3PWCA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA02
1OKXA 1YCPH 1UJ1A 4M7GA 1YBWA 1AO5A 2AGEX 5L2ZH 1J15A 3M35A 2ZGJA 2UUFB 1DLKB 3MNBA 3UQVA 2GGVB 1GMCG 4YO9A 1GI3A 1O2LA 3KEEA 5FX5A 4ABEA 1L4ZA 1HLTH 1BB0B 5EPNA 5C20A 1F5LA 2BY8X 2J95A 1XXFA 3RP2A 1D6RA 1GJDB 4JZIA 1V2VT 3UWJH 2VNTA 5ESTE 3SU3A 4I8KA 2BDBA 3F9GA 5JPMH 3TPIZ 3FZZA 1GJ7B 1TX8A 1MUEB 3SZNA 2FP7B 4AG2A 3SGAE 1W12U 2JETC 5F03A 3O8RA 3HATH 1V2RT 1JXPA 1OWHA 3M36A 3PLPA 4I32A 1ETTH 1SB1H 5TJXA 4DW2U 4Q7YA 1ZJDA 2BXUH 4IN2A 1QRXA 1PPGE 2FIRH 3BTKE 3ZZBA 1P11E 1GMCF 3PMJA 1P2KA 1UVSH 2VWMA 1EP5A 4A92A 1P2IA 4XBCA 1D3QB 3NK8A 1HAOH 2CGAA 2GZ8A 3SU2A 3QZQA 3RXLA 1MD8A 5E0JA 2ODPA 1IQJA 1G3CA 2HNTE 2FM2A 1DLEA 1Y3XA 2BQ6B 3M5MA 3ZVAA 1AGJA 4WXIA 2ILNA 3AAVA 4NCYA 2ZEBA 3F6UH 1O35A 4CHAC 3IG6B 2XXLA 3U98H 5DGJA 2O8TA 1EAXA 1ESTA 3KF2A 2C93B 1QA0A 1K1PA 4X6OA 3VXFH 4AYYB 2ZFTA 4CH8B 1C1RA 1KIGH 1XX9A 4Y11E 4Z0KA 3RU4T 2BVSH 3L3TA 2ZA5A 4NFEA 1KXFA 2CJIA 1BBRE 1EZQA 5AFYH 1FONA 1WTHD 2R9PA 2PSYA 4TY6A 1TPAE 1ZMJA 2FMJA 3LGIA 3HK6B 1A4WH 3M61U 1D4PB 1YKTA 5AHGH 3ZZ4A 5E0GA 1UK2A 1AUJA 3BIVH 1C2HA 1EASA 1QL7A 1SGFG 4AFSA 3SJKA 1GHBG 4J2YB 4AFZA 1DVAH 2FPZA 3RC4A 1A5HA 4CRCA 1A61H 1BTXA 3P8GA 1SVPA 1BHXB 2JKHA 1RIWC 1MCTA 1FV9A 1O5GH 2XBXA 1MTUA 1C1TA 1FPCH 1NRRH 1ZLRA 1HJAC 3EYDA 2FXRA 4UEHH 4NIWA 1TRMA 2RDLA 3LH3A 3E0PB 5F8XA 1MZDA 1O2IA 1BQYA 1JIRA 1A3BH 1J16A 1P10A 1H8DH 1W14U 4JMYA 4KTCA 1NS3A 3C1KA 1C4V2 2ZTYA 1GBCA 1TNHA 1C2KA 1DWEH 2P59A 3QUMP 3RLYH 1XUGA 2B9LA 1DX5M 1H8IH 1J14A 3UNSA 3KL6A 1TRYA 4H6SB 4YM9A 4MNYA 5IDKA 1BDAA 2FOMB 3UR6A 1FXYA 1W0YH 2RCEA 1CSOE 3NZIA 1V2PT 1XKAC 2FI3E 1HNEE 1NFWA 2PKAB 5EXLA 3BTWE 2VIDA 2HRVA 1HAHH 4LZ1H 3OU0A 1UK4A 1W3CA 5HYOA 2EEKA 1ZZZA 4ISLA 1H9HE 3F9FA 2PUXB 1YPHC 3EA8A 2W7SA 3F68H 1FY3A 3TJNA 2A2QH 4QT8C 3SI3H 3U1IB 2FOHA 2BDCA 1MTSA 2XCNA 2G4TA 1INCA 3V13A 1UK3A 4IW4E 3RUOA 4FUHA 1O31A 5DJ7A 2F9OA 2STBE 4WMDA 3RU4D 2DUCA 1V2UT 3VGCB 1EAIA 3SV6A 2Z9JA 1PPFE 1AVXA 3MH4A 1QRZA 4R0IA 3UUZA 7GCHG 4FUGA 1J17T 1SG8B 1Z6JH 2AFQB 1NESE 3Q3XA 8LPRA 1K9OE 2XBWA 3LDXH 1QBOA 3FZDA 1XVOA 3URCA 1FIWA 2OCVB 1ANBA 2DE8A 5TCCA 2NU2E 1KXEA 2G5VA 3O8CA 1KXBA 1ZGVA 1AWFH 1UTMA 5EG4A 3QX5H 4ABAA 1C1PA 4I8LA 1N6XA 3E6PH 1QURH 1TMUH 2R3UA 4Q80A 2D2DA 4MNWA 1O3MA 1ZR0A 2VGCC 5FHTA 1DXWA 2P3UB 3ZZ7A 2ZPQA 4ZKSU 1V2JT 3GY5A 3GDUA 2W3IA 5T6DA 1IQEA 3PO1B 3GYMA 4MNXA 3KQCA 1LHCH 3ODDA 3ZZAA 1BUIA 5C5NA 5DP8A 3LT3A 2OQUA 1NFXA 1EJNA 2M5TA 1N6YA 2PSXA 1UCYE 2AMQA 3TLOA 4MG3A 1MU6B 2P95A 1UCYK 2Q6FA 1E37B 4U32A 1C5LH 5SGAE 5LH8A 4CR9A 3EGKH 2BY7X 3QWCH 1FN8A 5DP7A 4AGJA 3K6ZA 4X6MA 2FOAA 1BMAA 1CBWC 1ZPCA 1Y59T 3RXDA 1KDQB 3A81A 3MH7A 1LVYA 3LOXA 3GCOA 3U69H 3R3GB 1SBWA 4ZMAH 3ZVBA 1SLWB 2STAE 1Z1IA 1HUTH 3GY7A 1SHHB 2BX3A 3GYLB 4NG9H 1MTWA 2ULLA 2XC4A 4HTCH 4NA8A 5T6FA 1TGBA 5C1XA 1EXFA 1YP9A 3PROA 4X0WU 1C5RA 4JYUH 2R3YA 1O2OA 4B73A 2FOEA 4TY7A 1VJAU 2CV3A 1O2JA 3KHVA 1NRPH 2ZCKP 6GCHF 4NIVA 1TMTH 1O5CB 2F9PA 2G00A 1KLJH 1OP8A 2J92A 1FAKH 3SJ9A 3W95A 1OXGA 1SQAA 2XBVA 1CGHA 1FMGA 1TRNA 2A5IA 4ZROA 1K22H 2ZGHA 3TNSA 4U2WA 1P2JA 2VJ1A 3LU9B 1V2TT 3K9XB 2Z9KA 2ZHWH 4K5ZA 2GD4B 3URDA 1VJ9U 1TB6H 2OXSA 1BMNH 1KLIH 2FTLE 3SGBE 2EI8A 2XW9A 1IAUA 3TK5A 1GBTA 5E8EH 3BV9B 4AFQA 2A1DB 1YPJH 2AYWA 4GUXA 4UFGH 2RA0A 4DVAU 1GI9B 1ABJH 1O2XA 2FI4E 1YM0A 3A7YA 5ETXA 4TWWA 4ZH8A 2W5EA 1V2MT 4X6NA 4K1EA 3RU4E 4GAWA 1B0FA 2Q6GA 3ZVCA 1DSTA 1JOUB 2VIWA 3SV7A 3SNDA 4B2CA 1QIXB 1C9TA 3E3TA 4ZXXH 3U1JB 4OS2A 1PPHE 2WV5A 1GI0A 3M7QA 3I78A 5EW2H 2SGEE 1RFNA 1TOCB 3ZZ3A 1HAXB 2BDGA 2QCYA 1TPSA 4X8SH 2JH5D 1ESBA 1EPTA 3HPTB 1UVOA 3UIRA 2B7DH 4FVDA 5FXLA 3P8FA 3MO9A 1L1JA 1CVWH 1Z7KA 3L6PA 5DG6A 4ZHMU 1S85A 4KKDA 4DCDA 1YC0A 3MU8A 5CHAC 3Q3KA 3M3SA 2VINA 2BQWB 4K8YA 1VCQA 5JB8S 2FWWA 3ZV8A 5BPEA 5C1YA 2K1QA 1SOTA 3MH6A 3SUGA 1AHTH 3ENSB 1C5UA 4X1RU 3VPKA 4YT7H 3M5OA 3MO3A 1WUNH 4D9RA 2HALA 1QB6A 1C2GA 3CS7A 5A09A 1CT2E 1QTFA 1O32A 1TA6A 1XUIA 2FZZA 5A8YA 1AE5A 2GDEH 3BEFB 1TNLA 2P3TB 1IQNA 3PLKA 3QTOH 1THPB 4O97A 6CHAB 2TGTA 1GI2A 3OY6U 1FQ3A 1P01A 4FUJA 3S0NA 1DSUA 4XSKU 4IC5A 1UO6A 1BBRH 4UFFH 1ETRH 2GDDA 2ZHQH 3FANA 3P8OA 3QGNB 4IC6A 3LGWA 4Y71A 2BZ6H 1C5QA 4YOJA 4XDEA 4GPGA 4ZUHA 3RMOH 2GZ9A 3MU0A 1BITA 4IGDA 3RXVA 2TIOA 1QBVH 1B0EA 1BRBE 3U8TH 3QDZB 4SGBE 4AFUA 1W2KH 1Z8JB 3HK3B 3WY8A 3K2UA 5HM9A 3TGIE 2J9NA 2H5CA 1H1BA 3H5CB 5ABWA 2Z7FE 3MOCA 4ZAEA 5EQRA 1NFYA 1O3JA 4WMFA 4JYTA 1TPPA 9LPRA 1O30A 1RTLA 5C2ZA 2WPKS 2QF3A 5A8XA 3T26A 1GJAB 1L1GA 3V7TA 2C8WB 1V2LT 1AB9C 3RMNH 4NIYA 4X8VH 5DPAA 5I25A 4DURA 1OOKB 2OTVA 1O2RA 4BTIB 3GDSA 1GG6B 3D23A 3BIUH 3P6ZB 2ZECA 4RKJB 5JYIA 1HAVA 1EAWA 4X1QU 1UHBB 3Q3YA 2PV9B 4X6PA 2GX4A 1DICA 3PB1E 4OS6A 1C5NH 1PPEE 4OS7A 1IQKA 1GBEA 5LGOA 1ETSH 1DUEA 3MMGA 5CMXH 2A4GA 5EPYA 1K28D 1UTQA 4I33A 3A7WA 3E91A 3QO6A 3EE0B 4ZKRU 4A1TA 2FS8A 5CE1A 5JBCS 4CRAA 1H4WA 5L6NH 1E36B 2O8MA 1MTNB 1SI5H 1NT1A 4MPUA 4MTBA 8KME2 1GGDC 1SGPE 1O2PA 1O3BA 4UDWH 2BD4A 1H9IE 3FP7E 5EQQA 1VGCB 3UY9A 1NFUA 