3PWCA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA02
1LPGB 2OTVA 4FUDA 3W95A 1S85A 5DK1A 2ZCHP 1JBUH 3RXQA 3K2UA 1IHTH 4K8BA 2V3OH 1GDNA 7GCHG 1Y3WA 2BDCA 2RA3A 3GCNA 3RXIA 1BT7A 1NRQH 1UJ1A 1WQSA 1TRMA 1HNEE 2HVXA 3Q3KA 1S84A 3A80A 3LJOA 4JZDH 1C5SA 4GCHF 1C2JA 1V2JT 3RXHA 1MTNC 4Q7XA 3DT0H 1QRZA 1TPPA 1EQ9A 2O8MA 1YPMH 2PTCE 5A2MH 3A86A 1P9UA 1HAVB 1JIMA 1ZTKA 1G32B 1W11U 1DLEA 3PMBB 1BOQA 3BV9B 4JYUH 3PROA 4KP0A 1GJ7B 4B1TA 1FAXA 4X2XA 1OP0A 4O9VA 2G4UA 2C3SA 1SGPE 1W12U 2QIQA 4JCNA 1NRRH 1B7XB 1Z8JB 1EXFA 1HPGA 1VITG 1MMJN 2C90B 5F8ZA 1TX8A 5K0HA 4X2WA 4Y8XA 1O5GH 4UFGH 1O31A 1QBNA 4ISNA 1W0ZU 5HGGA 2SGFE 1RD3B 5CMXH 2LPRA 4BAKB 3H5CB 3DFLA 1CA8B 2B7DH 3PWBA 3P6ZB 3EDXB 4O3TA 5LH8A 3DA9B 1S6HA 1ZTJA 4GPGA 2QYIA 3U9AH 1FV9A 1QHRB 5IYTA 2ZTXA 3IITA 3RMNH 1G2LA 4OS5A 1QY6A 1ZJKA 1ELAA 3U1JB 1MTSA 2YNBA 1VITH 1T8NA 2ANMH 2QN5T 5ABWA 2AERH 1YPEH 3Q3YA 1F0UA 1DY9A 4Y6DA 7LPRA 3ELAH 1T8LA 1JWTA 3ZZCA 3M5LA 3VB7A 5K7RA 2G52A 3MU8A 1V2PT 1AWHB 2A31A 3K65B 3BEUA 4QT8C 1O3NA 1EJMA 4RSPA 1C9PA 2BDHA 1TMTH 5A8ZA 5LPEA 2R0KA 1L2EA 2D2DA 3A7YA 4NA9H 5E0JA 1HAHH 3GCOA 1UVPA 5A8YA 1GBIA 5DP7A 4UDWH 1GBFA 3QZQA 4B75A 1WV7H 4CHAC 2P8OB 1V2NT 3NUMA 2QXJA 1PQ5A 1A3EH 2OC7A 5AFYH 2GCTB 1W10U 2P16A 1YPHE 5F8TA 4MLFB 3M3SA 4JZFH 1TNKA 2XC5A 2OCVB 3BN9A 3HK3B 1VCQA 2WPLS 4YOJA 2Z3EA 1Y3UA 2VNTA 1P2JA 5LPRA 1LVMA 4INHA 1O36A 4X0WU 3RC6A 2VVUA 1BDAA 1WU1A 2H9HA 1D6RA 1SFIA 3NXPA 3ZVFA 1K1LA 2ZZUH 4ZMAH 1C2HA 3SU5A 2ZTZA 2ODYB 3QLPH 5FPYA 1V3XA 2A0QB 1XM1A 2CJIA 1W2KH 1O32A 1YCPH 2XBVA 1T8MA 2W7UA 2J4IA 3E1XB 5F6MA 3TH3H 3E16B 3UWIA 4RKOB 3AW1A 1K9OE 1CA0C 1HB0B 1LQDB 2ZHWH 1AVGH 1CBWC 5T6GA 4TPIZ 4JK5A 4OS2A 4IS5A 1AMHA 2BDBA 1GHZA 2ASUB 2PV9B 4ASHA 2QF3A 2ZCLP 3U98H 3CP7A 1J17T 2AEIH 3EA9A 1F5LA 1TGTA 2XYAA 1SOTA 1QIXB 2ZC9H 3VB3A 1SPJA 4D9RA 5JB8S 1GJ9B 1PPBH 2P94A 1ETSH 1A3BH 3SUEA 2VWOA 3V0XA 1FNIA 3Q77A 1V2RT 4KKDA 1EZSC 2ESTE 3CENA 2QXHA 1TA6A 1ORFA 2ZPQA 3OTJE 1C5WB 3OY6U 4X6PA 1A0HB 1LHEH 2XBYA 2SGAA 1QB6A 2R3UA 1Z6JH 2ZO3H 2FOCA 4O03A 4D7GA 2VWNA 4YOIA 2P93A 4BXWA 1QJ1B 3AAUA 1BTXA 4I32A 1ZSLA 4K5ZA 1SGCA 1UK2A 3PYHA 2ILNA 1GJAB 1QA0A 1HAGE 1DT2A 1YPLH 2G5NA 2EC9H 2Z7FE 1CHGA 1MTNB 1SGFA 1IQIA 4MVNA 1UVUH 4R0IA 6CHAB 4BAMB 5CHAC 1BB0B 3UFAA 2WUBA 2XNIA 4Z6AH 2XCFA 4B73A 2ANYA 2ZIQH 1N6XA 3O8CA 1DE7H 4HFPB 1BRAA 1GBAA 3RM0H 2UWLA 5GCHG 1YPJH 3NWUA 4WVPE 4XDEA 4GHQA 4WF8A 3GY7A 3O8DA 2XRCA 3E0NB 1SQTA 2OD3B 1HJ9A 4NWKA 4ABEA 3E90B 4X8UH 2CV3A 2A5KA 4UEHH 3LGVA 5C1XA 5DP8A 3QK1A 4IC6A 2HGTH 2PHBA 4K8YA 1TAWA 4FUCA 1P04A 2G81E 6GCHF 2AMQA 1O3FA 3S9BA 4CR5A 1ZMLA 2AS9A 4I8KA 3UNSA 4Y8ZA 4THNH 2BD8A 3GCHB 2HWLB 4ZKRU 4AB9A 1O2ZA 4O3UA 1C4Y2 3A84A 1INCA 3SU2A 4GVUA 2QV1A 3SI3H 4ABHA 3MNCA 4IW4E 5FCKA 1TE0A 2R0LA 1DANH 3SU3A 1BTYA 1P2MA 2AFQB 3ZZDA 1ZRKA 4MNXA 1F0RA 1MAXA 1SOZA 1TQ0B 3UIRA 4I8GA 2BDGA 1V2MT 3GICB 1C2KA 5BPEA 1GJ4H 4LXBH 1Q31A 1K1MA 4MTBA 5C3NA 2R2WU 4U32A 3URCA 3ZVCA 3TH2H 2QA9E 1ZMNA 3GCTG 2FXRA 1CT0E 2G4TA 2AMDA 1UMAH 4CHAB 4NIXA 2ZU4A 3PLKA 1BTPA 3QGJA 3SW2B 3TGKE 4B74A 2F9VA 3VXFH 4X2YA 3TJOA 1AUJA 1O2MA 3RLWH 2NU1E 1IQNA 1C2LA 2A45B 2PTNA 3EA8A 3BTWE 1DSTA 2GGVB 1JXPA 1IHSH 1GI2A 3MO6A 3VGCB 3MI4A 4FUEA 5JBAS 1BJVA 3SN8A 1GHAG 1V2OT 1SB1H 3R3GB 1TGNA 4I7YH 1NM6A 2ZWLH 1XUGA 4DIIH 2GCHF 2XTTB 2ZU3A 1KIGH 1HFDA 5F8XA 3QGNB 1V6DA 2FOHA 1UTLM 4YLQH 1C1NA 1JRSA 1TWXB 1CA0B 1MBQA 3QZRA 1MKWK 3NCLA 2A4OA 4IMZA 5DJ7A 2QGRA 1W14U 3SU0A 2BXTH 1BJUA 2FX6A 5E2PA 1QGFA 2W7SA 1C2IA 4BNRA 1QFKH 2AYWA 1FDPA 1P12E 3SORA 3F68H 1A1RA 4CRDA 8GCHG 2V35A 1L0ZA 3SNDA 3M35A 5EW2H 1C5NH 3TU7H 8LPRA 4CH8B 2SNWA 2C93B 1BZXE 5ETXA 1AD8H 1Y3VA 1C1VH 2A4GA 1NFYA 1OP2A 1P3CA 2GZ8A 2ZFRH 5JBCS 2FIRH 1CT2E 3NKKA 4JMYA 4OS7A 1YBWA 1HAYB 3C1KA 2WINI 4X1PU 4AX9H 4BTUB 5JB9S 3UNQA 5C20A 3A83A 5L6NH 4E05H 1MKXH 4Z0KA 4K1TA 1O5DH 1AFEH 3RMLH 2XCNA 4FUFA 1G3CA 4I8LA 4BAHB 4CRGA 5GDSH 4OGXA 1KTSB 1SGYE 1C5LH 4ZXXH 4F49A 3UOUA 5JPMH 2FODA 5JBBS 1P09A 1C2GA 5CHAB 1ETRH 2FOAA 2O8TA 1YYY1 1DXPA 1HAVA 1WCZA 4JYTA 1ESTA 3ATMA 2XWAA 3SGBE 1GHBG 4INLA 3LKWA 2A7HA 3M7TA 3U8TH 4CREA 3TK5A 1XXDA 2OBQA 2BB4A 3PMAB 4UFFH 3KCGH 1O2YA 2PFEA 1D3DB 3B9FH 3MH7A 5I25A 1SGTA 5DP5A 5DP6A 1V2VT 1ZYOA 3QWCH 1EOJA 4INKA 1IQFA 1T4UH 2PSYA 2ZECA 1BHXF 1YCPK 2RG3A 1ZGVA 5H4IB 4Y7BA 3F1SB 3RC4A 4TWYA 3RXKA 3SJOA 3FZDA 2P8OC 3TK9A 3TPIZ 1C5UA 1C4V2 1XX9A 1HAIH 2ZGJA 1Z71A 3BTFE 5DP3A 1DICA 1HBTH 4AG1A 2GCTC 2FYQA 3VEQB 4ABJA 5B6OA 3SQHE 1UTQA 3T5FH 4FXGH 1NTPA 4E7RG 2SGPE 1Z1IA 1ACBE 1HIAA 3A8AA 1TOMH 2HPPH 3SV2H 3R0FA 1EAXA 5TCAA 4XBCA 3JZ2B 2BD5A 4A1VA 1HCGA 1MUEB 3KNXA 2ALVA 2Z6BD 1NFUA 1XUJA 4AYYB 1CE5A 4J1YA 3LH1A 2HALA 3UQVA 1TPAE 3K6ZA 5JYIA 1O2WA 1NY22 3GOVB 5FPTA 1SGNE 1KXAA 1P02A 5FBIA 2PLXA 1NZQH 1KLIH 4X8SH 1IQHA 3RXUA 4IBLH 1SLXB 2UUKB 2FDAA 2BX3A 4TY7A 2Y6TA 1GHXH 2H1UA 2GV6A 3LJJA 2ZDVH 3KHVA 3RXVA 3BF6H 2BDIA 1TNIA 1DWBH 4KTCA 3BTQE 1O5AB 3L33A 2BY7X 1U6QA 1O2QA 2ZHQH 3D23A 2PW8H 2QXGA 4FUHA 3TNSA 3IG6B 3SV8A 3LH3A 