3PWCA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA02
1ZPZA 4X1PU 4X8VH 2ZZUH 1HLTH 3JZ2B 1O5AB 1NU9A 2TRMA 1V2KT 1P09A 2EC9H 4NA9H 4B74A 3B23B 1FIZA 3P17H 1C2HA 2PHBA 1JMOH 1QGFA 1FZZA 3P70B 2BD8A 5LGOA 2A5AA 1BB0B 4NGAH 4NSYA 2SGAA 4TYDA 3TJVA 5A8YA 4U01A 3PV4A 1KYNA 2TPIZ 1ZHRA 2V6NA 4TWYA 1VITF 2FDAA 1AFEH 4O9VA 1VITG 4MPUA 1W13U 2NU3E 2PW8H 4ABJA 1C5UA 2FO9A 1TABE 5SGAE 2R0KA 1OXGA 2ANKH 2CJIA 4ISHH 3SNAA 1K2I1 2UUFB 1C1TA 2HVXA 1GHVH 3A7TA 1HAGE 1ANCA 3A85A 4JYVH 5JBCS 2QF3A 2UUYA 3B8JA 1TGCA 3SU6A 1C2IA 3VB5A 3GYMA 2ASUB 5HYOA 6ESTA 1CSOE 1SL3A 6LPRA 3NUMA 4FUDA 6CHAC 1BTHH 3S0NA 1Z1JA 2OTVA 2FLBH 1SLWB 3M37A 3TPIZ 1D3TB 4NWLA 1O3JA 1UCYH 1HYLA 1O3CA 1LTOA 4JZIA 2EA3A 1A5HA 1KDQA 1IHSH 4HI3A 5EXMA 8GCHG 1AKSA 3GCTG 2BDGA 1XXFA 4BTIB 2YOLA 1P05A 3KQEA 1BTPA 2WPKS 3P8FA 4GCHG 2W7UA 3V0XA 4HFPB 3BF6H 5I46H 3QLPH 1FI8A 1O2VA 1HDTH 3TK9A 1FAKH 2JKHA 4X8TH 3TH2H 1BUIA 3QTVH 5E0HA 1GJ4H 1V2RT 3A80A 1GVZA 4JZFH 5E2PA 5EPNA 1Z8JB 1O3IA 2TBSA 2FOMB 4WWYA 3P95A 1SG8B 3SO3A 3GISB 2AMDA 2OBOA 2ZEBA 5EW1H 1QJ6B 3RUOA 3HGPA 1D6RA 3QX5H 1AD8H 1T31A 3SJ8A 1FLEE 3NKKA 2BX3A 3TU7H 4CBNA 1UO6A 1SGRE 1BITA 4X6MA 4YLQH 3KQDA 2P94A 2PKAA 1GBLA 3KNXA 1BHXB 2PLXA 2ANYA 1E35B 2Y7ZA 4BTUB 1O3EA 1TALA 1RGQA 3E0NB 2Y80A 1O2HA 1VZQH 2R3YA 1YF4A 2FYRA 2ZDLA 3ZVBA 1N8OB 1QRZA 2BOHB 3ATIA 2QY0B 5JB9S 1GBJA 2A4QA 5H4IB 3RP2A 1PPBH 2OQUA 4NG9H 3UOUA 1DLKB 2JETB 3RMOH 4H42U 1PQAA 1SGCA 3BSQA 2QXGA 2BD2A 1AB9B 2SGEE 1MMJN 2CN0H 2EI6A 1RS0A 4D9QA 5A2MH 1CBWB 1TNIA 5EW2H 1VCPA 1CHOG 3ZZ5A 2C3SA 2F9NA 2WYGA 3STJA 1GHZA 2Z94A 5PTPA 3SQHE 8ESTE 4CRBA 3UR9A 5DPAA 1KSNA 1AU8A 4ABEA 4Y8XA 3K2UA 1UTQA 1XVOA 4TY6A 3SUGA 1NY22 1ETRH 2V3HH 1N6XA 2ODQA 2GGVB 1K21H 5FBEA 2THFB 1DXWA 1MCTA 5HM2A 1TX6A 3RXCA 1TB6H 6GCHF 5GJ4B 2BLOA 1GJ5H 1NFWA 3PWCA 4U32A 1GBTA 4RN6A 1O5DH 1NRSH 2ZKSA 3VGCC 4SGAE 1KLTA 3O8BA 1MTUA 3F1SB 3EA9A 3BTTE 1C5LH 3T28A 2ZFFH 1LHDH 1UTPA 4X0WU 1AGJA 2VH0A 1KXDA 2SGFE 3D23A 1GJCB 2HNTF 1O2JA 4YOIA 1TNKA 1C2MA 1BMNH 1Z8GA 2ZGJA 3GY8A 1AZZA 3SN8A 3BG4C 2A7HA 1TQ0B 1GHWH 1O3FA 2BDHA 1T8LA 2BD9A 2A1DB 1O2RA 3SI4H 2O8LA 2Q6DA 1O34A 3M3SA 4GSOA 1ZJKA 3RXAA 1C1OA 2F9PA 2Y81A 1GMHG 3U8TH 3DD2H 2G5VA 2AGGX 4YOGA 1P57B 3V12A 4MLFB 2ODYB 2C4FH 3B9FH 3LC3A 1G3DA 4CR5A 1QURH 1GCTB 4JZDH 9ESTA 1DWCH 2VWOA 2HOBA 1O30A 5CMXH 4GHTA 2A31A 1O2YA 1XMNB 1UVOA 4BAHB 3ATLA 1CU1A 1BTZA 1HAPH 1GGDC 1C5OH 5ABWA 1MZDA 1K1MA 2J38A 4DGJA 3HK6B 4ZHAA 3TGIE 2FOGA 2AH4X 2PGBB 1JIMA 5GXPA 1YC0A 2O8WA 5K0HA 5L6NH 1XKAC 1XKBC 5JB8S 1NRRH 2ZHQH 3P8OA 5DK1A 1LVYA 2ZP0H 1V3XA 2IOTA 3PB1E 3S9CA 4AFQA 1BT7A 2STAE 2ZU3A 5GPIB 2ZFPH 2ZNKH 3GDUA 1TMTH 1LHCH 1H4WA 1ZR0A 2JETC 1QFKH 1O3KA 1BJVA 1K28D 1FY5A 5F03A 3FP6E 1GCDA 1EASA 2O8TA 2SGPE 1FPHH 1ELVA 3U8RH 3MU4A 2Y5FA 1TMBH 3M3VA 1FXYA 2XBWA 1GCTC 1IQNA 4HZHA 1TWXB 4O97A 4MNVA 3TGKE 1TRYA 5LPFA 2AS9A 3T29A 1K1OA 1VGCC 1SQOA 2GX4A 5JDUB 1O3HA 1A5GH 2D1JA 2GT8A 1C5XB 2Z9IA 4ABBA 1UK4A 1BOQA 1JBUH 3QDZB 1JOUB 1XM1A 5GCHG 1CGJE 2OBQA 2XC4A 1K1NA 3OY6U 4AG2A 7GCHF 4MG3A 1SGFG 3NCLA 1RJXB 4FU8A 2FI5E 1BTXA 3PLPA 1AVWA 1L4ZA 1MU8B 3F9GA 4Q7ZA 1IQEA 3RLWH 4WXIA 3RM0H 2J95A 3PROA 5C1UA 1UTLM 3UOPA 1C5MD 1S83A 5DP3A 3HKIB 1E38B 3LGIA 1O3BA 1CT4E 1AQ7A 1G3BA 5EXLA 3UQOA 1Z6JH 1EZUC 1S0RA 1P3EA 1C5YB 1HAYB 1HIAA 1Z1IA 1KTTB 2FX6A 1YPEH 4NIXA 1A0LA 2VINA 3KGPA 3RC6A 3MNSA 4XFQA 1P9UA 1BHXF 5AFZH 4YLUA 2QGRA 1N6YA 1ELTA 3VB7A 1O5EH 1QRXA 1O3LA 2H1UA 5JBBS 1Q31A 3ATKA 1TONA 3FZDA 5FPTA 1QTFA 1ZMNA 1ABIH 5AHGH 4IN2A 1AIXH 1AB9C 1DM4B 1ZSJA 1N1LA 1EAWA 4K8YA 1A0JA 3A86A 3HATH 1PQ8A 1NRPH 2BB4A 1BMLA 5A09A 2W3IA 1QL8A 4D8NA 1H8DH 1NO9H 1GBAA 5DP4A 1ACBE 3RC5A 3A7VA 1QL7A 5FHTA 4YT7H 4JZ1A 3M7UA 4SGBE 2YNAA 5E8EH 4CR9A 3EQ0H 3WY8A 1OS8A 2AERH 3RXRA 2XCNA 4NIWA 4YTAA 4JZEH 1BBRK 5HM9A 5EQQA 1SQAA 2ZC9H 3ZV9A 2PUXB 3SJ9A 1X7AC 3ENSB 4OS2A 2A4GA 4WMDA 2R9PA 4HGCA 2ZDNA 1GHBG 2IN2A 2ZHWH 4XOJA 4B73A 2WYJA 3SW2B 1ZSKA 1C5NH 1UHBB 1JWTA 1OSSA 1BMAA 3SORA 3RXPA 3BTHE 1O2XA 3F9FA 3QTOH 1ELEE 1C1WH 3DFJA 1ELFA 1O2GH 4JCNA 4UFEH 2BLVA 1THRH 3GCOA 2BD7A 1L1GA 2EEKA 4CH8B 5T3HA 2ALPA 1BJUA 3T62A 3UR6A 2FTMA 1O3DA 2ZHDA 2CMYA 2HALA 2NWNA 1O37A 3LONA 1S0QA 1HGTH 5CHAC 3GY2A 2A4RA 3NWUA 1EB1H 1MCVA 1SQTA 1GJ6A 2P93A 2ZDKA 2ZDAH 4BNRA 3PM3A 1O2MA 2I6SA 2A32A 2TGAA 5C1XA 2GCHG 2BOKA 2M5TA 1SFQB 2A2XH 1L0ZA 1QRWA 4QT8C 2DE8A 1VJ9U 3HGNA 5EG4A 3ZVEA 1YCPM 1ZMLA 5AVDA 3ZVGA 1WQVH 4DOQA 4INKA 2OINA 1L1NA 3M3TA 1V2WT 1O3NA 4KTSA 4ZKOU 4NA7A 3SNDA 5DGJA 4ASHA 5A0CA 3Q3XA 1UTMA 5F6MA 3AAUA 1IAUA 1LPGB 4J1YA 1PPFE 1XUFA 2PSXA 3ZVDA 1EX3A 4UDWH 1F92A 2Z3DA 1THSH 3KL6A 3C1KA 2ZFTA 4FUEA 2XRCA 1Z6EA 1XUKA 1ELBA 3EAJA 1MD8A 3QGJA 1KLIH 1O2OA 3SGBE 1HAIH 2WPIS 1SLUB 5JBTA 4XSKU 4WF8A 2WV5A 1C5ZB 3GY6A 3KF2A 3MNXA 3Q00A 5GIBA 2BQ7B 6CHAB 1OWKA 1FQ3A 1GI4A 1HAOH 2H9TH 4BXWA 2B5TB 3MHWU 1Y59T 1FDPA 1WQSA 2SNVA 1SGTA 4WH8A 1NN6A 4I8LA 2BXTH 1SBWA 2BY9X 3GY3A 1YYY1 1GI9B 1YLCA 1JRSA 3LC5A 2KAIA 2AMQA 1DDJA 1XVMA 4X1SU 1WBGB 1AY6H 