1C5WB 1O3AA 2A45B 5A8ZA 1AQ7A 1EOJA 1C1SA 1G9IE 1QY6A 4NIXA 2BD5A 1ID5H 1GJBB 1ZJKA 2VIPA 1SQOA 2H9HA 3PWCA 1O3IA 1TGSZ 1ZHMA 1ZOMA 2OC1A 1ARBA 3SI4H 1MQ5A 3TK9A 4B75A 1P57B 4K1TA 4DT7B 3TGJE 1BHXF 2FX6A 2VWLA 3TGKE 1P8VC 2GTBA 3MO6A 2UUKB 1Y8TA 4WXVA 1QL9A 4JZDH 1P2MA 1V2ST 3RXQA 2I6QA 2WPIS 2BXTH 1SPJA 3TNTA 2FOBA 2QA9E 5C67A 2HVXA 5T6GA 3T27A 2QXIA 1FNIA 2A5AA 3T29A 5AFZH 1GBHA 1CGIE 3EQ0H 2ZNKH 1DPOA 4ESTE 1ELCA 1AMHA 1FLEE 2ZFSA 4YZUA 2CMYA 1CT4E 2AH4X 1NU9A 1TOMH 1SGYE 2BVRH 2P8OB 1Z71A 2WPLS 1PYTC 1D3DB 2A2XH 3TVJB 2D26C 1OWKA 2WPHS 2QF0A 3FP6E 1P9SA 7ESTE 1IQMA 1C5TA 4VGCC 1WCZA 2IOTA 1EJMA 3GISB 3GCTF 4CREA 1GCTB 1W11U 1FZZA 2PKAA 1O3NA 1NPMA 4HFPB 4INHA 1NTPA 1LKBA 4Q7XA 3A83A 1GVZA 3RXKA 1ELEE 1G36A 4BAHB 3TJVA 2J38A 5EOKA 1HJ9A 2I6SA 5FX6A 4A1XA 4MVNA 2VB0A 3SJ8A 1GBKA 1YLDA 2THFB 2ZPRA 3M5LA 4ABIA 1XUKA 4WJG2 1TQ7B 5J4SA 1EZUC 1TABE 3P70B 1A0JA 3PM3A 3T5FH 1AKSB 2PFEA 1GCDA 3TH3H 1KXDA 3A8CA 1S81A 2ALPA 3MNXA 2ZTZA 1LKAA 2AS9A 4WF8A 1Q3XA 3CS0A 3KCGH 1GHXH 3O8DA 3TU7H 1ZSKA 4KP0A 1LMWB 2F9BH 1G30B 1XMNB 1GBMA 1E0FD 4I31A 9ESTA 2GCHG 2A4QA 1BTPA 1V2NT 3UTUH 5EODA 1CGJE 2A4RA 5IYTA 5GCHF 3RXEA 4CRDA 2ZP0H 1O5BB 1S84A 3L33A 3S7KB 1ELDE 1TBZH 1P3EA 1EPTC 3V3MA 3RDZA 2TBSA 1AFQC 2ZO3H 3U9AH 4FUFA 3FAOA 2BLVA 1BJVA 5DP4A 4NSYA 4AORA 2BD9A 5DP5A 2B5TB 2AMPA 3SUDA 2H2ZA 1K1IA 1D3TB 3ZVEA 1XXDA 2GCHF 4YLUA 2YOLA 1UVTH 2VVVA 4Y6DA 2OC7A 4Y0ZE 1QHRB 2LPRA 1C9PA 1MAYA 4FU8A 1HDTH 3NPSA 3E8LA 3A7ZA 1GVLA 3RXAA 3SNAA 1VITH 4XOJA 4F4OC 2UWLA 1G3DA 2GCTB 1KDQA 2GMTC 1IHTH 2BTCE 5L30H 3BTHE 1AD8H 1C1VH 2ZU1A 2A7JA 4YESB 1GHYH 4NSVA 1SOZA 1YPHE 4FUDA 4BAOB 1LHFH 2PGBB 4DG4A 1U6QA 1TBQH 1A7SA 1BTWA 2HOBA 1UTJA 3ZZ5A 1IQIA 1KTTB 4ABBA 2F83A 1OX1A 1BTYA 3HGNA 4DIIH 1YYY1 2PHBA 2AIPA 1C4U2 1EQ9A 3S9BA 3MU5A 1GHAG 1SGIB 2PKSB 1D6WA 1CA0B 1TMBH 2ANWA 1DANH 1BMLA 4GVUA 4CR5A 1AE8H 3ZVGA 4DY7B 3BN9A 1S6HA 2FTMA 3NWUA 1HAPH 4Y7AA 3UNRA 1GJ5H 1O3EA 4A1VA 1W8BH 1F7ZA 3IWMA 1SLVB 1FJSA 3A8DA 3KIDU 4I8HA 1O2HA 3S69A 1GCTC 3V12A 2FX4A 3K6YA 3ZYEA 3PTBA 1G2MA 5E2OA 1DY9A 1TGTA 3GY3A 3S7HB 3KQEA 3P8NA 2P93A 1GWAA 1GHAF 1TNGA 1ANCA 2G81E 2HWLB 2ZU3A 1VCPA 4IS5A 1GMDF 1RS0A 3A85A 3RXHA 5K0HA 1MCVA 1TWXB 1LHGH 1YCPK 2Z9LA 1PPBH 4INLA 5GJ4B 1G3BA 1RXPA 2V6NA 3K65B 3GCHB 1Y5BT 1P0SH 2UWOA 4ZHLU 3SBKA 4IMQA 3E90B 2QV1A 4HGCA 1QCPA 1QGFA 4K3JA 1D3PB 1TQ0B 1OS8A 1SC8U 7LPRA 8ESTE 4ISNA 2A31A 2O8WA 2ALVA 1SQTA 2ANYA 3SV2H 2KAIA 3LC5A 4ISHH 5BRRE 1HPGA 1MD7A 1V2OT 1DUAA 5C3NA 1A3EH 2GV7A 1YPKH 3EAJA 1O5FH 3A8BA 2CF8H 4BXWA 6GCHG 4BAKB 1H9LB 3D49H 3AW0A 1KXAA 3MNCA 3GCNA 1LO6A 1CHGA 1PPZA 4WY3A 2HPPH 1VR1H 2C4FH 1T8LA 1HBTH 2UWPA 1XKBC 1QB9A 1UTPA 3A84A 4OGYA 4K69A 4Q7ZA 2BD8A 2QXHA 1WSSH 4FUIA 2W26A 1SGEE 4AYVB 2BMGB 3M37A 2VIQA 5A0AE 1DWBH 1MKXH 1N8OB 1A46H 1AY6H 5F8TA 1FY5A 3DHKH 1ESAA 1SSXA 1MBQA 1ELFA 1YCPM 4H4FA 3A88A 4MPXA 1FY1A 1GBLA 1NM6A 2BY9X 4J1YA 2F3CE 1TGNA 4CBOA 1K1NA 1T8MA 1GJCB 1QL8A 2ZFFH 4GSOA 2XYAA 4OGXA 4NA9H 1O3DA 1O33A 1Z8IB 3BTME 2GT7A 1BRAA 3OY5U 1O3OA 1EZXC 1UMAH 3A7VA 3F9HA 2XC5A 2SFAA 2QAAA 1HAIH 2H9TH 1LPGB 1Y5UT 3BTTE 2SGAA 3GDVA 2ZCLP 1TBRH 2GT8A 2IJOB 2V3OH 3JZ2B 1CU1A 1ZSJA 3TITA 2IPHA 5J4QA 1F92A 1SGTA 1BCUH 1WOFA 4ISIH 1GDUA 3BG4B 1PQ7A 2QXGA 2VH0A 4AGKA 4X1NU 4ABHA 2VWNA 4E7NA 2EC9H 1J8AA 2FOFA 3D65E 5FAHA 1YF4A 4I8GA 3MH5A 5JBAS 1C1QA 2BHGA 3LKWA 4KTSA 1E38B 1JRSA 2BD7A 2ZQ2A 2V3HH 3TH2H 1GJ8B 2ZGXH 2Q1JA 2XWBI 1NC6A 1FAXA 2AGIX 5DKMA 2Z3EA 1S83A 2OBOA 4XE4A 3BTEE 3UFAA 3PMAB 1WQSA 3B23B 2ZGCA 1EUFA 2ZHEH 1ZRBA 3R0FA 2EA3A 3VGCC 1AVWA 5DP3A 4CRFA 1PPCE 4GHTA 3BEUA 3I77A 1FPHH 1UHBA 1Y3WA 1SL3A 3A82A 3RXCA 1GBAA 4THNH 2HNTF 4ABGA 2J4IA 1CO7E 1KLTA 3AW1A 2SGPE 1G32B 3PMBB 1C5XB 3AASA 3RXRA 3VXEH 4AN7A 2BY5X 1GHWH 3RC6A 1LHEH 1AUTC 1O3GA 6LPRA 3CENA 4ISOA 1LPKB 4LOYH 4F49A 4FVBA 3BF6H 3HKIB 2BDIA 1IQHA 2ZFQH 3BEIB 5FCKA 1HIAB 1SLUB 4E06H 3C27B 3QGJA 1FDPA 1ANDA 2PR3A 2XC0A 3MU4A 2ZKSA 3PO1C 4BTTB 4U01A 1HYLA 4DIHH 2DE9A 1KTSB 1C2FA 2ZG0H 1HRTH 5HM2A 4WH6A 4I8JA 2XRCA 3QZRA 4X8UH 1S6FA 1O39A 1N1LA 1BTZA 2ZI2H 1O2GH 4NGAH 1PYTD 4AOQA 3Q00A 2QY0B 1O2ZA 2BQ7B 2XBYA 1MZAA 2RA3A 1F2SE 4ZKNU 1BZXE 3TJUA 1QJ1B 2OQ5A 1QNJA 1K1JA 2WUCA 5LPFA 3ATLA 3HKJB 3S9CA 2VVUA 1P2NA 4D9QA 3RMLH 1MU8B 1ZGIA 3M7TA 1L2EA 2OBQA 1RTFB 1HV7A 3VB5A 4O03A 2JH6D 3AAUA 3SW2B 2WINI 2ZU5A 4HI3A 3BSQA 1Z1JA 4AZ2B 1F0TA 1OP2A 1N8OC 3A7XA 2WUBA 2ZDVH 1QRWA 3UNQA 2ZIQH 6ESTA 2JETB 3MWIU 2ZHFH 1EZSC 2QC2A 4XFQA 1RGQA 1G2LA 1TIOA 1NZQH 4UE7H 1MBMA 2G55A 2NU3E 5JB9S 5A0CA 4D8NA 1GI5A 4TWYA 1SFIA 1QJ6B 4ABJA 2BDHA 1Z8RA 3TH4H 1EX3A 1ELGA 1IQLA 4B76A 2H1UA 5AVDA 3ZVFA 1DDJA 3MYWA 3PV4A 3B8JA 1OWIA 5DO4H 1GL1A 3ODFA 1GJ9B 1YPMH 4FUCA 4E05H 2R2WU 4YTAA 3A80A 4ABDA 1NY22 1QA7A 1A5GH 3BTQE 3VB4A 1O2VA 1YGCH 3MU1A 5GXPA 3SUFA 3ZZ8A 4OS1A 5B6OA 1GI8B 1O38A 3QLPH 1DITH 1BRUP 2FO9A 1ZYOA 3I29A 1C1OA 1C5PA 1SFQB 3F1SB 1S0QA 3ATWA 2ZDLA 3P92A 3ZV9A 1SGQE 3VB7A 4Z6AH 1AKSA 4UONA 1HFDA 2UUJB 3OX7U 2ZGBH 3KNXA 1O2UA 1SHYA 3SU0A 