3PWCA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwcA02
3SU3A 1AVGH 5I25A 4XBBA 3SGQE 4KGAA 4BANB 2OCVB 2FLBH 5ESBA 2FOHA 1TGTA 5C3NA 1V2WT 1D3DB 3RXUA 3PMHB 4BTIB 2ZCHP 3RP2A 3LDXH 1V2LT 1T32A 3SU4A 1BITA 5EU8A 1FY1A 1EB2A 1FAKH 2HPQH 5A8XA 4XSKU 1T31A 5DG6A 3JZ1B 3PMBB 1O3OA 2QAAA 1BTPA 1GI3A 1S83A 3GY8A 4H6SB 1ETSH 4X2WA 2BM2A 1YPKH 6LPRA 1DITH 3TVJB 3DHKH 1GBAA 2ALVA 5GDSH 1O2PA 5LPRA 2NU3E 4MLFB 1Y59T 2ZZUH 4RN6A 1MU6B 4Z6AH 1P2QA 1IQEA 1EZSC 3O8RA 1O2XA 1YBWA 3GCHC 3P17H 4YOGA 1ZR0A 4GAWA 2CJIA 3K6YA 4YLUA 2QXJA 1O38A 3RC6A 1O3MA 4YT7H 3GY7A 3C27B 1GBCA 2GMTC 3AW1A 2SGPE 1S0RA 8KME2 1SGCA 1UTOA 1TYNA 1J16A 3NUMA 3VB6A 2AFQB 4X6OA 1DS2E 2SGAA 3BN9A 2BD9A 2G5VA 1JMOH 2HGTH 2Y5HA 1HUTH 5CHAC 2B8OH 2A2XH 4OGXA 1QL9A 1O32A 2OC8A 4OS5A 1Z8IB 3T25A 1UTPA 3ZZ5A 1SQOA 3A8BA 2WPIS 1CO7E 4AG1A 1EQ9A 3HATH 5JBTA 1HRTH 3MO6A 4THNH 1CHOF 2BZ6H 4MNXA 1DLKB 1BT7A 1K2I1 2B0FA 4AFQA 2Y81A 1SQAA 2ZHQH 1O2SA 5DP9A 2ZDVH 2FTLE 1UTQA 4I7YH 2Y80A 3SUFA 2FX6A 4WMFA 4CH2B 1FNIA 1E34B 3SQHE 2XTTB 3ZZ6A 1B0FA 3BTGE 3K9XB 2FEQH 1GBFA 3U1IB 1O2JA 1O33A 3SJOA 4SGBE 1H8DH 3SNCA 4CRGA 1C1NA 1NRRH 2J2UA 3RXMA 4BAKB 1YPHC 3UOPA 1W12U 1GVZA 2PKAA 1C4Y2 1MTNB 2STBE 3EAJA 5F6MA 3BG4B 4ZKNU 1QL7A 3SUGA 1W0YH 4WF8A 2H5CA 2XC5A 3PYHA 3RXVA 2BY6X 4MPWA 1FPHH 1YF4A 2PV9B 3JZ2B 1MD8A 3HK6B 1GHAF 1TA6A 2A7JA 2ZC9H 2ANKH 5C67A 5GWZA 1S5SA 1EJNA 3TJOA 2BXTH 2BD8A 3WY8A 1GMHF 4SGAE 1CA0B 1OWDA 3E6PH 4FU9A 4A92A 2ZDLA 1F5RA 1L0ZA 5JYIA 2PFEA 4HFPB 1D3QB 1HIAA 1ESBA 1GI5A 3HKIB 3ATKA 2VIVA 2OQ5A 3GICB 5F8XA 1Z8GA 2AERH 2C90B 5AFZH 1EAWA 2ZCKP 3SNDA 4AGJA 3SORA 3TLOA 1QRWA 1BZXE 1SC8U 2XNIA 3AW0A 4JZIA 3SV2H 2AGIX 1K1PA 3A84A 1MCTA 1U6QA 3FP6E 4ABHA 3GY5A 2CXVA 1TQ7B 1TX8A 2SGQE 5CE1A 1OP2A 5A09A 3AASA 3SN8A 3V0XA 3DUXH 3ZVCA 6ESTA 1QR3E 4AB8A 3U8RH 1LPKB 1ZTKA 1ELFA 2WV4A 4CBOA 1IQJA 1C2JA 4CR5A 3MMGA 1C5OH 4FUDA 1S82A 5EOKA 5DP6A 5CMXH 1MQ5A 4O3UA 4OS4A 4NZQA 5GCHF 2B5TB 1UVPA 3DFJA 4XBDA 4Y0YE 5C2ZA 1HXEH 2ZU3A 1V2VT 3T29A 4JMYA 3ATWA 1SGDE 3MNXA 4K1EA 5F8TA 3SNAA 1SOZA 2H2ZA 1H9IE 2FOEA 4Y6DA 1J17T 2A4RA 5K7RA 1TQ0B 3M7TA 4ZUHA 3RXIA 1Y5AT 3TH2H 1O5EH 4DOQA 1TNGA 1YPLH 4WWYA 2ZCLP 1A0LA 1X7AC 4CH8B 2I6QA 3GCOA 1SGNE 4WH6A 3LOXA 1QRZA 3LH1A 3GCHB 1NU7B 3L3TA 2AYWA 2BQWB 6CHAC 2GMTB 1W3CA 5EQQA 1QHRB 3DFLA 1BBRE 1P2OA 5FCRA 5IDKA 2A32A 4ISOA 4NGAH 4XBCA 4U32A 3A7ZA 4GVUA 1XM1A 1IQNA 3RLYH 2XCFA 3Q77A 1SR5C 1SQTA 3CENA 4ABEA 4R0IA 3V7TA 1RTFB 3LGVA 3O8DA 3M5MA 1C5PA 1NY22 5C1UA 5CHAB 1QNJA 4A7IB 1ZSJA 3TJVA 5B6OA 3M35A 1SGTA 1NROH 3TJUA 2PTNA 1ANDA 4NIWA 1XUIA 3OY6U 3T28A 3EQ0H 1V2JT 3HKJB 2EEKA 1SFQB 5EODA 1BTZA 2RA0A 1VGCC 2ZECA 1O0DH 5LPFA 2GKVE 3NZIA 5AVDA 2D2DA 1OWEA 1OXGA 1EOJA 5A0BA 1GJ7B 1OWHA 5GPIB 1ELDE 3D23A 1IQMA 3RMLH 2ZPRA 1O2RA 2M5TA 1BTWA 2A5IA 1EZQA 4D9RA 3E16B 3ESTA 1BTXA 2GT8A 1FQ3A 4O9VA 3TNSA 1CT0E 2OP9A 3E3TA 2Z7FE 3P8GA 4CRAA 5E0HA 1NFYA 2CHAB 4YLQH 1Q3XA 4Y79A 1IHSH 2G81E 2IPHA 1J14A 1Z6JH 2Z9IA 1C5MD 2ULLA 1GGDC 4OS2A 1XUHA 4CRCA 2BDIA 1ELTA 1TMUH 4I8HA 4A1VA 3FZZA 1PQ8A 1GHBG 3MO3A 1NFUA 4K5ZA 1GCDA 2Z94A 1CU1A 1GI4A 1MTSA 1Z71A 3BTKE 4NA9H 1HYLA 2R2MB 1BRBE 8LPRA 1ZLRA 2AGEX 4AG2A 1TNHA 3SGBE 1MH0A 5FBIA 2FIRH 1BTYA 1F92A 4FUGA 1C5LH 5BPEA 4YM9A 2H6MA 1C1MA 1L1NA 3QGNB 4X6PA 1A7SA 1KLTA 3M3VA 3S0NA 2QN5T 2BDCA 1K9OE 1QCPA 5EXNA 3NWUA 2FXRA 1O2IA 3MYWA 1LVMA 1D9IA 1Y8TA 3SV9A 1MD7A 1PQAA 4UDWH 1GG6C 1TRMA 1WQSA 1PPEE 4TWYA 1HAPH 1DUEA 1ELVA 2F83A 1TMBH 1ZGIA 3RU4T 1V2TT 1E37B 2W5EA 1VZQH 2G55A 1VJ9U 3K65B 4NWKA 2J95A 2BQ7B 2Z9GA 1PQ5A 1AWFH 2ZU2A 3RM2H 4YT6H 6GCHG 2QA9E 1Z8JB 1P11E 2QF0A 2AMQA 5ESTE 2QXGA 3LH3A 4BNRA 4DT7B 1AO5A 1O36A 1C1QA 4X8SH 1XKAC 1XVOA 2IN2A 2V6NA 3LIWA 1ANBA 4A6LA 1YC0A 2I6SA 3Q00A 2P8OC 4A5TS 2VWMA 1ZOMA 2FODA 2ANWA 1P0SH 1W0ZU 3K6ZA 1GBHA 5JBBS 1S6HA 4A1XA 3BIVH 4I32A 1P3EA 2PKAB 4F4OC 1C5XB 1GL1A 1GMDG 3ENSB 1HB0B 3SI3H 1VCPA 3MU5A 3TK9A 3BTQE 