1B5GH 4CRBA 5FX6A 2ZP0H 4HTCH 2Z9JA 4TPYA 3EE0B 4NZLA 1DWDH 1Y3XA 1BITA 2BD4A 3RXOA 1CU1A 1GMCG 1H4WA 4X6MA 3I29A 1ZRBA 3QO6A 2FOEA 1MU8B 4MPXA 2OC8A 2BOHB 2BY5X 3T26A 4X6NA 3ZVAA 1NO9H 2VVCA 3M36A 3RXEA 1J15A 1QTFA 2ZDAH 4ABDA 2D1JA 1IQKA 1BRBE 1Y59T 1OYQA 2FI5E 2J95A 3OX7U 2ZHFH 1TQ7B 1QB9A 3BTME 1AE8H 1EP5A 1NN6A 1QBOA 2VWMA 3A7WA 4A7IB 1O2XA 1ELEE 1V2WT 2B9LA 8KME2 3JZ1B 1BRCE 5HM9A 6CHAC 4AGJA 3GY5A 2BD7A 3V7TA 3T2NA 5E8EH 5FAHA 1PJPA 2ZTYA 3MU0A 4KGAA 3DUXH 3P70B 1SBWA 1Y5UT 3EGKH 2DE8A 5EOKA 3T28A 1OOKB 3ZZBA 1P05A 2DE9A 2TBSA 1K1PA 2BVRH 3BEIB 2BMGB 5FCRA 5FXLA 4YM9A 3E0PB 3P8NA 2AGGX 1P57B 4ISOA 3QN7A 1JOUB 1MZAA 5C2ZA 1RS0A 2BM2A 4HZHA 1BHXB 2C8WB 1Y5AT 1MKWH 1RFNA 2GD4B 2FS8A 3KF2A 5EGMA 1FY1A 3RUOA 1NFXA 3GCHC 4CBOA 1O3GA 2P3UB 3MO9A 1FN8A 3GDSA 2UUYA 3U8RH 1HIAB 2G8TA 3MH4A 3E8LA 3SV6A 4MDSA 1D9IA 1C1QA 2A2QH 1ESBA 4WY3A 1SI5H 1EKBB 7GCHF 1TBQH 1UTMA 1TMBH 3CS0A 3ODFA 4GAWA 1O39A 3UY9A 4ABFA 4I8HA 2WPIS 4Y10E 1C1SA 2ZF0H 1O3EA 2Y7ZA 3LGYA 1NRNH 1K2I1 2FOFA 3MU5A 3TGJE 2H9EH 4NSYA 2BVSH 1GBDA 2ZU5A 2IPHA 4YOGA 1PPEE 1O2OA 2JH5D 4DJZB 1O2RA 5DPAA 3PV4A 4DG4A 3MYWA 1JMOH 2Y80A 3A7VA 5DO4H 1LHCH 5ESTE 1ZSKA 1CQQA 4WH6A 1W8BH 1H8IH 2Z9KA 3G01A 8ESTE 4CRFA 3ITIA 2F83A 1GHYH 3BTKE 1XVMA 3F6UH 3QUMP 2SGEE 4B2AA 1V2ST 3SOSA 1PQ7A 1J9CH 1BTUA 1EB2A 2BZ6H 1ZPBA 3HKIB 1C5RA 3VGCC 4FVBA 4AOQA 2VB0A 3HGPA 1SGEE 3RXBA 2HNTF 1DUEA 1JRTA 1UTOA 1RTFB 2ZFQH 3PMJA 1LVOA 1OSSA 2OC1A 3MNXA 4MPUA 4WH8A 3VFEA 1GBEA 1AO5A 2F9OA 5GJ4B 1YGCH 4F4OC 2JETB 1DWCH 1XUFA 3BEFB 1G3EA 4A5TS 2FYRA 3BTGE 2PUQH 2CN0H 1L1NA 1VCWA 1C1OA 1C5PA 1MKXK 1QRWA 1V2TT 5FBEA 3PO1C 1GVZA 1GBLA 1SGFG 1FXYA 1O3OA 3K6YA 2ZFPH 1A7SA 1G36A 1GI4A 1YM0A 1DY8A 1VGCC 3D49H 5LGOA 1S0RA 1GCTB 5FHTA 2NU0E 3D65E 3LC5A 3SJIA 2STAE 5GPIB 3FANA 1ELDE 4FU8A 2OP9A 3P8FA 2UWPA 3BIVH 4UE7H 4GLYA 1KXFA 5SGAE 1P3EA 2V0BA 3SGAE 3BTEE 2J34A 4I8JA 2EI8A 3KIDU 3PM3A 1HUTH 1TB6H 4SGBE 1GMHG 1KXCA 4X1SU 1TBRH 1GI9B 1LKAA 2B5TB 1QB1A 1TOCB 4ZH8A 3NZIA 1GBKA 4TWWA 1AGJA 4FUGA 4NZQA 1O3HA 1NESE 3T62A 1QCPA 1P9SA 4KELA 1THRH 1LTOA 3SUFA 2SGDE 2RA0A 1LCYA 3SJ9A 5TCCA 1MAYA 2W3KA 1ESAA 4WXVA 5A8XA 1O2TA 4Y71A 2BLWA 2OQUA 1ZOMA 1A5HA 3OYPA 1FZZA 1ZHRA 4JYVH 5TJXA 1NT1A 1BTWA 4NG9H 3CS7A 1NRPH 3T29A 2W3IA 2BY6X 3F9HA 1F5KU 1Z1JA 5T6DA 2BLQA 1SQAA 3RM2H 2FM2A 1BQYA 3GY6A 1LVBA 3LGTA 2ZGBH 3ZYDA 1EATA 3PLBA 2WPJS 2XC0A 1O5BB 1OWJA 1HJAB 2V3HH 1EUFA 2ZCKP 4MNYA 2A7CA 9LPRA 3S9CA 2O8UA 3OU0A 1OYTH 4U30A 1KXEA 1S83A 4Y8YA 5AVDA 1CHOF 2ZFFH 1O30A 4X8TH 1H1BA 1TNLA 1HYLA 4K3JA 2ZPSA 1LPKB 3VXEH 4K69A 2G00A 5EG4A 1YP9A 4FUIA 1C1RA 2O8WA 2VU8E 3ATKA 4AORA 1D3PB 1EZUC 1O3CA 2BQ7B 1AE5A 2FI3E 1PYTC 2G55A 2C8YB 5JBTA 2FOMB 3MU1A 1V2UT 1LPZB 2WPHS 4Y11E 3MO3A 1K1JA 3GYLB 2FX4A 1SMFE 3U8OH 4X1NU 2VINA 3ATWA 5E0HA 1GBCA 1HDTH 1QL8A 1W13U 1O3AA 3U69H 1OWHA 1P11E 3M5NA 1QL7A 1ELGA 1KLTA 5CE1A 1O33A 2FEQH 1W3CA 1FY8E 5GCHF 4H6TA 1O34A 2FP7B 4UD9H 1QRXA 2TGDA 2BVXH 2STBE 3U1IB 2BY9X 3ZZ9A 2F91A 1FPHH 4NWLA 2A32A 2W26A 1A46H 1ZR0A 5AF9H 2GZ9A 4R8TB 1IAUA 1ELCA 1WAYB 3A7XA 2A5IA 1GI6A 3DFJA 4GHTA 3N7OA 2J9NA 2CF8H 1GL0E 4YT7H 1G3DA 2ZDMA 1C1PA 3ZZ3A 4NIVA 1G37A 1O2IA 2LNCA 5DGJA 4DURA 2ZNKH 1N8OC 1AQ7A 4UFEH 2RCEA 3QTOH 3T27A 1TGCA 1UTJA 2Y7XA 3FFGA 4K60A 1UVOA 2UUFB 1IQLA 1NU9A 2GMTC 3K9XB 1W0YH 3ENSB 3STIA 2BD3A 1K1OA 3SO3A 4Q7ZA 4ABAA 1H8DH 3PO1B 4IGDA 4AYVB 1BIOA 1T31A 1IQMA 1VGCB 1A4WH 5AHGH 2GT8A 1AKSA 4A1XA 1FIZA 1MU6B 1T32A 1E35B 2A4QA 1OS8A 3H7TA 1BRUP 1GVLA 9ESTA 1PFXC 3GCTF 3V13A 3UTUH 4MPVA 2BLVA 1OWIA 1UCYH 2PKAA 1MBMA 1DXWA 3P95A 1FI8A 1FY3A 1ANBA 1O5FH 1FPCH 1L1GA 1O2PA 1Z7KA 1ZGIA 2CGAA 2SGQE 5EQSA 3ZVDA 3SI4H 2J2UA 3ZYEA 2ZFTA 3TIUA 2Y82A 3ZVGA 3VB4A 2PKSC 2NU4E 2TIOA 5L2YH 1GBHA 4ZXYH 1UK3A 3TJNA 2V6NA 3RU4T 4X1QU 1P2NA 3DHKH 2ODQA 2BQ6B 1OWEA 1UK4A 2ODPA 4Y76A 2D26C 3PWCA 3MTYA 1WTHD 1EOLA 4BOHA 3TLOA 1O3KA 3LC3A 1GHAF 1GPZA 1EAWA 1CGIE 2FWWA 3GYMA 1C5OH 4JZEH 1RIWC 4H4FA 2KAIB 5HMAA 3PB1E 3RXDA 1FONA 4CR9A 2GKVE 4H6SB 3LGIA 3SUGA 2Z9IA 1YCPM 3RMMH 1C5ZB 2CXVA 3GY2A 2GZ7A 1EPTB 1NROH 1B0FA 1C1UH 2AIPA 3DD2H 1ARBA 1DVAH 1PPFE 3SU6A 1C5TA 5C1UA 3A89A 2PGQB 1SGDE 1GMDG 1T7CA 2VIOA 1BUIA 3KN2A 1XKAC 1KYNA 1H9LB 3UUZA 1CT4E 3BG4B 1GJBB 1FQ3A 3ODDA 3MOCA 3S7HB 2A7JA 3KQDA 4NFEA 1GG6B 1MTVA 4TY6A 1TA2A 1WBGB 1EP6A 1P8VC 1A2CH 3A85A 1EASA 1PPCE 2EI7A 1V2LT 4IN1A 2Y5HA 8GCHF 3SJKA 2BDYA 4HI3A 2Y5FA 1WUNH 2VH6A 5FX5A 1SC8U 2OQ5A 2A4RA 4BXSA 1O38A 3F9EA 1XUKA 5EQQA 4I31A 1B0EA 1AB9C 4ZKNU 3FZZA 3T25A 6LPRA 1QNJA 2P59A 4YZUA 1MTWA 1PPZA 1FMGA 3B23B 1O3BA 4AGKA 1TALA 1O35A 2BQWB 1THSH 3A88A 1EZXC 3GY8A 1GJ8B 1Q3XA 3TJVA 2IJOB 2ULLA 2F3CE 1A0JA 3GY3A 3VB5A 4MQAA 1TPOA 4XBBA 4XE4A 1YF4A 1GI5A 4DCDA 4IN2A 3AASA 4HGCA 1C1WH 2JETC 3UOPA 4XBDA 4DVAU 1DFPA 5J4SA 4KTSA 4JK6A 4AB8A 4AFZA 1W7XH 3KQCA 4ZHLU 3BG8A 2AIQA 4H42U 1PYTD 1GHBF 1PPGE 1JIRA 1BA8B 4U2WA 2M5TA 1TABE 1UVTH 1TPSA 2XWBI 5C1YA 4GCHG 4NA7A 1AKSB 4D9QA 3LIWA 1GCTC 3ESTA 3LT3A 3AVZA 2ZQ1A 1TLDA 2R3YA 3SNAA 