1ZLRA 2CF8H 1YPLH 1ZGVA 3QO6A 4FUCA 4OGXA 5FBIA 3RU4T 1TIOA 7LPRA 2ZHFH 1V2JT 3SUFA 3V3MA 3UNRA 1TA2A 2F91A 1LCYA 2BD4A 5IDKA 2PKAB 2VB0A 3A89A 5FCRA 2FXRA 3KEEA 2FIRH 1RTLA 1C1RA 1HAHH 2C8XB 1GWAA 3K6YA 5T6FA 2F9OA 1LVBA 1CA0B 1JRTA 1TRMA 3BEFB 3UTUH 1ZJDA 1LHGH 2A7JA 3AAVA 4ZAEA 2SGQE 2OD3B 1P8VC 2K1QA 4RKJB 1FIWA 1D6WA 1HAXB 3GCHB 2UWOA 2FS8A 4D9RA 1BZXE 3I29A 1GI3A 1GPZA 3OU0A 4BAMB 2F9UA 3RXKA 3RXGA 4CRCA 3VXEH 2GDDA 1ZOMA 2ZDMA 1BTUA 1H8IH 1KY9A 5DP9A 4GCHF 1MQ6A 2OC7A 3PYHA 2Y5GA 2FOBA 2P3FH 1F5RA 4LOYH 1KXBA 3O8CA 1HUTH 1BTYA 2FOHA 3QN7A 4I7YH 4AZ2B 2A0QB 3EE0B 1S5SA 3ZVAA 2ZU1A 1IQJA 4Y0YE 4F4OC 1GBBA 1YKTA 1TE0A 5FX6A 3RXMA 3QGNB 3OSYA 1TMUH 3R3GB 1GVKB 1C1PA 1DLEA 5L2ZH 4Y11E 3VPKA 1OPHB 3SU3A 3SJOA 4X8UH 2QC2A 1TNGA 3K6ZA 1GBDA 3MNCA 4D7FA 3MMGA 5HXFA 1C4V2 3A8DA 1PPHE 3DHKH 2RG3A 2GTBA 2XYAA 1LQDB 1PPCE 3MWIU 4LXBH 3LH3A 3LIWA 5BPEA 1TGTA 1QA0A 1YPMH 1BIOA 3MH7A 4F49A 4IBLH 1LPKB 2GCHF 1EPTC 1MAXA 4E05H 2BHGA 1GGDB 1QL9A 1W10U 4OS7A 1SB1H 5B6OA 4ABDA 3RMLH 2AEIH 3PO1B 1PYTD 1C1SA 1T8NA 2BY8X 2QV1A 2ZIQH 3NPSA 4Y7BA 4JMYA 2ZI2H 1E37B 1C5TA 3NK8A 4FXGH 3M5LA 1E34B 2UUJB 3VB3A 1YPGH 2NU0E 5LPEA 4DCDA 1MTVA 1SHHB 1UTJA 1SOZA 4MNXA 3SUEA 1PQ7A 1EQ9A 4Q7YA 2HNTE 1BRCE 1LHEH 4E06H 1MTNB 3LT3A 4J2YB 3FFGA 7GCHG 3VFEA 3AASA 2BVRH 3T25A 3RXDA 1GG6B 2D8WA 1AHTH 3RDZA 1AO5A 2XXLA 1UVPA 3KHVA 4K1SA 5IYTA 1F0RA 5A8ZA 1Z8RA 4BAKB 1GI2A 5C5NA 2VIVA 3LJOA 4Y10E 1EZXC 4KKDA 1VCWA 1B5GH 2AIQA 2VH6A 1MD7A 2JH5D 4AG1A 1T4UH 1IOEA 2BDIA 1G3CA 3EYDA 4MPVA 4XDEA 3VXFH 1Y5UT 3LH1A 2GMTB 4AOQA 1SOTA 1FN8A 2H6MA 2ZCHP 4XBBA 1O39A 1EATA 3M5NA 2QYIA 1QIXB 3GCNA 4I8GA 1QA7A 2A5IA 4X2VA 3LDXH 4D7GA 2WPLS 3ZZDA 3RXHA 3CENA 3D65E 1EJMA 2VGCB 4IC5A 1GBIA 2FPZA 3SZNA 2CF9H 1YM0A 1NTPA 2IJOB 3KIDU 1Y5AT 2B0FA 1P2QA 1EPTB 1TX8A 2ZPRA 2ZHEH 4ABHA 2BVXH 1C2GA 2GD4B 3OY5U 3RLYH 2PFEA 3S7KB 1DPOA 1FMGA 4VGCB 2Q6GA 1HAVA 4CRFA 3AW1A 3K65B 3RXVA 1Q3XA 3URCA 2BYAX 1MKXH 3GDVA 3G01A 4A1XA 1AVXA 1MKWH 4ISOA 2Z7FE 5DJ7A 2ZFRH 2J92A 3DT0H 1ZZZA 3BTGE 4TPIZ 3M61U 1DX5M 1C5QA 4FUHA 1S6HA 4YT6H 2A45B 1GHXH 1O2UA 1Y5BT 1O2WA 1A5IA 4NZLA 3TVJB 1DITH 1SMFE 1ZGIA 3A8BA 4MVNA 3KN2A 4ISNA 2BLQA 3ODDA 3O8DA 1YBWA 1U6QA 1MH0A 4KTUA 2DE9A 4WH6A 5DP8A 1DWEH 4AX9H 4LZ1H 3VB4A 4AFUA 1E36B 2HPQH 1ID5H 4CBOA 3FP8E 4KP0A 1AE5A 1SGDE 1SC8U 2Y5HA 2BD3A 1KTSB 1CGHA 1O32A 4XE4A 1MTWA 5EOKA 1GMDG 4U2WA 4IS5A 2BM2A 1IQGA 3TJUA 2B8OH 4MNWA 4DVAU 4AYYB 1EJNA 5FPSA 1O5GH 1IHTH 5C3NA 3SU2A 3H7OA 1XUIA 1ZHPA 1C5VA 2UWLA 2FLRH 4UD9H 1HIAB 1YCPK 3RC4A 1WUNH 4ZROA 2VIQA 4X6NA 5K7RA 5L2YH 1KXFA 3H5CB 4A1VA 4DIIH 1C2KA 1TQ7B 3U1JB 1D3QB 3UNSA 4VGCC 4IMZA 2P95A 2B7DH 4GHQA 4UE7H 1O2SA 4B71A 4UFFH 1T8OA 1XUJA 2RCEA 3ZZ6A 1TYNA 1G32B 1MBMA 2BY7X 5AF9H 1G2LA 1UHBA 5JPMH 1FPCH 2J94A 1TGSZ 1MZAA 2QA9E 1IQHA 4ZH8A 3MOCA 3BV9B 3MYWA 4YO9A 4BOHA 2O8UA 2BD5A 2QXJA 4IGDA 1O35A 2VIWA 4OS5A 3SHCH 4BAOB 1XUHA 5C1YA 3ATMA 1B0FA 3BG8A 5F8TA 3W94A 1TPPA 1C5RA 1WTGH 2FI4E 1W2KH 3EA7A 3AW0A 1C1NA 3GCTF 5EPYA 1K9OE 1QQUA 4E7NA 1O38A 2ZWLH 2V35A 1DWDH 4ABFA 5DO4H 3M7QA 2DUCA 3ZV8A 1DSUA 2AFQB 1UVUH 2O9QA 1LMWB 2ZPQA 3P8NA 1PYTC 1O33A 3RXBA 1C4U2 1IQLA 1WTHD 5TCAA 1A0HB 1UTNA 2GKVE 2VIDA 4I8JA 2BDCA 2JH0D 1P2JA 2R3UA 2XNIA 1Y3WA 1BRBE 1AKSB 2ZECA 1F5LA 5I25A 2OXSA 4MNYA 2PSYA 1Y3UA 2STBE 3M5OA 1SLVB 3SJIA 2VVUA 4Y0ZE 1A4WH 1C2LA 3IITA 1P2IA 1EP6A 4R0IA 3PTNA 1QJ7B 2OCVB 4UFGH 1B0EA 3R0FA 4AGKA 2XCFA 2BY5X 3SU5A 2VIPA 2ZCLP 1GDUA 3OX7U 1C5PA 1DY8A 4X2XA 4PROA 1BMMH 1IQFA 1DUEA 1HJ8A 1QNJA 4AFSA 2VVCA 4CHAB 2BZ6H 3V7TA 2D26C 1RIWC 3EDXB 3ELAH 5JYIA 5EGMA 1OWIA 2FM2A 2R0LA 1OKXA 4X1QU 1BRAA 3M36A 1RFNA 3ODFA 3GOVB 3L6PA 2Y6TA 4AFZA 2ZTXA 4ABIA 4AYVB 3RU4E 4IW4E 5CHAB 1K1PA 2C93B 3SUDA 3ZYEA 2OC1A 1O5FH 1A61H 1DXPA 2A4OA 2VJ1A 1BTWA 1C2FA 1C4Y2 1ELCA 4ESTE 1TPAE 1W7XH 4BAQB 1MU6B 3SV8A 1OYTH 2XTTB 1HJAC 4HTCH 1O2TA 1RTFB 3DFLA 3NZIA 1CBWC 3ITIA 4RSPA 3MI4A 1EAUA 4GUXA 8LPRA 2FWWA 1LHFH 4BXSA 1ANEA 3I77A 1V2OT 1NROH 2FI3E 2OC8A 1FJSA 3SGQE 3ATWA 3CS0A 3IWMA 3M35A 4Z0KA 3RXFA 2F3CE 1PPEE 4ZHLU 2O8MA 4CRAA 1T7CA 4XBDA 4Y8YA 1C1MA 4ZXXH 4I32A 4O3TA 1TX7A 1VJAU 1P3CA 5C20A 1SI5H 4NWKA 2RDLA 1N8OC 3LJJA 1LVOA 4I33A 1HPGA 2CGAA 5E0JA 1JIRA 2H5CA 1YPHC 4Q2KA 4WY3A 3LU9B 4NCYA 4ZUHA 5FCKA 1UCYK 2C8YB 1SGQE 1C2JA 3TLOA 1WV7H 1NFYA 2BQ6B 1V2ST 4U30A 1EB2A 4I31A 3RXTA 2EI7A 4ZHMU 3L33A 2WINI 3HPTB 4RKOB 1V6DA 4X1NU 1NZQH 1XXDA 1J15A 1P2MA 1LDTT 1AZ8A 4DY7B 2C8ZB 3BIUH 3TJOA 1DT2A 1GJ9B 2ZPSA 3ZZ9A 1GI0A 1G37A 1CQQA 4NFFA 2HLCA 3KQCA 1DOJA 5EU8A 5EODA 3EA8A 1J14A 3BTKE 1GJ7B 2HRVA 1H9HE 2OP9A 1EUFA 1RXPA 4Y71A 1VITH 4Y79A 2BX4A 1O2NA 1Y3YA 3UREA 4DW2U 1A7SA 1ARBA 2Q6FA 1AN1E 3JZ1B 1OP8A 4NFEA 1GDQA 1GHYH 2BDBA 3H7TA 4ZXYH 3ZZ3A 1TPSA 3M7TA 1A3BH 1NT1A 1D4PB 3TNTA 1F2SE 1KXEA 3LGUA 4MPWA 1HBTH 3MFJA 1ELGA 3A87A 2XWAA 1YCPH 1HJ9A 2J2UA 2PWXA 2QXHA 4INHA 1GVLA 1ESBA 1UK2A 4JYTA 5E0GA 1PQ5A 1SGIB 3BN9A 1UVTH 1AUJA 2VWLA 1HAVB 1WAYB 1TGBA 3MO3A 1V2TT 2C8WB 2C90B 1H1BA 1O2ZA 2ZTZA 3GY5A 