3TJOA 3GY2A 1DY8A 1RJXB 2ZF0H 2Y5GA 1D9IA 2BLWA 5HMAA 1YPGH 4NFFA 3M5NA 3ZVDA 2P94A 1BRCE 2VWOA 1PQ8A 1V2WT 1RIWB 4TPYA 2A5KA 2QN5T 1BMMH 2QIQA 5E2PA 3D62A 1OWEA 1LHDH 2WPJS 2NWNA 3T25A 2G51A 5GPIB 3LC3A 4AX9H 1HJAB 3A7TA 5L2YH 1DXPA 4CBNA 4D7FA 2F9VA 2Z9IA 4A6LA 4ZXYH 3SORA 1XM1A 1GI7B 3GCTG 1XUJA 4HZHA 3RXPA 1WQVH 2YNBA 1A2CH 5GIBA 3T62A 4WWYA 2BYAX 3HGPA 2XNIA 5EW1H 3SO3A 4E7RG 3V0XA 4MLFB 4O3UA 1GPZA 4H42U 4B71A 1O2QA 2O9QA 4Q2KA 1TALA 1QB1A 2TGDA 1F0UA 1TYNA 3PMHB 1MH0A 1O3KA 4ASHA 2OC8A 2CF9H 6CHAC 1FY4A 3QN7A 2OLGA 4AG1A 1ZMNA 3RM0H 1KY9A 1UCYH 4Y8YA 3RXFA 2BZAA 1HGTH 1A0LA 1GDNA 1O2KA 2FLRH 1P12E 3P95A 5K7RA 1KXCA 1K21H 5GCHG 1AN1E 1C1WH 1SGCA 4LXBH 1SR5C 1W7XH 4X8TH 2BVXH 1C4Y2 4IMZA 3UR9A 4AB8A 2P16A 1VITG 1O2TA 1TNJA 4GCHG 1DS2E 4CRBA 3FVFB 2FDAA 2D1JA 1SLXB 4BNRA 2ZHDA 1O2MA 1TONA 1HAVB 1OWJA 1SGDE 1LPZB 4KGAA 1LTOA 3BTDE 2BX4A 3E16B 3KGPA 1TX6A 4Y10E 2TGPZ 2XCFA 1GG6C 2CN0H 2VGCB 3M3TA 1Q2WA 1ACBE 1ZPZA 3LGVA 1O2WA 2BLOA 2J34A 1HAZB 3RXSA 4ZKOU 1LVMA 4FXGH 1G37A 3OSYA 2G8TA 3VB6A 4MPVA 2J2UA 3A86A 4PROA 1FUJA 1J9CH 2HNTC 1TPOA 2SGDE 1G3EA 1LQDB 2G52A 1VITF 1T4VH 1ZPBA 4GCHF 3RXUA 5JBTA 1BBRK 5E0HA 3RLWH 1DE7H 3TK6A 2A0QB 1BA8B 1L0ZA 4R8TB 4BXSA 2PGQB 1MTNC 5DK1A 2AGGX 3A87A 3Q76A 4GLYA 2OINA 3PTNA 2GP9B 3LGTA 3BTFE 2A32A 1FI8A 1S82A 2Q6DA 5FPSA 1MMJN 4BTUB 5FBIA 3RXGA 4CH2B 5T3HA 1VGCC 1Y3YA 1GBFA 2SGQE 1T31A 5FBEA 1CBWB 2ESTE 1TLDA 5I46H 1NO9H 2NU0E 4YOIA 3RXTA 3STIA 1MAXA 4U30A 2BY6X 4RKOB 1ARCA 4WVPE 2CXVA 5TCAA 3E1XB 2NU1E 3GOVB 1O5AB 5EU8A 2ZDNA 1O3CA 4ABFA 3GICB 2F9UA 3KQDA 1WV7H 1HJ8A 2R0LA 3UWIA 3B9FH 1JRTA 4A5TS 4JCNA 4JK6A 4LK4A 1T7CA 1EATA 3JZ1B 4MNVA 4Y0YE 2WYJA 2F91A 2Y7XA 1ZHRA 2BB4A 2G4UA 1F5KU 5HXFA 1GHBF 2ODYB 5PTPA 1SGFA 2ASUB 4NWKA 1ORFA 2B8OH 4YLQH 4NZLA 1C2IA 3ATKA 1C2DA 1GL0E 2H5DA 4JZEH 2WV4A 2ZWLH 1GMDG 4RSPA 3S9AA 2FESH 1DWCH 1GBJA 2B0FA 4Y76A 1V3XA 2P8OC 2OUAA 2ZZUH 5EQSA 1UTNA 1SGRE 3SOSA 2GVFA 4LZ4B 8GCHG 1V2QT 4UFDH 2VIVA 4Y79A 1AI8H 1KSNA 1TNKA 4FUEA 3MFJA 2ZDKA 1CHOG 2Y5HA 1P3CA 1C1NA 4YT6H 1MKWH 3TIUA 1HAGE 3UQOA 2AERH 1C1UH 1QR3E 7KMEH 2O8LA 1AFEH 4X1PU 2TGAA 2AMDA 1RRKA 4INKA 4K1SA 4DGJA 2C90B 1HAYB 2ZFPH 3MHWU 1OPHB 1P09A 4AB9A 3ATIA 3FP8E 3N7OA 2D8WA 2FOGA 4O9VA 1CE5A 1MTVA 5HGGA 1T32A 3SHAH 1KYNA 1RTKA 4JZFH 1K1MA 1O5EH 3GY8A 1WAYB 4Y8ZA 8GCHF 5JBBS 4I7YH 4GHQA 2VH6A 4K60A 4OS4A 1ZHPA 3Q77A 2PLXA 5EXMA 2ANKH 1CHOF 2WYGA 1P06A 1GHVH 3SV8A 4XBDA 4XBBA 2ZU2A 1QJ7B 2SGFE 2Y5FA 4O3TA 1PJPA 4BAMB 3ZZ6A 2NU4E 1OYQA 5CHAB 3DA9B 4FU7A 2Y81A 2ZU4A 4X1SU 1ZTLA 4X2WA 1C5OH 1OSSA 4D7GA 3KN2A 1Y3UA 1Z8GA 1NRSH 5A2MH 1HIAA 7GCHF 5FPYA 1THRH 3DFLA 1P03A 2BDAA 5H4IB 3EA9A 2QXJA 1ZTKA 3QTVH 3LGYA 4Y7BA 1UTOA 5FCRA 1C2MA 4B74A 1EP6A 3A8AA 3H7OA 2FYQA 1O2YA 3RM2H 1AVGH 3RMMH 4SGAE 1DM4B 3LJOA 3LJJA 3SU6A 2HGTH 2A7HA 1LQEA 1HXFH 1DFPA 4NWLA 5DP9A 1JIMA 3LH1A 3U8OH 1IQFA 1PQ5A 1GJ6A 1ZMLA 3NKKA 1K1OA 2CHAB 3RXMA 1P05A 3SNBA 4TPIZ 2HLCA 4IN1A 2QGRA 3PLBA 1P2QA 2Z9GA 4CRGA 1WBGB 3EDXB 3RXOA 3SJIA 1W10U 2FS9A 2GZ7A 1QFKH 2BD3A 2GCTC 4OS5A 2W7UA 2H9EH 2C3SA 1NROH 1O2NA 2Y82A 1W0ZU 2BOHB 1CT0E 3M3VA 2EI7A 4MPWA 1BJUA 1P04A 1TA2A 3UREA 2O8UA 3A89A 2WPMS 3GY4A 1ELBA 2FI5E 1GI6A 1VCWA 2AEIH 4K8BA 3BG8A 1SGNE 5F8ZA 1SMFE 1Y5AT 3LPRA 1P9UA 4IBLH 5LPRA 1ELTA 1C5VA 5LPEA 1Z6EA 1W7GH 3NUMA 3ESTA 2Y6TA 2ZPSA 1JWTA 2BD2A 1DOJA 3UPEA 2PKSC 1AB9B 1TAWA 1CA0C 1BTHH 1S5SA 1GVKB 4MDSA 1A1RA 3IITA 1E35B 1ZTJA 2FODA 4DOQA 1V2KT 1EJAA 5C1UA 2Z3CA 2ZCHP 1F5RA 1UVUH 2BM2A 4JK5A 4FU9A 4UFEH 3SNEA 1HXEH 5ESBA 1GJ4H 3M7UA 5JDUB 3DFJA 3SHCH 4YOGA 1JMOH 1BOQA 3RXIA 2FOCA 1NU7B 1TE0A 1GI4A 1DWDH 3LONA 2EI6A 3SNCA 3T28A 2P3FH 3P17H 1GDQA 4X2VA 1GGDB 3LGUA 1IQGA 1O3HA 3BTGE 3ITIA 3AVZA 1QBNA 2AIQA 3NXPA 1NN6A 1BTUA 1PQAA 1OYTH 3ATMA 1YPEH 3UOPA 2ODQA 1BT7A 3SGQE 1C5MD 2ZC9H 5G4BA 1O36A 2Y80A 1V6DA 3STJA 3GCHC 1XUHA 2KAIB 2G5NA 1HB0B 3ZZDA 3SU1A 2OC0A 2FEQH 3PWBA 3OTJE 1Q31A 2ZDAH 4WH8A 2Z6BD 1EB1H 1F0SA 2TRMA 3RXBA 1C5SA 1W13U 2VU8E 1A5IA 3SN8A 1ANEA 5EXNA 2PUQH 5A0BA 1AZ8A 1GBDA 2JH0D 3VB3A 4BOHA 1VZQH 3SQEE 3LIWA 1AWHB 1LVOA 2YNAA 3EA7A 3O8BA 1B7XB 2C8XB 2PW8H 1E34B 3DT0H 2W3KA 1O34A 5EGMA 1GHZA 1OP0A 2PTNA 3SUEA 2SNVA 1O3PB 2OP9A 1WU1A 1UVPA 1C2LA 5AF9H 3SU5A 2VIOA 1FIZA 4D76A 1OWDA 4JZ1A 4KELA 1TX7A 2H6MA 2IN2A 1MKWK 2QYIA 1THSH 4A7IB 2ZFRH 4BAQB 2F9NA 2ZQ1A 1AZZA 1F0RA 2C8ZB 1QQ4A 2GKVE 2XTTB 4FUBA 1NRQH 4VGCB 2CHAC 1ELAA 3UOUA 1O5DH 1P2OA 2Y7ZA 1QQUA 2XWAA 4X2XA 4BANB 2LNCA 1T8OA 5FPTA 1EB2A 1YPLH 2BDYA 2V35A 3FFGA 1P02A 3MI4A 1ZRKA 5DP6A 1L1NA 1EKBB 1CA8B 4KTUA 1O2SA 4NZQA 5F6MA 3CP7A 1RD3B 3SV9A 1TGCA 2A4OA 2SNWA 1O0DH 4JYVH 1MQ6A 4H6TA 2C8YB 2BOKA 1AU8A 2PWXA 4MQAA 3ELAH 3U8RH 4DJZB 1LDTT 4CHAB 3BG4C 1A0HB 3W94A 4B2BA 2J94A 1XVMA 3NCLA 3VFEA 2R0KA 1GI1A 2FLBH 3RXJA 2Z3DA 1AIXH 1K1LA 1YLCA 5C5OA 2OD3B 3MTYA 1M9UA 3PYHA 1HCGA 1L4DA 3DUXH 3DD2H 4RN6A 2VVCA 2A7CA 4NA7A 2R2MB 3ZZCA 1B5GH 1EOLA 1DT2A 1TNIA 1MKXK 1BIOA 1PFXC 2FYRA 4B1TA 3KQBA 3SQHE 1O3FA 1EAUA 1LVBA 1T4UH 2GV6A 1ELVA 1XUFA 1GMHG 1NRNH 1K2I1 3ZYDA 2ZDMA 3SU4A 3T2NA 3G01A 1ABIH 1C5YB 1EPTB 1AFQB 1FY8E 1Y3VA 2UUYA 1O37A 2Z94A 3VEQB 1ZSLA 3E0NB 3QK1A 4UD9H 2HPQH 2BLQA 3ZZ9A 1WTGH 2V0BA 4Y8XA 1WYKA 3H7TA 4TYDA 1IHSH 2TPIZ 1C1MA 1UTLM 1T8NA 1X7AC 1C2JA 1JBUH 1TFXA 1FN6A 2RG3A 4K2YA 4ZHAA 3GY6A 1GBBA 1UTKA 3MNSA 4WMEA 4X2YA 3SJOA 1C5ZB 5GDSH 3RC5A 1C2EA 3OYPA 3F9EA 1GMHF 5GWZA 1GBIA 1O3LA 2PTCE 2ZTXA 1CQQA 1IOEA 2GMTB 1LCYA 2ANMH 4B2AA 1S0RA