1HAPH 5IDKA 2TGPZ 2PKAB 2R9PA 3BSQA 5GIBA 1AHTH 1CVWH 4JZ1A 4BAOB 1A0LA 3Q00A 2SFAA 3KEEA 2VIWA 1XXFA 2VIVA 1N8OB 1QQ4A 1S82A 1OKXA 4UONA 1FAKH 2BDAA 3ZZ7A 4A92A 2BLOA 2GMTB 3L3TA 4AG2A 3A82A 1CGJE 2O8LA 4CBNA 3RXCA 1UTNA 2C4FH 1AZZA 2A2XH 5EPNA 1TNGA 1GBBA 1S5SA 3V3MA 4A1TA 4DT7B 4D76A 1P2OA 3KQBA 3ZVBA 4VGCB 2CF9H 4NGAH 2NU3E 1SGRE 3E91A 1O2KA 2WPKS 4Y0ZE 7ESTE 1UHBA 1RTKA 4WMEA 2CMYA 4YLUA 1OXGA 1K28D 2PGBB 3B8JA 2K1QA 4MPWA 1O2GH 3S9AA 2PKSB 2FLRH 1GI1A 1O2HA 2G5VA 3GDUA 1E0FD 1MQ6A 3SUDA 3SBKA 2H9TH 3A7ZA 4DOQA 4ZAEA 3PMHB 1OP8A 2QXIA 5EPYA 1SHYA 1ELBA 1GMCF 1N6YA 3RLYH 3I78A 1LMWB 3RXJA 2F9NA 1Z8IB 1L4DA 1HJAC 2WYJA 3SNCA 3F9FA 3RDZA 1RIWB 1E36B 2VVVA 5PTPA 1ZTLA 1L1JA 1CGHA 5JDUB 1MH0A 3F9GA 2SNVA 1G3BA 1K22H 2HLCA 1Z8RA 4LZ4B 2ZGCA 1AU8A 1O2JA 1O3DA 2TPIZ 2ZDLA 1UO6A 1MD7A 2FZZA 5E0GA 3TK6A 3PTNA 2PWXA 1MZDA 1TYNA 1YPGH 2A1DB 3SV7A 1WQVH 1ZZZA 1GI0A 4MG3A 2CHAB 1SL3A 2GV7A 5A0CA 2HNTC 4DW2U 1NS3A 1C4U2 2GT7A 1TX6A 1TBZH 1MTUA 1D6WA 2VIDA 4KTUA 1O3JA 1P01A 3I77A 4PROA 3SQEE 5C5NA 3LGUA 4LZ1H 1T4VH 2H2ZA 1OPHB 1YC0A 5DP9A 1C9TA 1K1NA 2VGCC 3LU9B 3ZZ4A 3TGIE 1THPB 3A7TA 4TYDA 1YKTA 3SHCH 1QL9A 3P8GA 1FIWA 3UWJH 1GDUA 1GI7B 3GISB 1A5GH 1EJNA 2J94A 1PPHE 2BOKA 3TJUA 4WWYA 2Y5GA 5HM2A 1K21H 5DKMA 1AB9B 1AFQB 1TNJA 1XUHA 1O3LA 3SU1A 1VITF 4AZ2B 3S0NA 1O3PB 1TRYA 3M37A 4YT6H 2FTMA 1KXBA 3NK8A 2YNAA 1F5RA 4I33A 3RXLA 1C5QA 1HXFH 1P10A 1UCYK 4AN7A 3RXRA 4XOJA 3E6PH 3SU4A 1GJCB 2J38A 2VH0A 2HRVA 3EYDA 1F7ZA 4ABBA 3UPEA 1S6FA 3L6PA 4NIYA 4MNWA 3S7KB 4E7NA 3RC5A 1LHDH 1GBJA 3M3VA 2FTLE 3GY4A 1O2UA 2ANKH 2JKHA 5GXPA 1UCYE 3A8BA 1O0DH 2ZPRA 4Y7AA 2NU2E 1RRKA 1C1TA 5T3HA 4BAQB 1WYKA 1ABJH 1IOEA 1DM4B 1S81A 5BRRE 1GI8B 1EJAA 4X2VA 1CSOE 2XC4A 1SGQE 1BCUH 1M9UA 1ZJDA 1GGDB 2F9BH 3QX5H 1WOFA 1BMMH 2TGAA 3URDA 1UHBB 1WSSH 2QCYA 1UVSH 2W5EA 2BD2A 1IQEA 2QF0A 1LDTT 2H5DA 5FPSA 3C27B 1VR1H 4IC5A 3RXSA 2FI4E 4Q80A 4Y0YE 2FOBA 2QY0B 2UUJB 3MFJA 1O3IA 1TNHA 1A5IA 3OY5U 4RN6A 5EXLA 2AMPA 3UREA 4OS1A 1BBRH 4ESTE 3FAOA 4OGYA 2ZA5A 5A09A 2H5CA 4BTIB 1DITH 1SLWB 4SGAE 1DS2E 1J16A 2RDLA 2P3FH 3AAVA 4LOYH 4NIWA 2G51A 2FMJA 2HPQH 3MH6A 4CRAA 3W94A 1Y8TA 2ZI2H 6GCHG 1HAXB 2J92A 4Y79A 1VCPA 1ANCA 2QC2A 1EAUA 2Q1JA 2WYGA 4D7FA 1TIOA 1G30B 5EXNA 3RXTA 1CHOG 1GWAA 2O9QA 1O5EH 5GWZA 4WXIA 2BTCE 2NWNA 2XXLA 1EPTC 4J2YB 2IOTA 3QTVH 2TRMA 1KSNA 2THFB 1P2IA 3RXGA 1SR5C 2ZKSA 1GCDA 3LOXA 3HPTB 3BG4C 1ELFA 2AGEX 1C5VA 1S0QA 1OX1A 1VJAU 3KGPA 3ZZ6A 1H9HE 1ZMJA 2Q6FA 1GG6C 3MNBA 2WPMS 1KXDA 2EA3A 4Q7YA 1QBVH 4X6OA 1ID5H 1TGBA 3ZZAA 1NU7B 3ZV9A 2ZFSA 3LONA 2I6SA 5C67A 1QJ6B 3PLPA 4MNVA 5T6FA 2ZGXH 4ISLA 5I46H 3A81A 2B0FA 2WUCA 1ANDA 2KAIA 3BTTE 1DUAA 1ZPCA 3NPSA 1GMHF 2Q6DA 3M5OA 2FPZA 1J8AA 3ZZ8A 2FS9A 1IQGA 1XVOA 3TNTA 3LGWA 2GVFA 4LK4A 5J4QA 1A61H 1D3QB 1GJDB 1C5YB 1P2QA 1EPTA 1GL1A 5C5OA 1E38B 1QURH 1NPMA 1TMUH 1D4PB 4B71A 1BTHH 2ZHDA 3EAJA 1G9IE 1O37A 1MD8A 1ELVA 1F0SA 3ATIA 3SNBA 5EQRA 2GCHG 1O5CB 1WTGH 2QAAA 1H9IE 7KMEH 1HV7A 4FU7A 3M61U 1SG8B 1SGIB 2VJ1A 3MNSA 1MCVA 2VGCB 2PSXA 1EZQA 4AFQA 3GDVA 1GJ5H 2OUAA 4FUBA 3ATLA 1ABIH 2OINA 4BTTB 1YLDA 2F9UA 4K1SA 4ABIA 2VIPA 2Z3CA 4UFDH 3BTDE 1L4ZA 1NRSH 1XUIA 5A0BA 1DSUA 3A8DA 4YESB 4ZHAA 1QA7A 1P0SH 4DGJA 3O8BA 1RTLA 1MCTA 4X8VH 5LPFA 2UWOA 1HLTH 1F2SE 4ABGA 1ZPZA 3H7OA 1GBMA 1AVWA 4FUJA 2XBWA 4JZIA 1BMNH 2Z3DA 4NFFA 2AH4X 3RXFA 3HKJB 3HGNA 4NSVA 1RGQA 1IQJA 2PUXB 3A8CA 1GJ6A 2H6MA 3M7UA 1KLJH 1C2DA 3V12A 1YPKH 2I6QA 1N1LA 2Z9LA 2ANWA 1ZLRA 1GDQA 1AVXA 1LVYA 1YPHC 3O8RA 1LKBA 2VWLA 2XBXA 1DPOA 1SQOA 1VJ9U 1TONA 3KQEA 1AIXH 1Y5BT 1FN6A 1AZ8A 2JH6D 2F9PA 4VGCC 4XSKU 1FLEE 2D8WA 1GHVH 3PTBA 3RU4D 1QQUA 1BMLA 1Y3YA 1Q2WA 4K1EA 1KDQA 1SVPA 4X1RU 2Y81A 3SZNA 3M3TA 1CO7E 3TH4H 1CBWB 1ZSJA 4WMDA 1DX5M 1ZHPA 2OC0A 1GVKB 1AI8H 2GTBA 2IN2A 2BYAX 3TITA 2C8ZB 2GDEH 5DP4A 1UTPA 1AUTC 3E3TA 1HAOH 1O2VA 1C2MA 4FVDA 4ISIH 3MWIU 1NFWA 1O3MA 4RKJB 3LPRA 1DOJA 3VPKA 3HATH 2XW9A 1ETTH 5HYOA 2GDDA 2P3TB 4O97A 4A6LA 4B2CA 1AWFH 1KTTB 4ZKOU 1D3TB 5G4BA 4ZKSU 3AW0A 2C8XB 4AFUA 1LQEA 1C1MA 1BTZA 4GSOA 2B8OH 1V2QT 1TX7A 4IMQA 2ZU1A 3UQOA 3SJ8A 1W7GH 1HGTH 1SFQB 2BD9A 2BZAA 1DDJA 4ZROA 1OWDA 3D62A 2OLGA 1SLVB 3UNRA 1YLCA 1AY6H 6ESTA 3BTHE 3FP7E 2WV5A 3M7QA 4NA8A 2DUCA 2EI6A 2ZHEH 2HNTE 3TVJB 2WV4A 1EAIA 2P95A 1F92A 3RXPA 1BMAA 5EW1H 4D8NA 2Z94A 3ZZ5A 1HRTH 5L30H 1VZQH 2CHAC 1SSXA 1FY4A 3VB6A 1O2LA 4DY7B 4ISHH 1X7AC 4CH2B 4Q2KA 3HK6B 3MH5A 1Z8GA 5EXMA 3WY8A 1GI3A 4ZUHA 3RXAA 1C5XB 2BX4A 1HXEH 1F0TA 3ZV8A 2EEKA 2AGIX 5L2ZH 1ARCA 2Q6GA 1E34B 2BHGA 3LDXH 2ALPA 1J14A 1XMNB 3A87A 2FESH 4NCYA 4GUXA 1FY5A 3P17H 4K2YA 1TRNA 4WMFA 4OS4A 1LO6A 1AFQC 3Q76A 3QDZB 2OXSA 2ZU2A 4CRCA 1KY9A 2GX4A 3FP6E 4WJG2 4U01A 1NC6A 1C2FA 3EQ0H 3OSYA 5E2OA 3SHAH 2BY8X 2OBOA 1EX3A 3SV9A 5EODA 1GHWH 1C5MD 2ZGHA 4BANB 3RU4E 1BBRK 5A0AE 4OS6A 2R2MB 2FOGA 1E37B 2GP9B 4FU9A 1P2KA 4ZHMU 3M5MA 1PQAA 2Z9GA 3RP2A 1P03A 3SGQE 4B76A 1O2NA 1ANEA 4XFQA 1GMDF 2FLBH 1HJ8A 3ZVEA 1UTKA 3KL6A 4YO9A 3RMOH 1O2SA 1BBRE 1DLKB 3P92A 4E06H 3SNEA 3MHWU 2FO9A 1AN1E 3EA7A 1XKBC 3FP8E 5F03A 3UR6A 2BXUH 1GGDC 2JH0D 2VIQA 1RJXB 1LHFH 3IWMA 3BIUH 1KDQB 1FUJA 2PR3A 5AFZH 1Z6EA 1V2KT 4B2BA 4YTAA 1HAZB 1QJ7B 1SHHB 2ZDNA 1EB1H 1LHGH 2ZQ2A 1MQ5A 1TGSZ 1P06A 2ZEBA 1G2MA 1QR3E 2A5AA 4DIHH 5HXFA 1ELTA 1PQ8A 4M7GA 3UR9A 3RXMA 5DG6A 3FVFB 2ZG0H 1C2EA 1TFXA 5EU8A 1OWKA 3MMGA 1GBTA 1DWEH 3S69A 1SLUB 1K1IA 2TGTA 3STJA 4AFSA 1FJSA 2YOLA 2ZDKA 5ESBA 2HOBA 3P8OA 1RXPA 1T8OA 3MU4A 1ZHMA 3Q3XA