1O0DH 2G8TA 1QBVH 4FUJA 1HNEE 3U9AH 1TNHA 1SGYE 4FUBA 1W3CA 3SBKA 4B2CA 1ETTH 3A7WA 3N7OA 1V2LT 1XUGA 4WMFA 1EZQA 2H2ZA 4A1TA 3E0PB 1P2KA 1HAZB 2WPHS 3O8RA 5DP7A 1PFXC 1GI6A 1SLXB 2GV6A 1NESE 1Z71A 2WUCA 1FN6A 1ZHMA 2UWPA 4BTTB 1J8AA 1AFQB 4XBCA 3KCGH 1MTSA 2ULLA 2ODPA 2XW9A 3UWJH 2P59A 4ZMAH 3MO6A 1V2PT 4B1TA 2AGEX 1A3EH 4WXVA 4GAWA 1J16A 2ZTYA 1EJAA 1V2NT 2CV3A 1A46H 1MUEB 5GDSH 3RXLA 4ZKNU 3MH4A 3SHAH 4YM9A 1KIGH 3GY4A 3RMNH 3BTEE 5T6GA 2G52A 1W0ZU 2BXUH 4OS4A 2FYQA 1T4VH 3A81A 2AYWA 3TH3H 3TJNA 4TY7A 2W5EA 1SGFA 2Z3CA 4B2AA 1GI5A 1XX9A 2ZF0H 3D62A 4CRGA 1W12U 1DFPA 1W14U 2HWLB 1QBNA 1S85A 3PMJA 1W7GH 2BTCE 3FVFB 1F7ZA 5GCHF 4WMEA 2XBYA 1UCYE 2BVSH 1Y8TA 3RXOA 1WYKA 2FS9A 3T2NA 4YOJA 2ZGBH 3BG4B 1LQEA 3S9BA 4JYUH 1DSTA 1GL1A 2IPHA 1LO6A 1C9TA 1FY3A 1QR3E 3A7ZA 1AMHA 3VEQB 1P2OA 3LOXA 3F68H 4THNH 1RIWB 2FP7B 1W11U 5ESTE 2GT7A 2BQWB 3QK1A 1OYQA 3SOSA 3E1XB 3LKWA 3STIA 1CHOF 1OWEA 2P8OB 1BQYA 3RM2H 2VU8E 2Y82A 4KTCA 1QY6A 4Y7AA 3Q77A 4UONA 2P3TB 2Z9GA 1NC6A 1IQMA 4I8KA 1GJAB 1MKWK 2AMPA 1FUJA 3IG6B 1G36A 3SU4A 4TWWA 4Y6DA 3M5MA 1E0FD 4WVPE 2HPPH 3GICB 3MO9A 2Z9JA 8KME2 2PKSC 3ZZAA 4FVDA 6GCHG 1F0TA 3RXSA 1C5WB 1S6FA 1ABJH 1S81A 2G5NA 4Y76A 1LPZB 2BLWA 3PMBB 1OX1A 1ZSLA 4K1EA 3ESTA 1C2EA 1NPMA 2AIPA 3PMAB 4IC6A 3RU4D 3E91A 3L3TA 4FVBA 4ZKSU 1QCPA 2FESH 4KGAA 8GCHF 1P06A 1C1QA 3PLBA 2V0BA 3A7YA 1ZRBA 2VIOA 3A82A 1DVAH 3AVZA 3CS7A 2ZFSA 2ALVA 4FUIA 4OGYA 1BCUH 1EP5A 3TGJE 1ARCA 4DJZB 1QB6A 3OTJE 3SNEA 5DG6A 4B76A 1NFUA 1YP9A 2LPRA 3A8CA 1GHBF 4X6OA 3ZYDA 1BRUP 3Q3YA 3A84A 1GBCA 1JXPA 2QF0A 3A7XA 3SV2H 3A8AA 3MU0A 3E6PH 1RRKA 1YPKH 3PLKA 1AFQC 4NZQA 2BY6X 3RXJA 4ABAA 1EAXA 2LNCA 1FY8E 2PKSB 1HRTH 3E8LA 1FNIA 1NRNH 5GWZA 2G4TA 3QUMP 4X6PA 3FAOA 1EXFA 2W3KA 2GZ7A 5A0AE 2B9LA 2PGQB 5DP5A 3GYLB 1GMCF 4UFDH 4X2YA 3A83A 1UTKA 1AVGH 3SV9A 4LZ4B 2YNBA 1IQIA 2P8OC 1DWBH 1G2MA 1CHGA 4ZKRU 3UWIA 4ISLA 4H6SB 1Z7KA 1SFIA 1BBRE 2FEQH 2XC5A 2ILNA 1CA0C 7KMEH 1LVMA 1S84A 4NA8A 3PO1C 1RTKA 1C2DA 4D76A 1V2VT 2ANMH 3HK3B 2BMGB 4TPYA 4OS6A 2BDAA 3BTDE 1GI1A 1D9IA 2GVFA 3CP7A 4X1RU 5LH8A 1P11E 1Y3XA 5DP6A 1DANH 1UVSH 1G3EA 2FX4A 2ZGCA 2TIOA 1Q2WA 1O3MA 1SHYA 2R2WU 3BIVH 3BEUA 4K3JA 2FOFA 3RXEA 3OYPA 1TPOA 2QAAA 1P04A 1M9UA 2J9NA 3TIUA 2OC0A 1GMDF 2RA0A 2ZQ1A 3S7HB 1GG6C 1C1UH 3SI3H 3UNQA 1OOKB 4O03A 2P3UB 5A0BA 2G00A 1TRNA 2FZZA 1D3DB 1DUAA 5JBAS 3UFAA 5FPYA 1RD3B 1ZMJA 3UPEA 4O3UA 4K60A 3ZZ7A 1ANDA 2UUKB 4K2YA 3F9EA 1G9IE 1P02A 1QJ1B 1S82A 4Q7XA 1WOFA 3BTME 1CVWH 1TOMH 2TGPZ 1BBRH 5HMAA 1L1JA 2GZ9A 1DS2E 1ETSH 2GZ8A 2QCYA 2RA3A 3BTWE 1MQ5A 1J17T 5T6DA 1TLDA 5A8XA 3FANA 4Z6AH 3URDA 1ZPCA 2J34A 4ABGA 5C2ZA 5BRRE 1EKBB 3I78A 1CA8B 1TBZH 3F6UH 1TNLA 7ESTE 1UK3A 1YGCH 3A88A 4H6TA 3ZZBA 4UEHH 1OP0A 1AI8H 1O2PA 3W95A 4AGJA 3SJKA 1P12E 3UUZA 1VCQA 2OUAA 1ORFA 1WCZA 4AORA 4MDSA 2Z6BD 5DKMA 2ZU2A 1J9CH 1QB9A 2ZFQH 1C1VH 3QZQA 3C27B 1L2EA 3SU1A 2W26A 5C67A 2GDEH 1O5CB 4A5TS 2VVVA 1P01A 4FU7A 2SNWA 4NIVA 4I8HA 2GMTC 4IMQA 3SNCA 1F5KU 2XBXA 4A92A 2H5DA 1TBQH 2F9BH 1ANBA 5FXLA 3LGYA 1PPGE 1SGNE 2NU1E 2Z9LA 3ZVCA 1KDQB 3S9AA 5L30H 1GBMA 1OWJA 1C5SA 1O2QA 1F0SA 2TGDA 4NIYA 1YPJH 1V2MT 1GI7B 1NU7B 4WJG2 2QXIA 3SQEE 1HCGA 1YPHE 3P92A 3TK6A 1VGCB 3Q3KA 2ZQ2A 4A7IB 1GBFA 3QWCH 1Z8IB 2Z9KA 1H9LB 4FUGA 1MTNC 1O2KA 2BZAA 4AB9A 3VGCB 1NS3A 3HKJB 4MPXA 1NRQH 3GCHC 4FUFA 4DG4A 1K22H 1B7XB 3U98H 1GHAG 1T8MA 3E3TA 2AGIX 3UIRA 3LGTA 4M7GA 2PTNA 2VWMA 1LKAA 3MTYA 4DT7B 1EAIA 1DE7H 1ELAA 4CRDA 4NSVA 9LPRA 1THPB 1L4DA 3SV6A 1GBKA 2G51A 2A7CA 3GY7A 2PV9B 1P10A 1QBOA 3V13A 3MU8A 1GMCG 2HNTC 2Z3EA 1VR1H 1P9SA 4INLA 1IQKA 1QQ4A 4X2WA 5E2OA 5FX5A 2CHAB 4H4FA 4KELA 3TH4H 1K1JA 4YESB 2ZG0H 1BA8B 2QIQA 1ZRKA 2ZGXH 2VGCC 2VNTA 1A1RA 1TA6A 3K9XB 2Y7XA 1O5BB 3VB6A 4YZUA 2ANWA 1ESAA 2CXVA 1AWFH 1EOLA 1WSSH 5C5OA 1FY4A 2A2QH 3Q76A 2FOEA 5J4QA 1SSXA 4GVUA 4K1TA 1CT2E 1P03A 3RXUA 2BDYA 1INCA 5HGGA 2XWBI 1AE8H 1AUTC 1QB1A 2KAIB 2ZU5A 5J4SA 3P6ZB 2XC0A 2I6QA 2OQ5A 2ZO3H 5CE1A 4FU9A 1O3GA 1PPZA 3RXIA 2GV7A 1DY9A 1SPJA 1ESTA 1GDNA 1D3PB 2G81E 3PMHB 3BEIB 2F83A 1H9IE 4Q80A 5FAHA 3LGVA 1O31A 1SR5C 3PWBA 3S69A 3F9HA 4BANB 1EPTA 4X8SH 3U1IB 4DIHH 1FV9A 2P16A 1HJAB 4LK4A 4JK5A 1EOJA 2H9EH 3ZZCA 1F0UA 4GLYA 1CE5A 4DURA 3E16B 3SNBA 1MBQA 3E90B 1OP2A 2EI8A 1GBHA 2XBVA 3UQVA 1QHRB 2V3OH 1ZYOA 4CHAC 1O36A 1FY1A 1TNJA 3KQBA 1HV7A 1UTOA 2SFAA 5F8ZA 1GI8B 1ELDE 3SV7A 4CH2B 3T26A 1P2NA 3MH6A 1W0YH 5ETXA 1HFDA 2G55A 2F9VA 1G30B 3GDSA 1HXEH 1GBEA 3ZZ4A 1TOCB 4IN1A 1ZTJA 1ZTKA 2J4IA 5EQRA 2R2MB 3UY9A 5EQSA 1OWDA 3SGAE 2ZA5A 1C9PA 1O2IA 1KLJH 2G4UA 5TCCA 2A5KA 3PTBA 2NU2E 1O3PB 3LPRA 2FOCA 2PTCE 1O3AA 3MH5A 1Y3VA 1OWHA 1MAYA 3RMMH 2GCTB 1P0SH 3U8OH 1SGEE 1UJ1A 1W8BH 3EGKH 2ZDVH 4MTBA 4CREA 1CO7E 1TAWA 1NM6A 1O3OA 1GMHF 2QN5T 2WPJS 4JK6A 2GCTC 2ZGHA 2D2DA 1TFXA 1YLDA 3T5FH 5AFYH 2VWNA 1KXAA 1V2QT 2CHAC 5ESBA 1CGIE 5EXNA 2FOAA 5G4BA 2GP9B 4Y8ZA 1GHAF 2ZCKP 2OLGA 5F8XA 2PUQH 3SU0A 2HGTH 4K5ZA 1EZSC 4R8TB 3ZZ8A 4B2BA 1K1LA 1ZPBA 1FAXA 3MNBA 1UMAH 3BTQE 3RXQA 2PR3A 3U69H 1BDAA 2H9HA 4OS1A 2FMJA 2W7SA 3MU5A 3FP7E 3TNSA 3LGWA 3NXPA 4GPGA 2WV4A 1TBRH 1AWHB 2JH6D 1A2CH 3P8GA 3TK5A 1GL0E 2FTLE 2Q1JA 1T32A 1GJDB 4K69A 1CT0E 1V2UT 4B75A 1SGPE 4K8BA 5TJXA 1NFXA 4E7RG 2WPMS 1KXCA 3D49H 1MKXK 3T27A 3QZRA 1WU1A 3DUXH 3FZZA 1TGNA 3DA9B 2NU4E 5LPRA 2SGDE 1K1IA 4A6LA 1SVPA 1GJ8B 1HXFH 3TITA 2TGTA 3ZVFA 1GJBB 1O2LA 1DICA 2WUBA 2ZU4A 4MQAA 1HB0B 1ZTLA 1PJPA 3BTFE 3MU1A 4ISIH 1LKBA 2ESTE 4AN7A 1FONA 2FODA 4AB8A