1AVWA 3H7OA 2YOLA 5LPEA 3U1JB 5EGMA 4ABBA 3ATMA 2R3UA 2XWBI 3NXPA 3MHWU 1GJ9B 1C4U2 1DXPA 4ABJA 5HMAA 3FAOA 1NRSH 6CHAB 2SNVA 3SU5A 3QLPH 4TWWA 1JWTA 1EKBB 2A2QH 3TITA 1YPMH 1EB1H 1UO6A 4ZXXH 2G8TA 1O2OA 1MKWH 5TCAA 2FI3E 2ZQ2A 2A4OA 4AFUA 4XDEA 1DE7H 1HIAB 1EP5A 3OYPA 2VJ1A 3OTJE 3SHAH 1TONA 3QO6A 2Y5GA 3RXKA 1V2MT 1NT1A 4ABAA 1F0SA 3V12A 2P93A 3SUEA 4MPUA 5T3HA 1CGJE 2GZ7A 3GDSA 3D65E 4FUCA 4HTCH 3PTNA 1V6DA 3RXJA 2ZGJA 4TY6A 5E0JA 1VGCB 4WXIA 2G51A 1MTVA 4K69A 3RXTA 1GBIA 1GI8B 3VB4A 1YP9A 3ELAH 4ZMAH 1GPZA 1IHTH 1O2GH 5FAHA 1C5UA 4HGCA 1M9UA 1CGIE 2ZFQH 2ZGHA 4AYVB 2FP7B 2P3UB 4R8TB 1W2KH 1CT4E 3A8CA 4X1RU 1C2MA 4D7FA 3RXLA 1LPGB 4X1NU 1QQUA 2VU8E 1ZYOA 3ATIA 1TB6H 4Q7ZA 3K2UA 3UUZA 3T26A 1DPOA 4X8TH 4H42U 3BV9B 1UTJA 1FJSA 3BSQA 2FM2A 1NRNH 5F8ZA 1GGDB 1ZRBA 1DLEA 3BTEE 2NU0E 1L2EA 1P3CA 1EATA 1ZPZA 2H9TH 1BA8B 2UUKB 3M5OA 3DA9B 1C2LA 1O31A 3MNBA 2ZEBA 1GHWH 1IQLA 1GI7B 1ANEA 1BMLA 1HBTH 2G5NA 2BDGA 2ZFTA 3M5NA 2GDDA 3U8OH 1C5SA 2A45B 1SG8B 2FWWA 2H5DA 1K28D 2F3CE 1J8AA 4JZFH 2PSYA 4IBLH 4PROA 2OBQA 2ZHEH 1ZMLA 3QN7A 2RDLA 4DY7B 1RTLA 1G30B 2WUCA 5EW1H 2ZTXA 1TNLA 3ZVEA 3A87A 1Y5UT 4FU7A 2UWPA 1W7GH 1CSOE 2FYRA 2IOTA 1MAYA 3BIUH 3RXHA 1GG6B 2CV3A 2UUYA 1QB1A 4JZEH 1BHXF 5G4BA 2ZTYA 1GHBF 2TGDA 2BY9X 1PPHE 1SSXA 2QF3A 1AKSA 2Y7ZA 2VGCC 2Y5FA 2ZFRH 3I29A 1HAIH 3MI4A 2JH6D 2BD3A 5FXLA 2VIOA 1DUAA 2VVVA 2AH4X 1P2KA 2Y7XA 4TY7A 5JBCS 1Z7KA 4MVNA 1SGEE 4JYUH 1C4V2 1O2TA 3LJJA 3PB1E 1GJCB 1BTUA 2P16A 2FESH 1C9TA 2P94A 4DG4A 2P8OB 2WUBA 1C2DA 4RKJB 1LTOA 2GV7A 2H9HA 3UTUH 3LJOA 1K21H 1UK2A 1UVSH 1G3BA 4AGKA 8ESTE 1AB9C 3BTHE 2BVSH 4GCHG 3EDXB 3B23B 3UNSA 1O39A 2J9NA 4X1QU 1A61H 3IWMA 1PYTD 2FYQA 4A1TA 4ESTE 1UCYH 4WH8A 3UFAA 2H9EH 1C2KA 3W95A 4Q80A 5E2OA 1TGNA 3LGTA 2ZIQH 2ODYB 2AGGX 3LT3A 4Y11E 6GCHF 1HAVA 2P3TB 4LXBH 1EAUA 1QIXB 1C2FA 1UVTH 9LPRA 1GI2A 1O5DH 1UHBA 1L4ZA 3F9GA 1BTHH 2FPZA 2TBSA 1C5YB 4BAMB 4Y8ZA 3RXAA 1Z6EA 2Z9KA 4ZKOU 1AFEH 4I8LA 1V2KT 4ISLA 1IQKA 1SLXB 2ALPA 3KIDU 2C93B 2QCYA 4E7RG 1JRSA 3A7TA 2VNTA 4ZHMU 1T8LA 2RG3A 2R9PA 1GMDF 1AD8H 4UONA 2A7HA 2BVXH 1O5BB 1QJ7B 1O34A 4UEHH 1PPFE 3RXEA 1QRXA 2BXUH 1XUKA 1IQGA 4X8VH 1PPCE 3SNBA 1RS0A 1UVOA 2ZPQA 2Y82A 1SL3A 4IS5A 1TX7A 4ZROA 1O2ZA 4KELA 1O3BA 1YGCH 1DANH 1ACBE 2OUAA 2XW9A 2TGPZ 3GDVA 2XBXA 3BTDE 1GJDB 3VXEH 4CBNA 3SBKA 1QY6A 4IN1A 3AVZA 1CA8B 1N6YA 1SVPA 1ABIH 2STAE 4GHTA 2CHAC 3IG6B 4ISHH 3LGYA 1AFQC 1YPJH 3BTTE 4D7GA 1GWAA 2AMDA 3RDZA 8GCHG 1GDNA 2UUJB 1CHGA 1HAGE 2J92A 1MU8B 1L1JA 3PWBA 3TGJE 5EQSA 2VIWA 2G4TA 1VR1H 3RU4E 2UUFB 1C2IA 3SJKA 3RXRA 2NU1E 1BMAA 1NPMA 1C2EA 3M5LA 1MAXA 4NG9H 2WPJS 4X8UH 5L30H 4I8GA 4ABFA 2BVRH 4OGYA 4LZ4B 3PM3A 2HPPH 3LKWA 4TPYA 5EPYA 4I8KA 1D6RA 1FMGA 1YKTA 1HAYB 2EA3A 3P8NA 3RXPA 3D49H 2FOCA 4JYVH 2FOMB 2FS8A 1UK4A 5C5OA 1BDAA 3MO9A 3ZZ7A 4NIVA 4Y0ZE 1A0JA 3KCGH 1NU9A 1TX6A 1GVKB 1P12E 2ZKSA 1KYNA 1NN6A 3UQVA 1HCGA 1GJAB 3MU8A 3OSYA 3V13A 4JK5A 3PROA 2B9LA 3TPIZ 3T2NA 3KGPA 3QWCH 2CN0H 5ABWA 1ARCA 2RA3A 1A0HB 3TNTA 3V3MA 5DKMA 5C5NA 3VB7A 3R0FA 2VGCB 2ZGXH 1AZ8A 3SV6A 2C8WB 2VB0A 1GVLA 3RC5A 2TPIZ 1DY8A 4IC5A 2VIPA 1GBLA 3U98H 2BY7X 2OC1A 3CS0A 2OTVA 1FY8E 3M3SA 1UTMA 1GBMA 4MNYA 1TMTH 2BX4A 3FANA 2J94A 1F7ZA 1TAWA 4LOYH 2VINA 2ZDMA 4ZHLU 2P95A 4FUEA 1AB9B 4B1TA 4BOHA 1SGIB 4Q2KA 2GVFA 5FPYA 1MUEB 3U8TH 3VPKA 2BLQA 5EXMA 2VH6A 3F9FA 3ODDA 1AZZA 4Y7BA 1HJAC 3UOUA 5AF9H 4X2YA 1O30A 1THPB 1BRCE 3M36A 2HNTE 1ZSLA 1P02A 2PGBB 3VB5A 5FHTA 1O3DA 2QV1A 3ZV8A 1H9HE 2GZ8A 1H1BA 1A5IA 2ZI2H 3SJIA 1A5GH 2V0BA 3R3GB 1O35A 4MG3A 2BDBA 2VWNA 1BHXB 3KN2A 5HGGA 2QGRA 3HK3B 5GJ4B 3ZVAA 4BXSA 4HI3A 4CRFA 5C20A 1H4WA 4GCHF 1A46H 1PYTC 1C1RA 1THRH 4VGCB 1EJMA 1OSSA 3TJNA 1MZAA 4KTCA 1N1LA 4GLYA 2GT7A 1KLJH 1BIOA 1KDQA 3SZNA 5JDUB 3N7OA 1GJ4H 1AKSB 5L2ZH 1MTWA 3TK5A 2Q1JA 1O3AA 4AZ2B 1BJVA 1DWCH 2FOGA 4D76A 3GY3A 4INHA 1EP6A 1DSUA 2W26A 1CVWH 4H4FA 1TRYA 2ASUB 1UTNA 2YNBA 3PV4A 4YO9A 1O2VA 