3PWCA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA02
5JB8S 1ZGIA 1FXYA 1FPCH 1BITA 4CH2B 1W0ZU 1TMUH 1O2IA 1GBIA 1DY8A 3FANA 4I8KA 2OP9A 4LOYH 7GCHF 4OS4A 4Y0ZE 1P9UA 1CT0E 4BAQB 5SGAE 4OS2A 4Z6AH 4CRCA 4DW2U 3W94A 1C5TA 1F0TA 1SQOA 4MPVA 2Y7ZA 1TONA 4TY6A 1DWDH 3EE0B 2J2UA 2BD4A 3ZVCA 1K1JA 2V0BA 1EQ9A 2JETB 1HJAC 5C2ZA 2BD5A 1AFEH 5T6DA 1FNIA 1VJAU 1P9SA 2Y82A 5A0BA 3SZNA 1F0RA 2AFQB 5A0CA 1GG6C 4KTCA 2PTNA 5PTPA 3F9HA 2ZDLA 2BDIA 2SGQE 2ZPSA 1EXFA 3A7TA 1XVOA 5CHAB 1TFXA 1UK4A 3CP7A 1AUJA 2XCFA 4Y7BA 1XM1A 4YLUA 2Z7FE 1C5UA 3FFGA 4UFGH 1CGJE 5AFZH 2O9QA 1FN8A 1GBJA 2JH6D 2QV1A 5FPSA 2G4UA 3F1SB 1UTNA 1FI8A 3F68H 3M5LA 3RXFA 4B73A 2EA3A 1TX7A 3QN7A 2WPJS 3TGKE 1CO7E 3QK1A 1ANDA 2O8WA 2ZZUH 1GHAG 2PFEA 2VVVA 1TPAE 1CGHA 2A5KA 2GTBA 1Z6EA 2XBWA 4X2XA 1JBUH 4RKJB 3UIRA 3VGCC 1UVUH 2Z3DA 2ZNKH 1TGSZ 1OWEA 3KCGH 5GDSH 4B74A 1A46H 4K69A 4IN1A 4B2BA 2FTLE 2P8OB 1SMFE 4UFFH 2ZPRA 2UWPA 3D65E 2VWLA 2PR3A 3ATKA 1MMJN 1TOCB 1UVTH 3LC5A 2VNTA 3SU4A 3PLKA 3FAOA 2BY8X 4FUJA 3QO6A 3TJNA 3ZZAA 1O2GH 3GYLB 5GJ4B 2XTTB 5LPFA 1KDQA 1GJDB 2OBOA 1SGPE 3C27B 3TJOA 1XXFA 2FX6A 2PHBA 3RU4T 1BMLA 1SR5C 1NFXA 2BDBA 2XNIA 1Z8RA 2ZDMA 1H9IE 1O2SA 2OTVA 5I46H 5L2YH 1HIAB 2P3TB 2W7SA 3M3VA 2BY6X 5A8ZA 1ZTJA 1V2QT 5EQRA 6CHAC 1IQMA 1TLDA 1AIXH 3RLWH 2ZHDA 3SV7A 3KGPA 1O2YA 1J17T 3C1KA 1T8OA 1SLUB 3PO1B 2FZZA 4CR9A 1V2RT 2JH5D 2PV9B 1LCYA 4UONA 1K2I1 1B7XB 3HGNA 1EATA 1DUEA 1V2LT 5IYTA 3AW1A 4YT6H 1YP9A 2OQ5A 3D49H 3A87A 2OBQA 1IQKA 4K1SA 1PPGE 4GHTA 3SHCH 1LQDB 1TRNA 3KL6A 4AFSA 1BRBE 1AWHB 3LH1A 1P2NA 1O2KA 3ZZBA 1V6DA 5DP9A 4AB9A 2GZ9A 2C8YB 4AFZA 4BAOB 2FX4A 2NU2E 1P2QA 1L1JA 5EQSA 1P06A 4ZH8A 4GPGA 5F8TA 4FU8A 1H9HE 1C5NH 2W3KA 4ABGA 2CGAA 4J2YB 2SFAA 1P05A 2ZEBA 2BXTH 1ELGA 1PPZA 5EG4A 1XUIA 2F9NA 3M5MA 3UFAA 5C1XA 1O3DA 2HPQH 1BMNH 4DOQA 4ABJA 1QL7A 1SQAA 1QA0A 5E8EH 3IWMA 1TABE 1UVPA 1T32A 4FVDA 2TGPZ 3ZVEA 3A7VA 4MQAA 3VXEH 4Q7ZA 1FN6A 4CHAB 1E34B 4O9VA 4DGJA 2R0KA 3F6UH 2ALVA 3PV4A 3RXDA 5EW1H 5ETXA 4JYUH 1DWCH 1L2EA 1C2GA 2VINA 1NRPH 4H6SB 2GT8A 2BX3A 3D62A 2WPHS 4ABDA 3GCHB 3JZ2B 2FLRH 1SSXA 4HI3A 5AFYH 3E90B 1BA8B 2LNCA 3FP7E 2VH0A 3M5OA 3ATIA 1TNJA 3OY6U 3NUMA 3B23B 5A09A 1IQFA 2BDGA 4MPWA 1OOKB 4MPXA 5JBAS 2O8UA 1IQJA 1UTLM 1W2KH 4MPUA 4YLQH 4X2YA 5C1UA 3RXJA 2ZHQH 3MFJA 1ZHRA 2ZDNA 3GY7A 4XBCA 1W0YH 4WWYA 5C5OA 1TMBH 1O31A 2FESH 1HJ9A 1UCYE 1OWKA 1FDPA 4YM9A 2TBSA 3ENSB 2VU8E 1AO5A 3IITA 2XWAA 3GDSA 3BG4C 3KQEA 1CA0B 1O2ZA 1GHWH 3HK3B 2STAE 1OWDA 4RSPA 5EXNA 3ZVDA 3U8OH 2F9OA 3NWUA 1Y3UA 1HDTH 1BTPA 1ACBE 1GVLA 4BTUB 1AVWA 1QGFA 4X1QU 4Y0YE 1THPB 1GBTA 3LJOA 2A5IA 2Q6GA 3HKJB 2HNTC 1D9IA 5EQQA 1UHBA 2FTMA 1V2JT 1N8OB 4F4OC 1AHTH 1PYTD 4WH8A 2HLCA 2C3SA 1VJ9U 2ZDKA 5HM2A 2FOMB 2Y5FA 2ZWLH 1P04A 1UTJA 5ABWA 1LVOA 2CHAB 3TNTA 3ZZ7A 2PGQB 1AVGH 2GCHG 1BBRH 3U8RH 1SGIB 3RP2A 1NRQH 4GCHF 1C5LH 1C5PA 1DDJA 1L4ZA 1O2XA 1C5QA 4VGCC 1JRTA 3Q00A 2BZ6H 1MKXH 1QQ4A 4ABBA 1RXPA 3GCTG 1B5GH 1AZ8A 1BJVA 3V0XA 2AIPA 1RIWB 1O3LA 1LVBA 4DG4A 1YPHE 2ZO3H 3GY5A 1QL8A 2WPKS 1MU8B 2W3IA 4JMYA 4ESTE 2VWNA 1BDAA 5EGMA 1UCYK 4UD9H 3SJKA 1N6XA 2ZKSA 5G4BA 1JWTA 3GCTF 2F83A 1LKAA 4IW4E 1Z71A 4FUGA 2BD3A 3PLBA 4CHAC 2NWNA 1C1UH 1Y3VA 2FWWA 5TCCA 1SLVB 3QZQA 1Y59T 3GY4A 1A3BH 2CF8H 2OC1A 2SGDE 2Y81A 1GHYH 1GI4A 1C2DA 1CBWC 1O32A 2ZGHA 5E0GA 1ELDE 4SGBE 3TGIE 3AASA 1O34A 2B7DH 1JOUB 4WMFA 1NU9A 1HV7A 2FPZA 3M61U 2W7UA 3M3TA 5GPIB 4SGAE 1C1WH 2FS8A 3RC4A 2R0LA 3TU7H 3VB5A 1QBNA 1ZR0A 3SU2A 1O30A 1SGNE 1PPBH 1YLCA 2FO9A 4I31A 1TOMH 1VITF 2CMYA 2G8TA 1C1MA 2WYGA 2Z9JA 1MAXA 1AVXA 3HK6B 4NSYA 4JK6A 4JYVH 1W7GH 3ZZ9A 4FUCA 3UNSA 3QGJA 1GBLA 4RKOB 3RXBA 2Q6DA 2Y7XA 4TYDA 3PB1E 2RG3A 2C90B 1KXEA 2Y5GA 1ZJKA 4D76A 4NIVA 3UY9A 3A8DA 4OS1A 1YM0A 2ZU2A 1ESBA 3SV2H 1NN6A 3PO1C 3SGAE 2XWBI 3A83A 1TNIA 1A61H 1A0HB 4O3TA 1RFNA 1GDNA 1G3CA 5L30H 2DE8A 2PW8H 3TH2H 3GY6A 3SNCA 2ZFPH 4A7IB 3CENA 2RDLA 3Q77A 2IN2A 2PSXA 1NU7B 2AIQA 5GWZA 5LGOA 1JRSA 1TBQH 3MTYA 2EC9H 1TNGA 1QTFA 1ORFA 1T31A 1MBMA 4WF8A 1EJAA 1C2EA 4DIHH 1AFQB 2G51A 1FY3A 4ISNA 1GDQA 3SV6A 1EPTB 3UPEA 3ESTA 3EA7A 5C20A 1LQEA 3ZZDA 1O37A 1RS0A 1BUIA 1O5DH 3T25A 3E8LA 4DIIH 1BHXF 1G2LA 2FXRA 2QXHA 1O5CB 1AE8H 1SGTA 2SGFE 2QF0A 3H7TA 4TY7A 5AF9H 6LPRA 3A8BA 3RM0H 2PTCE 4ZKSU 3SU6A 1YGCH 2GV7A 1GMDF 1P03A 4A1VA 1ID5H 1H8IH 1O3CA 2FOCA 1QL9A 3SOSA 4GAWA 1HB0B 1E37B 1XX9A 1AWFH 7GCHG 3LKWA 3UWJH 5FAHA 1XUGA 3RUOA 4OS7A 4MNYA 1FMGA 2FS9A 1ZPZA 5ESTE 4OGXA 4QT8C 1BTWA 1WSSH 1YPMH 2QIQA 2ZF0H 4LXBH 3U1IB 2H9TH 1MQ6A 3N7OA 8GCHF 1Y5AT 1EB2A 3V13A 1G3BA 1O2LA 3M7TA 1HIAA 3ZZ4A 1FPHH 3RXTA 1SC8U 2O8LA 1ZHMA 4ZXYH 3GCHC 1PQAA 1OWJA 4YOGA 4K1TA 1C1NA 4D9QA 5E0JA 1ELBA 1FLEE 1QR3E 1ZJDA 2PKSC 1SHYA 3AW0A 3A81A 3LPRA 3RDZA 1DXWA 2ZTXA 4XOJA 1G2MA 3GY2A 3E91A 2A45B 4ZAEA 1ZMLA 1EPTA 1IHTH 1J14A 1A5IA 1FY4A 1Y5BT 2ODPA 1N1LA 1A1RA 1H9LB 5DP7A 3SU1A 1W11U 1YPLH 1TALA 1BCUH 1HJAB 4JZDH 1MU6B 1P57B 4D8NA 3TGJE 1GHZA 4BTIB 3GISB 1C9TA 2VIQA 4I32A 1O2WA 4Y7AA 5L2ZH 1ZHPA 1GJ8B 1GI8B 