chains in the Genus database with same CATH superfamily
1ZPZA 4X1PU 4X8VH 2ZZUH 1HLTH 3JZ2B 1O5AB 1NU9A 2TRMA 1V2KT 1P09A 2EC9H 4NA9H 4B74A 3B23B 1FIZA 4F48B 3P17H 1C2HA 2PHBA 1JMOH 2K0QA 1QGFA 1FZZA 3P70B 2BD8A 5LGOA 2A5AA 1BB0B 4NGAH 4NSYA 2SGAA 2L74A 4TYDA 3TJVA 5A8YA 3DSGA 4U01A 3PV4A 1KYNA 2TPIZ 1ZHRA 2V6NA 4TWYA 1VITF 2FDAA 1AFEH 4O9VA 1VITG 4MPUA 1W13U 2NU3E 2PW8H 4ABJA 1C5UA 2FO9A 1TABE 4ZCNA 5SGAE 2R0KA 1OXGA 2ANKH 2CJIA 4ISHH 3SNAA 1K2I1 2UUFB 1C1TA 2HVXA 1GHVH 3A7TA 1HAGE 1ANCA 3A85A 4JYVH 5JBCS 2QF3A 2UUYA 3B8JA 1TGCA 3SU6A 1C2IA 3VB5A 3GYMA 2ASUB 5HYOA 6ESTA 1CSOE 1SL3A 5IK2D 3N7DA 6LPRA 3NUMA 4FUDA 6CHAC 1BTHH 3S0NA 1Z1JA 2OTVA 2XOKD 2FLBH 1SLWB 3M37A 3TPIZ 1D3TB 4NWLA 1O3JA 1UCYH 1HYLA 1O3CA 1LTOA 4JZIA 2KX4A 2EA3A 1A5HA 1KDQA 1IHSH 4HI3A 5EXMA 8GCHG 1AKSA 3GCTG 2BDGA 1XXFA 4BTIB 2YOLA 1P05A 3KQEA 1BTPA 2WPKS 3P8FA 4GCHG 2W7UA 3V0XA 4HFPB 3BF6H 5I46H 3QLPH 1FI8A 1O2VA 1HDTH 3TK9A 1FAKH 2JKHA 3OEHD 4X8TH 3TH2H 1BUIA 3OEED 3QTVH 5E0HA 1GJ4H 1V2RT 3A80A 1GVZA 4JZFH 5E2PA 5EPNA 1Z8JB 1O3IA 2TBSA 2FOMB 4WWYA 3P95A 1SG8B 3SO3A 3GISB 2AMDA 2OBOA 2ZEBA 3EE7A 5EW1H 1QJ6B 3RUOA 5C0UA 3HGPA 1D6RA 3QX5H 1AD8H 1T31A 3SJ8A 1FLEE 3NKKA 2BX3A 3TU7H 4CBNA 1UO6A 1SGRE 2LELA 1BITA 4X6MA 4YLQH 3KQDA 2P94A 2PKAA 1GBLA 3KNXA 1BHXB 2PLXA 2ANYA 1E35B 2Y7ZA 4BTUB 1O3EA 1TALA 1RGQA 3E0NB 2Y80A 1O2HA 1VZQH 2R3YA 1YF4A 2FYRA 2ZDLA 3OE7D 3ZVBA 1N8OB 1QRZA 2BOHB 3ATIA 2QY0B 5JB9S 1GBJA 2A4QA 5H4IB 3RP2A 1PPBH 2OQUA 4NG9H 3UOUA 1DLKB 5FL7D 2JETB 3UAIC 3RMOH 4H42U 1PQAA 1SGCA 3BSQA 2QXGA 2BD2A 1AB9B 2SGEE 1MMJN 2CN0H 2KCAA 2EI6A 1RS0A 4D9QA 5A2MH 2XNDD 1H8ED 1CBWB 1TNIA 5EW2H 1VCPA 1CHOG 3ZZ5A 2C3SA 2F9NA 2WYGA 3STJA 1YWUA 1GHZA 2Z94A 5PTPA 3SQHE 8ESTE 4CRBA 3UR9A 5DPAA 1KSNA 1AU8A 4ABEA 4Y8XA 3K2UA 2WPDD 5CDFE 1UTQA 1XVOA 4TY6A 3SUGA 1NY22 1ETRH 2V3HH 1N6XA 2ODQA 2GGVB 1K21H 5FBEA 3AK5A 2THFB 1DXWA 1MCTA 5HM2A 1TX6A 3RXCA 4Q4LA 1TB6H 6GCHF 5GJ4B 2BLOA 4Q63A 1GJ5H 1NFWA 3PWCA 4U32A 1GBTA 1FX0B 4RN6A 1O5DH 1NRSH 2ZKSA 3VGCC 4SGAE 1KLTA 3O8BA 1MTUA 3F1SB 3EA9A 3BTTE 1C5LH 3T28A 2ZFFH 1LHDH 1UTPA 4X0WU 1AGJA 2VH0A 1KXDA 2SGFE 3D23A 3FN8A 2L6OA 1GJCB 2HNTF 1O2JA 3FOAA 4YOIA 1TNKA 1C2MA 1BMNH 1Z8GA 2ZGJA 3F0OA 3GY8A 1AZZA 3SN8A 3BG4C 2A7HA 1TQ0B 1GHWH 1O3FA 4P02A 2BDHA 1T8LA 2BD9A 2A1DB 3DCLA 1O2RA 3SI4H 2O8LA 2Q6DA 1O34A 3M3SA 4GSOA 2OK5A 1ZJKA 3RXAA 1C1OA 2F9PA 2Y81A 1GMHG 3U8TH 4OM9A 3DD2H 2G5VA 2AGGX 4YOGA 1P57B 3V12A 4MLFB 2ODYB 2C4FH 3B9FH 3LC3A 1G3DA 4CR5A 1QURH 1GCTB 4JZDH 9ESTA 5GNDA 1DWCH 2VWOA 2HOBA 1O30A 5CMXH 4GHTA 2A31A 1O2YA 1XMNB 1UVOA 2JDID 4BAHB 3ATLA 1CU1A 1BTZA 1HAPH 1GGDC 1C5OH 5ABWA 1MZDA 1K1MA 3OAAD 2J38A 4DGJA 5HKKD 3HK6B 4ZHAA 3TGIE 2FOGA 3PV2A 1WDIA 2AH4X 2PGBB 1JIMA 5GXPA 2QF5A 1YC0A 2O8WA 5K0HA 5DSFA 5L6NH 1XKAC 1XKBC 5JB8S 1NRRH 2ZHQH 3P8OA 5DK1A 1LVYA 2ZP0H 1V3XA 2IOTA 3PB1E 3S9CA 4AFQA 1BT7A 2STAE 2ZU3A 5GPIB 2ZFPH 2ZNKH 3GDUA 1TMTH 1LHCH 1H4WA 1ZR0A 2JETC 1QFKH 1O3KA 1BJVA 1K28D 1FY5A 5F03A 3FP6E 1GCDA 1EASA 2O8TA 2SGPE 1FPHH 1ELVA 1W0JD 3U8RH 3MU4A 2Y5FA 1TMBH 2KCPA 3M3VA 1FXYA 2XBWA 1GCTC 4B6EA 1IQNA 4HZHA 1TWXB 4O97A 4MNVA 3TGKE 1TRYA 5LPFA 2AS9A 3T29A 1K1OA 1VGCC 1SQOA 2GX4A 5JDUB 1O3HA 1A5GH 2D1JA 2GT8A 1C5XB 2Z9IA 4ABBA 1UK4A 2PP6A 1BOQA 1JBUH 3QDZB 1JOUB 1XM1A 5GCHG 1CGJE 2OBQA 2XC4A 1K1NA 3OY6U 4AG2A 7GCHF 4MG3A 1SGFG 3NCLA 1RJXB 4FU8A 2FI5E 1BTXA 3PLPA 1AVWA 1L4ZA 1MU8B 3F9GA 4Q7ZA 1IQEA 3RLWH 4WXIA 3RM0H 2J95A 3PROA 5C1UA 1UTLM 3UOPA 1C5MD 1S83A 5DP3A 3HKIB 1E38B 3LGIA 2KCOA 1O3BA 1CT4E 1AQ7A 1G3BA 5EXLA 3UQOA 3WWFA 4AB8A 1Z6JH 1EZUC 1S0RA 1P3EA 3F2FA 1C5YB 1HAYB 1HIAA 1Z1IA 1KTTB 2FX6A 1YPEH 4NIXA 1A0LA 2VINA 3KGPA 3RC6A 3MNSA 4XFQA 1P9UA 1BHXF 5AFZH 4YLUA 2QGRA 1N6YA 1ELTA 3VB7A 1O5EH 1QRXA 1O3LA 1OHHD 2H1UA 3W1EA 5JBBS 3GS9A 1Q31A 3ATKA 1TONA 3FZDA 5FPTA 1QTFA 1ZMNA 1ABIH 5AHGH 2JIZD 4IN2A 1AIXH 1AB9C 1DM4B 1ZSJA 1N1LA 1EAWA 4K8YA 1A0JA 3A86A 3HATH 1PQ8A 2W6JD 1NRPH 2BB4A 1BMLA 5A09A 2W3IA 1QL8A 4D8NA 1H8DH 1NO9H 1GBAA 5DP4A 1ACBE 3RC5A 3A7VA 1QL7A 5FHTA 4YT7H 4JZ1A 3M7UA 4SGBE 2YNAA 5E8EH 4CR9A 3EQ0H 3WY8A 1OS8A 1S6LA 2AERH 3RXRA 2XCNA 4NIWA 4YTAA 4JZEH 1BBRK 5HM9A 5EQQA 1SQAA 2ZC9H 3ZV9A 2PUXB 3SJ9A 1X7AC 3ENSB 4OS2A 2A4GA 4WMDA 2R9PA 4HGCA 2ZDNA 1GHBG 2IN2A 2ZHWH 4XOJA 4B73A 3WW7A 2WYJA 1YY3A 3SW2B 1ZSKA 4TSFD 1C5NH 1UHBB 1JWTA 1OSSA 1BMAA 3SORA 5B6LA 3RXPA 3BTHE 1O2XA 3F9FA 3QTOH 1ELEE 1C1WH 3DFJA 1ELFA 1O2GH 4JCNA 4UFEH 5C94A 2BLVA 1THRH 3GCOA 2BD7A 1L1GA 2EEKA 3CNRA 4CH8B 5T3HA 2ALPA 1BJUA 3T62A 3UR6A 2FTMA 1O3DA 