7KMEH 1AFQB 3KEEA 1UMAH 1EXFA 1TA2A 3GYMA 3MH7A 2RCEA 2UWOA 2VIQA 3Q76A 1AUJA 3H5CB 4E06H 4OS1A 4GSOA 2NU2E 3TIUA 2XCNA 4O3TA 3A88A 1LVYA 2PWXA 1K22H 1HPGA 1TNIA 3MWIU 1O3KA 2GV6A 2GX4A 1QA7A 2HWLB 1GI1A 1KXEA 5DP4A 1SLUB 3HPTB 1P05A 1P10A 1YCPH 3E90B 1HAVB 2DE9A 4BTTB 1JOUB 2F9BH 3RXQA 2JETC 1MBMA 2DUCA 3A86A 1UHBB 1NC6A 2H1UA 1UTKA 4F49A 1G3EA 1ANCA 3VGCC 2GTBA 3SU6A 1PPGE 3QK1A 2WV5A 4CRBA 2JH5D 2F9NA 2FX4A 3LC5A 3GOVB 4ABIA 1C1TA 3RXDA 3QZQA 5T6FA 8GCHF 3HGPA 1K1LA 4AX9H 1GJ5H 2BD7A 1IQIA 2ZHFH 1AY6H 2SGEE 3B9FH 3F1SB 1XXFA 1DOJA 1V2PT 4IMZA 1RFNA 1LKAA 3QDZB 3QZRA 3SW2B 1GDQA 2V3OH 1IQHA 1ZMNA 1OP8A 2OXSA 3GYLB 1GCTC 2ZFFH 4I8JA 1C1PA 1O2WA 3T5FH 1DT2A 4I33A 4KKDA 5DK1A 5SGAE 3CP7A 3EA9A 2W3KA 2FO9A 1THSH 2Z3CA 4ZKSU 1XVMA 4HZHA 1RGQA 1LQEA 1LVBA 1EZUC 1S84A 1P9UA 4UE7H 2BLWA 3VEQB 2FI4E 4WMDA 3OX7U 4LK4A 3TU7H 5PTPA 2NWNA 3P8OA 1PJPA 4DJZB 1O2MA 1ZHRA 5TJXA 2ZPSA 3PLPA 2J34A 2ANMH 4YOIA 1BOQA 2OBOA 2W3IA 4NA8A 1G37A 1S6FA 1OYTH 3UREA 2OQUA 4OS7A 3A8DA 3F68H 3URDA 2GCTC 2Q6DA 2TGTA 4X0WU 3RXOA 1RD3B 2BDHA 4ZHAA 1HJAB 3EYDA 3EA7A 3TH3H 1YPHE 2O8LA 3SI4H 1EX3A 2BDAA 3QTOH 1GBBA 4UD9H 1YM0A 1GJBB 1DY9A 2BDYA 4AORA 2WPLS 1B7XB 2TIOA 3MNSA 2XC0A 1XUFA 1MCVA 5DP8A 2VWOA 5DP7A 1JIMA 3E1XB 1EAIA 1C2HA 2WPHS 1J15A 2AMPA 2OC7A 3BEIB 2BHGA 3KF2A 1FXYA 1FI8A 1BRAA 5EXLA 2QXIA 1K1JA 3PLBA 1ZTLA 5DP5A 1DM4B 3Q3KA 1V2OT 3MH5A 1SLWB 3BTME 4NSVA 5HYOA 1NZQH 1VCQA 2WINI 3DD2H 1P04A 3Q3XA 1GBJA 1N6XA 3OU0A 2PR3A 1WCZA 2O9QA 2ZTZA 4XOJA 1MKWK 5A0CA 2ZFSA 3QUMP 1A5HA 4Y76A 1O2HA 3BF6H 1A3BH 1O3JA 1K1MA 3M7QA 4WJG2 1OYQA 1PPZA 3SUDA 1O3GA 5TCCA 5JB9S 2BYAX 3O8CA 4TYDA 3AAUA 1O3HA 2O8UA 4CREA 1LHCH 1WQVH 1C1UH 1MZDA 1PQ7A 2WPMS 1XUJA 1HJ8A 3S7KB 2PW8H 4DIHH 2ZFPH 1RXPA 1IAUA 1ESAA 1NO9H 4X2VA 1TRNA 1W14U 3DT0H 1JBUH 1MKXH 3MH4A 1NS3A 1F2SE 2LPRA 1GBKA 3ZZ4A 1SGQE 1AWHB 1L1GA 1ETTH 5DP3A 4JZ1A 1ELEE 2C8XB 1ZHPA 3B8JA 3ZVBA 3UNQA 1ZSKA 4LZ1H 2Z3DA 3ZVFA 1ZTJA 2FZZA 2BD5A 2AS9A 2ILNA 1C5TA 2YNAA 4JYTA 1SB1H 1Q31A 5BRRE 3I77A 1KIGH 3VB3A 2JETB 1GMCG 1UTLM 1INCA 2OD3B 5EPNA 3T27A 1TFXA 4KTUA 2G52A 4FVDA 1HV7A 3VGCB 3ITIA 1D6WA 4NFEA 3MOCA 1TPAE 3UQOA 5JPMH 3ZZAA 2BY5X 4DURA 1E0FD 2O8MA 1V2UT 3S9AA 2FOFA 2HLCA 1GBTA 1FV9A 1O5CB 3ZZ3A 1H9LB 1VITG 3PO1C 2GDEH 4B71A 1CBWC 2O8TA 2PLXA 2JKHA 2V35A 2XBVA 3C1KA 3NPSA 5FX5A 1LKBA 4MDSA 1C5ZB 1J9CH 1KDQB 1GCTB 1C1WH 4YESB 1QJ1B 1MBQA 1AQ7A 2KAIA 2HOBA 2F9UA 1D3PB 3GY4A 1G32B 2C4FH 1FY3A 1LO6A 1SGYE 4UFGH 3ZZDA 5DJ7A 1OWKA 2ODQA 3A7XA 1W13U 1T4VH 3QTVH 1LHFH 1EJAA 1QL8A 3A7YA 4TPIZ 1WUNH 1NTPA 1MMJN 3LONA 1W11U 1Z1JA 1P57B 3RLWH 1T7CA 5EQRA 3P6ZB 1V2QT 1NFXA 1TBZH 3RXBA 3UWIA 3L33A 3KNXA 2R0LA 3MFJA 1ZGVA 1EPTA 1ZPCA 2B7DH 4ZAEA 2O8WA 2ZU1A 1DICA 2C8ZB 3BTWE 2A0QB 1EOLA 1GBEA 1O5GH 1C9PA 2GCTB 1VCWA 1OWJA 1A3EH 1GL0E 1HGTH 2QIQA 2PUXB 2PTCE 4Y8YA 1C5QA 1WAYB 3SO3A 1WBGB 1P2IA 1V2ST 3M61U 2AIQA 3P95A 3SU1A 1V3XA 1ORFA 4X2XA 2HALA 4NSYA 1WTHD 1PPBH 1N8OC 2J4IA 3M7UA 3GCTG 3A80A 4Y71A 3S9CA 1SOTA 1Q2WA 1YLDA 1LCYA 4RKOB 4ASHA 1G2LA 1SHHB 1UJ1A 3SJ9A 2GCHG 1ELCA 1GJ6A 3S9BA 1O5AB 3ZYEA 1TPSA 5JB8S 3SNEA 1K1IA 1UCYK 1ZMJA 4VGCC 2ZGBH 3GISB 3SU2A 3EA8A 4MNVA 2SFAA 3MU1A 4B73A 1E36B 1XXDA 5L2YH 1GI0A 2C8YB 1GBDA 1O3EA 5A8YA 5DO4H 1C5RA 1O3LA 3NCLA 4WVPE 4J1YA 1WYKA 2XWAA 3NKKA 1DVAH 3RXCA 1DWBH 1VJAU 2ANYA 4DGJA 2F9VA 2W7UA 1AMHA 1TWXB 1HAHH 1O3CA 4X1PU 4FVBA 5C1YA 3UR6A 2PSXA 4UFEH 4WXVA 1EUFA 4FUBA 2LNCA 2PKSB 5F03A 1C1VH 1FN8A 4IGDA 2A4GA 4B76A 1DDJA 3KHVA 3CS7A 2BX3A 2QYIA 5HXFA 4GHQA 1SFIA 1AI8H 1HDTH 3OY5U 3RXSA 2G4UA 1EPTC 1MTUA 1TBQH 4OS6A 1F0RA 3RXGA 2NU4E 1OOKB 4DCDA 3UPEA 1ZPBA 1TLDA 4Q7XA 1GJ8B 1TABE 1OS8A 3KQBA 2VH0A 4IN2A 4K3JA 2FTMA 4KP0A 4RSPA 3SHCH 1DXWA 4D8NA 2EI8A 4AOQA 2ZF0H 1MQ6A 3BEFB 1K1NA 3G01A 4X1SU 5T6DA 1QB9A 4XFQA 3A83A 1VITH 1FDPA 2ESTE 2ODPA 1QQ4A 2OC0A 4JZDH 3A8AA 2CGAA 3M3TA 4MPXA 1ESTA 3ATLA 1HAXB 4UFDH 1Y3VA 3F9EA 2BOHB 