4DY7B 4A1TA 3M3SA 1CT2E 2XBXA 3SI3H 1IQHA 2D2DA 2H6MA 1C2MA 1O36A 4GCHG 4INKA 2F91A 3A8CA 4X1SU 3LGWA 1RTFB 3ZZ6A 1EZUC 1P2OA 3U8TH 3VPKA 2ZP0H 3SJ8A 1OX1A 2P8OC 3RXMA 4YTAA 9LPRA 2AGGX 1CA0C 1GWAA 1G3EA 3AAVA 2NU3E 1EUFA 1Y3WA 2GV6A 5LH8A 4X0WU 1H8DH 1A0JA 2A4QA 3SI4H 2A32A 1ZLRA 3VGCB 5ESBA 3ZVGA 2FODA 3E6PH 5A8XA 2WV4A 2SNVA 2QF3A 2BZAA 2HPPH 1GHBG 5J4QA 2F9BH 3NZIA 2XW9A 1C5WB 3RC6A 2H2ZA 1GBKA 3UQVA 1RTLA 1SOZA 1WTHD 1O3PB 2OC8A 3ZV9A 2PLXA 1Y5UT 2PGBB 4HTCH 4Q7YA 3UR9A 6GCHG 2ZGXH 4YESB 1QBVH 2ZQ1A 8LPRA 1AB9C 1MZDA 5DPAA 3OX7U 1QB6A 3OTJE 2VGCB 2B9LA 3AAUA 1YF4A 2HWLB 3RXHA 4E06H 4ABEA 1MD7A 1ZMJA 2ANWA 5EXLA 3MH7A 1LHGH 1Z1IA 4K1EA 1UHBB 1WQVH 1BJUA 1GJ4H 3QUMP 5H4IB 1O3MA 1AKSB 3BEIB 2BDHA 1PPHE 1GI6A 4AB8A 2PKSB 3MNCA 1BTYA 2KAIB 1AQ7A 1W13U 1UK2A 1NPMA 2WPLS 1GG6B 1KXFA 1C5MD 2O8MA 3P92A 4X8UH 2VGCC 1J16A 1C9PA 1AB9B 1FIWA 5BRRE 4X6OA 5C1YA 5K7RA 4ABIA 1K1IA 3BTQE 4FU7A 1T4UH 1UK3A 4FUFA 4NG9H 2WUBA 2CJIA 1P8VC 3E16B 4JYTA 3TH3H 2K1QA 1UCYH 2QAAA 1INCA 4GLYA 3SV8A 1KLJH 4ASHA 4Q7XA 1ELAA 2ZQ2A 1HFDA 3VB3A 6ESTA 1BTXA 1Z7KA 3RXEA 3UTUH 2GKVE 3ATWA 4X2WA 1RTKA 2I6QA 3AVZA 2A7CA 1BT7A 3MU5A 2WPMS 4JCNA 1MH0A 1J8AA 1X7AC 1KXDA 1C1TA 4INHA 5HYOA 1IOEA 1W12U 1PPCE 1TQ7B 2ILNA 5JDUB 4DVAU 1Y8TA 1EX3A 4FU9A 5DG6A 1IQEA 1ZPCA 3DUXH 3MI4A 1C4V2 3SGQE 1HUTH 8GCHG 2FP7B 4AFQA 1AGJA 3LGIA 4WH6A 3ZVAA 2BLVA 2GVFA 1D6RA 2ZFTA 1UTOA 1FY8E 4CRBA 1VGCB 2BX4A 2JETC 1SGDE 2AGEX 2PKAB 5FBEA 3UNQA 2BLWA 4AG2A 3LGTA 5EPYA 1OPHB 2BLQA 5DP6A 2FOBA 1OYQA 2D1JA 1ANCA 4NWKA 1HYLA 1ESAA 2ZFSA 2ODYB 3B8JA 3NPSA 2GDEH 1KY9A 2J34A 1GPZA 4BAHB 1G30B 1V2KT 4I8JA 1CT4E 5HXFA 2XYAA 4GVUA 4X1NU 2BQ7B 1D3QB 2WV5A 3GCNA 3NCLA 3SJ9A 3RMLH 4FUHA 3SO3A 1S5SA 4ISHH 3SW2B 3I77A 3LOXA 1YLDA 3MO9A 3EA8A 2G5NA 4YOJA 4DCDA 3BN9A 4ABHA 1NRNH 3QWCH 1A0LA 2D8WA 2BOHB 1D3DB 1UJ1A 2UUJB 1MCVA 1TGNA 3STIA 3A7WA 4JZFH 3MH5A 2F9PA 2G5VA 3VEQB 1MTWA 5FXLA 3MHWU 2B5TB 2XC0A 5C5NA 1E36B 1UO6A 1FAKH 1HAYB 1DFPA 1EB1H 1A5HA 2H5CA 1O3IA 2PUQH 2HNTE 5EU8A 1SI5H 4BANB 1GL1A 2FMJA 1K28D 2FOHA 1VCQA 4ISLA 3SUGA 2FYRA 2BLOA 4NGAH 1ARCA 4GUXA 2JKHA 1BZXE 3RXSA 1YCPK 2TGAA 3EA9A 1JMOH 2V6NA 3K6YA 1DSUA 3Q3KA 1ANEA 1SGQE 1C5VA 2ZC9H 3RMNH 4ZKRU 1PPFE 1P10A 1SGEE 2W26A 3SGBE 3DD2H 1SGCA 1V2UT 1Z8GA 2GP9B 1QY6A 1AZZA 3KF2A 2SGAA 3BG4B 4XFQA 5DP4A 1OXGA 2P16A 2Z9GA 4BAKB 2ZA5A 2ANKH 3F9FA 1S0QA 4KTUA 2GX4A 2VIDA 1PQ7A 1TPOA 1QHRB 2BVRH 2J95A 1VITG 1CHGA 1TA6A 1WAYB 3GCOA 4ZHAA 4BAMB 4OS5A 4MNVA 3BTTE 1HXEH 2OINA 1DY9A 4HFPB 2W5EA 5FCKA 3ODDA 1DXPA 3LGYA 3VB6A 1TGBA 1ZMNA 1ARBA 4X6NA 3BTME 3RXCA 5GXPA 1O2VA 4ZROA 2DE9A 2ZDAH 3ZZCA 3ATLA 4NWLA 4AZ2B 3MMGA 4NA8A 1ETRH 2STBE 5TCAA 3W95A 1DITH 1C5SA 3TIUA 1WU1A 2O8TA 2GMTB 1MTNB 3TJUA 3M37A 1Q3XA 4ZKNU 2J38A 2B8OH 5HM9A 1ZSJA 1O3JA 2EI6A 2YNBA 1VZQH 1WYKA 4Y6DA 3EAJA 1H4WA 1DWEH 3RXIA 1V2OT 3RU4E 2ZGCA 3LC3A 5DP8A 3A82A 3L3TA 3KQBA 1N6YA 1DVAH 1TGTA 2H9EH 4K2YA 2C8XB 3BTWE 2A7HA 3FP8E 3PMBB 1TMTH 3E0PB 1CU1A 1DPOA 3O8DA 5EXMA 3A88A 3BTHE 1OS8A 5HGGA 1RGQA 4DURA 5JBCS 3QLPH 2UUYA 2G81E 4UFDH 3UR6A 1GGDC 1F5LA 1O5FH 2VWOA 1GMCF 1VITH 1GJCB 1Q31A 1FY5A 3P8OA 4X1PU 2XXLA 1HBTH 1V2ST 2V3HH 2TGDA 2ULLA 1V2NT 2OC0A 1P12E 3MNXA 2QXJA 1MKWH 1EZQA 1YBWA 3ZZ5A 5FPTA 2QN5T 4XBDA 1BRUP 3TK9A 1IQLA 2Y5HA 1QIXB 1LHEH 1DICA 7KMEH 1TQ0B 5GIBA 1FV9A 5T3HA 1GI9B 2UWLA 1UVOA 1DUAA 4CRFA 1WQSA 4A6LA 1T7CA 2J4IA 2DUCA 2FI3E 1F0UA 3K6ZA 4IMQA 3P95A 3RM2H 1C2FA 3E0NB 5BPEA 2AH4X 3O8BA 4AGJA 1O2PA 8KME2 2VJ1A 1G36A 5FX6A 2GCTB 3K2UA 1SGFG 1LHCH 2IJOB 1O2MA 2B0FA 2HOBA 3U69H 2FI4E 4IMZA 4R8TB 5CE1A 1OWHA 3L33A 1HJ8A 1TX6A 1WOFA 3URDA 3BTDE 1UTKA 5T6FA 2BHGA 1ZGVA 3MNBA 3F9EA 3A84A 4H4FA 2R9PA 2FM2A 3MH6A 3TPIZ 2BMGB 4I8LA 1NFYA 1GBBA 2BVSH 2RA3A 1DSTA 4D7GA 3SU3A 1W7XH 1HAIH 1KXBA 4K8BA 4AOQA 2BY7X 1GMCG 1V2MT 2QGRA 1QBOA 2ZCHP 3MOCA 4I8GA 3SNEA 3GDVA 2QC2A 5A0AE 4MDSA 1ZRKA 2CHAC 1DANH 1QA7A 3O8RA 3H5CB 5LPEA 1EZSC 1O5BB 1T4VH 3ZV8A 1VR1H 1O3AA 2QCYA 1P2MA 5DJ7A 1GJBB 2AYWA 3DFLA 3BF6H 1ZYOA 3MU1A 2PUXB 3KQDA 1TNKA 3TNSA 4O97A 1HXFH 1PFXC 4KP0A 2VH6A 1O3NA 2CV3A 3RMOH 2Y80A 1S0RA 4UDWH 1NO9H 4ABFA 3LT3A 4Y79A 4TWWA 4AYYB 3A86A 4K3JA 4ABAA 4NIWA 1Z1JA 2HGTH 3UOPA 1ELCA 1ZPBA 1C4Y2 3T26A 1GI2A 2G4TA 2FOGA 2A4RA 1O2UA 2SGEE 4M7GA 1YCPH 3QX5H 3FZDA 2KAIA 1TX8A 1YPEH 3PWCA 2HNTF 1S85A 1G32B 1LDTT 1BBRK 1V2WT 2Z3EA 2ZHFH 1C5YB 2ZU1A 1A3EH 1GI0A 2F9UA 3A89A 2Y6TA 1YPHC 1YPJH 4HGCA 2WPIS 3LJJA 2GDDA 3BTEE 4AX9H 4U01A 3BEUA 1VCWA 5IDKA 1K1OA 1GDUA 3SV9A 4XSKU 2R3UA 2FYQA 1OWIA 3LONA 2ZGJA 3EQ0H 4ISIH 3MO3A 1ESTA 2ZU3A 2BVXH 3ZVBA 3Q3XA 3PTNA 4B75A 1UTMA 2FEQH 1OP2A 1TRYA 1IQGA 1FAXA 1K1PA 3CS0A 1O2TA 2ZGBH 3SU5A 2AS9A 1QRXA 1BQYA 2YOLA 4NSVA 1SPJA 4TPYA 1EPTC 1K9OE 5EW2H 2THFB 4IS5A 3V7TA 2XBVA 1ZSLA 3RXRA 1HAZB 3G01A 2VVCA 3UQOA 1MTNC 4LZ1H 1UMAH 4B71A 1MTVA 1TBZH 1MKWK 3H7OA 1CGIE 1BOQA 4MG3A 3I29A 3PMHB 4THNH 2OQUA 1MUEB 4CBNA 3HGPA 4AYVB 4X8TH 6GCHF 3KEEA 1O3OA 3RXKA 2A1DB 1LVMA 4ZXXH 3KHVA 4NFFA 1QJ6B 1EJMA 5FX5A 4E05H 