2ZHDA 3F0PA 2CMYA 2HALA 2NWNA 1O37A 3LONA 1S0QA 1HGTH 5CHAC 3GY2A 2A4RA 3NWUA 1EB1H 1MCVA 1SQTA 1GJ6A 2P93A 2ZDKA 2ZDAH 4BNRA 3PM3A 1O2MA 2I6SA 2A32A 2TGAA 5C1XA 2GCHG 2BOKA 2M5TA 3F2GA 1SFQB 2A2XH 1L0ZA 1QRWA 4QT8C 2DE8A 1VJ9U 3HGNA 5EG4A 3ZVEA 1YCPM 1ZMLA 5AVDA 3ZVGA 1WQVH 4DOQA 4INKA 2OINA 1L1NA 3M3TA 1V2WT 1O3NA 4KTSA 4ZKOU 4NA7A 3SNDA 5DGJA 4ASHA 5A0CA 3Q3XA 1UTMA 5F6MA 3AAUA 1IAUA 1LPGB 4J1YA 1PPFE 1XUFA 2PSXA 3ZVDA 1EX3A 4UDWH 1F92A 2Z3DA 1THSH 3KL6A 3C1KA 2ZFTA 4FUEA 2XRCA 2K8IA 1Z6EA 1XUKA 1ELBA 3EAJA 1MD8A 3QGJA 1KLIH 1O2OA 3SGBE 1HAIH 2WPIS 1SLUB 5JBTA 4XSKU 4WF8A 2WV5A 1C5ZB 3GY6A 3KF2A 3MNXA 3Q00A 5GIBA 2BQ7B 6CHAB 1OWKA 1FQ3A 1GI4A 1HAOH 2H9TH 4BXWA 2B5TB 3MHWU 1Y59T 1FDPA 1WQSA 2SNVA 1SGTA 4WH8A 1NN6A 4I8LA 2BXTH 1EFRD 1SBWA 1E79D 2BY9X 3GY3A 1YYY1 1GI9B 1YLCA 1JRSA 1KMHB 3LC5A 2KAIA 1SKYE 2AMQA 1DDJA 1XVMA 4X1SU 1WBGB 1AY6H 1ZLRA 2CF8H 1YPLH 1ZGVA 3QO6A 4FUCA 4OGXA 5FBIA 3H09A 3RU4T 1TIOA 7LPRA 2ZHFH 1V2JT 3SUFA 3V3MA 3UNRA 1TA2A 2F91A 1LCYA 2BD4A 5IDKA 2PKAB 2VB0A 3A89A 5FCRA 2FXRA 3KEEA 2FIRH 1RTLA 1C1RA 1HAHH 2C8XB 1GWAA 3K6YA 5T6FA 2F9OA 1LVBA 1CA0B 1JRTA 3VG8A 1TRMA 3BEFB 3UTUH 1ZJDA 1LHGH 2A7JA 3AAVA 4ZAEA 2SGQE 2OD3B 1P8VC 2K1QA 4RKJB 1FIWA 1D6WA 1HAXB 3SYJA 3GCHB 2UWOA 2FS8A 4D9RA 1BZXE 3I29A 1GI3A 1GPZA 3OU0A 4BAMB 2F9UA 3RXKA 3RXGA 4CRCA 3VXEH 2GDDA 1ZOMA 2ZDMA 1BTUA 1H8IH 1KY9A 5DP9A 4GCHF 1MQ6A 2OC7A 3PYHA 2V7QD 2Y5GA 2FOBA 2P3FH 1F5RA 4LOYH 1KXBA 3O8CA 1HUTH 1BTYA 2FOHA 3QN7A 4I7YH 4AZ2B 2A0QB 3EE0B 1S5SA 3ZVAA 5EJLA 2ZU1A 1IQJA 4Y0YE 4F4OC 1GBBA 1YKTA 1TE0A 5FX6A 3RXMA 3QGNB 3OSYA 1TMUH 3R3GB 1GVKB 1C1PA 1DLEA 5L2ZH 4Y11E 3VPKA 1OPHB 3SU3A 3SJOA 4X8UH 2QC2A 1TNGA 2QF4A 3K6ZA 1GBDA 3MNCA 4D7FA 3MMGA 3OFND 5HXFA 1C4V2 3A8DA 1PPHE 3DHKH 2RG3A 2GTBA 2XYAA 1LQDB 1PPCE 3MWIU 4LXBH 3LH3A 3LIWA 5BPEA 1TGTA 1QA0A 1YPMH 1BIOA 3MH7A 4F49A 4IBLH 1LPKB 2GCHF 1EPTC 1MAXA 4E05H 2BHGA 1GGDB 1QL9A 1W10U 4OS7A 1SB1H 5B6OA 4ABDA 3RMLH 2AEIH 3PO1B 1PYTD 1C1SA 1T8NA 2BY8X 2QV1A 2ZIQH 3NPSA 4Y7BA 4JMYA 2ZI2H 1E37B 1C5TA 3NK8A 4FXGH 3M5LA 1E34B 2UUJB 3VB3A 1YPGH 2NU0E 5LPEA 4DCDA 1MTVA 2F4LA 1SHHB 1UTJA 1SOZA 2JJ2D 4MNXA 3SUEA 1PQ7A 1EQ9A 4Q7YA 2HNTE 1BRCE 1LHEH 4E06H 1MTNB 3LT3A 4J2YB 3FFGA 7GCHG 3KYFA 3VFEA 3AASA 2BVRH 3T25A 3RXDA 1GG6B 2D8WA 1AHTH 3RDZA 1AO5A 1SQRA 1UVPA 2XXLA 3KHVA 4K1SA 5IYTA 1F0RA 5A8ZA 1Z8RA 5CHBA 4BAKB 1GI2A 5C5NA 2VIVA 3LJOA 4Y10E 1EZXC 4KKDA 1VCWA 1B5GH 2AIQA 2VH6A 1MD7A 2JH5D 4AG1A 1T4UH 1IOEA 2BDIA 1G3CA 3EYDA 4MPVA 4XDEA 3VXFH 1Y5UT 3LH1A 2GMTB 4AOQA 3KYGA 1SOTA 1FN8A 2V3MA 2H6MA 2ZCHP 4XBBA 1O39A 1EATA 3M5NA 2QYIA 1QIXB 3GCNA 4I8GA 1K0HA 1QA7A 2A5IA 4X2VA 3LDXH 1NBME 4D7GA 2WPLS 3ZZDA 5T1VA 3RXHA 3CENA 3D65E 1EJMA 2VGCB 4IC5A 1GBIA 2FPZA 3SZNA 2CF9H 1YM0A 1NTPA 2IJOB 5EJ1A 3KIDU 1Y5AT 2B0FA 1P2QA 3FKSD 1EPTB 1TX8A 2ZPRA 2ZHEH 4ABHA 5EIYA 2BVXH 1C2GA 2GD4B 3OY5U 3RLYH 2PFEA 3S7KB 1DPOA 1FMGA 4VGCB 2Q6GA 1HAVA 4CRFA 3AW1A 3K65B 3RXVA 1Q3XA 3URCA 2BYAX 1MKXH 3GDVA 3G01A 4A1XA 1AVXA 1MKWH 4ISOA 2Z7FE 5DJ7A 2ZFRH 2J92A 3DT0H 1ZZZA 3BTGE 4TPIZ 3M61U 2YMSC 1DX5M 1C5QA 4FUHA 1S6HA 4YT6H 2A45B 1GHXH 1O2UA 4HG6A 1Y5BT 1COWD 1O2WA 1A5IA 4NZLA 3TVJB 1DITH 1SMFE 5KEDA 1ZGIA 3A8BA 4MVNA 3KN2A 4ISNA 2BLQA 3ODDA 3O8DA 1YBWA 4RT0A 2WV9A 1U6QA 1MH0A 4KTUA 2DE9A 4WH6A 5DP8A 1DWEH 4AX9H 4LZ1H 3VB4A 4AFUA 1E36B 2HPQH 1ID5H 4CBOA 3FP8E 4KP0A 1AE5A 1SGDE 1SC8U 1W0KD 2Y5HA 2BD3A 2HLDD 1KTSB 1CGHA 1O32A 4XE4A 4XRNA 1MTWA 5EOKA 1GMDG 4U2WA 4IS5A 2BM2A 1IQGA 3TJUA 2B8OH 4MNWA 4DVAU 4AYYB 1EJNA 5FPSA 1O5GH 1IHTH 5C3NA 3SU2A 3H7OA 3KQ5A 1XUIA 1ZHPA 1C5VA 2UWLA 2FLRH 4UD9H 1HIAB 1YCPK 3RC4A 1WUNH 4ZROA 2VIQA 4X6NA 5K7RA 5L2YH 1KXFA 3H5CB 4A1VA 4DIIH 1C2KA 1TQ7B 3U1JB 1D3QB 3UNSA 4VGCC 4IMZA 2P95A 2B7DH 4GHQA 4UE7H 1QZ8A 2HVYB 1O2SA 4B71A 4UFFH 1T8OA 1XUJA 2RCEA 3ZZ6A 1TYNA 1G32B 1MBMA 2BY7X 5AF9H 1G2LA 1UHBA 5JPMH 1FPCH 2J94A 1TGSZ 1MZAA 2QA9E 1IQHA 4ZH8A 3MOCA 3BV9B 3MYWA 4YO9A 4BOHA 2O8UA 2BD5A 2QXJA 4IGDA 1O35A 2VIWA 4OS5A 3SHCH 4BAOB 1XUHA 5C1YA 3ATMA 1B0FA 3BG8A 5F8TA 3W94A 1TPPA 1C5RA 1WTGH 1H8HD 2FI4E 4YXWD 1W2KH 3EA7A 3AW0A 1C1NA 3GCTF 5EPYA 1K9OE 1QQUA 4E7NA 1O38A 2ZWLH 2V35A 1DWDH 4ABFA 4B6FA 5DO4H 3M7QA 2DUCA 3ZV8A 1DSUA 2AFQB 1UVUH 2O9QA 1LMWB 2ZPQA 3P8NA 1PYTC 1WXRA 1O33A 5C17A 3RXBA 1C4U2 1IQLA 1WTHD 2EQNA 5TCAA 1A0HB 4M9FA 1UTNA 2GKVE 2VIDA 4I8JA 2BDCA 2JH0D 1P2JA 2R3UA 2XNIA 1Y3WA 1BRBE 1AKSB 2ZECA 1F5LA 5I25A 2OXSA 4MNYA 2PSYA 3MQKC 1Y3UA 2STBE 3M5OA 1SLVB 3SJIA 2VVUA 4Y0ZE 1A4WH 1C2LA 3IITA 1P2IA 1EP6A 4R0IA 3PTNA 1QJ7B 2OCVB 4UFGH 1B0EA 3R0FA 4AGKA 2XCFA 2BY5X 3SU5A 2EY4C 2VIPA 2ZCLP 1GDUA 3OX7U 2KCYA 1C5PA 1DY8A 4X2XA 4PROA 1BMMH 1IQFA 1DUEA 1HJ8A 1QNJA 4AFSA 2VVCA 4CHAB 4TT3D 2BZ6H 3V7TA 2D26C 1RIWC 3EDXB 3ELAH 5JYIA 5EGMA 1OWIA 2FM2A 2R0LA 1OKXA 4X1QU 1BRAA 3M36A 1RFNA 3ODFA 3OTPA 3F3BA 3GOVB 3L6PA 2Y6TA 4AFZA 2ZTXA 4ABIA 4AYVB 3RU4E 4IW4E 2RDEA 1K1PA 2C93B 5CHAB 3SUDA 3ZYEA 2OC1A 1O5FH 1A61H 2M2AA 1DXPA 2A4OA 2VJ1A 1BTWA 1C2FA 1C4Y2 1ELCA 4ESTE 