chains in the Genus database with same CATH superfamily
1LPGB 2OTVA 4FUDA 3W95A 1S85A 2WSSD 5DK1A 4HG6A 2ZCHP 1JBUH 3RXQA 3K2UA 1IHTH 4K8BA 2V3OH 1GDNA 7GCHG 1Y3WA 2BDCA 2RA3A 3GCNA 3RXIA 1W0KD 1BT7A 1NRQH 1UJ1A 1WQSA 1TRMA 1HNEE 5HIYA 2HVXA 3Q3KA 1S84A 3A80A 3LJOA 4JZDH 1C5SA 4GCHF 1C2JA 1V2JT 3RXHA 1MTNC 4Q7XA 3DT0H 1QRZA 1TPPA 2K8IA 1EQ9A 2O8MA 1YPMH 2PTCE 5A2MH 3A86A 1P9UA 1HAVB 1JIMA 1ZTKA 1G32B 1W11U 3OEHD 1DLEA 3PMBB 1BOQA 3BV9B 4JYUH 3PROA 4KP0A 1GJ7B 4B1TA 1FAXA 4X2XA 1OP0A 4O9VA 2G4UA 2C3SA 1SGPE 1W12U 2QIQA 4JCNA 1NRRH 1B7XB 1Z8JB 1EXFA 1HPGA 1VITG 1MMJN 2C90B 5F8ZA 1TX8A 4ACBA 5K0HA 4X2WA 4Y8XA 1O5GH 4UFGH 1O31A 1QBNA 4ISNA 2QF5A 1W0ZU 5HGGA 2SGFE 1RD3B 5CMXH 2LPRA 4BAKB 3H5CB 3DFLA 1CA8B 2B7DH 3PWBA 5C94A 3P6ZB 3EDXB 4O3TA 5LH8A 3DA9B 1S6HA 1ZTJA 4GPGA 2QYIA 3U9AH 1FV9A 1QHRB 5IYTA 2ZTXA 3IITA 3RMNH 1G2LA 4OS5A 1QY6A 1ZJKA 1ELAA 3U1JB 1MTSA 2YNBA 1VITH 1T8NA 2ANMH 2QN5T 5ABWA 2AERH 1YPEH 3Q3YA 1F0UA 1DY9A 2JJ2D 4Y6DA 3DSGA 7LPRA 3ELAH 1T8LA 1JWTA 3ZZCA 3M5LA 3VB7A 5K7RA 2G52A 3MU8A 1V2PT 1AWHB 2F4LA 2A31A 3K65B 3BEUA 4QT8C 1O3NA 1EJMA 4RSPA 1C9PA 2BDHA 1TMTH 5A8ZA 5LPEA 3CNRA 2R0KA 1L2EA 2KM0A 2D2DA 3A7YA 4NA9H 5E0JA 1HAHH 3GCOA 1UVPA 5A8YA 1GBIA 5DP7A 4UDWH 1GBFA 3QZQA 4B75A 4RI0A 1WV7H 4CHAC 2P8OB 1V2NT 3NUMA 2QXJA 1PQ5A 1A3EH 2OC7A 5AFYH 2GCTB 1W10U 2P16A 1YPHE 5F8TA 4MLFB 3M3SA 4JZFH 1TNKA 2XC5A 2OCVB 3BN9A 3HK3B 1VCQA 2WPLS 4YOJA 2Z3EA 1Y3UA 2VNTA 1P2JA 3OEED 5LPRA 1LVMA 4INHA 1O36A 4X0WU 3RC6A 2VVUA 1BDAA 1WU1A 2H9HA 1D6RA 1SFIA 3NXPA 3ZVFA 1K1LA 2ZZUH 4ZMAH 1C2HA 2RFKC 2WV9A 3SU5A 2ZTZA 2ODYB 3QLPH 5FPYA 1V3XA 2A0QB 1XM1A 2CJIA 1W2KH 1O32A 1YCPH 2XBVA 1T8MA 2W7UA 2J4IA 3E1XB 1SQRA 5F6MA 2J97A 3TH3H 3E16B 1W0JD 4RKOB 3AW1A 3UWIA 1K9OE 1CA0C 1HB0B 1LQDB 2ZHWH 1AVGH 1CBWC 5T6GA 4TPIZ 4JK5A 4OS2A 4IS5A 1AMHA 2BDBA 1GHZA 2ASUB 2PV9B 4ASHA 2QF3A 2ZCLP 3U98H 3CP7A 1J17T 2AEIH 3EA9A 1F5LA 1TGTA 2XYAA 1SOTA 1QIXB 2ZC9H 3VB3A 1SPJA 4D9RA 5JB8S 1GJ9B 1PPBH 2P94A 1ETSH 1A3BH 3SUEA 2VWOA 3V0XA 1FNIA 3Q77A 1V2RT 4KKDA 1EZSC 2ESTE 3CENA 2QXHA 1TA6A 1ORFA 2ZPQA 3OTJE 1C5WB 3OY6U 3SYJA 4X6PA 1A0HB 1LHEH 2XBYA 2SGAA 1QB6A 2R3UA 1Z6JH 2ZO3H 2FOCA 4O03A 4D7GA 2VWNA 4YOIA 2P93A 4ACAA 4BXWA 1QJ1B 3AAUA 5CDFE 1BTXA 4I32A 1ZSLA 4K5ZA 1SGCA 1UK2A 3PYHA 2ILNA 1GJAB 1QA0A 4TT3D 1HAGE 1DT2A 1YPLH 2G5NA 2EC9H 2Z7FE 1CHGA 1MTNB 1SGFA 1IQIA 4MVNA 1UVUH 4R0IA 2W6JD 3DSPA 4BAMB 6CHAB 5CHAC 1BB0B 3UFAA 2WUBA 2XNIA 4Z6AH 2XCFA 4B73A 2ANYA 2ZIQH 1N6XA 3O8CA 1DE7H 4HFPB 1BRAA 1GBAA 3RM0H 2UWLA 5GCHG 1YPJH 3NWUA 4WVPE 4XDEA 3FKSD 4GHQA 2V3MA 4RT1A 4WF8A 3GY7A 3O8DA 2XRCA 1NBMD 3E0NB 1SQTA 2OD3B 1HJ9A 4NWKA 4ABEA 3E90B 4X8UH 4FOUC 2KCAA 2CV3A 2A5KA 4UEHH 3LGVA 5C1XA 5DP8A 3QK1A 4IC6A 2HGTH 2PHBA 4K8YA 1TAWA 4FUCA 1P04A 2G81E 6GCHF 2AMQA 1O3FA 3S9BA 4CR5A 1ZMLA 2AS9A 4I8KA 3UNSA 4Y8ZA 4THNH 3FN8A 2BD8A 3GCHB 2HWLB 4ZKRU 4AB9A 1O2ZA 4O3UA 1C4Y2 3A84A 1INCA 3SU2A 4GVUA 2QV1A 3SI3H 4ABHA 3MNCA 4IW4E 5FCKA 1TE0A 2R0LA 1DANH 3SU3A 1BTYA 1P2MA 2AFQB 3ZZDA 1ZRKA 4MNXA 1F0RA 1MAXA 1SOZA 2JIZD 1TQ0B 3UIRA 4I8GA 2BDGA 1V2MT 3GICB 1C2KA 5BPEA 1GJ4H 4LXBH 1Q31A 1K1MA 4MTBA 5C3NA 2R2WU 4U32A 3URCA 3ZVCA 2GJGA 3TH2H 2QA9E 1ZMNA 3PV5A 3GCTG 2FXRA 1CT0E 2G4TA 2AMDA 1UMAH 4CHAB 4NIXA 2ZU4A 3PLKA 1BTPA 3QGJA 3SW2B 3TGKE 4B74A 2F9VA 3DCLA 3VXFH 4M9FA 4X2YA 3TJOA 1AUJA 1O2MA 3RLWH 2NU1E 1IQNA 1C2LA 2A45B 2PTNA 3EA8A 4YXWD 3BTWE 1DSTA 2GGVB 1JXPA 1IHSH 1GI2A 3MO6A 3VGCB 3MI4A 4FUEA 5JBAS 1BJVA 4RT0A 3SN8A 1GHAG 1V2OT 1SB1H 3R3GB 1TGNA 4I7YH 1NM6A 2ZWLH 1XUGA 4DIIH 2GCHF 1COWD 2XTTB 2ZU3A 1KIGH 1HFDA 5F8XA 3QGNB 1V6DA 2FOHA 1UTLM 4YLQH 1C1NA 1JRSA 1TWXB 1CA0B 1MBQA 3ZIAD 3QZRA 1MKWK 3NCLA 2A4OA 2WPDD 4IMZA 5DJ7A 2QGRA 1W14U 3SU0A 2BXTH 1BJUA 2FX6A 5E2PA 1QGFA 2W7SA 1C2IA 4BNRA 1QFKH 2AYWA 1FDPA 1P12E 3SORA 3F68H 3FO8D 1A1RA 4CRDA 8GCHG 2V35A 5CHBA 1L0ZA 3SNDA 3M35A 5EW2H 1C5NH 3TU7H 8LPRA 4CH8B 2SNWA 2C93B 1BZXE 5ETXA 1AD8H 1Y3VA 1C1VH 2A4GA 1NFYA 1OP2A 1P3CA 2GZ8A 2ZFRH 5JBCS 2FIRH 1CT2E 1E1RD 3NKKA 4JMYA 4OS7A 1YBWA 1HAYB 3C1KA 2WINI 4X1PU 3AK5A 4AX9H 4BTUB 5JB9S 3UNQA 5C20A 3A83A 5L6NH 4E05H 2KX4A 1MKXH 4Z0KA 4K1TA 1O5DH 5DSFA 1AFEH 3RMLH 2XCNA 4FUFA 1G3CA 4I8LA 1VKYA 4BAHB 4CRGA 5GDSH 4OGXA 5DN6D 1KTSB 1SGYE 1C5LH 4ZXXH 4F49A 3UOUA 5JPMH 2FODA 5JBBS 1P09A 2KCPA 1C2GA 5CHAB 1ETRH 2FOAA 2O8TA 1YYY1 1DXPA 1HAVA 1WCZA 4JYTA 1ESTA 3ATMA 2XWAA 3SGBE 1GHBG 4INLA 3LKWA 2A7HA 3M7TA 3U8TH 4CREA 3TK5A 1XXDA 2OBQA 2BB4A 3PMAB 4UFFH 3KCGH 1O2YA 2PFEA 1D3DB 3B9FH 3MH7A 2KZ4A 5I25A 1SGTA 5DP5A 