3SOSA 3GCNA 1GHXH 2A5AA 3ZZ8A 3RU4D 3S69A 4NZLA 1GI9B 1SGFG 4YTAA 1DWDH 1T4UH 2IJOB 2XBWA 2CMYA 4FUIA 4K1SA 1Y3YA 3ZYDA 1SI5H 1GDUA 3PO1B 1IQFA 1CBWB 2OLGA 2VVCA 2THFB 2Z6BD 1TNKA 2ZP0H 1DX5M 2Z3EA 3M37A 4B2AA 2R2WU 4WY3A 1LHGH 4U30A 4FUFA 2ZU4A 2BTCE 3RUOA 1WU1A 1KXAA 1GMCF 1P2MA 2ZNKH 3SJ8A 3RC4A 1O3PB 7GCHF 2DE8A 1Y3WA 1HNEE 1HFDA 4NIXA 4QT8C 1Y5BT 3TGIE 5FPTA 4D9QA 3LGWA 4H6TA 4YOJA 4M7GA 2F9PA 1P03A 2A7CA 4BXWA 2ZO3H 5K0HA 2ZGCA 1AN1E 1WV7H 3LGIA 2GGVB 3H7TA 1DSTA 4FUHA 3A7VA 1VITF 1O37A 1A1RA 1RJXB 3P8FA 2SGFE 2PGQB 1HLTH 1TNJA 3EE0B 1C1SA 4MTBA 4X6MA 4MQAA 2K1QA 2C3SA 3L6PA 3UR9A 1T8OA 1W8BH 4B2CA 1HAZB 5GXPA 1YPEH 1XX9A 1FLEE 2VVUA 2ZQ1A 1QBOA 4ZXYH 4DW2U 1KTTB 1G2MA 1LQDB 1LVOA 3ODFA 1LHDH 1HAOH 1QBVH 2XYAA 3RMMH 3QGJA 1T8NA 3RXFA 1N8OB 2R3YA 1QBNA 3LPRA 3AAVA 1BRUP 3BTFE 7LPRA 1C5VA 1RIWC 2F9OA 2BLOA 3LU9B 1XUGA 2AEIH 1GHVH 3ZZ9A 4IW4E 2Q6GA 5DGJA 2D8WA 3BEUA 1ELAA 1AE8H 4BAOB 1HXFH 2BB4A 2FOAA 2FS9A 2W7SA 3A82A 1P2NA 3MH6A 1O2KA 1S0QA 1K1OA 3U69H 1ABJH 3MU4A 1ZZZA 3KQEA 4MPVA 1KXFA 3A89A 1AE5A 1W10U 1QFKH 4UFFH 2HVXA 1RTKA 3ZVDA 4B75A 4FU8A 4U01A 1Y3XA 3E0NB 5FPSA 3STIA 2ZHDA 3P70B 1LMWB 1HJ9A 4NFFA 4B2BA 5LGOA 5AFYH 1UK3A 1Z8RA 5E8EH 2KAIB 4CRDA 3E0PB 3GCTF 3ZZBA 1G3DA 1KY9A 1KXBA 1O3NA 1BUIA 1O3FA 3MNCA 2GCHF 3GY6A 1GI6A 4Z0KA 4AN7A 1G9IE 1GHZA 1SBWA 5L6NH 5EG4A 1E38B 2ZU5A 4DVAU 1CQQA 1TOCB 1CE5A 1B5GH 1C5WB 1O2NA 1XKBC 1IOEA 1C2GA 1QTFA 1P2JA 1KSNA 1DWEH 3FP8E 1GHYH 1BJUA 2XRCA 3URCA 4K1TA 2TRMA 1SLVB 2SGDE 1EPTB 2ZDKA 4CHAC 1W7XH 5J4QA 1JIRA 1LPZB 1KLIH 2BY8X 2WPKS 5GIBA 1KXDA 5JBAS 2D26C 2BMGB 1V2RT 3UWJH 3ZV9A 4GUXA 3A85A 1G36A 4IC6A 3FFGA 3SV8A 3PMAB 2BD4A 4Y10E 4JCNA 3VXFH 3Q3YA 5HM2A 3TH4H 4BAQB 2J38A 1AHTH 4YZUA 4IMQA 1YYY1 1L4DA 1CGHA 2VIDA 2EI6A 1QJ6B 2FLRH 1YPGH 2TGAA 3KL6A 1FAXA 1P06A 3BG8A 4U2WA 1BBRH 3IITA 1A2CH 4E7NA 2GZ9A 3KQDA 3MU0A 5E0GA 1TGBA 4CR9A 1JXPA 2Y6TA 1YCPK 1FPCH 1D3TB 1JRTA 2G00A 1EASA 1Z1IA 4KTSA 5J4SA 4ABGA 1QB6A 2A5KA 2R0KA 3ZVGA 2ZHWH 1AUTC 2AIPA 1AVXA 3RM0H 1LDTT 3MTYA 5A2MH 1FUJA 3S7HB 1FN6A 1SGPE 2ZDNA 2P59A 5DPAA 1TOMH 5E2PA 3SU0A 1F0TA 4B74A 1BMMH 1NRPH 1WTGH 2P3FH 1SGFA 4AFZA 1QA0A 1BBRK 1KXCA 1TALA 4BTUB 4ISNA 5HM9A 1TPOA 3A81A 2EI7A 4O97A 4K2YA 3F9HA 1YCPM 4NIYA 4E05H 2VWLA 1ARBA 1PFXC 1OKXA 2A1DB 1LHEH 1BMNH 4MNWA 1O5FH 5A8ZA 2SNWA 5LH8A 2ZG0H 1P9SA 1F0UA 3TGKE 3PWCA 2XBYA 2QY0B 4FUJA 1ELGA 2BQ6B 3HGNA 2QXHA 3SGAE 1F5LA 1FIZA 3LGUA 2BD2A 3ZZCA 1CHOG 3RMOH 4INLA 1SPJA 1KTSB 1ELBA 1CT2E 1FIWA 1QGFA 2HNTF 2A4QA 4K60A 4K8BA 1ZJDA 1F5KU 2EC9H 1O2QA 1OWIA 3FVFB 1EZXC 1FZZA 1SGRE 1RIWB 3FZDA 4NCYA 3STJA 3E8LA 1ZHMA 1ZRKA 3VFEA 1OP0A 1TPPA 2FI5E 4ISIH 5ETXA 1BCUH 1A4WH 2F91A 2HRVA 2PHBA 3PLKA 5EW2H 4AB9A 3GDUA 4FXGH 4J2YB 4XE4A 2XXLA 4ABDA 1AIXH 1BQYA 5FX6A 4WMEA 1S81A 1SMFE 1NESE 1SHYA 5H4IB 2OINA 5C1XA 2PUQH 1NRQH 2UWLA 2ZA5A 1OX1A 1P01A 2QC2A 2CF8H 2JH0D 3KQCA 3GY2A 1O3IA 4Y7AA 4ZH8A 1AGJA 3PTBA 1P8VC 1YLCA 3P92A 1GHAG 2BOKA 2PKSC 1FY4A 4Q7YA 2Q6FA 3LC3A 1P09A 1T8MA 2Z9LA 1XMNB 1GMHG 1TGCA 2ZDAH 1G3CA 1O2LA 1FONA 1ID5H 3UY9A 3EGKH 2Z9JA 1QURH 5AHGH 2A31A 1TGSZ 1UCYE 1H8IH 1EAXA 1Y3UA 5FCKA 1WOFA 3TK6A 1O2YA 3W94A 4AYYB 1ETRH 4DIIH 5FBEA 3QX5H 2HNTC 1MTNC 3D62A 1D4PB 4CHAB 1RRKA 3BG4C 3NK8A 1FY5A 4I31A 2WYGA 1WSSH 4K8YA 3A7WA 1NM6A 2BZAA 9ESTA 3UIRA 1TE0A 1ZJKA 4O03A 3I78A 1DFPA 2D1JA 2FMJA 4NA7A 1MKXK 7GCHG 1TBRH 4GPGA 1S85A 1CA0C 2GP9B 4AFSA 1AU8A 1C1OA 4INKA 1TIOA 1BB0B 1V2NT 2V3HH 5GCHG 1UVUH 2CF9H 1C5NH 3U9AH 3F6UH 3O8BA 5IYTA 3UNRA 1E35B 5T6GA 5I46H 2BLVA 2GD4B 4Y8XA 2WYJA 3PMJA 4ZKRU 2FOBA 7ESTE 1NFWA 1O2UA 4X6NA 4BAHB 3RMNH 3SV7A 3SQEE 3FP7E 4NWLA 3E91A 1B0EA 4JK6A 2FDAA 5A0AE 1OPHB 2XC4A 2ZWLH 3T62A
chains in the Genus database with same CATH superfamily