1O39A 1WBGB 1GI1A 1GBAA 1Z8IB 1THSH 3A80A 1SL3A 2ZCLP 3TJVA 4I8HA 1C4U2 1NC6A 1O3FA 2Z6BD 4Y76A 2Z3CA 3SUEA 1GBFA 4WJG2 1YPGH 4H6TA 1QB1A 4YOIA 3DFJA 4BXWA 2ZFFH 1C5RA 3P8FA 1CVWH 1RD3B 1MAYA 1DS2E 2XRCA 1HAPH 1GMHF 1A7SA 2TGTA 3BV9B 3RLYH 3O8CA 3E3TA 4CH8B 2Z9LA 3MYWA 1O5EH 5FHTA 4K5ZA 3P6ZB 3BSQA 2VB0A 5HMAA 3S9CA 3HKIB 1L1NA 1M9UA 4IGDA 2FOFA 5AHGH 1KDQB 1H1BA 2A0QB 2C4FH 3OY5U 3LGUA 1CHOF 1QFKH 1C5OH 3VFEA 1MQ5A 1THRH 2ZHEH 2D26C 4XDEA 3RXLA 1WCZA 1HLTH 2PKAA 2BXUH 1GBCA 2IPHA 5AVDA 2A2XH 1AY6H 1F92A 1ANBA 5JB9S 3ZYEA 1NS3A 4X1RU 1F2SE 4K60A 4B76A 1EAIA 5EPNA 3U98H 1T8MA 1BRAA 1K1MA 1LKBA 3MWIU 2AMQA 3ZVFA 3RXPA 1Z6JH 3TK6A 3GY3A 4OGYA 1C1VH 3SHAH 1V2TT 1RJXB 4UE7H 3T29A 1O2RA 1O5AB 1DX5M 1NESE 1O2OA 2BM2A 1D3PB 2BTCE 1PQ8A 3ELAH 4Y11E 2UUFB 2P59A 2ZFRH 1HNEE 3SJOA 4B2CA 1W14U 1O2NA 1TE0A 1YYY1 3K9XB 5TJXA 1L4DA 3K65B 4X8SH 1JIRA 1SBWA 2NU0E 2SNWA 4INLA 1S6FA 3UNRA 1GBEA 3S69A 4Y8YA 1A2CH 3A8AA 1GCDA 2V3OH 1AE5A 5DO4H 1XUJA 2V35A 2H5DA 2M5TA 5B6OA 2FDAA 4NIXA 1K1NA 3M5NA 1TAWA 1LHFH 1SB1H 3Q3YA 4LZ4B 1YPKH 3HATH 1SLXB 1GVKB 1G9IE 1EAWA 1GL0E 1PQ5A 3RXAA 4AFUA 2GGVB 1W10U 2FIRH 2QXIA 2A4OA 1GCTB 4JZ1A 3NXPA 3UUZA 1C1QA 2GD4B 4I33A 1LPKB 1P0SH 2BY9X 3RXUA 1GJ7B 1ZZZA 3GYMA 4MNXA 1A5GH 1GMDG 1WTGH 2EI7A 2NU4E 1P11E 1TNHA 4CRDA 2VIVA 3ITIA 1GI7B 1F5RA 1HAXB 1LHDH 1O3EA 1FIZA 1CSOE 4Y8ZA 3BEFB 4CRAA 2J92A 5FBIA 4UEHH 3SQHE 1DOJA 5J4SA 3S0NA 4AORA 2F9VA 4NA9H 3SJIA 1KIGH 4MTBA 1VCPA 1Z8JB 1KLIH 1O2QA 4FUDA 3SN8A 1MTSA 1J15A 1OYTH 1WV7H 1C1PA 2ZG0H 4B2AA 3PROA 1HAHH 1XVMA 3P8NA 1FZZA 1F5KU 3UWIA 3T28A 3SORA 1GJAB 3L6PA 2FLBH 4VGCB 3D23A 1YKTA 1AU8A 3S9AA 4XE4A 1CE5A 4MVNA 2WINI 1EAUA 1HAVB 3Q76A 1CBWB 2H1UA 3DA9B 3LIWA 2ZFQH 4U32A 3F9GA 1UTQA 2GT7A 3EYDA 3LDXH 1C2KA 1S82A 5FPYA 1ETTH 5JYIA 4Q80A 1UVSH 3M7UA 5EODA 1GBHA 1VGCC 4K8YA 1LMWB 1G37A 1O3BA 1MTUA 4NA7A 4AGKA 2ZTYA 7LPRA 4KKDA 4H42U 5F8XA 5F6MA 1BMAA 1MBQA 3PTBA 1EP5A 5A2MH 3RU4D 1O38A 2OXSA 2AGIX 1NRRH 1SG8B 1HAOH 3FP6E 1BRCE 1RRKA 4Y71A 2BQWB 1O3HA 1AI8H 4AN7A 2PWXA 4ISOA 2OCVB 1GJ5H 1F7ZA 5F8ZA 2ANYA 2FI5E 3MU8A 2ZCKP 4WMDA 3EGKH 2QXGA 6CHAB 4A1XA 2CN0H 4FUIA 4ZMAH 2G52A 1WUNH 3BTKE 4E7NA 1EZXC 1V2PT 3E1XB 1S81A 4FUBA 2GCHF 4LK4A 3T2NA 1IQIA 3R3GB 1XXDA 5GCHG 1CA8B 3SNBA 1QRZA 3TLOA 1TWXB 5E2PA 4FVBA 1KYNA 1CHOG 4NCYA 1GHAF 3FVFB 1KTTB 4WXIA 4OS6A 3A85A 1XKBC 3DT0H 3URCA 2YNAA 2ANMH 1NT1A 1P2IA 1TRMA 1PJPA 1LPGB 4DT7B 4D9RA 2A31A 4IBLH 2CF9H 3RXQA 4WXVA 1D4PB 4YT7H 2AEIH 1TNLA 1TBRH 4F49A 1YC0A 1GMHG 4YZUA 1BTZA 3LU9B 1SVPA 2A4GA 3U9AH 1BIOA 1EJNA 4I7YH 2ZPQA 1XUKA 1MKXK 1K22H 4X2VA 3U1JB 2UUKB 4WVPE 2BDAA 3VXFH 3EDXB 1JIMA 4PROA 2BQ6B 3T5FH 3TH4H 3IG6B 3MNSA 5T6GA 1Y3XA 2Z9IA 1SGRE 3LGVA 3P17H 3M7QA 3SUFA 3BTFE 2H9HA 1AKSA 2VVUA 5C3NA 3TK5A 1O2HA 1NTPA 3QZRA 3CS7A 5DP3A 3RMMH 2R3YA 1ZSKA 1XMNB 5DP5A 3PM3A 1KLTA 4U30A 2HALA 2AERH 4E7RG 3VB4A 1UTPA 2R2WU 2VIOA 1LPZB 2WUCA 3PLPA 3PMAB 3STJA 1E35B 1NM6A 1AN1E 2GCTC 3TVJB 2GMTC 3RXGA 4BNRA 1C1SA 4X8VH 9ESTA 1GI5A 2PSYA 4IC5A 1QJ7B 2XC4A 2P3FH 2R2MB 4WMEA 1NROH 1BHXB 2FOAA 4Y8XA 4GSOA 1BTUA 3WY8A 2BYAX 1GVZA 2XCNA 4BXSA 2F3CE 5DGJA 2QYIA 3A7YA 1KSNA 1T8LA 1GJ6A 1DLKB 3OSYA 2NU1E 4HZHA 3M36A 2AMPA 4TWYA 2RA0A 1NZQH 1QRWA 3T27A 3S7KB 1EKBB 2ASUB 3P70B 3MH4A 1QURH 2VIWA 3QGNB 4FUEA 2VIPA 2BY5X 1LVYA 3BIUH 1K21H 3M35A 1ABJH 5I25A 4A5TS 2ODQA 4JZIA 3RXVA 2WYJA 1D3TB 4D7FA 2XC5A 1J9CH 1ZTLA 2VWMA 2ZI2H 1IAUA 3A7ZA 3GY8A 3TITA 3V12A 1O5GH 3QTVH 1LTOA 2TPIZ 1GGDB 1ELTA 3SNDA 1MCTA 5A8YA 1V3XA 1XKAC 4RN6A 1LO6A 4MNWA 8ESTE 4DJZB 3V3MA 5GCHF 1K1LA 2OD3B 1NRSH 1AUTC 1HAGE 1BB0B 4XBBA 3ZZ8A 4IN2A 1ETSH 3SNAA 1GHVH 3MO6A 2FOEA 1KTSB 1QNJA 1ELVA 4Q2KA 1ZRBA 1OKXA 1OP8A 2LPRA 1NFWA 2P95A 5E0HA 1SLWB 4JZEH 3I78A 4B1TA 2BOKA 2ZU4A 2G55A 4FXGH 4WY3A 1GJ9B 2HRVA 5C67A 4NZLA 2BD9A 1TIOA 2A7JA 1P01A 2EI8A 3PMJA 3PYHA 4TPIZ 5JBTA 2Z9KA 2CXVA 4X6PA 2G00A 3GICB 3ATMA 1RIWC 3RC5A 2IOTA 1QQUA 2P94A 1P09A 1ZTKA 1GI3A 3BTGE 3GDUA 4MLFB 1TPPA 1AMHA 1T8NA 3P8GA 3KQCA 3S9BA 1L1GA 2ESTE 2J94A 1DM4B 1W8BH 2RCEA 1HRTH 4ZUHA 3UOUA 1PYTC 3GOVB 1EAXA 2ZHWH 4AG1A 2BB4A 1A4WH 1ELFA 1P3CA 1EASA 1SGFA 1XUHA 3MU0A 4JK5A 1GCTC 4IC6A 5EOKA 3ZZ3A 1C1OA 1E0FD 2OC7A 2Q1JA 4CBOA 5FCRA 1O0DH 5CHAC 5JBBS 1OSSA 1BTHH 1GHXH 1IHSH 1Q2WA 1NY22 1DLEA 2P93A 4J1YA 2BDYA 1SQTA 3JZ1B 1OP0A 1C2IA 1ZOMA 1SGYE 3QTOH 4ZHMU 1MZAA 1B0EA 1YCPM 2J9NA 4O03A 4BTTB 4CR5A 2A5AA 1ELEE 3DHKH 2BD7A 5LPRA 2C8ZB 1S6HA 4Y10E 1FUJA 2ZDVH 2Q6FA 1F0SA 5E2OA 1V2VT 1QJ1B 3A7XA 4A92A 1DE7H 1GHBF 4CRGA 1FY1A 4NFEA 2I6SA 1BBRE 1AD8H 1C5ZB 1C2JA 1O3GA 2BD8A 4ZHLU 3S7HB 4CREA 3OYPA 1GBDA 1C2LA 1SHHB 1HGTH 3NKKA 4KELA 5F03A 1EOJA 2TRMA 2OUAA 3NK8A 2OLGA 2GZ8A 1C1RA 4YO9A 3KNXA 4NIYA 3SUDA 4O3UA 1O35A 1S83A 3R0FA 1IQNA 1U6QA 3T62A 1D6WA 1P2JA 3VB7A 3ODFA 3OU0A 2ZU5A 1P2KA 4BOHA 1O33A 1W3CA 3UREA 2Z94A 3SQEE 1FJSA 1PPEE 2C93B 1C5XB 4U2WA 1P3EA 5L6NH 1O2JA 1TGCA 4KGAA 4R0IA 2AMDA 3SBKA 3FZZA 5JPMH 1DT2A 3PWBA 1MD8A 1CQQA 2ALPA 1NFUA 2BDCA 4KTSA 2BD2A 1FQ3A 1HPGA 5DKMA 5K0HA 1E38B 3KN2A 3MU4A 2UWOA 4GHQA 2ZECA 1Y3YA 1C2HA 1KXCA 1L0ZA 5CMXH 3ZYDA 1TYNA 2P3UB 1DWBH 1GBMA 1TA2A 1KXAA 3BG8A 2A2QH 4UFEH 1SFIA 4ZKOU 1HAVA 1O3KA 1BMMH 1EOLA 1EP6A 2SGPE 2TIOA 3LH3A 2HVXA 7ESTE 3QDZB 2ZIQH 1N8OC 1ABIH 2JH0D 4X6MA 2GZ7A 4NZQA 1TPSA 3HPTB 1P02A 3SU0A 1XUFA 1FONA 1S84A 2ZTZA 3BIVH 2C8WB 1JXPA 3RXOA 1G3DA 1B0FA 1TB6H 1HCGA 2XBYA 1SFQB 3B9FH 1QCPA 1SOTA 1AFQC 5DK1A 2EEKA 2QA9E 3KIDU 2QY0B 1QB9A 4Z0KA