chains in the Genus database with same CATH superfamily
1OKXA 1YCPH 1UJ1A 4M7GA 1YBWA 1AO5A 2AGEX 5L2ZH 1J15A 3M35A 2ZGJA 2UUFB 1DLKB 3MNBA 3UQVA 2GGVB 1GMCG 4YO9A 1GI3A 1O2LA 3KEEA 5FX5A 4ABEA 1L4ZA 1HLTH 1BB0B 5EPNA 5C20A 1F5LA 2BY8X 2J95A 2KX4A 3PRDA 2WV9A 1XXFA 3RP2A 1D6RA 1GJDB 4JZIA 1V2VT 3UWJH 2VNTA 5ESTE 3SU3A 4I8KA 2BDBA 3F9GA 3FOAA 3TPIZ 5JPMH 3FZZA 1GJ7B 1TX8A 1MUEB 3SZNA 2FP7B 4AG2A 3SGAE 1W12U 2JETC 5F03A 3O8RA 3HATH 1V2RT 1JXPA 1OWHA 3M36A 3PLPA 4I32A 1ETTH 1SB1H 5TJXA 4DW2U 4Q7YA 1ZJDA 2BXUH 4IN2A 1QRXA 1PPGE 2FIRH 3BTKE 4B6EA 3ZZBA 1P11E 1GMCF 3PMJA 1P2KA 1UVSH 2VWMA 1EP5A 4A92A 1P2IA 4XBCA 2KCPA 1D3QB 3NK8A 1HAOH 2CGAA 2GZ8A 1NBME 3SU2A 3QZQA 3RXLA 1MD8A 5E0JA 2ODPA 1IQJA 1G3CA 5C0TA 2HNTE 2FM2A 1DLEA 5DN6D 1SKYE 1Y3XA 2BQ6B 3M5MA 3ZVAA 1AGJA 4WXIA 2ILNA 3AAVA 4NCYA 2ZEBA 3F6UH 1O35A 4CHAC 3IG6B 2XXLA 3U98H 4P02A 5DGJA 2O8TA 1EAXA 1ESTA 3KF2A 2C93B 3GS9A 1QA0A 1K1PA 4X6OA 3VXFH 4AYYB 2ZFTA 4CH8B 1C1RA 1KIGH 2W6JD 1XX9A 4Y11E 4Z0KA 3RU4T 2BVSH 3SYJA 3L3TA 2ZA5A 4NFEA 1KXFA 2CJIA 1BBRE 1EZQA 5AFYH 1FONA 1YLNA 1WTHD 2R9PA 2PSYA 4TY6A 4M9FA 1TPAE 1ZMJA 2FMJA 3LGIA 3HK6B 1A4WH 3M61U 1D4PB 1YKTA 5AHGH 3ZZ4A 5E0GA 1UK2A 1AUJA 3BIVH 1C2HA 1EASA 1QL7A 1SGFG 4AFSA 3SJKA 1GHBG 4J2YB 4AFZA 1DVAH 2FPZA 3RC4A 1A5HA 4CRCA 1A61H 1BTXA 3P8GA 1SVPA 3DSGA 1BHXB 2JKHA 1RIWC 1MCTA 3PRBA 1FV9A 1O5GH 2XBXA 1MTUA 1C1TA 1FPCH 1NRRH 1ZLRA 1HJAC 3EYDA 2FXRA 4UEHH 4NIWA 1TRMA 2RDLA 3LH3A 3E0PB 5F8XA 1MZDA 1O2IA 1BQYA 1JIRA 1A3BH 1J16A 1P10A 1H8DH 1W14U 4JMYA 4KTCA 1NS3A 3C1KA 1C4V2 2ZTYA 1GBCA 1TNHA 2YMSC 1C2KA 1DWEH 2P59A 3QUMP 3RLYH 1XUGA 2B9LA 1DX5M 1H8IH 1J14A 2KM0A 3KL6A 1TRYA 3UNSA 4H6SB 4YM9A 4MNYA 5IDKA 1BDAA 2FOMB 1QZ8A 3UR6A 1FXYA 1W0YH 2RCEA 1CSOE 3NZIA 1V2PT 1XKAC 2FI3E 1HNEE 1NFWA 2PKAB 5EXLA 3BTWE 2VIDA 2HRVA 1HAHH 4LZ1H 3OU0A 1UK4A 1W3CA 5HYOA 2EEKA 1ZZZA 3DSPA 4ISLA 1H9HE 3F9FA 2PUXB 1YPHC 3EA8A 2W7SA 3F68H 1FY3A 3TJNA 2A2QH 4QT8C 3SI3H 3U1IB 2FOHA 2BDCA 1MTSA 2XCNA 2G4TA 1INCA 3V13A 1UK3A 4IW4E 3RUOA 4FUHA 1O31A 5DJ7A 2F9OA 2STBE 4WMDA 3RU4D 5HIYA 2DUCA 1V2UT 3VGCB 1EAIA 3SV6A 2Z9JA 1PPFE 1AVXA 3MH4A 1QRZA 4R0IA 3UUZA 7GCHG 4FUGA 1J17T 1SG8B 1Z6JH 2AFQB 1NESE 3Q3XA 8LPRA 1K9OE 2XBWA 3LDXH 1QBOA 3FZDA 1XVOA 3URCA 1FIWA 2OCVB 1ANBA 2DE8A 5TCCA 5GNDA 2NU2E 1KXEA 2G5VA 3O8CA 1KXBA 1ZGVA 1AWFH 1UTMA 4TSFD 5EG4A 3QX5H 3KYFA 1C1PA 4ABAA 4I8LA 1N6XA 3E6PH 1QURH 1TMUH 2R3UA 4Q80A 2D2DA 4MNWA 1O3MA 1ZR0A 2VGCC 5FHTA 1DXWA 2P3UB 3ZZ7A 2ZPQA 4ZKSU 1V2JT 3GY5A 3GDUA 2W3IA 5T6DA 1IQEA 3PO1B 3GYMA 4MNXA 3KQCA 1LHCH 4XRNA 3ODDA 3ZZAA 1BUIA 5C5NA 2IJD1 5DP8A 4FETA 1W0KD 3LT3A 2OQUA 1NFXA 1EJNA 2M5TA 1N6YA 2PSXA 1UCYE 2AMQA 3TLOA 4MG3A 1MU6B 5C0UA 2P95A 1UCYK 2Q6FA 5C94A 1E37B 3PV5A 4U32A 3OEED 1C5LH 5SGAE 5LH8A 3DCLA 4CR9A 3EGKH 2BY7X 3QWCH 1FN8A 5DP7A 4AGJA 3K6ZA 4X6MA 2FOAA 1BMAA 1CBWC 1ZPCA 1Y59T 3RXDA 1KDQB 3A81A 3MH7A 1LVYA 4YXWD 3LOXA 3GCOA 3U69H 3R3GB 1SBWA 4ZMAH 3ZVBA 1SLWB 2STAE 3WWBA 1Z1IA 1HUTH 3GY7A 1SHHB 2BX3A 3GYLB 4NG9H 1MTWA 2ULLA 2XC4A 4HTCH 4NA8A 5T6FA 1TGBA 5C1XA 5IK2D 1EXFA 1YP9A 2QF4A 3PROA 1UW7A 4X0WU 1C5RA 4JYUH 2R3YA 1O2OA 4B73A 2FOEA 4TY7A 1VJAU 2CV3A 1O2JA 3KHVA 1NRPH 2ZCKP 6GCHF 4NIVA 1TMTH 1O5CB 2F9PA 2G00A 1KLJH 1OP8A 2J92A 1FAKH 2LP6A 5FL7D 3SJ9A 1OXGA 1SQAA 2JIZD 3W95A 2XBVA 1CGHA 1FMGA 1TRNA 2A5IA 4ZROA 1K22H 2ZGHA 3TNSA 4U2WA 1P2JA 2VJ1A 3LU9B 1V2TT 2KFWA 3K9XB 2Z9KA 2ZHWH 4K5ZA 2GD4B 3F0OA 1VJ9U 3URDA 1TB6H 2OXSA 1BMNH 1KLIH 2FTLE 3SGBE 2EI8A 2XW9A 1IAUA 3TK5A 1GBTA 5E8EH 3BV9B 4AFQA 2A1DB 1YPJH 2AYWA 4GUXA 4UFGH 2RA0A 4DVAU 1GI9B 4ACBA 1ABJH 1O2XA 2FI4E 1YM0A 3A7YA 5ETXA 4TWWA 4ZH8A 2W5EA 1V2MT 5C17A 4X6NA 4K1EA 3RU4E 4GAWA 1B0FA 2Q6GA 3ZVCA 1DSTA 1JOUB 2VIWA 3SV7A 3SNDA 4HG6A 4B2CA 1QIXB 1C9TA 3E3TA 4ZXXH 3U1JB 4OS2A 1PPHE 2WV5A 1GI0A 3M7QA 3I78A 5EW2H 2SGEE 1RFNA 1TOCB 3ZZ3A 1HAXB 2BDGA 2QCYA 1TPSA 4X8SH 2JH5D 2WZQA 1ESBA 1EPTA 3HPTB 1UVOA 3UIRA 2B7DH 4FVDA 5FXLA 3P8FA 3MO9A 1L1JA 1CVWH 1Z7KA 3L6PA 5DG6A 4ZHMU 1S85A 4KKDA 4DCDA 1YC0A 3MU8A 5CHAC 3Q3KA 4RI0A 3M3SA 2VINA 2BQWB 4K8YA 1VCQA 5JB8S 2FWWA 3ZV8A 5BPEA 5C1YA 2K1QA 1SOTA 3MH6A 3SUGA 1AHTH 3ENSB 1C5UA 4X1RU 3VPKA 4YT7H 3M5OA 3MO3A 1WUNH 4D9RA 2HALA 1QB6A 1C2GA 3CS7A 5A09A 1CT2E 1QTFA 1O32A 1TA6A 1XUIA 2FZZA 5A8YA 1AE5A 2GDEH 3BEFB 1TNLA 2P3TB 3WWFA 1IQNA 3PLKA 3QTOH 1THPB 4O97A 6CHAB 2TGTA 1GI2A 3OY6U 4I86A 1FQ3A 1P01A 4FUJA 3S0NA 1DSUA 4XSKU 4IC5A 1UO6A 1BBRH 4UFFH 1ETRH 2GDDA 2ZHQH 3FANA 3P8OA 3QGNB 4IC6A 3LGWA 4Y71A 2BZ6H 1C5QA 4YOJA 4XDEA 4GPGA 4ZUHA 2J98B 