3SU3A 1AVGH 5I25A 4XBBA 4Q63A 3SGQE 4KGAA 4BANB 2OCVB 2FLBH 5ESBA 2FOHA 1TGTA 5C3NA 1V2WT 1D3DB 3RXUA 3PMHB 4BTIB 2ZCHP 3RP2A 3LDXH 1V2LT 1T32A 3SU4A 1BITA 5EU8A 1FY1A 1EB2A 1FAKH 2HPQH 5A8XA 4XSKU 1T31A 5DG6A 3JZ1B 3PMBB 1O3OA 2QAAA 1BTPA 1GI3A 1S83A 3GY8A 4H6SB 1ETSH 4X2WA 2BM2A 1YPKH 6LPRA 1DITH 3TVJB 3DHKH 1GBAA 2ALVA 5GDSH 1O2PA 5LPRA 2NU3E 4MLFB 1Y59T 2ZZUH 4RN6A 1MU6B 4Z6AH 1P2QA 1IQEA 1EZSC 3O8RA 1O2XA 1YBWA 3GCHC 3P17H 4YOGA 1ZR0A 4GAWA 2CJIA 3K6YA 4YLUA 2QXJA 1O38A 3RC6A 1O3MA 4YT7H 3GY7A 3C27B 4ACBA 1GBCA 2GMTC 3AW1A 3WWBA 2SGPE 1S0RA 8KME2 1SGCA 1UTOA 1TYNA 1J16A 3NUMA 3VB6A 2AFQB 4X6OA 1DS2E 2SGAA 3BN9A 5EJLA 2BD9A 2G5VA 1JMOH 2HGTH 2Y5HA 1HUTH 5CHAC 2B8OH 2A2XH 2V7QD 4OGXA 1H8HD 1QL9A 1O32A 1E79D 2OC8A 4OS5A 1Z8IB 3T25A 1UTPA 3ZZ5A 1SQOA 3A8BA 2WPIS 1CO7E 4AG1A 1EQ9A 3HATH 5JBTA 1HRTH 3MO6A 4THNH 1CHOF 2BZ6H 4MNXA 1DLKB 1BT7A 1K2I1 2B0FA 4AFQA 2Y81A 1SQAA 2ZHQH 1O2SA 5DP9A 4ASUD 2ZDVH 2FTLE 1UTQA 3N7DA 4I7YH 2Y80A 3SUFA 2FX6A 4WMFA 4CH2B 1FNIA 1E34B 3SQHE 2XTTB 3FN8A 3ZZ6A 1B0FA 3BTGE 3K9XB 2FEQH 1GBFA 3U1IB 2KZ4A 1O2JA 1O33A 3SJOA 4SGBE 1H8DH 3SNCA 4CRGA 1C1NA 1NRRH 2J2UA 3RXMA 4BAKB 1YPHC 4P02A 3KYGA 3UOPA 1W12U 2KFWA 1GVZA 2PKAA 1C4Y2 1MTNB 2STBE 3EAJA 5F6MA 3BG4B 4ZKNU 1QL7A 3SUGA 1W0YH 3OAAD 4WF8A 2H5CA 2XC5A 3PYHA 3RXVA 2BY6X 4MPWA 1FPHH 1YF4A 2PV9B 3JZ2B 1MD8A 3HK6B 1GHAF 1TA6A 2A7JA 2ZC9H 2ANKH 5C67A 5GWZA 1S5SA 1EJNA 3TJOA 2BXTH 2BD8A 3WY8A 1GMHF 4SGAE 1CA0B 1OWDA 3E6PH 4FU9A 4A92A 2ZDLA 1F5RA 1L0ZA 5JYIA 2PFEA 4HFPB 1D3QB 1HIAA 1ESBA 1GI5A 3HKIB 4RT0A 3ATKA 2VIVA 2OQ5A 1YWUA 3GICB 5F8XA 1Z8GA 2AERH 2C90B 5AFZH 1EAWA 2ZCKP 3SNDA 4AGJA 3SORA 3TLOA 1QRWA 1BZXE 1SC8U 2XNIA 3AW0A 4JZIA 3OE7D 3SV2H 2AGIX 1K1PA 3A84A 1MCTA 1U6QA 3FP6E 4ABHA 3GY5A 2CXVA 1TQ7B 1TX8A 2SGQE 5CE1A 1OP2A 5A09A 3AASA 3SN8A 2JJ1D 3V0XA 3DUXH 3ZVCA 6ESTA 1QR3E 4AB8A 3U8RH 1LPKB 1ZTKA 4ZCNA 1ELFA 2WV4A 4CBOA 1IQJA 1C2JA 4CR5A 3MMGA 1C5OH 4FUDA 1S82A 5EOKA 5DP6A 5CMXH 1MQ5A 4O3UA 4OS4A 4NZQA 5GCHF 2B5TB 1UVPA 3DFJA 4XBDA 4Y0YE 5C2ZA 1HXEH 2ZU3A 1V2VT 3T29A 4JMYA 3ATWA 1SGDE 3MNXA 4K1EA 5F8TA 3SNAA 1SOZA 2H2ZA 1H9IE 2FOEA 4Y6DA 1NBME 1J17T 2A4RA 5K7RA 1TQ0B 3M7TA 4ZUHA 3RXIA 1Y5AT 3TH2H 1O5EH 4DOQA 1TNGA 1YPLH 4WWYA 2W6ID 2ZCLP 1A0LA 1X7AC 4CH8B 2I6QA 3GCOA 1SGNE 4WH6A 3LOXA 1QRZA 3LH1A 3GCHB 1NU7B 3L3TA 2AYWA 2BQWB 6CHAC 2GMTB 1W3CA 5EQQA 1QHRB 3DFLA 1BBRE 1P2OA 5FCRA 5IDKA 2A32A 4ISOA 4NGAH 4XBCA 4U32A 3A7ZA 4GVUA 1XM1A 1IQNA 3RLYH 2XCFA 3Q77A 1SR5C 1SQTA 3CENA 4ABEA 4R0IA 3V7TA 1RTFB 3LGVA 3O8DA 3M5MA 1C5PA 1NY22 5C1UA 5CHAB 1QNJA 4A7IB 1ZSJA 1NBMD 3TJVA 5B6OA 3M35A 1SGTA 1NROH 3TJUA 2PTNA 2HLDD 1ANDA 4NIWA 1XUIA 3OY6U 3T28A 3EQ0H 1V2JT 3HKJB 2EEKA 1SFQB 5EODA 1BTZA 2RA0A 1VGCC 2ZECA 1O0DH 5LPFA 2GKVE 3NZIA 5AVDA 2D2DA 1OWEA 1OXGA 1EOJA 5A0BA 1GJ7B 1OWHA 5GPIB 1ELDE 3D23A 1IQMA 3RMLH 2ZPRA 1O2RA 2M5TA 1BTWA 2A5IA 1EZQA 4D9RA 3E16B 3ESTA 1BTXA 2GT8A 1FQ3A 4O9VA 3TNSA 1CT0E 2OP9A 3E3TA 1EFRD 2Z7FE 3P8GA 4CRAA 5E0HA 1NFYA 2CHAB 4YLQH 1Q3XA 4Y79A 1IHSH 2G81E 2IPHA 1J14A 1Z6JH 2Z9IA 1C5MD 2ULLA 1GGDC 4OS2A 1XUHA 4CRCA 2BDIA 1ELTA 1TMUH 4I8HA 4A1VA 3FZZA 1PQ8A 1GHBG 3MO3A 1NFUA 4K5ZA 1GCDA 2Z94A 1CU1A 1GI4A 1MTSA 1Z71A 3BTKE 4NA9H 1HYLA 2R2MB 1BRBE 8LPRA 1ZLRA 2AGEX 4AG2A 1TNHA 3SGBE 1MH0A 5FBIA 2FIRH 1BTYA 2AHME 1F92A 4FUGA 1C5LH 5BPEA 5B6LA 3AK5A 4YM9A 2H6MA 1C1MA 3W1EA 1L1NA 3QGNB 4X6PA 1A7SA 1KLTA 3M3VA 3F2GA 3S0NA 2QN5T 3MQKC 2BDCA 1K9OE 1QCPA 5EXNA 4Q4LA 3NWUA 2FXRA 1O2IA 3MYWA 1LVMA 1D9IA 1Y8TA 3SV9A 1MD7A 1PQAA 4UDWH 1GG6C 5EJZA 1TRMA 1WQSA 1PPEE 4TWYA 1HAPH 1DUEA 1ELVA 2F83A 1TMBH 1ZGIA 1W0KD 3RU4T 1V2TT 1E37B 2W5EA 1VZQH 4DT4A 2G55A 1VJ9U 3K65B 4NWKA 2J95A 2BQ7B 2Z9GA 1PQ5A 1AWFH 2ZU2A 3RM2H 4YT6H 6GCHG 2QA9E 1Z8JB 1P11E 2QF0A 2AMQA 5ESTE 2QXGA 3LH3A 4BNRA 4DT7B 1AO5A 1O36A 1C1QA 4X8SH 1XKAC 1XVOA 2IN2A 2V6NA 3LIWA 1ANBA 4A6LA 3PRDA 1YC0A 2I6SA 3Q00A 2P8OC 4A5TS 2VWMA 1ZOMA 2FODA 2ANWA 4ACAA 1P0SH 1W0ZU 3K6ZA 1GBHA 5JBBS 1S6HA 4A1XA 3BIVH 4I32A 1P3EA 2PKAB 4F4OC 1C5XB 1GL1A 1GMDG 3ENSB 1HB0B 3SI3H 1VCPA 3MU5A 3TK9A 3BTQE 