chains in the Genus database with same CATH superfamily
5JB8S 1ZGIA 1FXYA 1FPCH 1BITA 2IJD1 4CH2B 1W0ZU 1TMUH 1O2IA 1GBIA 1DY8A 3FANA 4I8KA 2OP9A 4LOYH 7GCHF 4OS4A 4Y0ZE 1P9UA 1CT0E 4BAQB 5SGAE 4OS2A 4Z6AH 4CRCA 4DW2U 3W94A 1C5TA 1F0TA 1SQOA 4MPVA 2Y7ZA 4AC9A 1TONA 4TY6A 1DWDH 3EE0B 2J2UA 2BD4A 3ZVCA 1K1JA 2V0BA 1EQ9A 2JETB 1HJAC 5C2ZA 2BD5A 1AFEH 5T6DA 1FNIA 1VJAU 1P9SA 2Y82A 5A0BA 3SZNA 1K0HA 1F0RA 2AFQB 5A0CA 1GG6C 4KTCA 2PTNA 5PTPA 5EIYA 3F9HA 2ZDLA 2BDIA 2SGQE 2ZPSA 1EXFA 3F2HA 3A7TA 2JJ1D 1XVOA 2KCYA 5CHAB 1TFXA 1UK4A 3CP7A 1AUJA 2XCFA 4Y7BA 5HKKD 1XM1A 4YLUA 2Z7FE 1C5UA 3FFGA 4UFGH 1CGJE 5AFZH 2O9QA 1FN8A 1GBJA 2JH6D 2QV1A 5FPSA 2G4UA 3F1SB 1UTNA 1FI8A 3F68H 3M5LA 3RXFA 4B73A 2EA3A 1TX7A 3QN7A 2WPJS 3TGKE 1CO7E 3QK1A 1ANDA 2O8WA 2ZZUH 1GHAG 2PFEA 2VVVA 1TPAE 1CGHA 2A5KA 2GTBA 1Z6EA 2XBWA 4X2XA 1JBUH 4RKJB 3UIRA 3VGCC 1OHHD 1UVUH 2Z3DA 2ZNKH 1TGSZ 1OWEA 3KCGH 5GDSH 4B74A 1WXRA 1A46H 4K69A 4IN1A 4B2BA 2FTLE 2P8OB 1SMFE 4TT3D 2WZQA 4UFFH 1E1QD 4HG6A 2ZPRA 2UWPA 3D65E 2VWLA 2PR3A 3ATKA 1MMJN 1TOCB 1UVTH 3LC5A 2VNTA 3SU4A 3PLKA 3FAOA 2BY8X 4FUJA 3QO6A 3TJNA 3ZZAA 1O2GH 3GYLB 5GJ4B 2XTTB 5LPFA 1KDQA 1GJDB 2OBOA 1SGPE 3C27B 3TJOA 4DT4A 1XXFA 2FX6A 2KM0A 2PHBA 1BMLA 1SR5C 3RU4T 1NFXA 2BDBA 2XNIA 1Z8RA 2ZDMA 1H9IE 1O2SA 2OTVA 4RT0A 5I46H 5L2YH 1HIAB 2P3TB 2W7SA 3M3VA 2BY6X 5A8ZA 1ZTJA 5C94A 1V2QT 5EQRA 6CHAC 1IQMA 1TLDA 1AIXH 3RLWH 2ZHDA 3SV7A 3KGPA 1O2YA 1J17T 2L74A 3C1KA 1T8OA 1SLUB 3H09A 3PO1B 4TSFD 2FZZA 4CR9A 1V2RT 2JH5D 2PV9B 1LCYA 4UONA 1K2I1 1B7XB 3HGNA 1EATA 1DUEA 1YWUA 1V2LT 1VKYA 3AW1A 4YT6H 5IYTA 1YP9A 2OQ5A 3D49H 3A87A 2OBQA 1IQKA 4K1SA 1PPGE 4GHTA 3SHCH 1LQDB 1TRNA 3KL6A 4AFSA 1BRBE 1AWHB 3LH1A 1P2NA 1O2KA 3UB0A 3ZZBA 1V6DA 5DP9A 4AB9A 2GZ9A 2C8YB 4AFZA 4BAOB 2FX4A 2NU2E 1P2QA 1L1JA 5EQSA 1P06A 4ZH8A 4GPGA 5F8TA 4FU8A 1H9HE 1C5NH 2W3KA 4ABGA 2CGAA 4J2YB 2SFAA 1P05A 2ZEBA 2BXTH 1ELGA 1PPZA 5EG4A 1XUIA 2F9NA 3M5MA 3UFAA 5C1XA 1O3DA 2HPQH 1BMNH 5C0TA 4DOQA 4ABJA 1QL7A 1SQAA 1QA0A 5E8EH 3IWMA 1TABE 1UVPA 1T32A 4FVDA 2TGPZ 3FOAA 3ZVEA 3A7VA 4MQAA 4Q63A 3VXEH 4Q7ZA 1FN6A 4CHAB 1E34B 4O9VA 4DGJA 2R0KA 3F6UH 2ALVA 3PV4A 3RXDA 5EW1H 5ETXA 4JYUH 1DWCH 1L2EA 1C2GA 2VINA 1NRPH 4H6SB 2GT8A 2BX3A 3D62A 2WPHS 4ABDA 3GCHB 3JZ2B 2FLRH 1SSXA 4HI3A 5AFYH 3E90B 1BA8B 2LNCA 3FP7E 2VH0A 3M5OA 3ATIA 1TNJA 3OY6U 3NUMA 3B23B 5A09A 1IQFA 2BDGA 4MPWA 1OOKB 4MPXA 5JBAS 2O8UA 1IQJA 1UTLM 1W2KH 4MPUA 4YLQH 4X2YA 5C1UA 3RXJA 3WWBA 1H8ED 2ZHQH 3MFJA 1ZHRA 2ZDNA 3GY7A 4XBCA 1W0YH 4WWYA 5C5OA 1TMBH 1O31A 2FESH 1HJ9A 1UCYE 1OWKA 1FDPA 4YM9A 2TBSA 3ENSB 2VU8E 1AO5A 3IITA 2XWAA 3GDSA 3BG4C 3KQEA 1CA0B 1O2ZA 1GHWH 3HK3B 2STAE 1OWDA 4RSPA 5EXNA 3ZVDA 3EE7A 3U8OH 2F9OA 3NWUA 1Y3UA 1HDTH 1BTPA 1ACBE 1GVLA 4BTUB 1AVWA 1QGFA 4X1QU 4Y0YE 1THPB 1GBTA 3LJOA 2A5IA 2Q6GA 3HKJB 2HNTC 4B6EA 1D9IA 5EQQA 1UHBA 2FTMA 1V2JT 1N8OB 4F4OC 1AHTH 1PYTD 5EJ1A 4WH8A 2HLCA 2C3SA 1VJ9U 2ZDKA 5HM2A 2FOMB 2Y5FA 2ZWLH 1P04A 2WV9A 4RI0A 1UTJA 5ABWA 1LVOA 2CHAB 3TNTA 3ZZ7A 2PGQB 1AVGH 2GCHG 1BBRH 3U8RH 1SGIB 3RP2A 1NRQH 4GCHF 1C5LH 1EFRD 1C5PA 1DDJA 1L4ZA 2KFWA 1O2XA 1C5QA 4VGCC 1JRTA 3Q00A 2BZ6H 1MKXH 1QQ4A 4ABBA 1RXPA 3GCTG 1B5GH 1AZ8A 1BJVA 3V0XA 1BMFD 2AIPA 1RIWB 1O3LA 2YMSC 1LVBA 4DG4A 1YPHE 2ZO3H 3GY5A 1QL8A 2WPKS 1MU8B 2W3IA 4JMYA 3UAIC 4ESTE 2VWNA 1BDAA 5EGMA 1UCYK 4UD9H 3SJKA 1N6XA 2ZKSA 2WPDD 5G4BA 4M9FA 1JWTA 3GCTF 2F83A 1LKAA 4IW4E 4RT1A 1Z71A 4FUGA 2BD3A 3PLBA 4CHAC 2NWNA 1C1UH 1Y3VA 2FWWA 5TCCA 1SLVB 3QZQA 1Y59T 3GY4A 1A3BH 2CF8H 2OC1A 2SGDE 2Y81A 1GHYH 1GI4A 1C2DA 1CBWC 1O32A 2ZGHA 5E0GA 1ELDE 4SGBE 3TGIE 3AASA 1O34A 2B7DH 1JOUB 4WMFA 1NU9A 1HV7A 2FPZA 3M61U 2W7UA 3M3TA 5GPIB 4SGAE 1C1WH 2FS8A 3RC4A 2R0LA 3TU7H 3VB5A 1QBNA 1ZR0A 3SU2A 1O30A 1SGNE 2M2AA 1PPBH 1YLCA 2FO9A 4I31A 1TOMH 1VITF 2CMYA 2G8TA 1C1MA 2WYGA 2Z9JA 1MAXA 1AVXA 3HK6B 4NSYA 4JK6A 4JYVH 1W7GH 3ZZ9A 2V7QD 4FUCA 3UNSA 3QGJA 2K0QA 1GBLA 4RKOB 3RXBA 2Q6DA 2Y7XA 4TYDA 3PB1E 2RG3A 2C90B 1KXEA 2Y5GA 1ZJKA 4D76A 4NIVA 1H8HD 3W1EA 3UY9A 3A8DA 4OS1A 1YM0A 2ZU2A 1ESBA 3SV2H 1NN6A 3PO1C 3SGAE 2XWBI 3A83A 1TNIA 1A61H 1A0HB 4O3TA 1RFNA 1GDNA 1G3CA 5L30H 2DE8A 2PW8H 3OTPA 3TH2H 3GY6A 3SNCA 2ZFPH 4A7IB 3CENA 4ACAA 2RDLA 3Q77A 2IN2A 2PSXA 1NU7B 2AIQA 5GWZA 5LGOA 1JRSA 1TBQH 3MTYA 2EC9H 1TNGA 1QTFA 1ORFA 1T31A 1MBMA 4WF8A 1EJAA 1C2EA 4DIHH 1AFQB 2G51A 1FY3A 4ISNA 1GDQA 3SV6A 1EPTB 3UPEA 3ESTA 3EA7A 5C20A 1LQEA 3ZZDA 1O37A 1RS0A 1BUIA 1O5DH 3T25A 1FX0B 2IPQX 3E8LA 4DIIH 1BHXF 1G2LA 2FXRA 2QXHA 3WW7A 1O5CB 1AE8H 1SGTA 2SGFE 2QF0A 3H7TA 