5DP6A 1V2VT 1ZYOA 3QWCH 1EOJA 4INKA 1IQFA 1T4UH 2PSYA 2ZECA 1BHXF 1YCPK 2RG3A 1ZGVA 5H4IB 4Y7BA 3F1SB 3RC4A 4TWYA 3RXKA 3SJOA 4F48B 3FZDA 2P8OC 3TK9A 3TPIZ 1C5UA 1C4V2 1XX9A 1HAIH 2ZGJA 1Z71A 3BTFE 5DP3A 1DICA 1HBTH 4AG1A 2GCTC 2FYQA 3VEQB 4ABJA 5B6OA 3SQHE 1UTQA 3T5FH 4FXGH 1NTPA 1YLNA 4E7RG 2SGPE 1Z1IA 1ACBE 1HIAA 3A8AA 1TOMH 2HPPH 3SV2H 3R0FA 1EAXA 5TCAA 4XBCA 3JZ2B 2BD5A 4A1VA 1HCGA 1MUEB 3KNXA 2ALVA 2Z6BD 1NFUA 4P00A 1XUJA 4AYYB 1CE5A 4J1YA 3LH1A 2HALA 3UQVA 1TPAE 3K6ZA 5JYIA 1O2WA 1NY22 3GOVB 5FPTA 2JJ1D 1SGNE 1KXAA 1P02A 5FBIA 2PLXA 1NZQH 1KLIH 4X8SH 1IQHA 3RXUA 4IBLH 1SLXB 5KECA 2UUKB 4ZCNA 2FDAA 2BX3A 4TY7A 2Y6TA 1GHXH 2H1UA 2GV6A 3LJJA 2ZDVH 3KHVA 3RXVA 3BF6H 2BDIA 1TNIA 1DWBH 4KTCA 3BTQE 1O5AB 3L33A 2BY7X 1U6QA 1O2QA 2ZHQH 3D23A 2PW8H 2QXGA 4FUHA 3TNSA 3IG6B 3SV8A 3LH3A 1B5GH 4CRBA 5FX6A 1FX0B 2ZP0H 4HTCH 4I86A 2Z9JA 4TPYA 3EE0B 4NZLA 1DWDH 1Y3XA 1BITA 2BD4A 3RXOA 1CU1A 1GMCG 1H4WA 4X6MA 3I29A 5EJLA 1ZRBA 3QO6A 2YMSC 2FOEA 1MU8B 4MPXA 1E1QD 2OC8A 2BOHB 2BY5X 3T26A 4X6NA 3ZVAA 1NO9H 2VVCA 3M36A 3RXEA 1J15A 1QTFA 1H8ED 2ZDAH 4ABDA 2D1JA 1IQKA 1BRBE 1Y59T 1OYQA 2FI5E 2J95A 3OX7U 2ZHFH 1TQ7B 2EY4C 1QB9A 3BTME 1AE8H 1EP5A 1NN6A 1QBOA 2VWMA 3A7WA 4A7IB 1O2XA 1ELEE 1V2WT 2B9LA 5T1VA 1QZ8A 8KME2 3JZ1B 1BRCE 5HM9A 6CHAC 3UAIC 4AGJA 3GY5A 2BD7A 3V7TA 3T2NA 5E8EH 5FAHA 1PJPA 3PRBA 2ZTYA 3MU0A 4KGAA 3DUXH 3P70B 1SBWA 1Y5UT 3EGKH 2DE8A 5EOKA 3T28A 1OOKB 3ZZBA 1P05A 2DE9A 2TBSA 1K1PA 2BVRH 3BEIB 2BMGB 5FCRA 5FXLA 4YM9A 4OM9A 3E0PB 3P8NA 2AGGX 1P57B 4ISOA 3QN7A 1JOUB 1MZAA 5C2ZA 1RS0A 2BM2A 4HZHA 1BHXB 2M2AA 2C8WB 1Y5AT 1MKWH 1RFNA 2GD4B 2FS8A 3KF2A 5EGMA 1FY1A 3RUOA 1NFXA 3GCHC 4CBOA 1O3GA 2P3UB 3MO9A 1FN8A 3GDSA 2UUYA 3U8RH 1HIAB 2G8TA 3MH4A 3E8LA 3SV6A 4MDSA 1D9IA 1C1QA 2A2QH 1ESBA 4WY3A 1SI5H 1EKBB 7GCHF 1TBQH 1UTMA 1TMBH 3CS0A 3ODFA 2KCYA 1O39A 4GAWA 3UY9A 4ABFA 4I8HA 2WPIS 4Y10E 1S6LA 1C1SA 2ZF0H 1O3EA 2Y7ZA 3LGYA 1NRNH 1K2I1 2FOFA 3MU5A 3TGJE 2H9EH 4NSYA 2BVSH 1GBDA 2ZU5A 2IPHA 4YOGA 1PPEE 1O2OA 2JH5D 4DJZB 1O2RA 5DPAA 3UB0A 3PV4A 4DG4A 3MYWA 1JMOH 2Y80A 3A7VA 5DO4H 1LHCH 5ESTE 1ZSKA 1CQQA 4WH6A 1W8BH 1H8IH 2Z9KA 3G01A 8ESTE 4CRFA 2RDEA 3ITIA 2F83A 1GHYH 3BTKE 1XVMA 3F6UH 3QUMP 2SGEE 4B2AA 1V2ST 3SOSA 1PQ7A 2XOKD 1J9CH 1BTUA 1EB2A 2J98A 4P02A 2BZ6H 1ZPBA 3HKIB 1C5RA 3VGCC 4FVBA 4AOQA 2VB0A 1MABB 3HGPA 1SGEE 3RXBA 2HNTF 1DUEA 1JRTA 1UTOA 1RTFB 2ZFQH 3PMJA 1LVOA 1OSSA 2OC1A 2QE7D 3MNXA 4MPUA 4WH8A 3VFEA 1GBEA 1AO5A 2F9OA 5GJ4B 1YGCH 4F4OC 2JETB 1DWCH 1XUFA 3BEFB 1G3EA 4A5TS 2FYRA 3BTGE 2PUQH 2CN0H 1L1NA 1VCWA 1C1OA 1C5PA 1MKXK 1QRWA 1V2TT 5FBEA 3PO1C 1GVZA 1GBLA 1SGFG 1FXYA 1O3OA 3K6YA 2F43B 2ZFPH 1A7SA 1G36A 1GI4A 1YM0A 1DY8A 1VGCC 3D49H 5LGOA 1S0RA 1GCTB 5FHTA 2NU0E 3D65E 3LC5A 3SJIA 2STAE 5GPIB 3FANA 1ELDE 4FU8A 2OP9A 3P8FA 2UWPA 3BIVH 4UE7H 4GLYA 1KXFA 5SGAE 1P3EA 2V0BA 3SGAE 3BTEE 2J34A 2YMSB 4I8JA 2EI8A 3KIDU 3PM3A 1HUTH 1TB6H 4SGBE 1GMHG 1KXCA 4X1SU 2WZQA 1TBRH 1GI9B 1LKAA 2B5TB 5C17A 1QB1A 1TOCB 4ZH8A 3NZIA 1GBKA 4TWWA 2YMSD 1AGJA 4FUGA 4NZQA 1O3HA 1NESE 3T62A 1QCPA 1P9SA 4KELA 1THRH 1LTOA 3SUFA 2SGDE 2RA0A 1LCYA 3SJ9A 5TCCA 1MAYA 2W3KA 1ESAA 4WXVA 5A8XA 1O2TA 4Y71A 2BLWA 2OQUA 1ZOMA 1A5HA 3OYPA 1FZZA 1ZHRA 4JYVH 5TJXA 1NT1A 5HKKD 1BTWA 4NG9H 3CS7A 1NRPH 3T29A 2W3IA 2BY6X 3F9HA 1F5KU 1Z1JA 5T6DA 2BLQA 1SQAA 3RM2H 2FM2A 1BQYA 3GY6A 1LVBA 3LGTA 2ZGBH 3F2FA 3ZYDA 1EATA 3PLBA 2WPJS 2XC0A 1O5BB 1OWJA 1HJAB 2V3HH 1EUFA 2ZCKP 4B6FA 1H8HD 4MNYA 2A7CA 9LPRA 3S9CA 2O8UA 3OU0A 1OYTH 4U30A 1KXEA 1S83A 4Y8YA 5AVDA 1CHOF 2J98B 2ZFFH 1O30A 4X8TH 1H1BA 1TNLA 1HYLA 4K3JA 2ZPSA 1LPKB 3VXEH 4K69A 2G00A 5EG4A 1YP9A 4FUIA 1C1RA 2O8WA 2VU8E 3ATKA 4AORA 1D3PB 1EZUC 1O3CA 2BQ7B 1AE5A 1WDIA 2FI3E 1PYTC 2G55A 2L74A 2C8YB 5JBTA 2FOMB 1UW7A 2W6ID 3MU1A 1V2UT 1LPZB 2WPHS 4Y11E 3MO3A 1K1JA 3GYLB 2HVYB 2FX4A 1SMFE 3U8OH 4X1NU 2VINA 3ATWA 5E0HA 1GBCA 1HDTH 1QL8A 1W13U 1O3AA 3N7EA 1OWHA 3U69H 1P11E 3M5NA 5GNDA 1QL7A 2K0QA 1ELGA 1KLTA 3KYGA 5CE1A 1O33A 2FEQH 1W3CA 1FY8E 5GCHF 4H6TA 1O34A 2FP7B 4UD9H 1QRXA 2TGDA 2BVXH 2STBE 3U1IB 2BY9X 5EJ1A 3ZZ9A 2F91A 1FPHH 4NWLA 2A32A 2W26A 1A46H 1ZR0A 5AF9H 2GZ9A 4R8TB 1IAUA 1ELCA 1WAYB 3A7XA 2A5IA 1GI6A 3DFJA 4GHTA 3N7OA 2J9NA 1WXRA 2CF8H 1GL0E 4YT7H 1G3DA 2ZDMA 1C1PA 3ZZ3A 4NIVA 1G37A 1O2IA 2LNCA 5DGJA 4DURA 2ZNKH 1N8OC 1AQ7A 4UFEH 2RCEA 3QTOH 4B6EA 3T27A 1TGCA 1UTJA 2Y7XA 3FFGA 4K60A 1UVOA 2UUFB 1IQLA 1NU9A 2GMTC 2KFWA 3DSOA 3K9XB 1W0YH 3ENSB 3STIA 2BD3A 1K1OA 3SO3A 2V7QD 4Q7ZA 4ABAA 1H8DH 3PO1B 4IGDA 4AYVB 1BIOA 3OTPA 1T31A 1IQMA 1VGCB 1A4WH 5AHGH 2GT8A 1AKSA 4A1XA 1FIZA 1MU6B 1T32A 1E35B 2A4QA 1OS8A 3H7TA 1BRUP 1GVLA 9ESTA 1PFXC 3GCTF 3V13A 3UTUH 4MPVA 2BLVA 1OWIA 1UCYH 2PKAA 1MBMA 1DXWA 3P95A 1FI8A 1FY3A 1ANBA 1O5FH 1FPCH 1L1GA 1O2PA 1Z7KA 1ZGIA 2CGAA 2SGQE 5EQSA 3ZVDA 1OHHD 3SI4H 2J2UA 3ZYEA 2ZFTA 3TIUA 2Y82A 3ZVGA 3VB4A 2PKSC 2NU4E 2TIOA 5L2YH 1GBHA 4ZXYH 1UK3A 3TJNA 2V6NA 3RU4T 4X1QU 1P2NA 3DHKH 2ODQA 2BQ6B 1OWEA 1UK4A 2ODPA 4Y76A 2D26C 3PWCA 3MTYA 1WTHD 