3RMOH 2GZ9A 3MU0A 1BITA 4IGDA 3RXVA 2TIOA 1QBVH 1B0EA 1BRBE 3U8TH 3QDZB 4SGBE 4AFUA 1W2KH 1Z8JB 3HK3B 3WY8A 3K2UA 5HM9A 3TGIE 2J9NA 2H5CA 1H1BA 3H5CB 5ABWA 3AK5A 2Z7FE 3MOCA 4ZAEA 5EQRA 1NFYA 1O3JA 4WMFA 4JYTA 1TPPA 9LPRA 1O30A 1RTLA 5C2ZA 2WPKS 2GJGA 2QF3A 5A8XA 3T26A 1GJAB 1L1GA 3V7TA 2EQNA 2C8WB 1V2LT 1AB9C 3RMNH 4NIYA 4X8VH 5DPAA 5I25A 4DURA 1OOKB 2OTVA 1O2RA 4BTIB 3GDSA 1GG6B 3D23A 3BIUH 3P6ZB 2ZECA 4RKJB 5JYIA 1HAVA 1EAWA 4X1QU 1UHBB 3Q3YA 2PV9B 4X6PA 2GX4A 1DICA 3PB1E 4OS6A 1C5NH 1PPEE 4OS7A 1IQKA 1GBEA 5LGOA 1ETSH 1DUEA 3MMGA 5CMXH 2A4GA 5EPYA 1K28D 1UTQA 4I33A 1KMHB 1H8ED 3A7WA 3E91A 2KZ4A 3QO6A 3EE0B 4ZKRU 4A1TA 2FS8A 5CE1A 5JBCS 4CRAA 1H4WA 5L6NH 1E36B 2O8MA 1MTNB 1SI5H 1NT1A 4MPUA 4MTBA 8KME2 1GGDC 1SGPE 1O2PA 1O3BA 4UDWH 2BD4A 1H9IE 3FP7E 5EQQA 1VGCB 3UY9A 1NFUA 1C5WB 2IPQX 2YMSD 1O3AA 2A45B 3SZEA 5A8ZA 1AQ7A 2K8IA 1EOJA 1C1SA 2CK3D 1G9IE 1QY6A 4NIXA 2BD5A 1ID5H 1GJBB 1ZJKA 2VIPA 1SQOA 2H9HA 3PWCA 1O3IA 1TGSZ 1ZHMA 1ZOMA 2OC1A 1ARBA 3SI4H 1MQ5A 3TK9A 4B75A 1P57B 4K1TA 4DT7B 3TGJE 1BHXF 2FX6A 2VWLA 3TGKE 1P8VC 3FO8D 2GTBA 3MO6A 2UUKB 1Y8TA 4WXVA 1QL9A 4JZDH 1P2MA 1V2ST 2EY4C 4Q4LA 3RXQA 2I6QA 2WPIS 2BXTH 1SPJA 3TNTA 2FOBA 2QA9E 5C67A 2HVXA 5T6GA 3T27A 2QXIA 1FNIA 2A5AA 3T29A 5AFZH 1GBHA 1CGIE 3EQ0H 2ZNKH 1DPOA 4ESTE 1ELCA 1AMHA 1FLEE 2ZFSA 4YZUA 2CMYA 1CT4E 2AH4X 1NU9A 1TOMH 2JDID 1SGYE 2BVRH 2L74A 2P8OB 1Z71A 2WPLS 1PYTC 1D3DB 2A2XH 3TVJB 2D26C 1OWKA 2WPHS 2QF0A 3FP6E 1P9SA 7ESTE 1IQMA 1C5TA 4VGCC 1WCZA 2IOTA 1EJMA 3GISB 3GCTF 4CREA 1GCTB 1W11U 1FZZA 2PKAA 1O3NA 1NPMA 4HFPB 4INHA 1NTPA 1LKBA 4Q7XA 3A83A 1GVZA 3DSOA 3RXKA 1ELEE 1G36A 4BAHB 3TJVA 2J38A 5EOKA 1HJ9A 2I6SA 5FX6A 4A1XA 4MVNA 2VB0A 3SJ8A 1GBKA 3FN8A 1YLDA 2THFB 2ZPRA 3M5LA 4ABIA 1XUKA 4WJG2 1TQ7B 5J4SA 1EZUC 1TABE 2L6OA 3P70B 1A0JA 3PM3A 3T5FH 1AKSB 2PFEA 1GCDA 3TH3H 1KXDA 3A8CA 1S81A 2ALPA 3MNXA 2ZTZA 1LKAA 2AS9A 4WF8A 1Q3XA 3CS0A 3KCGH 1GHXH 3O8DA 3TU7H 1ZSKA 3EE7A 4KP0A 1LMWB 2F9BH 1G30B 1XMNB 1GBMA 1E0FD 4I31A 9ESTA 2GCHG 2XNDD 2A4QA 1BTPA 1V2NT 3UTUH 5EODA 1CGJE 2A4RA 5IYTA 5GCHF 3RXEA 4CRDA 2ZP0H 1O5BB 1S84A 3L33A 3S7KB 1ELDE 1TBZH 1P3EA 1EPTC 3V3MA 3RDZA 2VBCA 2TBSA 1AFQC 2ZO3H 3U9AH 4FUFA 3FAOA 2BLVA 1BJVA 5DP4A 4NSYA 4AORA 2BD9A 5DP5A 2B5TB 2AMPA 3SUDA 2H2ZA 1K1IA 1D3TB 3ZVEA 1XXDA 2GCHF 4YLUA 2YOLA 1UVTH 2VVVA 4Y6DA 2OC7A 4Y0ZE 1QHRB 2LPRA 5T1VA 1C9PA 1MAYA 4FU8A 4ASUD 1HDTH 3NPSA 3E8LA 3A7ZA 1GVLA 3RXAA 3SNAA 1VITH 4XOJA 4F4OC 2UWLA 1G3DA 2GCTB 1KDQA 2GMTC 1IHTH 2BTCE 5L30H 3BTHE 1WDIA 1AD8H 1C1VH 2ZU1A 2A7JA 4YESB 1GHYH 4NSVA 1SOZA 1YPHE 4FUDA 4BAOB 3OE7D 1LHFH 2PGBB 4DG4A 1U6QA 1TBQH 1A7SA 1BTWA 2HOBA 1UTJA 3ZZ5A 1IQIA 4F48B 1KTTB 4ABBA 2F83A 1OX1A 1BTYA 3HGNA 4DIIH 1YYY1 2PHBA 2AIPA 2HVYB 1C4U2 1EQ9A 3S9BA 3MU5A 3N99A 1GHAG 1SGIB 2PKSB 1COWD 1D6WA 1CA0B 1TMBH 2ANWA 1DANH 2OK5A 1BMLA 4ACAA 4GVUA 4CR5A 1AE8H 3ZVGA 4DY7B 3BN9A 3F2HA 1S6HA 2FTMA 3NWUA 4F55A 1HAPH 4Y7AA 3UNRA 1GJ5H 1O3EA 4A1VA 1W8BH 1F7ZA 3IWMA 1SLVB 1FJSA 3A8DA 3KIDU 4I8HA 1O2HA 3S69A 1GCTC 3V12A 2FX4A 3K6YA 3ZYEA 3PTBA 1G2MA 5E2OA 1DY9A 1TGTA 3GY3A 3S7HB 3KQEA 3P8NA 2P93A 1GWAA 5EJ1A 1GHAF 1TNGA 1ANCA 2G81E 2HWLB 2ZU3A 1VCPA 4IS5A 1GMDF 1RS0A 3A85A 3RXHA 5K0HA 5KGOA 1MCVA 1TWXB 1LHGH 1YCPK 2Z9LA 1PPBH 4INLA 5GJ4B 1G3BA 1RXPA 2V6NA 3K65B 3GCHB 1Y5BT 1P0SH 2UWOA 4ZHLU 2J97A 3SBKA 4IMQA 3E90B 2QV1A 4HGCA 1QCPA 1QGFA 4K3JA 1D3PB 4AC9A 1TQ0B 1OS8A 1SC8U 7LPRA 8ESTE 5B6LA 4ISNA 2A31A 2O8WA 2ALVA 1SQTA 2ANYA 3SV2H 2KAIA 3LC5A 4XD7D 4ISHH 5BRRE 1HPGA 1MD7A 1V2OT 1DUAA 5C3NA 1A3EH 1E79D 2GV7A 1YPKH 3EAJA 1O5FH 3A8BA 2CF8H 4BXWA 6GCHG 4BAKB 1H9LB 3D49H 3AW0A 2V3MA 5HKKD 1KXAA 3MNCA 3GCNA 1LO6A 1CHGA 1PPZA 4WY3A 2HPPH 1VR1H 2C4FH 1T8LA 1HBTH 2UWPA 1XKBC 1QB9A 1UTPA 3A84A 4OGYA 4K69A 4Q7ZA 2BD8A 2QXHA 1WSSH 4FUIA 2W26A 1SGEE 4AYVB 2BMGB 3M37A 2VIQA 5A0AE 1DWBH 1MKXH 1N8OB 1A46H 1AY6H 5F8TA 1FY5A 3DHKH 1ESAA 1SSXA 1MBQA 1ELFA 1YCPM 4H4FA 3A88A 4MPXA 1FY1A 1GBLA 1NM6A 2BY9X 4J1YA 2F3CE 1TGNA 4CBOA 1K1NA 1T8MA 1GJCB 1QL8A 2ZFFH 4GSOA 3OAAD 2XYAA 4OGXA 4NA9H 1O3DA 1O33A 1Z8IB 3BTME 2GT7A 1BRAA 3OY5U 1O3OA 1EZXC 1UMAH 3A7VA 3F9HA 2XC5A 2QE7D 2SFAA 2QAAA 1HAIH 2H9TH 1LPGB 1Y5UT 3BTTE 2SGAA 3GDVA 2ZCLP 1TBRH 2GT8A 2IJOB 2V3OH 3JZ2B 1CU1A 1ZSJA 2J98A 3TITA 2IPHA 5J4QA 1F92A 1SGTA 1BCUH 1WOFA 4ISIH 1GDUA 3BG4B 1PQ7A 2QXGA 2VH0A 4AGKA 4X1NU 4ABHA 2VWNA 4E7NA 2EC9H 1J8AA 1K0HA 2FOFA 3D65E 5FAHA 1YF4A 4I8GA 3MH5A 5JBAS 1C1QA 2BHGA 3LKWA 4KTSA 1WXRA 1E38B 1JRSA 2BD7A 2ZQ2A 3NRLA 2V3HH 3TH2H 1GJ8B 2ZGXH 2Q1JA 2XWBI 1NC6A 1FAXA 2AGIX 5DKMA 2Z3EA 1S83A 2OBOA 4XE4A 3BTEE 3UFAA 3PMAB 1WQSA 3B23B 2ZGCA 1EUFA 2ZHEH 1ZRBA 3R0FA 2EA3A 3N7DA 1AVWA 5DP3A 3VGCC 4CRFA 1PPCE 4GHTA 3BEUA 3I77A 1FPHH 1UHBA 1Y3WA 1SL3A 3A82A 3RXCA 1GBAA 4THNH 2HNTF 4ABGA 2J4IA 1CO7E 1KLTA 3AW1A 2SGPE 1G32B 3PMBB 1C5XB 3AASA 3RXRA 3VXEH 4AN7A 2BY5X 1GHWH 3RC6A 1LHEH 1AUTC 1O3GA 6LPRA 3CENA 4ISOA 1LPKB 4LOYH 4F49A 4FVBA 3BF6H 3HKIB 2BDIA 1IQHA 2ZFQH 3BEIB 5FCKA 1HIAB 1SLUB 4E06H 3C27B 