4TY7A 5AF9H 6LPRA 3A8BA 3RM0H 2PTCE 4ZKSU 3SU6A 1YGCH 2GV7A 1GMDF 1P03A 4P00A 3OFND 4A1VA 1ID5H 1H8IH 1O3CA 2FOCA 1QL9A 3SOSA 4GAWA 1HB0B 1E37B 1XX9A 1AWFH 7GCHG 3LKWA 3UWJH 5FAHA 1XUGA 3RUOA 4OS7A 4MNYA 1FMGA 2FS9A 5DSFA 1ZPZA 5ESTE 4OGXA 4QT8C 1BTWA 1WSSH 1YPMH 2QIQA 2ZF0H 3PRDA 4LXBH 2H9TH 1MQ6A 3N7OA 3U1IB 1Y5AT 1EB2A 3V13A 1G3BA 1O2LA 3M7TA 1HIAA 2XOKD 3ZZ4A 3F0PA 1FPHH 3RXTA 1SC8U 2O8LA 1ZHMA 4ZXYH 3GCHC 1PQAA 1OWJA 1W0JD 8GCHF 4YOGA 4K1TA 1C1NA 4D9QA 5E0JA 1ELBA 1FLEE 1QR3E 1ZJDA 2PKSC 1SHYA 3AW0A 3A81A 3LPRA 3RDZA 1DXWA 2ZTXA 4XOJA 1COWD 1G2MA 3GY2A 3E91A 2A45B 4ZAEA 1ZMLA 1EPTA 1IHTH 1J14A 1A5IA 1FY4A 1Y5BT 2ODPA 1N1LA 1A1RA 1H9LB 5DP7A 3SU1A 1W11U 1YPLH 1TALA 1BCUH 1HJAB 4JZDH 1MU6B 1P57B 4D8NA 3TGJE 1GHZA 2JDID 4BTIB 3GISB 1C9TA 2VIQA 4I32A 1O2WA 4Y7AA 5L2ZH 1ZHPA 1GJ8B 1GI8B 4DY7B 4A1TA 3M3SA 1CT2E 2XBXA 3SI3H 1IQHA 2D2DA 2H6MA 1C2MA 1O36A 4GCHG 4INKA 3FO8D 2F91A 3A8CA 4X1SU 3LGWA 1RTFB 5T1VA 3ZZ6A 1EZUC 1P2OA 3U8TH 3VPKA 2ZP0H 3SJ8A 1OX1A 2P8OC 3RXMA 4YTAA 9LPRA 2AGGX 1CA0C 1GWAA 1G3EA 3AAVA 2NU3E 1EUFA 1Y3WA 2GV6A 5LH8A 4X0WU 1H8DH 1A0JA 2A4QA 3SI4H 2A32A 1ZLRA 3VGCB 5ESBA 3ZVGA 2FODA 3E6PH 5A8XA 4YXWD 2WV4A 2SNVA 2QF3A 2BZAA 2LELA 2HPPH 1GHBG 5J4QA 2F9BH 3NZIA 2XW9A 1C5WB 3RC6A 2H2ZA 1GBKA 3UQVA 1RTLA 1SOZA 2PP6A 1WTHD 1O3PB 2OC8A 3ZV9A 2PLXA 1Y5UT 2PGBB 4HTCH 4Q7YA 3UR9A 6GCHG 2ZGXH 1E1RD 4YESB 1QBVH 2ZQ1A 8LPRA 1AB9C 1MZDA 5DPAA 3OX7U 1QB6A 3OTJE 2VGCB 2B9LA 3AAUA 1YF4A 2HWLB 3RXHA 4E06H 4ABEA 1MD7A 1ZMJA 2ANWA 5EXLA 3MH7A 1LHGH 1Z1IA 4K1EA 1UHBB 1WQVH 1BJUA 1GJ4H 3QUMP 5H4IB 1O3MA 1AKSB 3BEIB 2BDHA 1PPHE 1GI6A 4AB8A 2PKSB 3MNCA 1BTYA 2KAIB 1AQ7A 3OE7D 1W13U 1MABB 1UK2A 1NPMA 4ZCNA 2WPLS 1GG6B 1KXFA 1C5MD 2W6ID 2O8MA 3P92A 4X8UH 2VGCC 1J16A 1C9PA 1AB9B 1FIWA 5BRRE 4X6OA 2JIZD 5C1YA 5K7RA 2W6JD 4ABIA 1K1IA 3BTQE 4FU7A 1T4UH 1UK3A 5CDFE 4FUFA 4NG9H 2WUBA 2CJIA 2F43B 1P8VC 4FETA 3E16B 4JYTA 3TH3H 2K1QA 1UCYH 2QAAA 1INCA 4GLYA 3OEED 1KLJH 3SV8A 4Q7XA 1KMHB 1ELAA 2ZQ2A 1HFDA 3VB3A 6ESTA 1BTXA 1Z7KA 3RXEA 3UTUH 2GKVE 3ATWA 4X2WA 1RTKA 2I6QA 1WDIA 3AVZA 2A7CA 1BT7A 3MU5A 2WPMS 2F4LA 4JCNA 1MH0A 1J8AA 1X7AC 3DSGA 1KXDA 1C1TA 4INHA 5HYOA 1IOEA 1W12U 1PPCE 1TQ7B 2ILNA 5JDUB 4DVAU 1Y8TA 1EX3A 4FU9A 5DG6A 1IQEA 1ZPCA 3DUXH 3MI4A 1C4V2 3SGQE 1HUTH 8GCHG 2FP7B 4AFQA 1AGJA 3LGIA 4WH6A 3ZVAA 2BLVA 2GVFA 1D6RA 2ZFTA 1UTOA 1FY8E 4CRBA 1VGCB 2BX4A 2JETC 1SGDE 2AGEX 1NBMD 2PKAB 5FBEA 3UNQA 2BLWA 4AG2A 3LGTA 5EPYA 1OPHB 2BLQA 5DP6A 2FOBA 1OYQA 2D1JA 1ANCA 4NWKA 1HYLA 1ESAA 2ZFSA 2ODYB 3B8JA 3NPSA 2GDEH 1KY9A 2J34A 1GPZA 4BAHB 1G30B 1V2KT 4I8JA 1CT4E 5HXFA 2XYAA 4GVUA 4X1NU 2BQ7B 1D3QB 2WV5A 3GCNA 3NCLA 3SJ9A 3RMLH 4FUHA 3SO3A 1S5SA 4ISHH 3SW2B 3I77A 3LOXA 1YLDA 3MO9A 3EA8A 2G5NA 4YOJA 4DCDA 3BN9A 4ABHA 1NRNH 3QWCH 1A0LA 2D8WA 2BOHB 1D3DB 1UJ1A 2UUJB 1MCVA 1TGNA 3STIA 3A7WA 4JZFH 3MH5A 2F9PA 2G5VA 3GS9A 3VEQB 1MTWA 5FXLA 3MHWU 2B5TB 2XC0A 5C5NA 1E36B 1UO6A 1FAKH 1HAYB 1DFPA 1EB1H 3FKSD 1A5HA 2H5CA 1O3IA 2PUQH 2HVYB 2HNTE 2HLDD 5EU8A 1SI5H 4BANB 1GL1A 2FMJA 1K28D 2FOHA 1VCQA 4ISLA 3SUGA 2FYRA 2BLOA 4NGAH 1ARCA 4GUXA 2JKHA 1BZXE 3RXSA 1YCPK 2TGAA 3EA9A 1JMOH 2V6NA 2KCPA 3K6YA 1DSUA 3Q3KA 1ANEA 1SGQE 1C5VA 2ZC9H 3RMNH 3OEHD 4ZKRU 1PPFE 1P10A 1SGEE 2W26A 3SGBE 3DD2H 1SGCA 1V2UT 1Z8GA 2GP9B 1QY6A 1AZZA 3KF2A 2SGAA 3BG4B 4XFQA 5DP4A 2P16A 1OXGA 2Z9GA 4BAKB 2ZA5A 2ANKH 3F9FA 1S0QA 4KTUA 2GX4A 2VIDA 1PQ7A 1TPOA 1QHRB 2BVRH 2JJ2D 2J95A 1VITG 1CHGA 1TA6A 1WAYB 3GCOA 4ZHAA 4BAMB 4OS5A 4MNVA 3BTTE 1HXEH 2OINA 1DY9A 4HFPB 2W5EA 5FCKA 3ODDA 1DXPA 3LGYA 3VB6A 1TGBA 1ZMNA 1ARBA 4X6NA 3BTME 3RXCA 5GXPA 1O2VA 4ZROA 2DE9A 2ZDAH 3ZZCA 3ATLA 4NWLA 4AZ2B 3MMGA 4NA8A 1ETRH 2STBE 1SKYE 5TCAA 3W95A 1DITH 1C5SA 3TIUA 1WU1A 2O8TA 2GMTB 1MTNB 3TJUA 3M37A 1Q3XA 4ZKNU 2J38A 2B8OH 2J5UA 5HM9A 1ZSJA 1O3JA 2EI6A 2YNBA 1VZQH 1WYKA 4Y6DA 3EAJA 1H4WA 1DWEH 3RXIA 1V2OT 3RU4E 1UW7A 2ZGCA 3F2FA 3LC3A 5DP8A 3A82A 3L3TA 2OK5A 3KQBA 1N6YA 1DVAH 1TGTA 2H9EH 4K2YA 2C8XB 3BTWE 2A7HA 3FP8E 3PMBB 1TMTH 3E0PB 1CU1A 1DPOA 3O8DA 5EXMA 3A88A 3BTHE 1OS8A 5HGGA 1RGQA 4DURA 5JBCS 3QLPH 2UUYA 2G81E 4UFDH 3UR6A 1GGDC 1F5LA 1O5FH 2VWOA 1GMCF 1VITH 1GJCB 1Q31A 1FY5A 3P8OA 4X1PU 2XXLA 1HBTH 1V2ST 2V3HH 2TGDA 2ULLA 1V2NT 2OC0A 1P12E 3MNXA 5FL7D 2QXJA 1MKWH 1EZQA 1YBWA 2KR7A 3ZZ5A 5FPTA 3KYGA 2QN5T 5EJZA 4XBDA 1BRUP 2KCOA 3TK9A 1IQLA 2Y5HA 1QIXB 1LHEH 1DICA 7KMEH 1TQ0B 5GIBA 1FV9A 5T3HA 1GI9B 2UWLA 1UVOA 1DUAA 4CRFA 1WQSA 4A6LA 1T7CA 2J4IA 2DUCA 2FI3E 1F0UA 3K6ZA 4IMQA 3P95A 3RM2H 1C2FA 3E0NB 5BPEA 2AH4X 3DCLA 3O8BA 4AGJA 1O2PA 8KME2 2VJ1A 1G36A 5FX6A 2GCTB 3K2UA 1SGFG 4I86A 1LHCH 2IJOB 1O2MA 2QE7D 2B0FA 2HOBA 3U69H 2FI4E 4IMZA 4R8TB 5CE1A 1OWHA 3L33A 1HJ8A 1TX6A 1WOFA 3URDA 3BTDE 1UTKA 5T6FA 2BHGA 1W0KD 1ZGVA 2YMSB 3MNBA 5KEDA 3F9EA 3A84A 3F3BA 4H4FA 2R9PA 2FM2A 3MH6A 3TPIZ 2BMGB 4I8LA 2J98A 1NFYA 1GBBA 2BVSH 2RA3A 1DSTA 4D7GA 3SU3A 1E79D 5B6LA 1W7XH 1HAIH 2CK3D 1KXBA 4K8BA 4AOQA 2BY7X 1GMCG 1V2MT 2QGRA 1QBOA 5HIYA 2ZCHP 3MOCA 4I8GA 3SNEA 