1EOLA 4BOHA 3TLOA 1O3KA 3LC3A 1GHAF 5IK2D 1GPZA 1EAWA 3VG8A 1CGIE 2FWWA 3GYMA 1C5OH 4JZEH 1RIWC 4H4FA 2KAIB 5HMAA 3PB1E 3RXDA 1FONA 4CR9A 2GKVE 4H6SB 3LGIA 3SUGA 2Z9IA 1YCPM 3RMMH 1C5ZB 2CXVA 3GY2A 2GZ7A 1EPTB 1NROH 1B0FA 1C1UH 2AIPA 3DD2H 3N99A 1ARBA 1DVAH 1PPFE 3SU6A 1C5TA 5C1UA 3A89A 2PGQB 1SGDE 1GMDG 2LELA 1T7CA 2VIOA 1BUIA 3KN2A 1XKAC 1KYNA 1H9LB 3UUZA 1CT4E 3BG4B 1GJBB 1FQ3A 3ODDA 3MOCA 3S7HB 2A7JA 3KQDA 4NFEA 1GG6B 1MTVA 4TY6A 1TA2A 1WBGB 1EP6A 1P8VC 1A2CH 3A85A 1EASA 1PPCE 2EI7A 1V2LT 4IN1A 2Y5HA 8GCHF 3SJKA 2BDYA 4HI3A 2Y5FA 1WUNH 2VH6A 5FX5A 1SC8U 2OQ5A 2A4RA 3PRDA 1O38A 4BXSA 3F9EA 3FOAA 1XUKA 5EQQA 4I31A 3SZEA 1B0EA 1AB9C 4ZKNU 3FZZA 3T25A 6LPRA 1QNJA 2P59A 4YZUA 1MTWA 2IPQX 1PPZA 1FMGA 3B23B 1O3BA 4AGKA 1TALA 1O35A 2BQWB 1THSH 3A88A 1EZXC 1BMFD 3GY8A 1GJ8B 1Q3XA 3TJVA 2IJOB 2ULLA 2F3CE 1A0JA 3GY3A 3VB5A 4MQAA 1TPOA 4XBBA 4XE4A 1YF4A 1GI5A 4DCDA 3WWFA 3MQKC 4IN2A 3AASA 4HGCA 1C1WH 2JETC 3UOPA 4XBDA 4DVAU 1DFPA 5J4SA 4KTSA 4JK6A 4AB8A 4AFZA 1W7XH 3KQCA 4ZHLU 3BG8A 2AIQA 4H42U 1PYTD 1GHBF 1PPGE 1JIRA 1BA8B 4U2WA 1TABE 1UVTH 2M5TA 1TPSA 2XWBI 5C1YA 4GCHG 4NA7A 1AKSB 4D9QA 3LIWA 3NRLA 1GCTC 3ESTA 3LT3A 3AVZA 1EFRD 2ZQ1A 1TLDA 2R3YA 3SNAA 1HAPH 4Q63A 5IDKA 2TGPZ 2PKAB 2R9PA 5HIZA 3BSQA 5GIBA 1AHTH 1CVWH 4JZ1A 4BAOB 1A0LA 3Q00A 5EIYA 2SFAA 3KEEA 2VIWA 1XXFA 2VIVA 1N8OB 1QQ4A 1S82A 1OKXA 4UONA 1FAKH 2OK5A 2BDAA 3ZZ7A 4A92A 2BLOA 2GMTB 3L3TA 4AG2A 3A82A 1CGJE 2O8LA 4CBNA 3RXCA 1UTNA 2C4FH 1AZZA 2A2XH 5EPNA 1TNGA 1GBBA 1S5SA 3V3MA 4A1TA 2AHME 4DT7B 4D76A 1P2OA 3KQBA 3F2HA 3ZVBA 4VGCB 2CF9H 4NGAH 2NU3E 1SGRE 3E91A 1O2KA 2WPKS 4Y0ZE 7ESTE 1UHBA 1RTKA 4WMEA 2CMYA 4YLUA 1OXGA 1K28D 2PGBB 3B8JA 2K1QA 4MPWA 2KCOA 1O2GH 3S9AA 2PKSB 2FLRH 1GI1A 1O2HA 2G5VA 3GDUA 1E0FD 1MQ6A 3SUDA 3SBKA 2H9TH 3A7ZA 4DOQA 4ZAEA 3PMHB 1OP8A 2QXIA 5EPYA 1SHYA 1ELBA 1GMCF 1N6YA 3RLYH 3I78A 2IJD1 1LMWB 3RXJA 2F9NA 1Z8IB 1L4DA 3KQ5A 1HJAC 2WYJA 4Q4LA 4DT4A 3SNCA 3F9FA 3RDZA 1RIWB 1E36B 2VVVA 5PTPA 1ZTLA 1L1JA 1CGHA 5JDUB 1MH0A 3F9GA 2SNVA 1G3BA 1K22H 2HLCA 1Z8RA 4LZ4B 2ZGCA 1AU8A 1O2JA 1O3DA 2TPIZ 2ZDLA 1UO6A 1MD7A 2FZZA 5E0GA 3PV2A 3TK6A 3PTNA 2PWXA 1MZDA 1TYNA 1YPGH 2A1DB 3SV7A 1WQVH 1ZZZA 1GI0A 4MG3A 2KR7A 2CHAB 1SL3A 2GV7A 5A0CA 2HNTC 4DW2U 1NS3A 1C4U2 2GT7A 1TX6A 1TBZH 1MTUA 2WHXA 1D6WA 2VIDA 4KTUA 1O3JA 1P01A 3I77A 4PROA 3SQEE 5C5NA 3LGUA 4LZ1H 1T4VH 2H2ZA 1OPHB 1YC0A 5DP9A 1C9TA 1K1NA 2VGCC 3LU9B 3ZZ4A 3TGIE 1THPB 3A7TA 4TYDA 1YKTA 3SHCH 1QL9A 3P8GA 1FIWA 3UWJH 1GDUA 1GI7B 3GISB 1A5GH 1EJNA 2J94A 1PPHE 2BOKA 3TJUA 4WWYA 2Y5GA 5HM2A 1K21H 3OE7D 5DKMA 1AB9B 1AFQB 1TNJA 1XUHA 1O3LA 3SU1A 1VITF 4AZ2B 3S0NA 1O3PB 1TRYA 3M37A 4YT6H 2FTMA 1KXBA 3NK8A 2YNAA 3U28C 1F5RA 4I33A 3RXLA 1C5QA 1HXFH 1P10A 1UCYK 4AN7A 3RXRA 4XOJA 3E6PH 3SU4A 1GJCB 2J38A 2VH0A 2HRVA 3EYDA 1F7ZA 4ABBA 3UPEA 3F0PA 1S6FA 3L6PA 4NIYA 4MNWA 3S7KB 4E7NA 3RC5A 1SKYE 1LHDH 1GBJA 3M3VA 2FTLE 3GY4A 1O2UA 2ANKH 2JKHA 5GXPA 1UCYE 3A8BA 1O0DH 2ZPRA 4Y7AA 2NU2E 1RRKA 1C1TA 5T3HA 4BAQB 1WYKA 1ABJH 1IOEA 1DM4B 1S81A 5BRRE 1GI8B 1EJAA 4X2VA 1CSOE 2XC4A 1SGQE 1BCUH 1M9UA 1ZJDA 1GGDB 2F9BH 3QX5H 1WOFA 1BMMH 2TGAA 3URDA 1UHBB 1WSSH 2QCYA 1UVSH 2W5EA 2BD2A 1IQEA 2QF0A 1LDTT 2H5DA 5FPSA 3C27B 1VR1H 4IC5A 3RXSA 2FI4E 4Q80A 4Y0YE 2FOBA 2QY0B 2UUJB 3MFJA 1O3IA 1TNHA 1A5IA 3OY5U 4RN6A 3EE7A 5EXLA 2AMPA 3UREA 4OS1A 1BBRH 4ESTE 3FAOA 4OGYA 2ZA5A 5A09A 2H5CA 4BTIB 1DITH 2JDID 1SLWB 4SGAE 1DS2E 1J16A 2RDLA 2P3FH 3AAVA 4LOYH 4NIWA 2G51A 2FMJA 2HPQH 3MH6A 4CRAA 3W94A 1Y8TA 2ZI2H 6GCHG 1HAXB 2J92A 4Y79A 1VCPA 1ANCA 2QC2A 1EAUA 2Q1JA 2WYGA 4D7FA 1TIOA 1G30B 5EXNA 3RXTA 1CHOG 1GWAA 2O9QA 1O5EH 5GWZA 4WXIA 2BTCE 2NWNA 2XXLA 1EPTC 4J2YB 3H09A 2IOTA 3QTVH 2TRMA 1KSNA 2THFB 4XD7D 1P2IA 3RXGA 1SR5C 2ZKSA 1K0HA 1GCDA 3LOXA 3HPTB 3BG4C 1ELFA 2AGEX 1C5VA 1S0QA 1OX1A 1VJAU 3KGPA 3ZZ6A 1H9HE 1ZMJA 2Q6FA 1GG6C 3MNBA 2HLDD 2WPMS 1KXDA 2EA3A 4Q7YA 1QBVH 4X6OA 1ID5H 1TGBA 3ZZAA 1NU7B 3ZV9A 2ZFSA 3LONA 2I6SA 5C67A 1QJ6B 3PLPA 4MNVA 5T6FA 2ZGXH 4ISLA 5I46H 3A81A 5EJZA 2B0FA 2WUCA 1ANDA 5B6LA 2KAIA 3BTTE 1DUAA 1ZPCA 1E79D 3NPSA 1GMHF 2Q6DA 3M5OA 2FPZA 1J8AA 3ZZ8A 2FS9A 1IQGA 1XVOA 3TNTA 3LGWA 2GVFA 4LK4A 5J4QA 1A61H 1D3QB 4AC9A 1GJDB 1C5YB 1P2QA 1EPTA 1GL1A 5C5OA 1YY3A 1E38B 1QURH 1NPMA 1TMUH 1D4PB 4TSFD 1BTHH 4B71A 2ZHDA 3EAJA 1G9IE 3F3BA 2L6OA 1O37A 1MD8A 1ELVA 4F55A 1F0SA 3ATIA 3SNBA 5EQRA 2GCHG 1O5CB 1WTGH 5C0UA 2QAAA 1H9IE 7KMEH 1HV7A 4FU7A 3M61U 1SG8B 1SGIB 2VJ1A 3MNSA 1MCVA 2VGCB 2PSXA 1EZQA 4AFQA 3GDVA 1GJ5H 2OUAA 4FUBA 3ATLA 1ABIH 2OINA 4BTTB 1YLDA 2F9UA 4K1SA 4ABIA 3WW7A 2VIPA 2Z3CA 4UFDH 3BTDE 1L4ZA 1NRSH 1XUIA 5A0BA 1DSUA 3A8DA 4YESB 4ZHAA 1QA7A 1P0SH 4DGJA 3O8BA 1RTLA 1MCTA 4X8VH 5LPFA 2UWOA 1HLTH 1F2SE 4ABGA 1ZPZA 3H7OA 1GBMA 1AVWA 4FUJA 2XBWA 4JZIA 1BMNH 2Z3DA 4NFFA 2AH4X 3RXFA 3HKJB 3HGNA 4NSVA 1RGQA 1IQJA 2PUXB 3A8CA 1GJ6A 2H6MA 3M7UA 1KLJH 1C2DA 3V12A 1YPKH 2I6QA 1N1LA 2Z9LA 2ANWA 1ZLRA 1GDQA 1AVXA 1LVYA 1YPHC 3O8RA 5KEDA 1LKBA 2VWLA 5C0TA 2XBXA 1DPOA 3WWBA 1SQOA 