1TPAE 1W7XH 4BAQB 1MU6B 3SV8A 1OYTH 2XTTB 1HJAC 4HTCH 3N7EA 1O2TA 1RTFB 3DFLA 3NZIA 3PV5A 1CBWC 3ITIA 2YMSD 3MI4A 1EAUA 4RSPA 4GUXA 8LPRA 2AHME 2FWWA 1LHFH 4BXSA 1ANEA 3I77A 1V2OT 1NROH 2FI3E 2OC8A 1FJSA 3SGQE 3ATWA 3CS0A 3IWMA 3M35A 4Z0KA 3RXFA 2F3CE 1PPEE 4ZHLU 2O8MA 4CRAA 1T7CA 4XBDA 4Y8YA 1C1MA 4ZXXH 4I32A 4O3TA 1TX7A 1VJAU 1P3CA 5C20A 1SI5H 4NWKA 2RDLA 1N8OC 3LJJA 1LVOA 2QE7D 4I33A 1HPGA 2CGAA 5E0JA 1JIRA 2H5CA 1YPHC 4Q2KA 4WY3A 3LU9B 4NCYA 4ZUHA 5FCKA 1UCYK 2C8YB 1SGQE 1C2JA 3TLOA 1WV7H 1NFYA 2BQ6B 1V2ST 4U30A 1EB2A 4I31A 3RXTA 2EI7A 4ZHMU 3L33A 2WINI 3HPTB 4RKOB 1V6DA 4X1NU 1NZQH 1XXDA 1J15A 1P2MA 1LDTT 1AZ8A 4DY7B 2C8ZB 3BIUH 3TJOA 1DT2A 1GJ9B 2ZPSA 3ZZ9A 1GI0A 1G37A 1CQQA 4NFFA 2HLCA 3KQCA 3PRDA 1DOJA 5EU8A 5EODA 3EA8A 1J14A 3BTKE 1GJ7B 2KM0A 2HRVA 1H9HE 2OP9A 1EUFA 1RXPA 4Y71A 1VITH 4Y79A 2BX4A 1O2NA 1Y3YA 3UREA 4DW2U 1A7SA 2IPQX 1ARBA 2Q6FA 1AN1E 3JZ1B 1OP8A 4NFEA 1GDQA 1GHYH 2BDBA 2J5UA 3H7TA 4ZXYH 3ZZ3A 1TPSA 3M7TA 1A3BH 1NT1A 1D4PB 3TNTA 2WSSD 1F2SE 1KXEA 3LGUA 4MPWA 1HBTH 3MFJA 1ELGA 3A87A 2XWAA 1YCPH 1HJ9A 2J2UA 2PWXA 2QXHA 4INHA 1GVLA 1ESBA 1UK2A 4JYTA 5E0GA 1PQ5A 1SGIB 3BN9A 1UVTH 1AUJA 2VWLA 1HAVB 1WAYB 1TGBA 3N99A 3MO3A 1V2TT 2C8WB 2C90B 1H1BA 1O2ZA 2ZTZA 3GY5A 1O0DH 2G8TA 1QBVH 4FUJA 1HNEE 3U9AH 1TNHA 1SGYE 4FUBA 2KR7A 1W3CA 3SBKA 4B2CA 1ETTH 3A7WA 3N7OA 1V2LT 1XUGA 4WMFA 1EZQA 2H2ZA 4FOUC 4A1TA 3E0PB 1P2KA 1HAZB 2WPHS 3O8RA 5DP7A 1PFXC 1GI6A 1SLXB 2GV6A 1NESE 1Z71A 2WUCA 1FN6A 1ZHMA 2J97A 2UWPA 4BTTB 1J8AA 1AFQB 4XBCA 3KCGH 1MTSA 2ULLA 2ODPA 2XW9A 3UWJH 2P59A 4P00A 4ZMAH 3MO6A 1V2PT 4B1TA 2AGEX 1A3EH 4WXVA 4ACAA 4GAWA 1J16A 2ZTYA 1EJAA 1V2NT 3DSPA 2CV3A 1A46H 1MUEB 5GDSH 3RXLA 1UW7A 4ZKNU 3MH4A 3SHAH 4YM9A 1KIGH 3GY4A 3RMNH 3BTEE 5T6GA 4RI0A 2G52A 1W0ZU 2BXUH 4OS4A 2FYQA 1T4VH 3A81A 2AYWA 3TH3H 3TJNA 5C0TA 4TY7A 2W5EA 4F55A 1SGFA 2Z3CA 4B2AA 1GI5A 1XX9A 2ZF0H 3D62A 4CRGA 1W12U 1DFPA 1W14U 1NBMD 2HWLB 1QBNA 1S85A 2LP6A 3PMJA 1W7GH 2BTCE 3FVFB 1F7ZA 2GJGA 5GCHF 4WMEA 2XBYA 3DSOA 1UCYE 2BVSH 1Y8TA 3RXOA 1WYKA 2FS9A 3T2NA 5HIZA 4YOJA 2ZGBH 3BG4B 1LQEA 3S9BA 4JYUH 1DSTA 1GL1A 2IPHA 1LO6A 2WZQA 1C9TA 1FY3A 1QR3E 3A7ZA 1AMHA 3VEQB 1P2OA 3LOXA 3F68H 4THNH 1RIWB 2FP7B 1W11U 5ESTE 3ZIAD 2GT7A 2WHXA 2BQWB 3QK1A 1OYQA 3SOSA 3E1XB 3LKWA 3STIA 1CHOF 1OWEA 2P8OB 1BQYA 3RM2H 2VU8E 2Y82A 4KTCA 1QY6A 4Y7AA 3Q77A 4UONA 2P3TB 2Z9GA 1NC6A 1IQMA 4I8KA 1GJAB 1MKWK 2AMPA 1FUJA 3IG6B 4ASUD 1G36A 3SU4A 4TWWA 4Y6DA 3M5MA 1E0FD 4WVPE 2HPPH 3GICB 3MO9A 2Z9JA 8KME2 2PKSC 3ZZAA 4FVDA 6GCHG 1F0TA 5EJZA 3RXSA 1C5WB 1S6FA 1ABJH 1S81A 2G5NA 4Y76A 2BLWA 1LPZB 3PMBB 1OX1A 1ZSLA 4K1EA 3ESTA 1C2EA 1NPMA 2AIPA 5HIYA 3PMAB 4IC6A 3RU4D 3E91A 3L3TA 4FVBA 4ZKSU 1QCPA 2FESH 4KGAA 8GCHF 1P06A 1C1QA 3PLBA 2V0BA 3A7YA 1ZRBA 2VIOA 3A82A 1DVAH 3AVZA 3CS7A 3U28C 1E1QD 2ZFSA 2IJD1 2ALVA 4FUIA 4OGYA 1BCUH 1EP5A 3TGJE 1ARCA 4DJZB 1QB6A 3OTJE 4DT4A 3SNEA 5DG6A 4B76A 1NFUA 1YP9A 2LPRA 3A8CA 1GHBF 4X6OA 3ZYDA 1BRUP 3Q3YA 3A84A 1GBCA 1JXPA 2QF0A 3A7XA 3SV2H 3A8AA 3MU0A 3E6PH 1RRKA 1YPKH 3PLKA 1AFQC 4NZQA 2BY6X 3RXJA 4ABAA 1EAXA 2LNCA 1FY8E 2PKSB 1HRTH 1VKYA 3E8LA 1FNIA 1NRNH 5GWZA 2G4TA 3QUMP 4X6PA 3FAOA 1EXFA 2W3KA 2GZ7A 5A0AE 2B9LA 2PGQB 5DP5A 3GYLB 1GMCF 4UFDH 4X2YA 3A83A 1UTKA 1AVGH 3F2HA 3SV9A 4LZ4B 2YNBA 1IQIA 2P8OC 1DWBH 1G2MA 1CHGA 4ZKRU 3UWIA 4ISLA 4H6SB 1Z7KA 1SFIA 1BBRE 2FEQH 2XC5A 2ILNA 1CA0C 7KMEH 1LVMA 1S84A 4NA8A 3PO1C 1RTKA 1C2DA 4D76A 1V2VT 2ANMH 1BMFD 2BMGB 3HK3B 4TPYA 4OS6A 2BDAA 3BTDE 1GI1A 1D9IA 2GVFA 3CP7A 4X1RU 5LH8A 1P11E 1Y3XA 5DP6A 1DANH 1UVSH 1G3EA 2FX4A 2ZGCA 2TIOA 1Q2WA 1O3MA 1SHYA 2R2WU 3BIVH 3BEUA 4K3JA 5KECA 2FOFA 3RXEA 3SZEA 3OYPA 1TPOA 2QAAA 1P04A 1M9UA 2J9NA 3TIUA 2OC0A 1GMDF 2RA0A 2ZQ1A 3S7HB 1GG6C 1C1UH 3SI3H 3UNQA 1OOKB 4O03A 2P3UB 5A0BA 2G00A 1TRNA 2FZZA 1D3DB 1DUAA 5JBAS 3UFAA 5FPYA 2J98B 1RD3B 1ZMJA 3UPEA 4O3UA 4K60A 3ZZ7A 1ANDA 2UUKB 4K2YA 3F9EA 1G9IE 1P02A 1QJ1B 1S82A 4Q7XA 1WOFA 3BTME 1CVWH 1TOMH 2TGPZ 1BBRH 1E1RD 5HMAA 1L1JA 2GZ9A 1DS2E 1ETSH 2GZ8A 2QCYA 2RA3A 3BTWE 1MQ5A 1J17T 5T6DA 1TLDA 5A8XA 3FANA 4Z6AH 3URDA 1ZPCA 2J34A 4ABGA 5C2ZA 5BRRE 1EKBB 3I78A 1CA8B 1TBZH 3F6UH 1TNLA 7ESTE 1UK3A 1YGCH 3A88A 4H6TA 3ZZBA 3NRLA 4UEHH 2RFKC 1OP0A 2KFWA 1AI8H 1O2PA 3W95A 4AGJA 2CK3D 3SJKA 1P12E 3UUZA 1VCQA 2OUAA 1ORFA 1WCZA 4AORA 4MDSA 2Z6BD 5DKMA 2ZU2A 1MABB 1J9CH 1QB9A 2ZFQH 1C1VH 3QZQA 3C27B 1L2EA 3SU1A 2W26A 5C67A 2GDEH 1O5CB 4A5TS 2VVVA 1P01A 4FU7A 2SNWA 4NIVA 4I8HA 2GMTC 4IMQA 3SNCA 1F5KU 2XBXA 4A92A 2H5DA 1TBQH 2F9BH 1ANBA 5FXLA 3LGYA 1PPGE 1SGNE 2NU1E 2Z9LA 3ZVCA 1KDQB 3S9AA 5L30H 1GBMA 1OWJA 1C5SA 1O2QA 1F0SA 2TGDA 4NIYA 1YPJH 1V2MT 1GI7B 1NU7B 4WJG2 2QXIA 3SQEE 1HCGA 1YPHE 3P92A 3TK6A 1VGCB 3Q3KA 2ZQ2A 4A7IB 2YMSB 1GBFA 3QWCH 1Z8IB 2JJ1D 1H9LB 2Z9KA 4FUGA 1MTNC 1O2KA 2BZAA 4AB9A 3VGCB 4ACBA 1NS3A 3HKJB 4MPXA 1NRQH 3GCHC 4FUFA 4DG4A 1K22H 1B7XB 3U98H 1GHAG 1T8MA 3E3TA 2AGIX 3FO8D 3UIRA 3LGTA 4M7GA 2PTNA 2VWMA 1LKAA 3MTYA 4DT7B 1EAIA 1DE7H 1ELAA 4CRDA 4NSVA 9LPRA 1THPB 