3GDVA 2QC2A 5A0AE 4MDSA 1ZRKA 2CHAC 1DANH 2RFKC 1QA7A 3O8RA 3H5CB 5LPEA 1EZSC 1O5BB 1QZ8A 1T4VH 3ZV8A 4Q4LA 1VR1H 1O3AA 2QCYA 1P2MA 5DJ7A 1GJBB 2AYWA 3DFLA 3BF6H 1ZYOA 3MU1A 2PUXB 3KQDA 1TNKA 3TNSA 4O97A 1HXFH 1PFXC 4KP0A 2VH6A 1O3NA 2CV3A 3RMOH 2Y80A 1S0RA 4UDWH 1NO9H 4ABFA 3LT3A 4Y79A 4TWWA 4AYYB 3A86A 4K3JA 4ABAA 4NIWA 1Z1JA 2HGTH 3UOPA 1ELCA 1ZPBA 1C4Y2 3T26A 1GI2A 2G4TA 2FOGA 2A4RA 1O2UA 2SGEE 4M7GA 1YCPH 3QX5H 3DSPA 3FZDA 2KAIA 1TX8A 1YPEH 3PWCA 2HNTF 1S85A 2RDEA 1G32B 1LDTT 1BBRK 1V2WT 2Z3EA 4XD7D 2ZHFH 1C5YB 2ZU1A 1A3EH 1GI0A 2F9UA 3A89A 2Y6TA 1YPHC 1YPJH 4HGCA 2WPIS 3LJJA 2GDDA 3BTEE 4AX9H 4U01A 3BEUA 1VCWA 5IDKA 1K1OA 1GDUA 3SV9A 4XSKU 2R3UA 2FYQA 1OWIA 3LONA 3OAAD 2ZGJA 3EQ0H 4ISIH 3MO3A 1ESTA 2ZU3A 2BVXH 3ZVBA 3Q3XA 3PTNA 4B75A 1UTMA 2FEQH 1OP2A 1TRYA 1IQGA 1FAXA 1K1PA 3CS0A 1O2TA 2ZGBH 3SU5A 3VG8A 2AS9A 3CNRA 1QRXA 1BQYA 2YOLA 2KCAA 4NSVA 1SPJA 4TPYA 1EPTC 1K9OE 5EW2H 2THFB 4IS5A 3V7TA 2XBVA 1ZSLA 3RXRA 1HAZB 3G01A 2VVCA 3UQOA 1MTNC 4LZ1H 1UMAH 4B71A 1MTVA 1TBZH 1MKWK 4B6FA 3H7OA 1CGIE 1BOQA 2KX4A 2KZ4A 4MG3A 3I29A 3PMHB 4THNH 2OQUA 1MUEB 4CBNA 3HGPA 4AYVB 4X8TH 6GCHF 3KEEA 1O3OA 3RXKA 2A1DB 1LVMA 4ZXXH 3KHVA 4NFFA 1QJ6B 2QF5A 1EJMA 5FX5A 4E05H 1O39A 1WBGB 1GI1A 5F53A 1GBAA 1Z8IB 1THSH 3A80A 1SL3A 2ZCLP 3TJVA 4I8HA 1C4U2 1NC6A 1O3FA 2Z6BD 4Y76A 2Z3CA 3SUEA 1GBFA 4WJG2 1YPGH 4H6TA 1QB1A 4YOIA 3DFJA 4BXWA 2ZFFH 1C5RA 3P8FA 1CVWH 2LP6A 1RD3B 1MAYA 1DS2E 1YLNA 2XRCA 1HAPH 1GMHF 1A7SA 2TGTA 3BV9B 3RLYH 3O8CA 3E3TA 4CH8B 2Z9LA 3MYWA 1O5EH 5FHTA 4K5ZA 3P6ZB 3BSQA 2VB0A 5HMAA 3S9CA 3HKIB 1L1NA 1M9UA 4IGDA 2FOFA 5AHGH 1KDQB 1H1BA 2A0QB 2C4FH 3OY5U 3LGUA 1CHOF 1QFKH 1C5OH 3VFEA 1MQ5A 1THRH 2ZHEH 2D26C 4XDEA 3RXLA 1WCZA 1HLTH 2PKAA 2BXUH 1GBCA 2IPHA 5AVDA 2A2XH 1AY6H 1F92A 1ANBA 5JB9S 3ZYEA 1NS3A 4X1RU 1F2SE 4K60A 4B76A 1EAIA 5EPNA 3U98H 1T8MA 1BRAA 1K1MA 1LKBA 3MWIU 2AMQA 3ZVFA 3RXPA 1Z6JH 3TK6A 3GY3A 4OGYA 1C1VH 3SHAH 1V2TT 1RJXB 4UE7H 3T29A 1O2RA 1O5AB 1DX5M 2L6OA 1NESE 1O2OA 2BM2A 1D3PB 2BTCE 1PQ8A 3ELAH 4Y11E 2UUFB 2P59A 2ZFRH 1HNEE 3SJOA 4B2CA 1W14U 1O2NA 1TE0A 1YYY1 3K9XB 5TJXA 1L4DA 3K65B 4X8SH 1JIRA 1SBWA 2NU0E 2SNWA 4INLA 1S6FA 3UNRA 1GBEA 3S69A 4Y8YA 1A2CH 3A8AA 1GCDA 2V3OH 1AE5A 5DO4H 1XUJA 2V35A 2H5DA 2M5TA 5B6OA 2FDAA 4NIXA 1K1NA 3M5NA 1TAWA 1LHFH 1SB1H 3Q3YA 4LZ4B 1YPKH 3HATH 1SLXB 1GVKB 1G9IE 1EAWA 1GL0E 1PQ5A 3RXAA 4AFUA 2GGVB 1W10U 5C0UA 2FIRH 2WHXA 2QXIA 2A4OA 4ASHA 1GCTB 4JZ1A 3NXPA 3UUZA 1C1QA 2GD4B 4I33A 1LPKB 1P0SH 2BY9X 5KECA 3RXUA 1GJ7B 1ZZZA 3GYMA 4MNXA 1A5GH 1GMDG 1WTGH 2EI7A 2NU4E 1P11E 1TNHA 4CRDA 2VIVA 2EQNA 3ITIA 1GI7B 1F5RA 1HAXB 1LHDH 1O3EA 1FIZA 1CSOE 4Y8ZA 3BEFB 4CRAA 2J92A 5FBIA 4UEHH 3SQHE 1DOJA 5J4SA 3S0NA 4AORA 2F9VA 4NA9H 3SJIA 1KIGH 4MTBA 2WSSD 1VCPA 1Z8JB 1KLIH 1O2QA 4FUDA 3SN8A 1MTSA 1J15A 1OYTH 1WV7H 1C1PA 2ZG0H 4B2AA 3PROA 1HAHH 1XVMA 3P8NA 1FZZA 1F5KU 3UWIA 3T28A 3SORA 1GJAB 3L6PA 2FLBH 4VGCB 3D23A 1YKTA 1AU8A 3S9AA 4XE4A 1CE5A 4MVNA 2WINI 3N7EA 1EAUA 1HAVB 3Q76A 3KYFA 1CBWB 2H1UA 3DA9B 3LIWA 2ZFQH 4U32A 3F9GA 2J97A 1UTQA 2GT7A 3EYDA 3LDXH 1C2KA 1S82A 5FPYA 1ETTH 5JYIA 4Q80A 4OM9A 1UVSH 3M7UA 5EODA 1GBHA 1VGCC 4K8YA 1LMWB 1G37A 1O3BA 3ZIAD 1MTUA 4NA7A 4AGKA 2ZTYA 7LPRA 4KKDA 3AK5A 4H42U 5F8XA 5F6MA 1BMAA 1MBQA 3PTBA 1EP5A 5A2MH 3RU4D 1O38A 2OXSA 2AGIX 1NRRH 1SG8B 1HAOH 3FP6E 1BRCE 1RRKA 4Y71A 2BQWB 1O3HA 1AI8H 4AN7A 2PWXA 4ISOA 2OCVB 1GJ5H 1F7ZA 5F8ZA 2ANYA 2FI5E 3MU8A 2GJGA 2ZCKP 4WMDA 3EGKH 2QXGA 6CHAB 4A1XA 2CN0H 4FUIA 4ZMAH 2G52A 1WUNH 3BTKE 5GNDA 4E7NA 1EZXC 1V2PT 3E1XB 1S81A 4FUBA 2GCHF 4LK4A 3T2NA 1IQIA 3R3GB 1XXDA 5GCHG 1CA8B 3SNBA 1QRZA 3TLOA 1TWXB 5E2PA 4FVBA 1KYNA 1CHOG 4NCYA 1GHAF 3FVFB 1KTTB 4WXIA 4OS6A 3A85A 1XKBC 3DT0H 3URCA 2YNAA 2ANMH 1NT1A 1P2IA 1TRMA 1PJPA 1LPGB 4DT7B 4D9RA 2A31A 4IBLH 2CF9H 3RXQA 4WXVA 1D4PB 4YT7H 3KQ5A 3N99A 5HIZA 2AEIH 1TNLA 1TBRH 4F49A 1YC0A 1GMHG 3N7DA 4YZUA 1BTZA 3LU9B 1SVPA 2A4GA 3U9AH 1BIOA 1EJNA 4I7YH 2ZPQA 1XUKA 1MKXK 1K22H 4X2VA 3U1JB 2UUKB 4WVPE 2BDAA 3VXFH 3EDXB 1JIMA 4PROA 2BQ6B 3T5FH 3TH4H 3IG6B 3MNSA 5T6GA 1Y3XA 2Z9IA 1SGRE 3LGVA 3P17H 3M7QA 3SUFA 5C17A 3BTFE 2H9HA 1AKSA 2VVUA 5C3NA 3TK5A 1O2HA 1NTPA 3QZRA 3CS7A 5DP3A 3RMMH 2R3YA 1ZSKA 1XMNB 5DP5A 3PM3A 1KLTA 4U30A 2HALA 2AERH 4E7RG 5EJLA 3VB4A 1UTPA 2R2WU 2VIOA 1LPZB 2WUCA 3PLPA 3PMAB 3STJA 1E35B 1NM6A 1AN1E 2GCTC 3TVJB 2GMTC 3RXGA 4BNRA 1C1SA 4X8VH 9ESTA 1GI5A 2PSYA 4IC5A 2XNDD 1QJ7B 2XC4A 2P3FH 2R2MB 4WMEA 1NROH 1BHXB 2FOAA 4Y8XA 4GSOA 1BTUA 3WY8A 2BYAX 1GVZA 2XCNA 4BXSA 2F3CE 5DGJA 2QYIA 3A7YA 1KSNA 1T8LA 1GJ6A 1DLKB 3OSYA 2NU1E 4HZHA 3M36A 2AMPA 4TWYA 2RA0A 1NZQH 1QRWA 3T27A 3S7KB 1EKBB 2ASUB 3P70B 3MH4A 1QURH 2VIWA 3QGNB 4FUEA 3SZEA 2VIPA 2BY5X 1LVYA 3BIUH 1K21H 3M35A 1ABJH 5I25A 5CHBA 2ODQA 4A5TS 4JZIA 3RXVA 2WYJA 1D3TB 4D7FA 2XC5A 1J9CH 3DSOA 1ZTLA 2VWMA 2ZI2H 1IAUA 3A7ZA 3GY8A 3TITA 3V12A 1O5GH 3QTVH 1LTOA 2TPIZ 1GGDB 1ELTA 3SNDA 1MCTA 5A8YA 1V3XA 1XKAC 3U28C 4RN6A 1LO6A 4MNWA 8ESTE 4DJZB 3V3MA 5GCHF 1K1LA 2OD3B 1NRSH 