1VJ9U 1TONA 3KQEA 1AIXH 5FL7D 5KGOA 1Y5BT 1FN6A 4XRNA 1AZ8A 3N7DA 2JH6D 2F9PA 4VGCC 4XSKU 1FLEE 2D8WA 1GHVH 3PTBA 3RU4D 1QQUA 1BMLA 1Y3YA 1Q2WA 4K1EA 1KDQA 1SVPA 4X1RU 2Y81A 3SZNA 3F2GA 3M3TA 1CO7E 3TH4H 1CBWB 1ZSJA 4WMDA 1DX5M 1ZHPA 2OC0A 1GVKB 1AI8H 2GTBA 2IN2A 1NBME 2BYAX 3TITA 2C8ZB 2GDEH 5DP4A 1UTPA 1AUTC 3E3TA 1HAOH 1O2VA 1C2MA 4FVDA 4ISIH 3MWIU 1NFWA 1O3MA 4RKJB 3LPRA 1DOJA 3VPKA 3HATH 2XW9A 1ETTH 5HYOA 2GDDA 2P3TB 4O97A 4A6LA 4FETA 1AWFH 4B2CA 1KTTB 4ZKOU 3KYFA 1D3TB 5G4BA 4ZKSU 3AW0A 2C8XB 4AFUA 1LQEA 1C1MA 1BTZA 4GSOA 2B8OH 1V2QT 1TX7A 4IMQA 2ZU1A 3UQOA 3SJ8A 1W7GH 1HGTH 1SFQB 2BD9A 2BZAA 1DDJA 2PP6A 1OWDA 4ZROA 3D62A 2OLGA 1SLVB 3UNRA 1YLCA 1AY6H 6ESTA 3BTHE 3FP7E 1KMHB 2WV5A 3M7QA 4NA8A 2DUCA 2EI6A 2ZHEH 2HNTE 5F53A 3TVJB 2WV4A 1EAIA 2P95A 1F92A 3OFND 3RXPA 1BMAA 5EW1H 4D8NA 2Z94A 3ZZ5A 3W1EA 1HRTH 5L30H 1VZQH 2CHAC 2CK3D 3OAAD 1SSXA 1FY4A 3VB6A 1O2LA 4DY7B 4ISHH 2VBCA 1X7AC 4CH2B 4Q2KA 3HK6B 3MH5A 1Z8GA 5EXMA 3WY8A 1GI3A 4ZUHA 3RXAA 1C5XB 2BX4A 1HXEH 1F0TA 2LP6A 3ZV8A 2EEKA 2AGIX 5L2ZH 1ARCA 2Q6GA 1E34B 2BHGA 3LDXH 2ALPA 1J14A 1XMNB 3A87A 2FESH 4NCYA 4GUXA 1FY5A 3P17H 4K2YA 1TRNA 4WMFA 4OS4A 1LO6A 1AFQC 3Q76A 3QDZB 2OXSA 2EQNA 2ZU2A 4CRCA 1KY9A 2GX4A 3FP6E 2QF4A 4WJG2 4U01A 1NC6A 1C2FA 3EQ0H 3OSYA 5E2OA 3SHAH 2BY8X 2OBOA 1EX3A 3SV9A 5EODA 1GHWH 1C5MD 2ZGHA 4BANB 3RU4E 3F0OA 1BBRK 5A0AE 4OS6A 2R2MB 2FOGA 1E37B 2GP9B 4FU9A 1P2KA 4ZHMU 3M5MA 1PQAA 2Z9GA 3RP2A 1P03A 3SGQE 4B76A 1O2NA 1ANEA 4XFQA 1GMDF 2FLBH 4Z1MD 1HJ8A 3ZVEA 1UTKA 2XNDD 3KL6A 4YO9A 3RMOH 1O2SA 1BBRE 1DLKB 3P92A 4E06H 3SNEA 3GS9A 2FO9A 1AN1E 3MHWU 3EA7A 1XKBC 3FP8E 5F03A 3UR6A 1YWUA 2BXUH 1GGDC 2JH0D 2VIQA 1RJXB 1LHFH 3IWMA 3BIUH 1KDQB 1FUJA 2PR3A 4ASUD 5AFZH 1Z6EA 1V2KT 4B2BA 4YTAA 1HAZB 1QJ7B 1SHHB 2ZDNA 1EB1H 1LHGH 2ZQ2A 1MQ5A 1TGSZ 1P06A 2ZEBA 1G2MA 1QR3E 2A5AA 4DIHH 5HXFA 1ELTA 1PQ8A 4M7GA 3UR9A 3RXMA 5DG6A 3FVFB 2ZG0H 1C2EA 1TFXA 5EU8A 1OWKA 3MMGA 1GBTA 1DWEH 3S69A 1SLUB 1K1IA 2TGTA 3STJA 4AFSA 1FJSA 2YOLA 2ZDKA 5ESBA 2HOBA 3P8OA 1RXPA 2J5UA 1T8OA 3MU4A 1ZHMA 3Q3XA
chains in the Genus database with same CATH topology
1LPGB 2OTVA 4FUDA 3W95A 1S85A 5DK1A 2ZCHP 1JBUH 3RXQA 3K2UA 1IHTH 4K8BA 2V3OH 1GDNA 7GCHG 1Y3WA 2BDCA 2RA3A 3GCNA 3RXIA 1BT7A 1NRQH 1UJ1A 1WQSA 1TRMA 1HNEE 2HVXA 3Q3KA 1S84A 3A80A 3LJOA 4JZDH 1C5SA 4GCHF 1C2JA 1V2JT 3RXHA 1MTNC 4Q7XA 3DT0H 1QRZA 1TPPA 1EQ9A 2O8MA 1YPMH 2PTCE 5A2MH 3A86A 1P9UA 1HAVB 1JIMA 1ZTKA 1G32B 1W11U 1DLEA 3PMBB 1BOQA 3BV9B 4JYUH 3PROA 4KP0A 1GJ7B 4B1TA 1FAXA 4X2XA 1OP0A 4O9VA 2G4UA 2C3SA 1SGPE 1W12U 2QIQA 4JCNA 1NRRH 1B7XB 1Z8JB 1EXFA 1HPGA 1VITG 1MMJN 2C90B 5F8ZA 1TX8A 5K0HA 4X2WA 4Y8XA 1O5GH 4UFGH 1O31A 1QBNA 4ISNA 1W0ZU 5HGGA 2SGFE 1RD3B 5CMXH 2LPRA 4BAKB 3H5CB 3DFLA 1CA8B 2B7DH 3PWBA 3P6ZB 3EDXB 4O3TA 5LH8A 3DA9B 1S6HA 1ZTJA 4GPGA 2QYIA 3U9AH 1FV9A 1QHRB 5IYTA 2ZTXA 3IITA 3RMNH 1G2LA 4OS5A 1QY6A 1ZJKA 1ELAA 3U1JB 1MTSA 2YNBA 1VITH 1T8NA 2ANMH 2QN5T 5ABWA 2AERH 1YPEH 3Q3YA 1F0UA 1DY9A 4Y6DA 7LPRA 3ELAH 1T8LA 1JWTA 3ZZCA 3M5LA 3VB7A 5K7RA 2G52A 3MU8A 1V2PT 1AWHB 2A31A 3K65B 3BEUA 4QT8C 1O3NA 1EJMA 4RSPA 1C9PA 2BDHA 1TMTH 5A8ZA 5LPEA 2R0KA 1L2EA 2D2DA 3A7YA 4NA9H 5E0JA 1HAHH 3GCOA 1UVPA 5A8YA 1GBIA 5DP7A 4UDWH 1GBFA 3QZQA 4B75A 1WV7H 4CHAC 2P8OB 1V2NT 3NUMA 2QXJA 1PQ5A 1A3EH 2OC7A 5AFYH 2GCTB 1W10U 2P16A 1YPHE 5F8TA 4MLFB 3M3SA 4JZFH 1TNKA 2XC5A 2OCVB 3BN9A 3HK3B 1VCQA 2WPLS 4YOJA 2Z3EA 1Y3UA 2VNTA 1P2JA 5LPRA 1LVMA 4INHA 1O36A 4X0WU 3RC6A 2VVUA 1BDAA 1WU1A 2H9HA 1D6RA 1SFIA 3NXPA 3ZVFA 1K1LA 2ZZUH 4ZMAH 1C2HA 3SU5A 2ZTZA 2ODYB 3QLPH 5FPYA 1V3XA 2A0QB 1XM1A 2CJIA 1W2KH 1O32A 1YCPH 2XBVA 1T8MA 2W7UA 2J4IA 3E1XB 5F6MA 3TH3H 3E16B 3UWIA 4RKOB 3AW1A 1K9OE 1CA0C 1HB0B 1LQDB 2ZHWH 1AVGH 1CBWC 5T6GA 4TPIZ 4JK5A 4OS2A 4IS5A 1AMHA 2BDBA 1GHZA 2ASUB 2PV9B 4ASHA 2QF3A 2ZCLP 3U98H 3CP7A 1J17T 2AEIH 3EA9A 1F5LA 1TGTA 2XYAA 1SOTA 1QIXB 2ZC9H 3VB3A 1SPJA 4D9RA 5JB8S 1GJ9B 1PPBH 2P94A 1ETSH 1A3BH 3SUEA 2VWOA 3V0XA 1FNIA 3Q77A 1V2RT 4KKDA 1EZSC 2ESTE 3CENA 2QXHA 1TA6A 1ORFA 2ZPQA 3OTJE 1C5WB 3OY6U 4X6PA 1A0HB 1LHEH 2XBYA 2SGAA 1QB6A 2R3UA 1Z6JH 2ZO3H 2FOCA 4O03A 4D7GA 2VWNA 4YOIA 2P93A 4BXWA 1QJ1B 3AAUA 1BTXA 4I32A 1ZSLA 4K5ZA 1SGCA 1UK2A 3PYHA 2ILNA 1GJAB 1QA0A 1HAGE 1DT2A 1YPLH 2G5NA 2EC9H 2Z7FE 1CHGA 1MTNB 1SGFA 1IQIA 4MVNA 1UVUH 4R0IA 6CHAB 4BAMB 5CHAC 1BB0B 3UFAA 2WUBA 2XNIA 4Z6AH 2XCFA 4B73A 2ANYA 2ZIQH 1N6XA 3O8CA 1DE7H 4HFPB 1BRAA 1GBAA 3RM0H 2UWLA 5GCHG 1YPJH 3NWUA 4WVPE 4XDEA 4GHQA 4WF8A 3GY7A 3O8DA 2XRCA 3E0NB 1SQTA 2OD3B 1HJ9A 4NWKA 4ABEA 3E90B 4X8UH 2CV3A 2A5KA 4UEHH 3LGVA 5C1XA 5DP8A 3QK1A 4IC6A 2HGTH 2PHBA 4K8YA 1TAWA 4FUCA 1P04A 2G81E 6GCHF 2AMQA 1O3FA 3S9BA 4CR5A 1ZMLA 2AS9A 4I8KA 3UNSA 4Y8ZA 4THNH 2BD8A 3GCHB 2HWLB 4ZKRU 4AB9A 1O2ZA 4O3UA 1C4Y2 3A84A 1INCA 3SU2A 4GVUA 2QV1A 3SI3H 4ABHA 3MNCA 4IW4E 5FCKA 1TE0A 2R0LA 1DANH 3SU3A 1BTYA 1P2MA 2AFQB 3ZZDA 1ZRKA 4MNXA 1F0RA 1MAXA 1SOZA 1TQ0B 3UIRA 4I8GA 2BDGA 1V2MT 3GICB 1C2KA 5BPEA 1GJ4H 4LXBH 1Q31A 1K1MA 