1L4DA 3SV6A 1GBKA 2G51A 2A7CA 3GY7A 2PV9B 1P10A 1QBOA 3V13A 3MU8A 1GMCG 2HNTC 2Z3EA 1VR1H 1P9SA 4INLA 1IQKA 1QQ4A 4X2WA 5E2OA 5FX5A 2CHAB 4H4FA 4KELA 3TH4H 1K1JA 4YESB 2ZG0H 1BA8B 2J98A 1ZRKA 2QIQA 2ZGXH 2VGCC 2VNTA 1A1RA 1TA6A 3K9XB 2Y7XA 1O5BB 3VB6A 4YZUA 2ANWA 1ESAA 2CXVA 1AWFH 1EOLA 1WSSH 5C5OA 1FY4A 2A2QH 3Q76A 3WWBA 2FOEA 5J4QA 1SSXA 4GVUA 4K1TA 1CT2E 2W6ID 1P03A 3RXUA 2BDYA 1INCA 5HGGA 2VBCA 2XWBI 1AE8H 1AUTC 1QB1A 2KAIB 2ZU5A 3PRBA 5J4SA 3P6ZB 2XC0A 2I6QA 2OQ5A 2ZO3H 5CE1A 4FU9A 4AC9A 1O3GA 1PPZA 3RXIA 2GV7A 1DY9A 1SPJA 1ESTA 1GDNA 1D3PB 2G81E 3PMHB 3BEIB 2F83A 1H9IE 4Q80A 5FAHA 3LGVA 1O31A 1SR5C 3PWBA 3S69A 3F9HA 4BANB 1EPTA 4X8SH 3U1IB 4DIHH 1FV9A 2P16A 1HJAB 4LK4A 4JK5A 1EOJA 2H9EH 3ZZCA 1F0UA 4GLYA 1CE5A 5KGOA 4DURA 3E16B 3SNBA 1MBQA 3E90B 4XD7D 1OP2A 2EI8A 1GBHA 2XBVA 3UQVA 1QHRB 2V3OH 1ZYOA 4CHAC 1O36A 1FY1A 1TNJA 3KQBA 1HV7A 1UTOA 2SFAA 5F8ZA 1GI8B 1ELDE 3SV7A 4CH2B 3T26A 1P2NA 3MH6A 1W0YH 5ETXA 1HFDA 2G55A 2KZ4A 2F9VA 1G30B 3GDSA 1HXEH 1GBEA 4RT1A 3ZZ4A 1TOCB 4IN1A 1ZTJA 1ZTKA 2J4IA 5EQRA 2R2MB 3UY9A 5EQSA 1OWDA 3SGAE 2ZA5A 1C9PA 1O2IA 1KLJH 2G4UA 5TCCA 2A5KA 3PTBA 2NU2E 1O3PB 3LPRA 2FOCA 2PTCE 1O3AA 3MH5A 1Y3VA 1OWHA 1MAYA 3RMMH 2GCTB 1P0SH 3U8OH 5DN6D 1SGEE 1UJ1A 4Z1MD 1W8BH 3EGKH 2ZDVH 4MTBA 4CREA 1CO7E 1TAWA 1NM6A 1O3OA 1GMHF 2QN5T 2WPJS 4JK6A 2GCTC 2ZGHA 2D2DA 1TFXA 1YLNA 1YLDA 3T5FH 5AFYH 2VWNA 1KXAA 1V2QT 2CHAC 5ESBA 1CGIE 5EXNA 2FOAA 5G4BA 2GP9B 4Y8ZA 1GHAF 2ZCKP 2OLGA 5F8XA 2PUQH 3SU0A 2HGTH 4K5ZA 1EZSC 4R8TB 3ZZ8A 4B2BA 1K1LA 1ZPBA 4I86A 1FAXA 3MNBA 1UMAH 3BTQE 3RXQA 2PR3A 3U69H 1BDAA 2H9HA 4OS1A 2FMJA 2W7SA 3MU5A 3FP7E 3TNSA 3UB0A 3LGWA 3NXPA 4GPGA 2WV4A 1TBRH 1AWHB 2JH6D 1A2CH 3P8GA 4FETA 3TK5A 1GL0E 2FTLE 2Q1JA 1T32A 1GJDB 4K69A 1CT0E 1V2UT 4B75A 1SGPE 4K8BA 5TJXA 1NFXA 4E7RG 2WPMS 1KXCA 3D49H 1MKXK 3T27A 3QZRA 1WU1A 3DUXH 3FZZA 1TGNA 3DA9B 2NU4E 5LPRA 2SGDE 1K1IA 4A6LA 1SVPA 1GJ8B 1HXFH 3TITA 2TGTA 3ZVFA 1GJBB 1O2LA 1DICA 2WUBA 2ZU4A 4MQAA 1HB0B 1ZTLA 1PJPA 3BTFE 3MU1A 4ISIH 1LKBA 2ESTE 4AN7A 1FONA 2FODA 5F53A 2F43B
chains in the Genus database with same CATH topology
1ZPZA 4X1PU 4X8VH 2ZZUH 1HLTH 3JZ2B 1O5AB 1NU9A 2TRMA 1V2KT 1P09A 2EC9H 4NA9H 4B74A 3B23B 1FIZA 3P17H 1C2HA 2PHBA 1JMOH 1QGFA 1FZZA 3P70B 2BD8A 5LGOA 2A5AA 1BB0B 4NGAH 4NSYA 2SGAA 4TYDA 3TJVA 5A8YA 4U01A 3PV4A 1KYNA 2TPIZ 1ZHRA 2V6NA 4TWYA 1VITF 2FDAA 1AFEH 4O9VA 1VITG 4MPUA 1W13U 2NU3E 2PW8H 4ABJA 1C5UA 2FO9A 1TABE 5SGAE 2R0KA 1OXGA 2ANKH 2CJIA 4ISHH 3SNAA 1K2I1 2UUFB 1C1TA 2HVXA 1GHVH 3A7TA 1HAGE 1ANCA 3A85A 4JYVH 5JBCS 2QF3A 2UUYA 3B8JA 1TGCA 3SU6A 1C2IA 3VB5A 3GYMA 2ASUB 5HYOA 6ESTA 1CSOE 1SL3A 6LPRA 3NUMA 4FUDA 6CHAC 1BTHH 3S0NA 1Z1JA 2OTVA 2FLBH 1SLWB 3M37A 3TPIZ 1D3TB 4NWLA 1O3JA 1UCYH 1HYLA 1O3CA 1LTOA 4JZIA 2EA3A 1A5HA 1KDQA 1IHSH 4HI3A 5EXMA 8GCHG 1AKSA 3GCTG 2BDGA 1XXFA 4BTIB 2YOLA 1P05A 3KQEA 1BTPA 2WPKS 3P8FA 4GCHG 2W7UA 3V0XA 4HFPB 3BF6H 5I46H 3QLPH 1FI8A 1O2VA 1HDTH 3TK9A 1FAKH 2JKHA 4X8TH 3TH2H 1BUIA 3QTVH 5E0HA 1GJ4H 1V2RT 3A80A 1GVZA 4JZFH 5E2PA 5EPNA 1Z8JB 1O3IA 2TBSA 2FOMB 4WWYA 3P95A 1SG8B 3SO3A 3GISB 2AMDA 2OBOA 2ZEBA 5EW1H 1QJ6B 3RUOA 3HGPA 1D6RA 3QX5H 1AD8H 1T31A 3SJ8A 1FLEE 3NKKA 2BX3A 3TU7H 4CBNA 1UO6A 1SGRE 1BITA 4X6MA 4YLQH 3KQDA 2P94A 2PKAA 1GBLA 3KNXA 1BHXB 2PLXA 2ANYA 1E35B 2Y7ZA 4BTUB 1O3EA 1TALA 1RGQA 3E0NB 2Y80A 1O2HA 1VZQH 2R3YA 1YF4A 2FYRA 2ZDLA 3ZVBA 1N8OB 1QRZA 2BOHB 3ATIA 2QY0B 5JB9S 1GBJA 2A4QA 5H4IB 3RP2A 1PPBH 2OQUA 4NG9H 3UOUA 1DLKB 2JETB 3RMOH 4H42U 1PQAA 1SGCA 3BSQA 2QXGA 2BD2A 1AB9B 2SGEE 1MMJN 2CN0H 2EI6A 1RS0A 4D9QA 5A2MH 1CBWB 1TNIA 5EW2H 1VCPA 1CHOG 3ZZ5A 2C3SA 2F9NA 2WYGA 3STJA 1GHZA 2Z94A 5PTPA 3SQHE 8ESTE 4CRBA 3UR9A 5DPAA 1KSNA 1AU8A 4ABEA 4Y8XA 3K2UA 1UTQA 1XVOA 4TY6A 3SUGA 1NY22 1ETRH 2V3HH 1N6XA 2ODQA 2GGVB 1K21H 5FBEA 2THFB 1DXWA 1MCTA 5HM2A 1TX6A 3RXCA 1TB6H 6GCHF 5GJ4B 2BLOA 1GJ5H 1NFWA 3PWCA 4U32A 1GBTA 4RN6A 1O5DH 1NRSH 2ZKSA 3VGCC 4SGAE 1KLTA 3O8BA 1MTUA 3F1SB 3EA9A 3BTTE 1C5LH 3T28A 2ZFFH 1LHDH 1UTPA 4X0WU 1AGJA 2VH0A 1KXDA 2SGFE 3D23A 1GJCB 2HNTF 1O2JA 4YOIA 1TNKA 1C2MA 1BMNH 1Z8GA 2ZGJA 3GY8A 1AZZA 3SN8A 3BG4C 2A7HA 1TQ0B 1GHWH 1O3FA 2BDHA 1T8LA 2BD9A 2A1DB 1O2RA 3SI4H 2O8LA 2Q6DA 1O34A 3M3SA 4GSOA 1ZJKA 3RXAA 1C1OA 2F9PA 2Y81A 1GMHG 3U8TH 3DD2H 2G5VA 2AGGX 4YOGA 1P57B 3V12A 4MLFB 2ODYB 2C4FH 3B9FH 3LC3A 1G3DA 4CR5A 1QURH 1GCTB 4JZDH 9ESTA 1DWCH 2VWOA 2HOBA 1O30A 5CMXH 4GHTA 2A31A 1O2YA 1XMNB 1UVOA 4BAHB 3ATLA 1CU1A 1BTZA 1HAPH 1GGDC 1C5OH 5ABWA 1MZDA 1K1MA 2J38A 4DGJA 3HK6B 4ZHAA 3TGIE 2FOGA 2AH4X 2PGBB 1JIMA 5GXPA 1YC0A 2O8WA 5K0HA 5L6NH 1XKAC 1XKBC 5JB8S 1NRRH 2ZHQH 3P8OA 5DK1A 1LVYA 2ZP0H 1V3XA 2IOTA 3PB1E 3S9CA 4AFQA 1BT7A 2STAE 2ZU3A 5GPIB 2ZFPH 2ZNKH 3GDUA 1TMTH 1LHCH 1H4WA 1ZR0A 2JETC 1QFKH 1O3KA 1BJVA 1K28D 1FY5A 5F03A 3FP6E 1GCDA 1EASA 2O8TA 2SGPE 1FPHH 1ELVA 3U8RH 3MU4A 2Y5FA 1TMBH 3M3VA 1FXYA 2XBWA 1GCTC 1IQNA 4HZHA 1TWXB 4O97A 4MNVA 3TGKE 1TRYA 5LPFA 2AS9A 3T29A 1K1OA 1VGCC 1SQOA 2GX4A 5JDUB 1O3HA 