1AUTC 1HAGE 1BB0B 4XBBA 3ZZ8A 4IN2A 1ETSH 3SNAA 1GHVH 3MO6A 2FOEA 1KTSB 1QNJA 1ELVA 4Q2KA 1ZRBA 2LPRA 1OKXA 1OP8A 3SYJA 2QF4A 1NFWA 2P95A 5E0HA 1SLWB 4F55A 4JZEH 3F0OA 3I78A 4B1TA 2BOKA 2ZU4A 2G55A 4FXGH 4WY3A 1GJ9B 2HRVA 5C67A 4NZLA 2BD9A 1TIOA 2A7JA 1P01A 2EI8A 3PMJA 2AHME 3PYHA 4TPIZ 5JBTA 2Z9KA 2CXVA 4X6PA 2G00A 3GICB 3ATMA 1RIWC 3RC5A 2IOTA 1QQUA 2P94A 3NRLA 1P09A 1ZTKA 1GI3A 3BTGE 3GDUA 4MLFB 4Z1MD 1TPPA 1AMHA 1T8NA 3P8GA 3KQCA 3S9BA 1L1GA 2ESTE 2J94A 1DM4B 1W8BH 2RCEA 2K8IA 1HRTH 4ZUHA 3UOUA 1PYTC 3GOVB 1EAXA 2ZHWH 4AG1A 2BB4A 1A4WH 1ELFA 1P3CA 1EASA 1SGFA 1XUHA 3MU0A 4JK5A 5DN6D 1GCTC 4IC6A 5EOKA 3ZZ3A 1C1OA 1E0FD 2OC7A 2Q1JA 4CBOA 5FCRA 1O0DH 5CHAC 4ASUD 5JBBS 1OSSA 1BTHH 3PV2A 1GHXH 1IHSH 1Q2WA 1NY22 1DLEA 2P93A 4J1YA 2BDYA 1SQTA 3JZ1B 1OP0A 1ZOMA 1C2IA 4FOUC 1SGYE 3QTOH 4ZHMU 1MZAA 1B0EA 1YCPM 2J9NA 2V3MA 4O03A 4BTTB 4CR5A 2A5AA 1ELEE 3DHKH 2BD7A 5LPRA 1YY3A 2C8ZB 1S6HA 4Y10E 1FUJA 2ZDVH 2Q6FA 1F0SA 5E2OA 1V2VT 1QJ1B 3A7XA 4A92A 1DE7H 1SQRA 1GHBF 4CRGA 1FY1A 4NFEA 2I6SA 1BBRE 1AD8H 1C5ZB 1C2JA 1O3GA 2BD8A 4ZHLU 3S7HB 4F48B 4P02A 5IK2D 4CREA 3OYPA 1GBDA 1C2LA 1SHHB 1HGTH 1S6LA 3NKKA 4KELA 5F03A 1EOJA 2TRMA 2OUAA 3NK8A 2OLGA 2GZ8A 1C1RA 4YO9A 3KNXA 4NIYA 3SUDA 4O3UA 1O35A 3F2GA 1S83A 3R0FA 1IQNA 1U6QA 3T62A 1D6WA 1P2JA 3VB7A 3ODFA 3OU0A 2ZU5A 1P2KA 4BOHA 1O33A 1W3CA 4XRNA 3UREA 2Z94A 3FN8A 3SQEE 1FJSA 1PPEE 2C93B 1C5XB 4U2WA 1P3EA 5L6NH 1O2JA 1TGCA 4KGAA 4R0IA 2AMDA 3SBKA 3FZZA 5JPMH 4ACBA 1DT2A 3PWBA 1MD8A 1CQQA 2ALPA 3WWFA 1NFUA 2BDCA 4KTSA 2BD2A 1FQ3A 1HPGA 5DKMA 5K0HA 1E38B 3KN2A 3MU4A 2UWOA 4GHQA 2ZECA 2YMSD 1Y3YA 1C2HA 1KXCA 1L0ZA 5CMXH 3ZYDA 1TYNA 2P3UB 1DWBH 1GBMA 1TA2A 1KXAA 3BG8A 2A2QH 4UFEH 1SFIA 4ZKOU 1HAVA 1O3KA 1BMMH 1EOLA 1EP6A 2SGPE 2TIOA 3LH3A 2HVXA 7ESTE 3QDZB 2ZIQH 1N8OC 1ABIH 2JH0D 2VBCA 4X6MA 2GZ7A 4NZQA 1TPSA 3HPTB 1NBME 1P02A 2J98B 3SU0A 1XUFA 1FONA 1S84A 2ZTZA 3BIVH 2C8WB 1JXPA 5KGOA 3RXOA 2EY4C 1G3DA 1B0FA 1TB6H 3MQKC 1HCGA 2XBYA 1SFQB 3B9FH 1QCPA 1SOTA 1AFQC 3PV5A 5DK1A 2EEKA 2QA9E 3PRBA 3KIDU 2QY0B 1QB9A 4Z0KA
chains in the Genus database with same CATH topology
5JB8S 1ZGIA 1FXYA 1FPCH 1BITA 4CH2B 1W0ZU 1TMUH 1O2IA 1GBIA 1DY8A 3FANA 4I8KA 2OP9A 4LOYH 7GCHF 4OS4A 4Y0ZE 1P9UA 1CT0E 4BAQB 5SGAE 4OS2A 4Z6AH 4CRCA 4DW2U 3W94A 1C5TA 1F0TA 1SQOA 4MPVA 2Y7ZA 1TONA 4TY6A 1DWDH 3EE0B 2J2UA 2BD4A 3ZVCA 1K1JA 2V0BA 1EQ9A 2JETB 1HJAC 5C2ZA 2BD5A 1AFEH 5T6DA 1FNIA 1VJAU 1P9SA 2Y82A 5A0BA 3SZNA 1F0RA 2AFQB 5A0CA 1GG6C 4KTCA 2PTNA 5PTPA 3F9HA 2ZDLA 2BDIA 2SGQE 2ZPSA 1EXFA 3A7TA 1XVOA 5CHAB 1TFXA 1UK4A 3CP7A 1AUJA 2XCFA 4Y7BA 1XM1A 4YLUA 2Z7FE 1C5UA 3FFGA 4UFGH 1CGJE 5AFZH 2O9QA 1FN8A 1GBJA 2JH6D 2QV1A 5FPSA 2G4UA 3F1SB 1UTNA 1FI8A 3F68H 3M5LA 3RXFA 4B73A 2EA3A 1TX7A 3QN7A 2WPJS 3TGKE 1CO7E 3QK1A 1ANDA 2O8WA 2ZZUH 1GHAG 2PFEA 2VVVA 1TPAE 1CGHA 2A5KA 2GTBA 1Z6EA 2XBWA 4X2XA 1JBUH 4RKJB 3UIRA 3VGCC 1UVUH 2Z3DA 2ZNKH 1TGSZ 1OWEA 3KCGH 5GDSH 4B74A 1A46H 4K69A 4IN1A 4B2BA 2FTLE 2P8OB 1SMFE 4UFFH 2ZPRA 2UWPA 3D65E 2VWLA 2PR3A 3ATKA 1MMJN 1TOCB 1UVTH 3LC5A 2VNTA 3SU4A 3PLKA 3FAOA 2BY8X 4FUJA 3QO6A 3TJNA 3ZZAA 1O2GH 3GYLB 5GJ4B 2XTTB 5LPFA 1KDQA 1GJDB 2OBOA 1SGPE 3C27B 3TJOA 1XXFA 2FX6A 2PHBA 3RU4T 1BMLA 1SR5C 1NFXA 2BDBA 2XNIA 1Z8RA 2ZDMA 1H9IE 1O2SA 2OTVA 5I46H 5L2YH 1HIAB 2P3TB 2W7SA 3M3VA 2BY6X 5A8ZA 1ZTJA 1V2QT 5EQRA 6CHAC 1IQMA 1TLDA 1AIXH 3RLWH 2ZHDA 3SV7A 3KGPA 1O2YA 1J17T 3C1KA 1T8OA 1SLUB 3PO1B 2FZZA 4CR9A 1V2RT 2JH5D 2PV9B 1LCYA 4UONA 1K2I1 1B7XB 3HGNA 1EATA 1DUEA 1V2LT 5IYTA 3AW1A 4YT6H 1YP9A 2OQ5A 3D49H 3A87A 2OBQA 1IQKA 4K1SA 1PPGE 4GHTA 3SHCH 1LQDB 1TRNA 3KL6A 4AFSA 1BRBE 1AWHB 3LH1A 1P2NA 1O2KA 3ZZBA 1V6DA 5DP9A 4AB9A 2GZ9A 2C8YB 4AFZA 4BAOB 2FX4A 2NU2E 1P2QA 1L1JA 5EQSA 1P06A 4ZH8A 4GPGA 5F8TA 4FU8A 1H9HE 1C5NH 2W3KA 4ABGA 2CGAA 4J2YB 2SFAA 1P05A 2ZEBA 2BXTH 1ELGA 1PPZA 5EG4A 1XUIA 2F9NA 3M5MA 3UFAA 5C1XA 1O3DA 2HPQH 1BMNH 4DOQA 4ABJA 1QL7A 1SQAA 1QA0A 5E8EH 3IWMA 1TABE 1UVPA 1T32A 4FVDA 2TGPZ 3ZVEA 3A7VA 4MQAA 3VXEH 4Q7ZA 1FN6A 4CHAB 1E34B 4O9VA 4DGJA 2R0KA 3F6UH 2ALVA 3PV4A 3RXDA 5EW1H 5ETXA 4JYUH 1DWCH 1L2EA 1C2GA 2VINA 1NRPH 4H6SB 2GT8A 2BX3A 3D62A 2WPHS 4ABDA 3GCHB 3JZ2B 2FLRH 1SSXA 4HI3A 5AFYH 3E90B 1BA8B 2LNCA 3FP7E 2VH0A 3M5OA 3ATIA 1TNJA 3OY6U 3NUMA 3B23B 5A09A 1IQFA 2BDGA 4MPWA 1OOKB 4MPXA 5JBAS 2O8UA 1IQJA 1UTLM 1W2KH 4MPUA 4YLQH 4X2YA 5C1UA 3RXJA 2ZHQH 3MFJA 1ZHRA 2ZDNA 3GY7A 4XBCA 1W0YH 4WWYA 5C5OA 1TMBH 1O31A 2FESH 1HJ9A 1UCYE 1OWKA 1FDPA 4YM9A 2TBSA 3ENSB 2VU8E 1AO5A 3IITA 2XWAA 3GDSA 3BG4C 3KQEA 1CA0B 1O2ZA 1GHWH 3HK3B 2STAE 1OWDA 4RSPA 5EXNA 3ZVDA 3U8OH 2F9OA 3NWUA 1Y3UA 1HDTH 1BTPA 1ACBE 1GVLA 4BTUB 1AVWA 1QGFA 4X1QU 4Y0YE 1THPB 1GBTA 3LJOA 2A5IA 2Q6GA 3HKJB 2HNTC 1D9IA 5EQQA 1UHBA 2FTMA 1V2JT 1N8OB 4F4OC 1AHTH 1PYTD 4WH8A 2HLCA 2C3SA 1VJ9U 2ZDKA 5HM2A 2FOMB 2Y5FA 2ZWLH 1P04A 1UTJA 5ABWA 1LVOA 2CHAB 3TNTA 3ZZ7A 2PGQB 1AVGH 2GCHG 1BBRH 3U8RH 1SGIB 3RP2A 1NRQH 4GCHF 1C5LH 1C5PA 1DDJA 1L4ZA 1O2XA 1C5QA 4VGCC 1JRTA 3Q00A 2BZ6H 