4MTBA 5C3NA 2R2WU 4U32A 3URCA 3ZVCA 3TH2H 2QA9E 1ZMNA 3GCTG 2FXRA 1CT0E 2G4TA 2AMDA 1UMAH 4CHAB 4NIXA 2ZU4A 3PLKA 1BTPA 3QGJA 3SW2B 3TGKE 4B74A 2F9VA 3VXFH 4X2YA 3TJOA 1AUJA 1O2MA 3RLWH 2NU1E 1IQNA 1C2LA 2A45B 2PTNA 3EA8A 3BTWE 1DSTA 2GGVB 1JXPA 1IHSH 1GI2A 3MO6A 3VGCB 3MI4A 4FUEA 5JBAS 1BJVA 3SN8A 1GHAG 1V2OT 1SB1H 3R3GB 1TGNA 4I7YH 1NM6A 2ZWLH 1XUGA 4DIIH 2GCHF 2XTTB 2ZU3A 1KIGH 1HFDA 5F8XA 3QGNB 1V6DA 2FOHA 1UTLM 4YLQH 1C1NA 1JRSA 1TWXB 1CA0B 1MBQA 3QZRA 1MKWK 3NCLA 2A4OA 4IMZA 5DJ7A 2QGRA 1W14U 3SU0A 2BXTH 1BJUA 2FX6A 5E2PA 1QGFA 2W7SA 1C2IA 4BNRA 1QFKH 2AYWA 1FDPA 1P12E 3SORA 3F68H 1A1RA 4CRDA 8GCHG 2V35A 1L0ZA 3SNDA 3M35A 5EW2H 1C5NH 3TU7H 8LPRA 4CH8B 2SNWA 2C93B 1BZXE 5ETXA 1AD8H 1Y3VA 1C1VH 2A4GA 1NFYA 1OP2A 1P3CA 2GZ8A 2ZFRH 5JBCS 2FIRH 1CT2E 3NKKA 4JMYA 4OS7A 1YBWA 1HAYB 3C1KA 2WINI 4X1PU 4AX9H 4BTUB 5JB9S 3UNQA 5C20A 3A83A 5L6NH 4E05H 1MKXH 4Z0KA 4K1TA 1O5DH 1AFEH 3RMLH 2XCNA 4FUFA 1G3CA 4I8LA 4BAHB 4CRGA 5GDSH 4OGXA 1KTSB 1SGYE 1C5LH 4ZXXH 4F49A 3UOUA 5JPMH 2FODA 5JBBS 1P09A 1C2GA 5CHAB 1ETRH 2FOAA 2O8TA 1YYY1 1DXPA 1HAVA 1WCZA 4JYTA 1ESTA 3ATMA 2XWAA 3SGBE 1GHBG 4INLA 3LKWA 2A7HA 3M7TA 3U8TH 4CREA 3TK5A 1XXDA 2OBQA 2BB4A 3PMAB 4UFFH 3KCGH 1O2YA 2PFEA 1D3DB 3B9FH 3MH7A 5I25A 1SGTA 5DP5A 5DP6A 1V2VT 1ZYOA 3QWCH 1EOJA 4INKA 1IQFA 1T4UH 2PSYA 2ZECA 1BHXF 1YCPK 2RG3A 1ZGVA 5H4IB 4Y7BA 3F1SB 3RC4A 4TWYA 3RXKA 3SJOA 3FZDA 2P8OC 3TK9A 3TPIZ 1C5UA 1C4V2 1XX9A 1HAIH 2ZGJA 1Z71A 3BTFE 5DP3A 1DICA 1HBTH 4AG1A 2GCTC 2FYQA 3VEQB 4ABJA 5B6OA 3SQHE 1UTQA 3T5FH 4FXGH 1NTPA 4E7RG 2SGPE 1Z1IA 1ACBE 1HIAA 3A8AA 1TOMH 2HPPH 3SV2H 3R0FA 1EAXA 5TCAA 4XBCA 3JZ2B 2BD5A 4A1VA 1HCGA 1MUEB 3KNXA 2ALVA 2Z6BD 1NFUA 1XUJA 4AYYB 1CE5A 4J1YA 3LH1A 2HALA 3UQVA 1TPAE 3K6ZA 5JYIA 1O2WA 1NY22 3GOVB 5FPTA 1SGNE 1KXAA 1P02A 5FBIA 2PLXA 1NZQH 1KLIH 4X8SH 1IQHA 3RXUA 4IBLH 1SLXB 2UUKB 2FDAA 2BX3A 4TY7A 2Y6TA 1GHXH 2H1UA 2GV6A 3LJJA 2ZDVH 3KHVA 3RXVA 3BF6H 2BDIA 1TNIA 1DWBH 4KTCA 3BTQE 1O5AB 3L33A 2BY7X 1U6QA 1O2QA 2ZHQH 3D23A 2PW8H 2QXGA 4FUHA 3TNSA 3IG6B 3SV8A 3LH3A 1B5GH 4CRBA 5FX6A 2ZP0H 4HTCH 2Z9JA 4TPYA 3EE0B 4NZLA 1DWDH 1Y3XA 1BITA 2BD4A 3RXOA 1CU1A 1GMCG 1H4WA 4X6MA 3I29A 1ZRBA 3QO6A 2FOEA 1MU8B 4MPXA 2OC8A 2BOHB 2BY5X 3T26A 4X6NA 3ZVAA 1NO9H 2VVCA 3M36A 3RXEA 1J15A 1QTFA 2ZDAH 4ABDA 2D1JA 1IQKA 1BRBE 1Y59T 1OYQA 2FI5E 2J95A 3OX7U 2ZHFH 1TQ7B 1QB9A 3BTME 1AE8H 1EP5A 1NN6A 1QBOA 2VWMA 3A7WA 4A7IB 1O2XA 1ELEE 1V2WT 2B9LA 8KME2 3JZ1B 1BRCE 5HM9A 6CHAC 4AGJA 3GY5A 2BD7A 3V7TA 3T2NA 5E8EH 5FAHA 1PJPA 2ZTYA 3MU0A 4KGAA 3DUXH 3P70B 1SBWA 1Y5UT 3EGKH 2DE8A 5EOKA 3T28A 1OOKB 3ZZBA 1P05A 2DE9A 2TBSA 1K1PA 2BVRH 3BEIB 2BMGB 5FCRA 5FXLA 4YM9A 3E0PB 3P8NA 2AGGX 1P57B 4ISOA 3QN7A 1JOUB 1MZAA 5C2ZA 1RS0A 2BM2A 4HZHA 1BHXB 2C8WB 1Y5AT 1MKWH 1RFNA 2GD4B 2FS8A 3KF2A 5EGMA 1FY1A 3RUOA 1NFXA 3GCHC 4CBOA 1O3GA 2P3UB 3MO9A 1FN8A 3GDSA 2UUYA 3U8RH 1HIAB 2G8TA 3MH4A 3E8LA 3SV6A 4MDSA 1D9IA 1C1QA 2A2QH 1ESBA 4WY3A 1SI5H 1EKBB 7GCHF 1TBQH 1UTMA 1TMBH 3CS0A 3ODFA 4GAWA 1O39A 3UY9A 4ABFA 4I8HA 2WPIS 4Y10E 1C1SA 2ZF0H 1O3EA 2Y7ZA 3LGYA 1NRNH 1K2I1 2FOFA 3MU5A 3TGJE 2H9EH 4NSYA 2BVSH 1GBDA 2ZU5A 2IPHA 4YOGA 1PPEE 1O2OA 2JH5D 4DJZB 1O2RA 5DPAA 3PV4A 4DG4A 3MYWA 1JMOH 2Y80A 3A7VA 5DO4H 1LHCH 5ESTE 1ZSKA 1CQQA 4WH6A 1W8BH 1H8IH 2Z9KA 3G01A 8ESTE 4CRFA 3ITIA 2F83A 1GHYH 3BTKE 1XVMA 3F6UH 3QUMP 2SGEE 4B2AA 1V2ST 3SOSA 1PQ7A 1J9CH 1BTUA 1EB2A 2BZ6H 1ZPBA 3HKIB 1C5RA 3VGCC 4FVBA 4AOQA 2VB0A 3HGPA 1SGEE 3RXBA 2HNTF 1DUEA 1JRTA 1UTOA 1RTFB 2ZFQH 3PMJA 1LVOA 1OSSA 2OC1A 3MNXA 4MPUA 4WH8A 3VFEA 1GBEA 1AO5A 2F9OA 5GJ4B 1YGCH 4F4OC 2JETB 1DWCH 1XUFA 3BEFB 1G3EA 4A5TS 2FYRA 3BTGE 2PUQH 2CN0H 1L1NA 1VCWA 1C1OA 1C5PA 1MKXK 1QRWA 1V2TT 5FBEA 3PO1C 1GVZA 1GBLA 1SGFG 1FXYA 1O3OA 3K6YA 2ZFPH 1A7SA 1G36A 1GI4A 1YM0A 1DY8A 1VGCC 3D49H 5LGOA 1S0RA 1GCTB 5FHTA 2NU0E 3D65E 3LC5A 3SJIA 2STAE 5GPIB 3FANA 1ELDE 4FU8A 2OP9A 3P8FA 2UWPA 3BIVH 4UE7H 4GLYA 1KXFA 5SGAE 1P3EA 2V0BA 3SGAE 3BTEE 2J34A 4I8JA 2EI8A 3KIDU 3PM3A 1HUTH 1TB6H 4SGBE 1GMHG 1KXCA 4X1SU 1TBRH 1GI9B 1LKAA 2B5TB 1QB1A 1TOCB 4ZH8A 3NZIA 1GBKA 4TWWA 1AGJA 4FUGA 4NZQA 1O3HA 1NESE 3T62A 1QCPA 1P9SA 4KELA 1THRH 1LTOA 3SUFA 2SGDE 2RA0A 1LCYA 3SJ9A 5TCCA 1MAYA 2W3KA 1ESAA 4WXVA 5A8XA 1O2TA 4Y71A 2BLWA 2OQUA 1ZOMA 1A5HA 3OYPA 1FZZA 1ZHRA 4JYVH 5TJXA 1NT1A 1BTWA 4NG9H 3CS7A 1NRPH 3T29A 2W3IA 2BY6X 3F9HA 1F5KU 1Z1JA 5T6DA 2BLQA 1SQAA 3RM2H 2FM2A 1BQYA 3GY6A 1LVBA 3LGTA 2ZGBH 3ZYDA 1EATA 3PLBA 2WPJS 2XC0A 1O5BB 1OWJA 1HJAB 2V3HH 1EUFA 2ZCKP 4MNYA 2A7CA 9LPRA 3S9CA 2O8UA 3OU0A 1OYTH 4U30A 1KXEA 1S83A 4Y8YA 5AVDA 1CHOF 2ZFFH 1O30A 4X8TH 1H1BA 1TNLA 1HYLA 4K3JA 2ZPSA 1LPKB 3VXEH 4K69A 2G00A 5EG4A 1YP9A 4FUIA 1C1RA 2O8WA 2VU8E 3ATKA 4AORA 1D3PB 1EZUC 1O3CA 2BQ7B 1AE5A 2FI3E 1PYTC 2G55A 2C8YB 5JBTA 2FOMB 3MU1A 1V2UT 1LPZB 2WPHS 4Y11E 3MO3A 1K1JA 3GYLB 2FX4A 1SMFE 3U8OH 4X1NU 2VINA 3ATWA 5E0HA 1GBCA 1HDTH 1QL8A 1W13U 1O3AA 3U69H 1OWHA 1P11E 3M5NA 1QL7A 1ELGA 1KLTA 5CE1A 1O33A 2FEQH 1W3CA 1FY8E 5GCHF 4H6TA