3QGJA 1FDPA 1ANDA 2PR3A 2XC0A 3MU4A 2ZKSA 3PO1C 4BTTB 4U01A 1HYLA 4DIHH 3F2FA 2DE9A 1KTSB 1C2FA 2ZG0H 1HRTH 5HM2A 4WH6A 4I8JA 5CDFE 2PP6A 2XRCA 3QZRA 4X8UH 1S6FA 1O39A 1N1LA 1BTZA 2ZI2H 1O2GH 4NGAH 1PYTD 4AOQA 3Q00A 2QY0B 1O2ZA 2BQ7B 2XBYA 1MZAA 2RA3A 1F2SE 4ZKNU 1BZXE 3TJUA 2W6ID 1QJ1B 3H09A 2OQ5A 1QNJA 1K1JA 2WUCA 5LPFA 3ATLA 3HKJB 3S9CA 2VVUA 1P2NA 4D9QA 5F53A 3RMLH 1MU8B 1ZGIA 3M7TA 1L2EA 2OBQA 1RTFB 1HV7A 3VB5A 4O03A 2JH6D 3AAUA 3SW2B 3KYGA 2WINI 2ZU5A 4HI3A 3BSQA 1Z1JA 4AZ2B 1F0TA 1OP2A 1N8OC 3A7XA 2WUBA 2ZDVH 1QRWA 3UNQA 2ZIQH 6ESTA 2JETB 3MWIU 2ZHFH 1EZSC 2QC2A 4XFQA 1RGQA 1G2LA 1TIOA 1NZQH 4UE7H 1MBMA 2G55A 2NU3E 5JB9S 5A0CA 4D8NA 1GI5A 4TWYA 1SFIA 1QJ6B 4ABJA 2BDHA 1Z8RA 3TH4H 1EX3A 1ELGA 1IQLA 4B76A 2H1UA 5AVDA 3ZVFA 1DDJA 3MYWA 3PV4A 3B8JA 3ZIAD 1OWIA 5DO4H 1GL1A 3ODFA 1GJ9B 1YPMH 4FUCA 4E05H 2R2WU 4YTAA 2M2AA 3A80A 4ABDA 1NY22 1QA7A 1A5GH 3BTQE 3VB4A 1O2VA 1YGCH 3MU1A 5GXPA 3SUFA 3ZZ8A 4OS1A 5B6OA 1GI8B 1O38A 3QLPH 1DITH 1BRUP 2FO9A 1ZYOA 3I29A 1C1OA 1C5PA 1SFQB 3F1SB 1S0QA 3ATWA 2ZDLA 3P92A 3ZV9A 1S6LA 1SGQE 3VB7A 4Z6AH 1AKSA 2K0QA 4RT0A 4UONA 1HFDA 2UUJB 3OX7U 2ZGBH 3KNXA 1O2UA 1SHYA 3SU0A 3TJOA 3GY2A 1DY8A 1RJXB 1E1RD 2ZF0H 2Y5GA 1D9IA 2BLWA 5HMAA 1YPGH 4OM9A 4NFFA 3M5NA 3KQ5A 3ZVDA 2P94A 1BRCE 2VWOA 1PQ8A 1V2WT 1RIWB 4TPYA 2A5KA 2QN5T 1BMMH 2QIQA 5E2PA 3D62A 1OWEA 1LHDH 2WPJS 2NWNA 3T25A 2G51A 5GPIB 3LC3A 4AX9H 1HJAB 3A7TA 2KCAA 5L2YH 1DXPA 4CBNA 4D7FA 2F9VA 3N7EA 2Z9IA 4A6LA 4ZXYH 3SORA 1XM1A 1GI7B 3GCTG 1XUJA 4HZHA 3RXPA 1WQVH 2YNBA 1A2CH 2YMSB 5GIBA 2J5UA 3T62A 4WWYA 2BYAX 3HGPA 2XNIA 5EW1H 3SO3A 4E7RG 3V0XA 4MLFB 1YY3A 4O3UA 1GPZA 4H42U 4B71A 4B6FA 1O2QA 2O9QA 4Q2KA 1TALA 1QB1A 2TGDA 1F0UA 1TYNA 3PMHB 1MH0A 1O3KA 4ASHA 2OC8A 2F4LA 2CF9H 6CHAC 1FY4A 3QN7A 2OLGA 1EFRD 4AG1A 1ZMNA 3RM0H 1KY9A 1UCYH 4Y8YA 3RXFA 1YWUA 2BZAA 1HGTH 1A0LA 1GDNA 1O2KA 2FLRH 1P12E 3P95A 5K7RA 1KXCA 1K21H 5GCHG 1AN1E 1C1WH 1SGCA 4LXBH 1SR5C 1W7XH 4X8TH 2BVXH 1C4Y2 4IMZA 3UR9A 4AB8A 2P16A 1VITG 1O2TA 1TNJA 4GCHG 1DS2E 4CRBA 3FVFB 2FDAA 2D1JA 2WHXA 1SLXB 2F43B 4BNRA 2ZHDA 3UAIC 1O2MA 1TONA 1HAVB 1OWJA 1SGDE 1LPZB 4KGAA 1LTOA 3BTDE 2BX4A 3E16B 3KGPA 1TX6A 4Y10E 2TGPZ 2XCFA 1GG6C 2CN0H 2VGCB 3M3TA 1Q2WA 1ACBE 1ZPZA 3LGVA 1O2WA 2BLOA 2J34A 1HAZB 3RXSA 4ZKOU 1LVMA 4FXGH 1G37A 3OSYA 2G8TA 3VB6A 4MPVA 2J2UA 3A86A 4PROA 1FUJA 1J9CH 2HNTC 1TPOA 2SGDE 1G3EA 1LQDB 2G52A 1VITF 1T4VH 1ZPBA 4GCHF 3RXUA 5JBTA 1BBRK 5E0HA 3RLWH 1DE7H 3TK6A 2A0QB 1BA8B 1L0ZA 4R8TB 4BXSA 2PGQB 1MTNC 4RT1A 5DK1A 2AGGX 3A87A 3Q76A 4GLYA 2OINA 3PTNA 2GP9B 3LGTA 3BTFE 2A32A 1FI8A 1S82A 2Q6DA 5FPSA 1MMJN 1W0JD 4BTUB 5FBIA 2HLDD 3RXGA 4CH2B 5T3HA 1VGCC 1Y3YA 1GBFA 2SGQE 1T31A 5FBEA 1CBWB 2ESTE 1TLDA 5I46H 1NO9H 2NU0E 4YOIA 3RXTA 3STIA 1MAXA 4U30A 2BY6X 4RKOB 1ARCA 4WVPE 2CXVA 5TCAA 3UB0A 3E1XB 2NU1E 3GOVB 1O5AB 5EU8A 2ZDNA 1O3CA 3CNRA 4ABFA 3GICB 2F9UA 3KQDA 1WV7H 1HJ8A 2R0LA 3UWIA 3B9FH 1JRTA 4A5TS 4JCNA 4JK6A 4LK4A 5CHBA 1T7CA 1EATA 3JZ1B 2WSSD 4MNVA 4Y0YE 2WYJA 2F91A 2Y7XA 1ZHRA 2BB4A 2KCOA 2G4UA 1F5KU 4TT3D 5HXFA 1GHBF 2ODYB 5PTPA 1SGFA 2ASUB 4NWKA 1ORFA 2B8OH 4YLQH 4NZLA 1C2IA 3ATKA 1C2DA 1GL0E 2H5DA 4JZEH 2WV4A 2ZWLH 1GMDG 4RSPA 3S9AA 2FESH 1DWCH 1GBJA 2B0FA 4Y76A 1V3XA 2P8OC 2OUAA 2ZZUH 5EQSA 2KCYA 1UTNA 1SGRE 3SOSA 2GVFA 4LZ4B 8GCHG 1V2QT 4UFDH 2VIVA 4Y79A 1AI8H 1KSNA 1TNKA 4FUEA 3MFJA 2ZDKA 1CHOG 2Y5HA 1P3CA 1C1NA 4YT6H 1MKWH 3TIUA 1HAGE 3UQOA 2AERH 1C1UH 1QR3E 4Z1MD 7KMEH 2RFKC 2O8LA 1AFEH 3MQKC 4X1PU 2TGAA 2AMDA 1RRKA 2XOKD 4INKA 4K1SA 4DGJA 2C90B 1HAYB 2ZFPH 3MHWU 1OPHB 1P09A 4AB9A 3ATIA 2RDEA 3FP8E 3N7OA 2D8WA 2FOGA 4O9VA 1CE5A 1MTVA 5HGGA 1T32A 2JJ1D 3SHAH 1KYNA 1RTKA 4JZFH 1K1MA 1O5EH 3GY8A 1WAYB 4Y8ZA 8GCHF 5JBBS 4I7YH 4GHQA 1SQRA 2VH6A 4K60A 4OS4A 1ZHPA 3Q77A 2PLXA 5EXMA 2ANKH 1CHOF 2WYGA 1P06A 1GHVH 3SV8A 4XBDA 4XBBA 2ZU2A 1QJ7B 2SGFE 2Y5FA 4O3TA 1PJPA 2KR7A 3ZZ6A 4BAMB 2NU4E 1OYQA 5CHAB 3DA9B 4FU7A 2Y81A 2ZU4A 4X1SU 1ZTLA 4X2WA 1C5OH 1OSSA 4D7GA 3KN2A 1Y3UA 1Z8GA 1NRSH 5A2MH 1HIAA 7GCHF 5FPYA 4P00A 1THRH 1BMFD 3DFLA 1P03A 2BDAA 5H4IB 3EA9A 2QXJA 1ZTKA 3QTVH 3LGYA 4Y7BA 1UTOA 5FCRA 1C2MA 4B74A 1EP6A 3A8AA 3H7OA 2FYQA 1O2YA 3RM2H 1AVGH 3RMMH 4SGAE 1DM4B 3LJOA 3LJJA 3SU6A 2HGTH 2A7HA 1LQEA 1HXFH 1DFPA 4NWLA 5DP9A 1JIMA 3LH1A 3U8OH 1IQFA 1PQ5A 1GJ6A 1ZMLA 3NKKA 4DT4A 1K1OA 2CHAB 3RXMA 1P05A 3SNBA 4TPIZ 2HLCA 3OTPA 4IN1A 2QGRA 3PLBA 1P2QA 2Z9GA 4CRGA 1WBGB 3EDXB 3RXOA 3SJIA 1W10U 2FS9A 2GZ7A 1QFKH 3PV2A 2BD3A 2GCTC 4OS5A 2W7UA 2H9EH 2C3SA 1NROH 1O2NA 2Y82A 1W0ZU 2BOHB 1CT0E 3M3VA 2EI7A 4MPWA 1BJUA 1P04A 1TA2A 3UREA 2O8UA 3A89A 2WPMS 3GY4A 1ELBA 2FI5E 2LELA 1GI6A 1VCWA 5EJLA 2AEIH 4K8BA 3BG8A 1SGNE 5F8ZA 1SMFE 1Y5AT 3LPRA 1P9UA 4IBLH 5LPRA 1ELTA 1C5VA 5LPEA 1Z6EA 2WPDD 1W7GH 3NUMA 3ESTA 2Y6TA 2ZPSA 1JWTA 5KECA 2BD2A 1DOJA 3UPEA 2PKSC 1AB9B 1TAWA 1CA0C 1BTHH 1S5SA 1GVKB 4MDSA 1A1RA 3IITA 1E35B 1ZTJA 3F2GA 2FODA 4DOQA 1V2KT 1EJAA 5C1UA 2Z3CA 2ZCHP 1FX0B 1F5RA 1UVUH 2BM2A 4FOUC 4JK5A 3W1EA 4ZCNA 4FU9A 4UFEH 3SNEA 