1MKXH 1QQ4A 4ABBA 1RXPA 3GCTG 1B5GH 1AZ8A 1BJVA 3V0XA 2AIPA 1RIWB 1O3LA 1LVBA 4DG4A 1YPHE 2ZO3H 3GY5A 1QL8A 2WPKS 1MU8B 2W3IA 4JMYA 4ESTE 2VWNA 1BDAA 5EGMA 1UCYK 4UD9H 3SJKA 1N6XA 2ZKSA 5G4BA 1JWTA 3GCTF 2F83A 1LKAA 4IW4E 1Z71A 4FUGA 2BD3A 3PLBA 4CHAC 2NWNA 1C1UH 1Y3VA 2FWWA 5TCCA 1SLVB 3QZQA 1Y59T 3GY4A 1A3BH 2CF8H 2OC1A 2SGDE 2Y81A 1GHYH 1GI4A 1C2DA 1CBWC 1O32A 2ZGHA 5E0GA 1ELDE 4SGBE 3TGIE 3AASA 1O34A 2B7DH 1JOUB 4WMFA 1NU9A 1HV7A 2FPZA 3M61U 2W7UA 3M3TA 5GPIB 4SGAE 1C1WH 2FS8A 3RC4A 2R0LA 3TU7H 3VB5A 1QBNA 1ZR0A 3SU2A 1O30A 1SGNE 1PPBH 1YLCA 2FO9A 4I31A 1TOMH 1VITF 2CMYA 2G8TA 1C1MA 2WYGA 2Z9JA 1MAXA 1AVXA 3HK6B 4NSYA 4JK6A 4JYVH 1W7GH 3ZZ9A 4FUCA 3UNSA 3QGJA 1GBLA 4RKOB 3RXBA 2Q6DA 2Y7XA 4TYDA 3PB1E 2RG3A 2C90B 1KXEA 2Y5GA 1ZJKA 4D76A 4NIVA 3UY9A 3A8DA 4OS1A 1YM0A 2ZU2A 1ESBA 3SV2H 1NN6A 3PO1C 3SGAE 2XWBI 3A83A 1TNIA 1A61H 1A0HB 4O3TA 1RFNA 1GDNA 1G3CA 5L30H 2DE8A 2PW8H 3TH2H 3GY6A 3SNCA 2ZFPH 4A7IB 3CENA 2RDLA 3Q77A 2IN2A 2PSXA 1NU7B 2AIQA 5GWZA 5LGOA 1JRSA 1TBQH 3MTYA 2EC9H 1TNGA 1QTFA 1ORFA 1T31A 1MBMA 4WF8A 1EJAA 1C2EA 4DIHH 1AFQB 2G51A 1FY3A 4ISNA 1GDQA 3SV6A 1EPTB 3UPEA 3ESTA 3EA7A 5C20A 1LQEA 3ZZDA 1O37A 1RS0A 1BUIA 1O5DH 3T25A 3E8LA 4DIIH 1BHXF 1G2LA 2FXRA 2QXHA 1O5CB 1AE8H 1SGTA 2SGFE 2QF0A 3H7TA 4TY7A 5AF9H 6LPRA 3A8BA 3RM0H 2PTCE 4ZKSU 3SU6A 1YGCH 2GV7A 1GMDF 1P03A 4A1VA 1ID5H 1H8IH 1O3CA 2FOCA 1QL9A 3SOSA 4GAWA 1HB0B 1E37B 1XX9A 1AWFH 7GCHG 3LKWA 3UWJH 5FAHA 1XUGA 3RUOA 4OS7A 4MNYA 1FMGA 2FS9A 1ZPZA 5ESTE 4OGXA 4QT8C 1BTWA 1WSSH 1YPMH 2QIQA 2ZF0H 4LXBH 3U1IB 2H9TH 1MQ6A 3N7OA 8GCHF 1Y5AT 1EB2A 3V13A 1G3BA 1O2LA 3M7TA 1HIAA 3ZZ4A 1FPHH 3RXTA 1SC8U 2O8LA 1ZHMA 4ZXYH 3GCHC 1PQAA 1OWJA 4YOGA 4K1TA 1C1NA 4D9QA 5E0JA 1ELBA 1FLEE 1QR3E 1ZJDA 2PKSC 1SHYA 3AW0A 3A81A 3LPRA 3RDZA 1DXWA 2ZTXA 4XOJA 1G2MA 3GY2A 3E91A 2A45B 4ZAEA 1ZMLA 1EPTA 1IHTH 1J14A 1A5IA 1FY4A 1Y5BT 2ODPA 1N1LA 1A1RA 1H9LB 5DP7A 3SU1A 1W11U 1YPLH 1TALA 1BCUH 1HJAB 4JZDH 1MU6B 1P57B 4D8NA 3TGJE 1GHZA 4BTIB 3GISB 1C9TA 2VIQA 4I32A 1O2WA 4Y7AA 5L2ZH 1ZHPA 1GJ8B 1GI8B 4DY7B 4A1TA 3M3SA 1CT2E 2XBXA 3SI3H 1IQHA 2D2DA 2H6MA 1C2MA 1O36A 4GCHG 4INKA 2F91A 3A8CA 4X1SU 3LGWA 1RTFB 3ZZ6A 1EZUC 1P2OA 3U8TH 3VPKA 2ZP0H 3SJ8A 1OX1A 2P8OC 3RXMA 4YTAA 9LPRA 2AGGX 1CA0C 1GWAA 1G3EA 3AAVA 2NU3E 1EUFA 1Y3WA 2GV6A 5LH8A 4X0WU 1H8DH 1A0JA 2A4QA 3SI4H 2A32A 1ZLRA 3VGCB 5ESBA 3ZVGA 2FODA 3E6PH 5A8XA 2WV4A 2SNVA 2QF3A 2BZAA 2HPPH 1GHBG 5J4QA 2F9BH 3NZIA 2XW9A 1C5WB 3RC6A 2H2ZA 1GBKA 3UQVA 1RTLA 1SOZA 1WTHD 1O3PB 2OC8A 3ZV9A 2PLXA 1Y5UT 2PGBB 4HTCH 4Q7YA 3UR9A 6GCHG 2ZGXH 4YESB 1QBVH 2ZQ1A 8LPRA 1AB9C 1MZDA 5DPAA 3OX7U 1QB6A 3OTJE 2VGCB 2B9LA 3AAUA 1YF4A 2HWLB 3RXHA 4E06H 4ABEA 1MD7A 1ZMJA 2ANWA 5EXLA 3MH7A 1LHGH 1Z1IA 4K1EA 1UHBB 1WQVH 1BJUA 1GJ4H 3QUMP 5H4IB 1O3MA 1AKSB 3BEIB 2BDHA 1PPHE 1GI6A 4AB8A 2PKSB 3MNCA 1BTYA 2KAIB 1AQ7A 1W13U 1UK2A 1NPMA 2WPLS 1GG6B 1KXFA 1C5MD 2O8MA 3P92A 4X8UH 2VGCC 1J16A 1C9PA 1AB9B 1FIWA 5BRRE 4X6OA 5C1YA 5K7RA 4ABIA 1K1IA 3BTQE 4FU7A 1T4UH 1UK3A 4FUFA 4NG9H 2WUBA 2CJIA 1P8VC 3E16B 4JYTA 3TH3H 2K1QA 1UCYH 2QAAA 1INCA 4GLYA 3SV8A 1KLJH 4ASHA 4Q7XA 1ELAA 2ZQ2A 1HFDA 3VB3A 6ESTA 1BTXA 1Z7KA 3RXEA 3UTUH 2GKVE 3ATWA 4X2WA 1RTKA 2I6QA 3AVZA 2A7CA 1BT7A 3MU5A 2WPMS 4JCNA 1MH0A 1J8AA 1X7AC 1KXDA 1C1TA 4INHA 5HYOA 1IOEA 1W12U 1PPCE 1TQ7B 2ILNA 5JDUB 4DVAU 1Y8TA 1EX3A 4FU9A 5DG6A 1IQEA 1ZPCA 3DUXH 3MI4A 1C4V2 3SGQE 1HUTH 8GCHG 2FP7B 4AFQA 1AGJA 3LGIA 4WH6A 3ZVAA 2BLVA 2GVFA 1D6RA 2ZFTA 1UTOA 1FY8E 4CRBA 1VGCB 2BX4A 2JETC 1SGDE 2AGEX 2PKAB 5FBEA 3UNQA 2BLWA 4AG2A 3LGTA 5EPYA 1OPHB 2BLQA 5DP6A 2FOBA 1OYQA 2D1JA 1ANCA 4NWKA 1HYLA 1ESAA 2ZFSA 2ODYB 3B8JA 3NPSA 2GDEH 1KY9A 2J34A 1GPZA 4BAHB 1G30B 1V2KT 4I8JA 1CT4E 5HXFA 2XYAA 4GVUA 4X1NU 2BQ7B 1D3QB 2WV5A 3GCNA 3NCLA 3SJ9A 3RMLH 4FUHA 3SO3A 1S5SA 4ISHH 3SW2B 3I77A 3LOXA 1YLDA 3MO9A 3EA8A 2G5NA 4YOJA 4DCDA 3BN9A 4ABHA 1NRNH 3QWCH 1A0LA 2D8WA 2BOHB 1D3DB 1UJ1A 2UUJB 1MCVA 1TGNA 3STIA 3A7WA 4JZFH 3MH5A 2F9PA 2G5VA 3VEQB 1MTWA 5FXLA 3MHWU 2B5TB 2XC0A 5C5NA 1E36B 1UO6A 1FAKH 1HAYB 1DFPA 1EB1H 1A5HA 2H5CA 1O3IA 2PUQH 2HNTE 5EU8A 1SI5H 4BANB 1GL1A 2FMJA 1K28D 2FOHA 1VCQA 4ISLA 3SUGA 2FYRA 2BLOA 4NGAH 1ARCA 4GUXA 2JKHA 1BZXE 3RXSA 1YCPK 2TGAA 3EA9A 1JMOH 2V6NA 3K6YA 1DSUA 3Q3KA 1ANEA 1SGQE 1C5VA 2ZC9H 3RMNH 4ZKRU 1PPFE 1P10A 1SGEE 2W26A 3SGBE 3DD2H 1SGCA 1V2UT 1Z8GA 2GP9B 1QY6A 1AZZA 3KF2A 2SGAA 3BG4B 4XFQA 5DP4A 1OXGA 2P16A 2Z9GA 4BAKB 2ZA5A 2ANKH 3F9FA 1S0QA 4KTUA 2GX4A 2VIDA 1PQ7A 1TPOA 1QHRB 2BVRH 2J95A 1VITG 1CHGA 1TA6A 1WAYB 3GCOA 4ZHAA 4BAMB 4OS5A 4MNVA 3BTTE 1HXEH 2OINA 1DY9A 4HFPB 2W5EA 5FCKA 3ODDA 1DXPA 3LGYA 3VB6A 1TGBA 1ZMNA 1ARBA 4X6NA 3BTME 3RXCA 5GXPA 1O2VA 4ZROA 2DE9A 2ZDAH 3ZZCA 3ATLA 4NWLA 4AZ2B 3MMGA 4NA8A 1ETRH 2STBE 5TCAA 3W95A 1DITH 1C5SA 3TIUA 1WU1A 2O8TA 2GMTB 1MTNB 3TJUA 3M37A 1Q3XA 4ZKNU 2J38A 2B8OH 5HM9A 1ZSJA 1O3JA 2EI6A 2YNBA 1VZQH 1WYKA 4Y6DA 3EAJA 1H4WA 1DWEH 3RXIA 1V2OT 3RU4E 2ZGCA 3LC3A 5DP8A 3A82A 3L3TA 3KQBA 1N6YA 1DVAH 1TGTA 2H9EH