1A5GH 2D1JA 2GT8A 1C5XB 2Z9IA 4ABBA 1UK4A 1BOQA 1JBUH 3QDZB 1JOUB 1XM1A 5GCHG 1CGJE 2OBQA 2XC4A 1K1NA 3OY6U 4AG2A 7GCHF 4MG3A 1SGFG 3NCLA 1RJXB 4FU8A 2FI5E 1BTXA 3PLPA 1AVWA 1L4ZA 1MU8B 3F9GA 4Q7ZA 1IQEA 3RLWH 4WXIA 3RM0H 2J95A 3PROA 5C1UA 1UTLM 3UOPA 1C5MD 1S83A 5DP3A 3HKIB 1E38B 3LGIA 1O3BA 1CT4E 1AQ7A 1G3BA 5EXLA 3UQOA 1Z6JH 1EZUC 1S0RA 1P3EA 1C5YB 1HAYB 1HIAA 1Z1IA 1KTTB 2FX6A 1YPEH 4NIXA 1A0LA 2VINA 3KGPA 3RC6A 3MNSA 4XFQA 1P9UA 1BHXF 5AFZH 4YLUA 2QGRA 1N6YA 1ELTA 3VB7A 1O5EH 1QRXA 1O3LA 2H1UA 5JBBS 1Q31A 3ATKA 1TONA 3FZDA 5FPTA 1QTFA 1ZMNA 1ABIH 5AHGH 4IN2A 1AIXH 1AB9C 1DM4B 1ZSJA 1N1LA 1EAWA 4K8YA 1A0JA 3A86A 3HATH 1PQ8A 1NRPH 2BB4A 1BMLA 5A09A 2W3IA 1QL8A 4D8NA 1H8DH 1NO9H 1GBAA 5DP4A 1ACBE 3RC5A 3A7VA 1QL7A 5FHTA 4YT7H 4JZ1A 3M7UA 4SGBE 2YNAA 5E8EH 4CR9A 3EQ0H 3WY8A 1OS8A 2AERH 3RXRA 2XCNA 4NIWA 4YTAA 4JZEH 1BBRK 5HM9A 5EQQA 1SQAA 2ZC9H 3ZV9A 2PUXB 3SJ9A 1X7AC 3ENSB 4OS2A 2A4GA 4WMDA 2R9PA 4HGCA 2ZDNA 1GHBG 2IN2A 2ZHWH 4XOJA 4B73A 2WYJA 3SW2B 1ZSKA 1C5NH 1UHBB 1JWTA 1OSSA 1BMAA 3SORA 3RXPA 3BTHE 1O2XA 3F9FA 3QTOH 1ELEE 1C1WH 3DFJA 1ELFA 1O2GH 4JCNA 4UFEH 2BLVA 1THRH 3GCOA 2BD7A 1L1GA 2EEKA 4CH8B 5T3HA 2ALPA 1BJUA 3T62A 3UR6A 2FTMA 1O3DA 2ZHDA 2CMYA 2HALA 2NWNA 1O37A 3LONA 1S0QA 1HGTH 5CHAC 3GY2A 2A4RA 3NWUA 1EB1H 1MCVA 1SQTA 1GJ6A 2P93A 2ZDKA 2ZDAH 4BNRA 3PM3A 1O2MA 2I6SA 2A32A 2TGAA 5C1XA 2GCHG 2BOKA 2M5TA 1SFQB 2A2XH 1L0ZA 1QRWA 4QT8C 2DE8A 1VJ9U 3HGNA 5EG4A 3ZVEA 1YCPM 1ZMLA 5AVDA 3ZVGA 1WQVH 4DOQA 4INKA 2OINA 1L1NA 3M3TA 1V2WT 1O3NA 4KTSA 4ZKOU 4NA7A 3SNDA 5DGJA 4ASHA 5A0CA 3Q3XA 1UTMA 5F6MA 3AAUA 1IAUA 1LPGB 4J1YA 1PPFE 1XUFA 2PSXA 3ZVDA 1EX3A 4UDWH 1F92A 2Z3DA 1THSH 3KL6A 3C1KA 2ZFTA 4FUEA 2XRCA 1Z6EA 1XUKA 1ELBA 3EAJA 1MD8A 3QGJA 1KLIH 1O2OA 3SGBE 1HAIH 2WPIS 1SLUB 5JBTA 4XSKU 4WF8A 2WV5A 1C5ZB 3GY6A 3KF2A 3MNXA 3Q00A 5GIBA 2BQ7B 6CHAB 1OWKA 1FQ3A 1GI4A 1HAOH 2H9TH 4BXWA 2B5TB 3MHWU 1Y59T 1FDPA 1WQSA 2SNVA 1SGTA 4WH8A 1NN6A 4I8LA 2BXTH 1SBWA 2BY9X 3GY3A 1YYY1 1GI9B 1YLCA 1JRSA 3LC5A 2KAIA 2AMQA 1DDJA 1XVMA 4X1SU 1WBGB 1AY6H 1ZLRA 2CF8H 1YPLH 1ZGVA 3QO6A 4FUCA 4OGXA 5FBIA 3RU4T 1TIOA 7LPRA 2ZHFH 1V2JT 3SUFA 3V3MA 3UNRA 1TA2A 2F91A 1LCYA 2BD4A 5IDKA 2PKAB 2VB0A 3A89A 5FCRA 2FXRA 3KEEA 2FIRH 1RTLA 1C1RA 1HAHH 2C8XB 1GWAA 3K6YA 5T6FA 2F9OA 1LVBA 1CA0B 1JRTA 1TRMA 3BEFB 3UTUH 1ZJDA 1LHGH 2A7JA 3AAVA 4ZAEA 2SGQE 2OD3B 1P8VC 2K1QA 4RKJB 1FIWA 1D6WA 1HAXB 3GCHB 2UWOA 2FS8A 4D9RA 1BZXE 3I29A 1GI3A 1GPZA 3OU0A 4BAMB 2F9UA 3RXKA 3RXGA 4CRCA 3VXEH 2GDDA 1ZOMA 2ZDMA 1BTUA 1H8IH 1KY9A 5DP9A 4GCHF 1MQ6A 2OC7A 3PYHA 2Y5GA 2FOBA 2P3FH 1F5RA 4LOYH 1KXBA 3O8CA 1HUTH 1BTYA 2FOHA 3QN7A 4I7YH 4AZ2B 2A0QB 3EE0B 1S5SA 3ZVAA 2ZU1A 1IQJA 4Y0YE 4F4OC 1GBBA 1YKTA 1TE0A 5FX6A 3RXMA 3QGNB 3OSYA 1TMUH 3R3GB 1GVKB 1C1PA 1DLEA 5L2ZH 4Y11E 3VPKA 1OPHB 3SU3A 3SJOA 4X8UH 2QC2A 1TNGA 3K6ZA 1GBDA 3MNCA 4D7FA 3MMGA 5HXFA 1C4V2 3A8DA 1PPHE 3DHKH 2RG3A 2GTBA 2XYAA 1LQDB 1PPCE 3MWIU 4LXBH 3LH3A 3LIWA 5BPEA 1TGTA 1QA0A 1YPMH 1BIOA 3MH7A 4F49A 4IBLH 1LPKB 2GCHF 1EPTC 1MAXA 4E05H 2BHGA 1GGDB 1QL9A 1W10U 4OS7A 1SB1H 5B6OA 4ABDA 3RMLH 2AEIH 3PO1B 1PYTD 1C1SA 1T8NA 2BY8X 2QV1A 2ZIQH 3NPSA 4Y7BA 4JMYA 2ZI2H 1E37B 1C5TA 3NK8A 4FXGH 3M5LA 1E34B 2UUJB 3VB3A 1YPGH 2NU0E 5LPEA 4DCDA 1MTVA 1SHHB 1UTJA 1SOZA 4MNXA 3SUEA 1PQ7A 1EQ9A 4Q7YA 2HNTE 1BRCE 1LHEH 4E06H 1MTNB 3LT3A 4J2YB 3FFGA 7GCHG 3VFEA 3AASA 2BVRH 3T25A 3RXDA 1GG6B 2D8WA 1AHTH 3RDZA 1AO5A 2XXLA 1UVPA 3KHVA 4K1SA 5IYTA 1F0RA 5A8ZA 1Z8RA 4BAKB 1GI2A 5C5NA 2VIVA 3LJOA 4Y10E 1EZXC 4KKDA 1VCWA 1B5GH 2AIQA 2VH6A 1MD7A 2JH5D 4AG1A 1T4UH 1IOEA 2BDIA 1G3CA 3EYDA 4MPVA 4XDEA 3VXFH 1Y5UT 3LH1A 2GMTB 4AOQA 1SOTA 1FN8A 2H6MA 2ZCHP 4XBBA 1O39A 1EATA 3M5NA 2QYIA 1QIXB 3GCNA 4I8GA 1QA7A 2A5IA 4X2VA 3LDXH 4D7GA 2WPLS 3ZZDA 3RXHA 3CENA 3D65E 1EJMA 2VGCB 4IC5A 1GBIA 2FPZA 3SZNA 2CF9H 1YM0A 1NTPA 2IJOB 3KIDU 1Y5AT 2B0FA 1P2QA 1EPTB 1TX8A 2ZPRA 2ZHEH 4ABHA 2BVXH 1C2GA 2GD4B 3OY5U 3RLYH 2PFEA 3S7KB 1DPOA 1FMGA 4VGCB 2Q6GA 1HAVA 4CRFA 3AW1A 3K65B 3RXVA 1Q3XA 3URCA 2BYAX 1MKXH 3GDVA 3G01A 4A1XA 1AVXA 1MKWH 4ISOA 2Z7FE 5DJ7A 2ZFRH 2J92A 3DT0H 1ZZZA 3BTGE 4TPIZ 3M61U 1DX5M 1C5QA 4FUHA 1S6HA 4YT6H 2A45B 1GHXH 1O2UA 1Y5BT 1O2WA 1A5IA 4NZLA 3TVJB 1DITH 1SMFE 1ZGIA 3A8BA 4MVNA 3KN2A 4ISNA 2BLQA 3ODDA 3O8DA 1YBWA 1U6QA 1MH0A 4KTUA 2DE9A 4WH6A 5DP8A 1DWEH 4AX9H 4LZ1H 3VB4A 4AFUA 1E36B 2HPQH 1ID5H 4CBOA 3FP8E 4KP0A 1AE5A 1SGDE 1SC8U 2Y5HA 2BD3A 1KTSB 1CGHA 1O32A 4XE4A 1MTWA 5EOKA 1GMDG 4U2WA 4IS5A 2BM2A 1IQGA 3TJUA 2B8OH 4MNWA 4DVAU 4AYYB 1EJNA 5FPSA 1O5GH 1IHTH 5C3NA 3SU2A 3H7OA 1XUIA 1ZHPA 1C5VA 2UWLA 2FLRH 4UD9H 1HIAB 1YCPK 3RC4A 1WUNH 4ZROA 2VIQA 4X6NA 5K7RA 5L2YH 1KXFA 3H5CB 4A1VA 4DIIH 1C2KA 1TQ7B 3U1JB 1D3QB 3UNSA 4VGCC 4IMZA 2P95A 2B7DH 4GHQA 4UE7H 1O2SA 4B71A 4UFFH 1T8OA 1XUJA 2RCEA 3ZZ6A 1TYNA 1G32B 1MBMA 2BY7X 5AF9H 1G2LA 1UHBA 5JPMH 1FPCH 2J94A 1TGSZ 1MZAA 2QA9E 1IQHA 4ZH8A 3MOCA 3BV9B 3MYWA 4YO9A 4BOHA 2O8UA 2BD5A 2QXJA 4IGDA 1O35A 2VIWA 4OS5A 3SHCH 4BAOB 1XUHA 5C1YA 3ATMA