1HXEH 5ESBA 1GJ4H 3F3BA 3M7UA 5JDUB 3DFJA 3SHCH 4YOGA 1JMOH 1BOQA 3RXIA 2FOCA 5EIYA 1NU7B 1TE0A 1GI4A 1DWDH 3LONA 2EI6A 3SNCA 3T28A 2P3FH 3P17H 1GDQA 4X2VA 1GGDB 3VG8A 3FKSD 3LGUA 1IQGA 1O3HA 3BTGE 3ITIA 3AVZA 1QBNA 2AIQA 3NXPA 1NN6A 1BTUA 1PQAA 1OYTH 3ATMA 1YPEH 3UOPA 2ODQA 1BT7A 3SGQE 1C5MD 2ZC9H 5G4BA 1O36A 2Y80A 1V6DA 3STJA 3GCHC 1XUHA 2KAIB 2G5NA 1HB0B 3ZZDA 3SU1A 2OC0A 2FEQH 3PWBA 3OTJE 1Q31A 2ZDAH 4WH8A 2Z6BD 1EB1H 1F0SA 2TRMA 3RXBA 1C5SA 1W13U 2VU8E 1A5IA 3SN8A 1ANEA 5EXNA 2PUQH 5A0BA 1AZ8A 1GBDA 2JH0D 3VB3A 4BOHA 1VZQH 3SQEE 3LIWA 1AWHB 1LVOA 2YNAA 1H8HD 3EA7A 3O8BA 1E1QD 1B7XB 2C8XB 2PW8H 1E34B 3DT0H 2W3KA 1O34A 5EGMA 1GHZA 1OP0A 2PTNA 3SUEA 2SNVA 1O3PB 2OP9A 1WU1A 1UVPA 3U28C 1C2LA 3WW7A 5AF9H 3OFND 3SU5A 2VIOA 1FIZA 4D76A 1OWDA 4JZ1A 4KELA 1TX7A 2H6MA 2IN2A 1MKWK 2QYIA 1THSH 4A7IB 2ZFRH 4BAQB 2F9NA 2ZQ1A 1AZZA 5HIZA 1F0RA 2C8ZB 1QQ4A 2GKVE 2XTTB 4FUBA 1NRQH 4VGCB 2CHAC 1ELAA 3UOUA 1O5DH 1P2OA 2Y7ZA 1QQUA 2XWAA 4X2XA 4BANB 2LNCA 1T8OA 4Q63A 5FPTA 1EB2A 1YPLH 2BDYA 2V35A 3FFGA 1P02A 3MI4A 1ZRKA 5DP6A 1L1NA 1EKBB 1CA8B 4KTUA 1O2SA 4NZQA 5F6MA 3CP7A 1RD3B 3SV9A 1TGCA 2A4OA 2SNWA 1O0DH 3F0PA 4JYVH 1MQ6A 4H6TA 1NBMD 2BOKA 2C8YB 1AU8A 2PWXA 4MQAA 5KEDA 3ELAH 3U8RH 4DJZB 1LDTT 4CHAB 3BG4C 1A0HB 3W94A 4B2BA 2J94A 1XVMA 3NCLA 3VFEA 2R0KA 1GI1A 2FLBH 3RXJA 2Z3DA 1AIXH 1K1LA 1YLCA 5C5OA 2OD3B 3MTYA 1M9UA 3PYHA 1HCGA 1L4DA 3DUXH 3DD2H 4RN6A 2VVCA 2A7CA 4NA7A 2R2MB 3ZZCA 1B5GH 1EOLA 1DT2A 1TNIA 2JJ2D 1MKXK 1BIOA 1PFXC 2FYRA 4B1TA 3KQBA 3SQHE 2AHME 1O3FA 1EAUA 1LVBA 1T4UH 2GV6A 1ELVA 1XUFA 1GMHG 1NRNH 1K2I1 3ZYDA 2ZDMA 3SU4A 3T2NA 3G01A 1ABIH 2V7QD 1C5YB 2QF5A 1EPTB 1AFQB 1FY8E 1Y3VA 2UUYA 1O37A 1OHHD 2Z94A 3VEQB 1ZSLA 3E0NB 1MABB 5EJZA 3QK1A 4UD9H 5DSFA 2HPQH 2BLQA 3ZZ9A 1WTGH 2V0BA 4Y8XA 1WYKA 1VKYA 3H7TA 3OEHD 4TYDA 1IHSH 2TPIZ 1C1MA 1UTLM 1T8NA 1X7AC 1C2JA 1JBUH 1TFXA 1FN6A 2RG3A 4K2YA 4ZHAA 3GY6A 1GBBA 1UTKA 3MNSA 4WMEA 4X2YA 3SJOA 1C5ZB 5GDSH 3RC5A 1C2EA 3OYPA 3F9EA 1GMHF 5GWZA 1GBIA 1O3LA 2PTCE 2ZTXA 1CQQA 1IOEA 2GMTB 1LCYA 2ANMH 4B2AA 1S0RA
chains in the Genus database with same CATH topology
1OKXA 1YCPH 1UJ1A 4M7GA 1YBWA 1AO5A 2AGEX 5L2ZH 1J15A 3M35A 2ZGJA 2UUFB 1DLKB 3MNBA 3UQVA 2GGVB 1GMCG 4YO9A 1GI3A 1O2LA 3KEEA 5FX5A 4ABEA 1L4ZA 1HLTH 1BB0B 5EPNA 5C20A 1F5LA 2BY8X 2J95A 1XXFA 3RP2A 1D6RA 1GJDB 4JZIA 1V2VT 3UWJH 2VNTA 5ESTE 3SU3A 4I8KA 2BDBA 3F9GA 5JPMH 3TPIZ 3FZZA 1GJ7B 1TX8A 1MUEB 3SZNA 2FP7B 4AG2A 3SGAE 1W12U 2JETC 5F03A 3O8RA 3HATH 1V2RT 1JXPA 1OWHA 3M36A 3PLPA 4I32A 1ETTH 1SB1H 5TJXA 4DW2U 4Q7YA 1ZJDA 2BXUH 4IN2A 1QRXA 1PPGE 2FIRH 3BTKE 3ZZBA 1P11E 1GMCF 3PMJA 1P2KA 1UVSH 2VWMA 1EP5A 4A92A 1P2IA 4XBCA 1D3QB 3NK8A 1HAOH 2CGAA 2GZ8A 3SU2A 3QZQA 3RXLA 1MD8A 5E0JA 2ODPA 1IQJA 1G3CA 2HNTE 2FM2A 1DLEA 1Y3XA 2BQ6B 3M5MA 3ZVAA 1AGJA 4WXIA 2ILNA 3AAVA 4NCYA 2ZEBA 3F6UH 1O35A 4CHAC 3IG6B 2XXLA 3U98H 5DGJA 2O8TA 1EAXA 1ESTA 3KF2A 2C93B 1QA0A 1K1PA 4X6OA 3VXFH 4AYYB 2ZFTA 4CH8B 1C1RA 1KIGH 1XX9A 4Y11E 4Z0KA 3RU4T 2BVSH 3L3TA 2ZA5A 4NFEA 1KXFA 2CJIA 1BBRE 1EZQA 5AFYH 1FONA 1WTHD 2R9PA 2PSYA 4TY6A 1TPAE 1ZMJA 2FMJA 3LGIA 3HK6B 1A4WH 3M61U 1D4PB 1YKTA 5AHGH 3ZZ4A 5E0GA 1UK2A 1AUJA 3BIVH 1C2HA 1EASA 1QL7A 1SGFG 4AFSA 3SJKA 1GHBG 4J2YB 4AFZA 1DVAH 2FPZA 3RC4A 1A5HA 4CRCA 1A61H 1BTXA 3P8GA 1SVPA 1BHXB 2JKHA 1RIWC 1MCTA 1FV9A 1O5GH 2XBXA 1MTUA 1C1TA 1FPCH 1NRRH 1ZLRA 1HJAC 3EYDA 2FXRA 4UEHH 4NIWA 1TRMA 2RDLA 3LH3A 3E0PB 5F8XA 1MZDA 1O2IA 1BQYA 1JIRA 1A3BH 1J16A 1P10A 1H8DH 1W14U 4JMYA 4KTCA 1NS3A 3C1KA 1C4V2 2ZTYA 1GBCA 1TNHA 1C2KA 1DWEH 2P59A 3QUMP 3RLYH 1XUGA 2B9LA 1DX5M 1H8IH 1J14A 3UNSA 3KL6A 1TRYA 4H6SB 4YM9A 4MNYA 5IDKA 1BDAA 2FOMB 3UR6A 1FXYA 1W0YH 2RCEA 1CSOE 3NZIA 1V2PT 1XKAC 2FI3E 1HNEE 1NFWA 2PKAB 5EXLA 3BTWE 2VIDA 2HRVA 1HAHH 4LZ1H 3OU0A 1UK4A 1W3CA 5HYOA 2EEKA 1ZZZA 4ISLA 1H9HE 3F9FA 2PUXB 1YPHC 3EA8A 2W7SA 3F68H 1FY3A 3TJNA 2A2QH 4QT8C 3SI3H 3U1IB 2FOHA 2BDCA 1MTSA 2XCNA 2G4TA 1INCA 3V13A 1UK3A 4IW4E 3RUOA 4FUHA 1O31A 5DJ7A 2F9OA 2STBE 4WMDA 3RU4D 2DUCA 1V2UT 3VGCB 1EAIA 3SV6A 2Z9JA 1PPFE 1AVXA 3MH4A 1QRZA 4R0IA 3UUZA 7GCHG 4FUGA 1J17T 1SG8B 1Z6JH 2AFQB 1NESE 3Q3XA 8LPRA 1K9OE 2XBWA 3LDXH 1QBOA 3FZDA 1XVOA 3URCA 1FIWA 2OCVB 1ANBA 2DE8A 5TCCA 2NU2E 1KXEA 2G5VA 3O8CA 1KXBA 1ZGVA 1AWFH 1UTMA 5EG4A 3QX5H 4ABAA 1C1PA 4I8LA 1N6XA 3E6PH 1QURH 1TMUH 2R3UA 4Q80A 2D2DA 4MNWA 1O3MA 1ZR0A 2VGCC 5FHTA 1DXWA 2P3UB 3ZZ7A 2ZPQA 4ZKSU 1V2JT 3GY5A 3GDUA 2W3IA 5T6DA 1IQEA 3PO1B 3GYMA 4MNXA 3KQCA 1LHCH 3ODDA 3ZZAA 1BUIA 5C5NA 5DP8A 3LT3A 2OQUA 1NFXA 1EJNA 2M5TA 1N6YA 2PSXA 1UCYE 2AMQA 3TLOA 4MG3A 1MU6B 2P95A 1UCYK 2Q6FA 1E37B 4U32A 1C5LH 5SGAE 5LH8A 4CR9A 3EGKH 2BY7X 3QWCH 1FN8A 5DP7A 4AGJA 3K6ZA 4X6MA 2FOAA 1BMAA 1CBWC 1ZPCA 1Y59T 3RXDA 1KDQB 3A81A 3MH7A 1LVYA 3LOXA 3GCOA 3U69H 3R3GB 1SBWA 4ZMAH 3ZVBA 1SLWB 2STAE 1Z1IA 1HUTH 3GY7A 1SHHB 2BX3A 3GYLB 4NG9H 1MTWA 2ULLA 2XC4A 4HTCH 4NA8A 5T6FA 1TGBA 5C1XA 1EXFA 1YP9A 3PROA 4X0WU 1C5RA 4JYUH 2R3YA 1O2OA 4B73A 2FOEA 4TY7A 1VJAU 2CV3A 