1AVWA 3H7OA 2YOLA 5LPEA 3U1JB 5EGMA 4ABBA 3ATMA 2R3UA 2XWBI 3NXPA 3MHWU 1GJ9B 1C4U2 1DXPA 4ABJA 5HMAA 3FAOA 1NRSH 6CHAB 2SNVA 3SU5A 3QLPH 4TWWA 1JWTA 1EKBB 2A2QH 3TITA 1YPMH 1EB1H 1UO6A 3SZEA 4ZXXH 2G8TA 1O2OA 1MKWH 5TCAA 2FI3E 2ZQ2A 2A4OA 4AFUA 4XDEA 1DE7H 1HIAB 1EP5A 3OYPA 2VJ1A 3OTJE 3SHAH 1TONA 1K0HA 2WSSD 5KEDA 3QO6A 2Y5GA 3RXKA 1V2MT 1NT1A 4ABAA 1F0SA 2JJ2D 3V12A 2P93A 3SUEA 4MPUA 5T3HA 1CGJE 4FOUC 2GZ7A 3DSPA 3GDSA 3D65E 4FUCA 4HTCH 3PTNA 1V6DA 3RXJA 2ZGJA 4TY6A 5E0JA 1VGCB 4WXIA 2G51A 1MTVA 2EY4C 4K69A 3RXTA 1GBIA 1GI8B 3VB4A 1YP9A 3ELAH 4ZMAH 1GPZA 1IHTH 1O2GH 5FAHA 3KYFA 1C5UA 4HGCA 1M9UA 1CGIE 2ZFQH 2ZGHA 4AYVB 2FP7B 2P3UB 4R8TB 1W2KH 1CT4E 3A8CA 4X1RU 3CNRA 1C2MA 4D7FA 3RXLA 1LPGB 4X1NU 4XD7D 1QQUA 2VU8E 1ZYOA 3ATIA 1TB6H 4Q7ZA 3K2UA 3UUZA 3T26A 1DPOA 4X8TH 4H42U 3BV9B 1UTJA 1FJSA 3BSQA 2FM2A 1NRNH 5F8ZA 1GGDB 1ZRBA 2IPQX 1DLEA 3BTEE 3OTPA 2NU0E 1L2EA 1P3CA 1EATA 1ZPZA 2H9TH 1BA8B 2UUKB 3M5OA 3DA9B 1C2LA 1O31A 2KX4A 2ZEBA 3MNBA 1GHWH 1IQLA 1YY3A 1GI7B 1ANEA 1BMLA 1HBTH 5IK2D 2G5NA 2BDGA 4YXWD 2ZFTA 3M5NA 2GDDA 3U8OH 1C5SA 2A45B 1SG8B 2FWWA 2H5DA 1K28D 2F3CE 1J8AA 4JZFH 2PSYA 4IBLH 4PROA 2OBQA 2ZHEH 1ZMLA 3QN7A 2RDLA 4DY7B 1RTLA 1G30B 2WUCA 5EW1H 2ZTXA 1TNLA 3ZVEA 3A87A 1Y5UT 4FU7A 2UWPA 1W7GH 1CSOE 2FYRA 2IOTA 1MAYA 3BIUH 3N99A 3RXHA 1GG6B 2CV3A 2UUYA 1QB1A 4JZEH 1BHXF 5G4BA 2ZTYA 1GHBF 2TGDA 2BY9X 1PPHE 1SSXA 2QF3A 1AKSA 2Y7ZA 2VGCC 2Y5FA 2ZFRH 3I29A 1HAIH 3MI4A 2JH6D 2BD3A 5FXLA 2VIOA 1DUAA 2VVVA 2AH4X 1P2KA 1QZ8A 2Y7XA 4TY7A 5JBCS 1Z7KA 4MVNA 3UB0A 1SGEE 4JYUH 1C4V2 1O2TA 3LJJA 3PB1E 1GJCB 1BTUA 2J97A 2P16A 2FESH 1C9TA 2P94A 4DG4A 2P8OB 2WUBA 1C2DA 4RKJB 1LTOA 2GV7A 2H9HA 3UTUH 3LJOA 3F3BA 1K21H 1UK2A 1UVSH 3FOAA 1G3BA 4AGKA 8ESTE 1AB9C 3BTHE 2BVSH 4GCHG 3EDXB 3B23B 3UNSA 1O39A 2J9NA 4X1QU 1A61H 3IWMA 1PYTD 2FYQA 4A1TA 4ESTE 1UCYH 4WH8A 3UFAA 2H9EH 1C2KA 3W95A 4Q80A 5E2OA 1TGNA 3LGTA 2ZIQH 2ODYB 2AGGX 3LT3A 4Y11E 6GCHF 1HAVA 2P3TB 4LXBH 1EAUA 2WHXA 1QIXB 1C2FA 1UVTH 2YMSD 9LPRA 1GI2A 1O5DH 1UHBA 1L4ZA 3F9GA 1BTHH 2FPZA 2TBSA 1C5YB 4BAMB 4Y8ZA 3PV2A 1Z6EA 3RXAA 2Z9KA 4ZKOU 1AFEH 3DSOA 4I8LA 1V2KT 3NRLA 4ISLA 1IQKA 1SLXB 2ALPA 3KIDU 2C93B 2QCYA 4E7RG 1JRSA 3A7TA 2VNTA 4ZHMU 1T8LA 2RG3A 2R9PA 1GMDF 1AD8H 4UONA 2A7HA 2BVXH 1O5BB 1QJ7B 1O34A 4UEHH 1PPFE 3RXEA 1QRXA 2BXUH 1XUKA 1IQGA 4X8VH 1PPCE 3SNBA 1RS0A 1UVOA 5HIZA 2ZPQA 2Y82A 1SL3A 4IS5A 1TX7A 4ZROA 1O2ZA 4KELA 1O3BA 1YGCH 1DANH 1ACBE 2OUAA 2XW9A 2TGPZ 3GDVA 2XBXA 3BTDE 1GJDB 3VXEH 4CBNA 3SBKA 1QY6A 4IN1A 3AVZA 1CA8B 1N6YA 1SVPA 1ABIH 2STAE 3H09A 4GHTA 2CHAC 2WPDD 3IG6B 4ISHH 3LGYA 1AFQC 1YPJH 3BTTE 4D7GA 1GWAA 2AMDA 3RDZA 8GCHG 1GDNA 2UUJB 1CHGA 1HAGE 2J92A 1MU8B 1L1JA 3PWBA 3TGJE 5EQSA 2VIWA 2G4TA 1VR1H 3RU4E 2UUFB 1C2IA 3SJKA 3RXRA 2NU1E 1BMAA 1NPMA 2KCYA 1C2EA 3M5LA 1MAXA 4NG9H 2KM0A 2WPJS 4X8UH 5L30H 4I8GA 4ABFA 2BVRH 4OGYA 4LZ4B 3PM3A 2HPPH 3LKWA 4TPYA 5EPYA 4I8KA 1D6RA 1FMGA 1YKTA 1HAYB 2EA3A 3P8NA 3RXPA 3D49H 2FOCA 4JYVH 2FOMB 2FS8A 1UK4A 5C5OA 1BDAA 3MO9A 3ZZ7A 4NIVA 4Y0ZE 1A0JA 3KCGH 4Z1MD 1NU9A 2IJD1 1TX6A 1GVKB 1P12E 2ZKSA 1KYNA 1NN6A 3UQVA 1HCGA 1GJAB 3MU8A 3OSYA 3V13A 4JK5A 3PROA 2B9LA 3TPIZ 1COWD 1S6LA 3T2NA 3KGPA 3QWCH 2CN0H 5ABWA 1ARCA 2RA3A 1A0HB 3TNTA 3V3MA 5DKMA 5C5NA 3VB7A 3F2HA 3R0FA 2VGCB 2ZGXH 1AZ8A 3SV6A 2C8WB 2VB0A 3ZIAD 1GVLA 3RC5A 2TPIZ 1DY8A 4IC5A 2VIPA 1GBLA 3U98H 2BY7X 2OC1A 3CS0A 2OTVA 1FY8E 3M3SA 1UTMA 1GBMA 4MNYA 1TMTH 2JDID 2BX4A 3FANA 2J94A 1F7ZA 1TAWA 4LOYH 2VINA 2ZDMA 4ZHLU 2P95A 4FUEA 1AB9B 4B1TA 4BOHA 1SGIB 4Q2KA 2GVFA 5FPYA 1MUEB 3U8TH 3VPKA 2BLQA 5EXMA 2VH6A 3F9FA 3ODDA 1AZZA 4Y7BA 1HJAC 4XRNA 3UOUA 5AF9H 4X2YA 1O30A 1THPB 1BRCE 3M36A 2HNTE 1ZSLA 1P02A 2PGBB 3OFND 3VB5A 5FHTA 1O3DA 2QV1A 3ZV8A 1H9HE 2GZ8A 1H1BA 1A5IA 2ZI2H 3SJIA 1A5GH 2V0BA 3R3GB 5HIYA 1O35A 4MG3A 2BDBA 5EIYA 2VWNA 1BHXB 3KN2A 4AC9A 5HGGA 2F4LA 2RDEA 2QGRA 3HK3B 5GJ4B 3ZVAA 4BXSA 4HI3A 4CRFA 