 A;  4GL6 A;  3IGH X;  5H2G A;  1BWZ A;  1K20 A;  4Q2H A;  5ANP A;  1U1X A;  2IW4 A;  1TM0 A;  5HA4 A;  1U1W A;  2PW0 A;  4DUN A;  4PY9 A;  2GKE A;  3EKM A;  3ICJ A;  1WPP A;  1QY9 A;  2ZXR A;  2ZVF A;  4K7G B;  3DEV A;  2ZXO A;  3W5W A;  2Q9H A;  2PVZ A;  1U0K A;  1GQZ A;  2QB7 A;  1K23 A;  1XUA A;  1YM5 A;  1U1V A;  3PTJ A;  2QB6 A;  1QYA A;  3G7K A;  2YMA A;  4JCI A;  4LB0 A;  4J9W A;  3PW9 A;  2QB8 A;  5H2Y A;  5M47 A;  4JBD A;  2H9F A;  4JD7 A;  3WQZ A;  2KW7 A;  2ZXP A;  4RPA A;  1W62 A;  4LG3 A;  1SDJ A;  1W61 A;  3FVE A;  1T6K A;  2GKJ A;  3PVH A;  3EJX A;  4IK0 A;  2KPT A;  4K7X A;  4K8L A;  3EDN A;  4LS9 A;  1I74 A;  2EB0 A;  4IJZ A;  1WPM A;  4OA3 A;  2ENX A;  4Q60 A;  1IR6 A;  2Q9J A;  5IWE A;  2MPB A;  4J9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...