1O2JA 3KHVA 1NRPH 2ZCKP 6GCHF 4NIVA 1TMTH 1O5CB 2F9PA 2G00A 1KLJH 1OP8A 2J92A 1FAKH 3SJ9A 3W95A 1OXGA 1SQAA 2XBVA 1CGHA 1FMGA 1TRNA 2A5IA 4ZROA 1K22H 2ZGHA 3TNSA 4U2WA 1P2JA 2VJ1A 3LU9B 1V2TT 3K9XB 2Z9KA 2ZHWH 4K5ZA 2GD4B 3URDA 1VJ9U 1TB6H 2OXSA 1BMNH 1KLIH 2FTLE 3SGBE 2EI8A 2XW9A 1IAUA 3TK5A 1GBTA 5E8EH 3BV9B 4AFQA 2A1DB 1YPJH 2AYWA 4GUXA 4UFGH 2RA0A 4DVAU 1GI9B 1ABJH 1O2XA 2FI4E 1YM0A 3A7YA 5ETXA 4TWWA 4ZH8A 2W5EA 1V2MT 4X6NA 4K1EA 3RU4E 4GAWA 1B0FA 2Q6GA 3ZVCA 1DSTA 1JOUB 2VIWA 3SV7A 3SNDA 4B2CA 1QIXB 1C9TA 3E3TA 4ZXXH 3U1JB 4OS2A 1PPHE 2WV5A 1GI0A 3M7QA 3I78A 5EW2H 2SGEE 1RFNA 1TOCB 3ZZ3A 1HAXB 2BDGA 2QCYA 1TPSA 4X8SH 2JH5D 1ESBA 1EPTA 3HPTB 1UVOA 3UIRA 2B7DH 4FVDA 5FXLA 3P8FA 3MO9A 1L1JA 1CVWH 1Z7KA 3L6PA 5DG6A 4ZHMU 1S85A 4KKDA 4DCDA 1YC0A 3MU8A 5CHAC 3Q3KA 3M3SA 2VINA 2BQWB 4K8YA 1VCQA 5JB8S 2FWWA 3ZV8A 5BPEA 5C1YA 2K1QA 1SOTA 3MH6A 3SUGA 1AHTH 3ENSB 1C5UA 4X1RU 3VPKA 4YT7H 3M5OA 3MO3A 1WUNH 4D9RA 2HALA 1QB6A 1C2GA 3CS7A 5A09A 1CT2E 1QTFA 1O32A 1TA6A 1XUIA 2FZZA 5A8YA 1AE5A 2GDEH 3BEFB 1TNLA 2P3TB 1IQNA 3PLKA 3QTOH 1THPB 4O97A 6CHAB 2TGTA 1GI2A 3OY6U 1FQ3A 1P01A 4FUJA 3S0NA 1DSUA 4XSKU 4IC5A 1UO6A 1BBRH 4UFFH 1ETRH 2GDDA 2ZHQH 3FANA 3P8OA 3QGNB 4IC6A 3LGWA 4Y71A 2BZ6H 1C5QA 4YOJA 4XDEA 4GPGA 4ZUHA 3RMOH 2GZ9A 3MU0A 1BITA 4IGDA 3RXVA 2TIOA 1QBVH 1B0EA 1BRBE 3U8TH 3QDZB 4SGBE 4AFUA 1W2KH 1Z8JB 3HK3B 3WY8A 3K2UA 5HM9A 3TGIE 2J9NA 2H5CA 1H1BA 3H5CB 5ABWA 2Z7FE 3MOCA 4ZAEA 5EQRA 1NFYA 1O3JA 4WMFA 4JYTA 1TPPA 9LPRA 1O30A 1RTLA 5C2ZA 2WPKS 2QF3A 5A8XA 3T26A 1GJAB 1L1GA 3V7TA 2C8WB 1V2LT 1AB9C 3RMNH 4NIYA 4X8VH 5DPAA 5I25A 4DURA 1OOKB 2OTVA 1O2RA 4BTIB 3GDSA 1GG6B 3D23A 3BIUH 3P6ZB 2ZECA 4RKJB 5JYIA 1HAVA 1EAWA 4X1QU 1UHBB 3Q3YA 2PV9B 4X6PA 2GX4A 1DICA 3PB1E 4OS6A 1C5NH 1PPEE 4OS7A 1IQKA 1GBEA 5LGOA 1ETSH 1DUEA 3MMGA 5CMXH 2A4GA 5EPYA 1K28D 1UTQA 4I33A 3A7WA 3E91A 3QO6A 3EE0B 4ZKRU 4A1TA 2FS8A 5CE1A 5JBCS 4CRAA 1H4WA 5L6NH 1E36B 2O8MA 1MTNB 1SI5H 1NT1A 4MPUA 4MTBA 8KME2 1GGDC 1SGPE 1O2PA 1O3BA 4UDWH 2BD4A 1H9IE 3FP7E 5EQQA 1VGCB 3UY9A 1NFUA 1C5WB 1O3AA 2A45B 5A8ZA 1AQ7A 1EOJA 1C1SA 1G9IE 1QY6A 4NIXA 2BD5A 1ID5H 1GJBB 1ZJKA 2VIPA 1SQOA 2H9HA 3PWCA 1O3IA 1TGSZ 1ZHMA 1ZOMA 2OC1A 1ARBA 3SI4H 1MQ5A 3TK9A 4B75A 1P57B 4K1TA 4DT7B 3TGJE 1BHXF 2FX6A 2VWLA 3TGKE 1P8VC 2GTBA 3MO6A 2UUKB 1Y8TA 4WXVA 1QL9A 4JZDH 1P2MA 1V2ST 3RXQA 2I6QA 2WPIS 2BXTH 1SPJA 3TNTA 2FOBA 2QA9E 5C67A 2HVXA 5T6GA 3T27A 2QXIA 1FNIA 2A5AA 3T29A 5AFZH 1GBHA 1CGIE 3EQ0H 2ZNKH 1DPOA 4ESTE 1ELCA 1AMHA 1FLEE 2ZFSA 4YZUA 2CMYA 1CT4E 2AH4X 1NU9A 1TOMH 1SGYE 2BVRH 2P8OB 1Z71A 2WPLS 1PYTC 1D3DB 2A2XH 3TVJB 2D26C 1OWKA 2WPHS 2QF0A 3FP6E 1P9SA 7ESTE 1IQMA 1C5TA 4VGCC 1WCZA 2IOTA 1EJMA 3GISB 3GCTF 4CREA 1GCTB 1W11U 1FZZA 2PKAA 1O3NA 1NPMA 4HFPB 4INHA 1NTPA 1LKBA 4Q7XA 3A83A 1GVZA 3RXKA 1ELEE 1G36A 4BAHB 3TJVA 2J38A 5EOKA 1HJ9A 2I6SA 5FX6A 4A1XA 4MVNA 2VB0A 3SJ8A 1GBKA 1YLDA 2THFB 2ZPRA 3M5LA 4ABIA 1XUKA 4WJG2 1TQ7B 5J4SA 1EZUC 1TABE 3P70B 1A0JA 3PM3A 3T5FH 1AKSB 2PFEA 1GCDA 3TH3H 1KXDA 3A8CA 1S81A 2ALPA 3MNXA 2ZTZA 1LKAA 2AS9A 4WF8A 1Q3XA 3CS0A 3KCGH 1GHXH 3O8DA 3TU7H 1ZSKA 4KP0A 1LMWB 2F9BH 1G30B 1XMNB 1GBMA 1E0FD 4I31A 9ESTA 2GCHG 2A4QA 1BTPA 1V2NT 3UTUH 5EODA 1CGJE 2A4RA 5IYTA 5GCHF 3RXEA 4CRDA 2ZP0H 1O5BB 1S84A 3L33A 3S7KB 1ELDE 1TBZH 1P3EA 1EPTC 3V3MA 3RDZA 2TBSA 1AFQC 2ZO3H 3U9AH 4FUFA 3FAOA 2BLVA 1BJVA 5DP4A 4NSYA 4AORA 2BD9A 5DP5A 2B5TB 2AMPA 3SUDA 2H2ZA 1K1IA 1D3TB 3ZVEA 1XXDA 2GCHF 4YLUA 2YOLA 1UVTH 2VVVA 4Y6DA 2OC7A 4Y0ZE 1QHRB 2LPRA 1C9PA 1MAYA 4FU8A 1HDTH 3NPSA 3E8LA 3A7ZA 1GVLA 3RXAA 3SNAA 1VITH 4XOJA 4F4OC 2UWLA 1G3DA 2GCTB 1KDQA 2GMTC 1IHTH 2BTCE 5L30H 3BTHE 1AD8H 1C1VH 2ZU1A 2A7JA 4YESB 1GHYH 4NSVA 1SOZA 1YPHE 4FUDA 4BAOB 1LHFH 2PGBB 4DG4A 1U6QA 1TBQH 1A7SA 1BTWA 2HOBA 1UTJA 3ZZ5A 1IQIA 1KTTB 4ABBA 2F83A 1OX1A 1BTYA 3HGNA 4DIIH 1YYY1 2PHBA 2AIPA 1C4U2 1EQ9A 3S9BA 3MU5A 1GHAG 1SGIB 2PKSB 1D6WA 1CA0B 1TMBH 2ANWA 1DANH 1BMLA 4GVUA 4CR5A 1AE8H 3ZVGA 4DY7B 3BN9A 1S6HA 2FTMA 3NWUA 1HAPH 4Y7AA 3UNRA 1GJ5H 1O3EA 4A1VA 1W8BH 1F7ZA 3IWMA 1SLVB 1FJSA 3A8DA 3KIDU 4I8HA 1O2HA 3S69A 1GCTC 3V12A 2FX4A 3K6YA 3ZYEA 3PTBA 1G2MA 5E2OA 1DY9A 1TGTA 3GY3A 3S7HB 3KQEA 3P8NA 2P93A 1GWAA 1GHAF 1TNGA 1ANCA 2G81E 2HWLB 2ZU3A 1VCPA 4IS5A 1GMDF 1RS0A 3A85A 3RXHA 5K0HA 1MCVA 1TWXB 1LHGH 1YCPK 2Z9LA 1PPBH 4INLA 5GJ4B 1G3BA 1RXPA 2V6NA 3K65B 3GCHB 1Y5BT 1P0SH 2UWOA 4ZHLU 3SBKA 4IMQA 3E90B 2QV1A 4HGCA 1QCPA 1QGFA 4K3JA 1D3PB 1TQ0B 1OS8A 1SC8U 7LPRA 8ESTE 4ISNA 2A31A 2O8WA 2ALVA 1SQTA 2ANYA 3SV2H 2KAIA 3LC5A 4ISHH 5BRRE 1HPGA 1MD7A 1V2OT 1DUAA 5C3NA 1A3EH 2GV7A 1YPKH 3EAJA 1O5FH 3A8BA 2CF8H 4BXWA 6GCHG 4BAKB 1H9LB 3D49H 3AW0A 1KXAA 3MNCA 3GCNA 1LO6A 1CHGA 1PPZA 4WY3A 2HPPH 1VR1H 2C4FH 1T8LA 1HBTH 2UWPA 1XKBC 1QB9A 1UTPA 3A84A 4OGYA 4K69A 4Q7ZA 2BD8A 2QXHA 1WSSH 4FUIA 2W26A 1SGEE 4AYVB 2BMGB 3M37A 2VIQA 5A0AE 1DWBH 1MKXH 1N8OB 1A46H 1AY6H 5F8TA 1FY5A 3DHKH 1ESAA 1SSXA 1MBQA 1ELFA 1YCPM 4H4FA 3A88A 4MPXA 1FY1A 1GBLA 1NM6A 2BY9X 4J1YA 2F3CE 1TGNA