5C20A 1H4WA 1BMFD 4GCHF 1A46H 1UW7A 1PYTC 1C1RA 1THRH 4VGCB 1EJMA 1OSSA 3TJNA 1MZAA 4KTCA 1N1LA 4GLYA 2GT7A 1KLJH 1BIOA 1KDQA 2M2AA 3SZNA 5JDUB 3N7OA 1GJ4H 1AKSB 5L2ZH 1MTWA 3TK5A 2Q1JA 1O3AA 4AZ2B 1BJVA 1DWCH 2FOGA 4D76A 3GY3A 4INHA 1EP6A 1DSUA 2W26A 1CVWH 4H4FA 5C0TA 1TRYA 2ASUB 1UTNA 2YNBA 3PV4A 4YO9A 1O2VA 7KMEH 1AFQB 3KEEA 1UMAH 1EXFA 1TA2A 3GYMA 3MH7A 2RCEA 2UWOA 2VIQA 3Q76A 1AUJA 3H5CB 4E06H 4OS1A 4GSOA 2NU2E 3TIUA 2XCNA 4O3TA 3A88A 2K8IA 1LVYA 2PWXA 1K22H 2J98A 1HPGA 1TNIA 3MWIU 1O3KA 2GV6A 2GX4A 1QA7A 2XOKD 2HWLB 1GI1A 1KXEA 5DP4A 1SLUB 3HPTB 1P05A 1P10A 1YCPH 3E90B 3F0OA 1HAVB 2DE9A 4BTTB 5C94A 1JOUB 2F9BH 1MABB 3RXQA 2JETC 1MBMA 2DUCA 3A86A 1UHBB 1NC6A 2H1UA 1UTKA 4F49A 2QE7D 1G3EA 1ANCA 3F2FA 3VGCC 2GTBA 3SU6A 1PPGE 3QK1A 2WV5A 2J5UA 4CRBA 2JH5D 3EE7A 2F9NA 2FX4A 3LC5A 3GOVB 4ABIA 1C1TA 3RXDA 3QZQA 5T6FA 8GCHF 3HGPA 1K1LA 4AX9H 1GJ5H 2BD7A 1IQIA 2ZHFH 1AY6H 2SGEE 3B9FH 3F1SB 1XXFA 1DOJA 1V2PT 4IMZA 1RFNA 1LKAA 3QDZB 3QZRA 3SW2B 1GDQA 2V3OH 1IQHA 1ZMNA 1OP8A 2OXSA 3GYLB 1GCTC 2ZFFH 4I8JA 1C1PA 1O2WA 3T5FH 1DT2A 4I33A 4KKDA 5DK1A 4RT1A 5CHBA 5SGAE 3CP7A 3EA9A 2W3KA 2FO9A 1THSH 1H8ED 2Z3CA 4ZKSU 1XVMA 4HZHA 1RGQA 4P00A 1LQEA 1LVBA 1EZUC 1S84A 1P9UA 4UE7H 2BLWA 3VEQB 2FI4E 4WMDA 3OX7U 4LK4A 3TU7H 5PTPA 2NWNA 3P8OA 1PJPA 4DJZB 1O2MA 1ZHRA 5TJXA 2ZPSA 3PLPA 2J34A 2ANMH 4YOIA 1BOQA 2OBOA 2W3IA 4NA8A 1G37A 5C0UA 1S6FA 1OYTH 3UREA 2OQUA 4OS7A 3A8DA 3F68H 3URDA 1WXRA 2GCTC 2Q6DA 2TGTA 4X0WU 3RXOA 1RD3B 2BDHA 2V3MA 4ZHAA 1HJAB 3EYDA 3EA7A 3TH3H 1YPHE 2O8LA 3SI4H 1EX3A 2BDAA 3QTOH 1GBBA 4UD9H 1YM0A 1GJBB 1DY9A 2BDYA 4AORA 2WPLS 1B7XB 2TIOA 3MNSA 2XC0A 1XUFA 1MCVA 5DP8A 2VWOA 5DP7A 1JIMA 4F55A 3E1XB 1EAIA 1C2HA 2WPHS 1J15A 2AMPA 4I86A 2OC7A 3BEIB 2BHGA 3KF2A 1FXYA 1FI8A 1BRAA 5EXLA 2QXIA 1K1JA 3PLBA 1ZTLA 5DP5A 1DM4B 3Q3KA 1V2OT 3MH5A 1SLWB 3BTME 4NSVA 5HYOA 1NZQH 1VCQA 2WINI 3DD2H 1P04A 3Q3XA 1GBJA 1N6XA 3OU0A 3UAIC 2PR3A 1WCZA 2O9QA 2ZTZA 4XOJA 1MKWK 5A0CA 2ZFSA 3QUMP 1A5HA 4Y76A 1O2HA 3BF6H 1A3BH 1O3JA 1K1MA 3M7QA 4WJG2 1OYQA 1PPZA 3SUDA 1O3GA 5KGOA 5TCCA 5JB9S 2BYAX 2F43B 3O8CA 4TYDA 3AAUA 1O3HA 2O8UA 4CREA 1LHCH 1WQVH 1C1UH 1MZDA 1PQ7A 2PP6A 4TSFD 2WPMS 1XUJA 1HJ8A 3S7KB 2PW8H 4DIHH 2ZFPH 1RXPA 1IAUA 1ESAA 1NO9H 4X2VA 1TRNA 1W14U 3DT0H 1JBUH 1MKXH 3MH4A 1NS3A 2WV9A 1F2SE 2LPRA 1GBKA 3ZZ4A 1SGQE 1AWHB 1L1GA 1E1QD 1ETTH 5DP3A 4JZ1A 1ELEE 2C8XB 1ZHPA 3B8JA 3ZVBA 3UNQA 1ZSKA 4LZ1H 2Z3DA 3ZVFA 1ZTJA 2FZZA 2BD5A 2AS9A 2ILNA 1C5TA 2YNAA 4JYTA 1SB1H 1Q31A 5BRRE 3I77A 1KIGH 1FX0B 3VB3A 2JETB 1GMCG 1UTLM 1INCA 2OD3B 2GJGA 5EPNA 3T27A 1TFXA 4KTUA 2G52A 4FVDA 1HV7A 2QF4A 3VGCB 3ITIA 1D6WA 4NFEA 3MOCA 1TPAE 3UQOA 5JPMH 3ZZAA 2BY5X 4DURA 1E0FD 2O8MA 2HVYB 1V2UT 3S9AA 2FOFA 2HLCA 1GBTA 1FV9A 1O5CB 3ZZ3A 1H9LB 1VITG 3PO1C 2GDEH 4B71A 1CBWC 2O8TA 2PLXA 2JKHA 2V35A 2XBVA 3C1KA 3NPSA 5DN6D 5FX5A 1LKBA 1WDIA 1C5ZB 4MDSA 1J9CH 1KDQB 1GCTB 1C1WH 4YESB 1QJ1B 1MBQA 1AQ7A 2KAIA 2HOBA 2F9UA 1D3PB 3GY4A 1G32B 2C4FH 1FY3A 1LO6A 1SGYE 4UFGH 3ZZDA 5DJ7A 1OWKA 2ODQA 3A7XA 1W13U 4RI0A 1T4VH 3QTVH 1LHFH 1EJAA 1QL8A 3A7YA 4TPIZ 1WUNH 1NTPA 1MMJN 3LONA 1W11U 1Z1JA 1P57B 3RLWH 1T7CA 5EQRA 3P6ZB 2KR7A 1V2QT 4FETA 1NFXA 1TBZH 3RXBA 5KECA 3UWIA 3L33A 3KNXA 2R0LA 3MFJA 1ZGVA 1EPTA 1ZPCA 2B7DH 3WWFA 4ZAEA 2O8WA 2ZU1A 1DICA 2C8ZB 3BTWE 5C17A 2A0QB 5FL7D 1EOLA 1GBEA 3PRBA 1O5GH 1C9PA 2GCTB 1VCWA 1OWJA 1A3EH 1GL0E 1HGTH 2JIZD 2PUXB 2QIQA 2J98B 2PTCE 4Y8YA 1C5QA 1WAYB 3SO3A 1WBGB 1P2IA 1V2ST 3M61U 2AIQA 5F53A 3P95A 3SU1A 1V3XA 1ORFA 4X2XA 2HALA 2LP6A 4NSYA 1WTHD 1PPBH 1N8OC 2J4IA 3M7UA 3GCTG 3A80A 4Y71A 3S9CA 1SOTA 1Q2WA 1YLDA 1LCYA 4RKOB 4ASHA 1G2LA 1SHHB 1UJ1A 3N7EA 2GCHG 3SJ9A 1ELCA 1GJ6A 3S9BA 1O5AB 2KCPA 3ZYEA 1TPSA 5JB8S 3SNEA 1K1IA 1UCYK 1ZMJA 4VGCC 2ZGBH 3GISB 3SU2A 3FKSD 3EA8A 4MNVA 2SFAA 3MU1A 4B73A 1E36B 1XXDA 5L2YH 1GI0A 2C8YB 1GBDA 1O3EA 5A8YA 5DO4H 1C5RA 1O3LA 3NCLA 4WVPE 4J1YA 1WYKA 2XWAA 3NKKA 1DVAH 3RXCA 1DWBH 1VJAU 2ANYA 4DGJA 2F9VA 2W7UA 1AMHA 1TWXB 1HAHH 1O3CA 4X1PU 4FVBA 5C1YA 3UR6A 2PSXA 4UFEH 4WXVA 1EUFA 4FUBA 2LNCA 2PKSB 5F03A 5DSFA 1C1VH 1FN8A 4IGDA 2A4GA 4B76A 1DDJA 3KHVA 3CS7A 2BX3A 2QYIA 5HXFA 4GHQA 1SFIA 1AI8H 1HDTH 3OY5U 3RXSA 2G4UA 1EPTC 2L6OA 1MTUA 1TBQH 4OS6A 1F0RA 3RXGA 2NU4E 1OOKB 4DCDA 3UPEA 1ZPBA 1TLDA 2L74A 4Q7XA 1GJ8B 1TABE 1OS8A 3KQBA 2VH0A 4IN2A 4K3JA 2FTMA 4KP0A 4RSPA 3SHCH 1DXWA 4D8NA 2EI8A 4AOQA 2ZF0H 1MQ6A 3BEFB 1K1NA 3G01A 4X1SU 5T6DA 1QB9A 4XFQA 3A83A 1VITH 1FDPA 2ESTE 2ODPA 1QQ4A 2OC0A 4JZDH 3A8AA 2CGAA 3M3TA 4MPXA 1ESTA 3ATLA 1HAXB 4UFDH 1Y3VA 3F9EA 2BOHB 3SOSA 3GCNA 1GHXH 2A5AA 3ZZ8A 3RU4D 3S69A 4NZLA 1GI9B 1SGFG 4YTAA 1DWDH 1T4UH 2IJOB 2XBWA 2CMYA 4FUIA 4K1SA 1Y3YA 3ZYDA 1SI5H 3GS9A 1GDUA 3PO1B 1IQFA 1CBWB 2OLGA 2VVCA 2THFB 2Z6BD 1TNKA 2ZP0H 1DX5M 2Z3EA 2OK5A 3M37A 4B2AA 2R2WU 4WY3A 1LHGH 3OEED 4U30A 4FUFA 2ZU4A 2BTCE 3RUOA 1WU1A 1KXAA 1GMCF 1P2MA 2ZNKH 3SJ8A 3RC4A 1O3PB 7GCHF 2DE8A 4B6FA 1Y3WA 1HNEE 1HFDA 1SQRA 4NIXA 4QT8C 1Y5BT 3TGIE 5T1VA 5FPTA 2XNDD 4D9QA 3LGWA 4H6TA 4YOJA 4M7GA 2F9PA 2W6JD 3DCLA 1P03A 2A7CA 4BXWA 2ZO3H 5K0HA 2ZGCA 1AN1E 1WV7H 3LGIA 2GGVB 2KCAA 3H7TA 1DSTA 4FUHA 3A7VA 1VITF 1O37A 1A1RA 1RJXB 3P8FA 2SGFE 2PGQB 1HLTH 1TNJA 3EE0B 1C1SA 4MTBA 4X6MA 4MQAA 5HKKD 2K1QA 2C3SA 3L6PA 3UR9A 1T8OA 1W8BH 4B2CA 1HAZB 5GXPA 1YPEH 1XX9A 1FLEE 2VVUA 2ZQ1A 1QBOA 4ZXYH 4DW2U 1KTTB 1G2MA 1LQDB 1LVOA 3ODFA 1LHDH 1HAOH 1QBVH 2XYAA 3RMMH 3QGJA 1T8NA 3RXFA 1N8OB 2R3YA 1QBNA 3LPRA 3AAVA 1BRUP 3BTFE 7LPRA 1C5VA 1RIWC 2F9OA 2BLOA 3LU9B 1XUGA 2AEIH 1GHVH 3ZZ9A 4IW4E 2K0QA 2Q6GA 5DGJA 2D8WA 3BEUA 1ELAA 1AE8H 4BAOB 2CK3D 1HXFH 2BB4A 2FOAA 2FS9A 2W7SA 2WZQA 3A82A 1P2NA 3MH6A 1O2KA 3KQ5A 2LELA 1S0QA 1K1OA 3U69H 1ABJH 3MU4A 1ZZZA 3KQEA 4MPVA 1KXFA 3A89A 1AE5A 1W10U 1QFKH 4UFFH 2YMSC 2HVXA 1RTKA 3ZVDA 4B75A 4FU8A 4U01A 1Y3XA 3E0NB 5FPSA 3STIA 2ZHDA 3P70B 1LMWB 1HJ9A 4NFFA 4B2BA 5LGOA 5AFYH 1UK3A 1Z8RA 5E8EH 2KAIB 4CRDA 3E0PB 3GCTF 3ZZBA 1G3DA 1KY9A 1KXBA 1O3NA 1BUIA 1O3FA 3MNCA 2GCHF 3GY6A 1GI6A 4Z0KA 4AN7A 1G9IE 1GHZA 1SBWA 5L6NH 2QF5A 5EG4A 1E38B 2ZU5A 4DVAU 1CQQA 1TOCB 1CE5A 1B5GH 1C5WB 1O2NA 1XKBC 1IOEA 1VKYA 1C2GA 1QTFA 1P2JA 2EQNA 1KSNA 1DWEH 3FP8E 1GHYH 1BJUA 2XRCA 3URCA 4K1TA 2TRMA 1SLVB 2SGDE 1EPTB 2ZDKA 4CHAC 1W7XH 5J4QA 1JIRA 1LPZB 1KLIH 2BY8X 2WPKS 5GIBA 1KXDA 5JBAS 2D26C 3DSGA 2BMGB 1V2RT 3UWJH 3ZV9A 4GUXA 3A85A 1G36A 4IC6A 3FFGA 3SV8A 3PMAB 2BD4A 4Y10E 4JCNA 3VXFH 3Q3YA 5HM2A 3VG8A 3TH4H 4BAQB 2J38A 1AHTH 4YZUA 4IMQA 1YYY1 1L4DA 1CGHA 2VIDA 2EI6A 1QJ6B 2FLRH 1YPGH 2TGAA 3KL6A 1FAXA 1P06A 3BG8A 4U2WA 1BBRH 3IITA 1A2CH 4E7NA 2GZ9A 3KQDA 3MU0A 5E0GA 1TGBA 4CR9A 1JXPA 2Y6TA 1YCPK 1FPCH 1D3TB 2VBCA 1JRTA 2G00A 1EASA 1Z1IA 4KTSA 5J4SA 4ABGA 1QB6A 2A5KA 2R0KA 3ZVGA 2ZHWH 1AUTC 2AIPA 1AVXA 3RM0H 1LDTT 3MTYA 5A2MH 1FUJA 3S7HB 1FN6A 1SGPE 2ZDNA 3FO8D 2P59A 5DPAA 1TOMH 5E2PA 3SU0A 1F0TA 4B74A 1BMMH 5EJ1A 1NRPH 1KMHB 1WTGH 2P3FH 1SGFA 4AFZA 1QA0A 1BBRK 1KXCA 1TALA 4BTUB 4ISNA 5HM9A 1TPOA 3A81A 2EI7A 4O97A 4K2YA 3F9HA 1YCPM 4NIYA 4E05H 2VWLA 1ARBA 1PFXC 1OKXA 2A1DB 1LHEH 1BMNH 4MNWA 1O5FH 5A8ZA 2SNWA 4M9FA 5LH8A 2ZG0H 1P9SA 3OEHD 1F0UA 3TGKE 3PWCA 2XBYA 2QY0B 4FUJA 1ELGA 2BQ6B 3HGNA 2QXHA 3SGAE 1F5LA 1FIZA 3LGUA 2BD2A 3ZZCA 1CHOG 3RMOH 4INLA 1SPJA 5CDFE 1KTSB 1ELBA 1CT2E 1FIWA 1QGFA 2HNTF 3SYJA 4HG6A 2A4QA 4K60A 4K8BA 1ZJDA 1F5KU 2EC9H 1O2QA 1OWIA 3FVFB 1EZXC 1FZZA 1SGRE 1RIWB 3FZDA 4NCYA 3STJA 3E8LA 1ZHMA 1ZRKA 3VFEA 1OP0A 1TPPA 2FI5E 4ISIH 5ETXA 1BCUH 1A4WH 2F91A 4OM9A 2HRVA 2PHBA 3PLKA 5GNDA 5EW2H 4AB9A 3GDUA 4FXGH 4J2YB 4XE4A 2XXLA 4ABDA 1AIXH 1BQYA 5FX6A 4WMEA 1S81A 1SMFE 1NESE 1SHYA 5H4IB 2OINA 5C1XA 2PUQH 1NRQH 2UWLA 2YMSB 2ZA5A 4F48B 1OX1A 1P01A 4TT3D 2QC2A 2CF8H 2JH0D 3KQCA 3GY2A 1O3IA 4Y7AA 4ZH8A 1AGJA 3PTBA 1P8VC 1YLCA 3P92A 1GHAG 2BOKA 2PKSC 1FY4A 4Q7YA 2Q6FA 3LC3A 1P09A 1T8MA 2Z9LA 1XMNB 1GMHG 1TGCA 2ZDAH 1G3CA 1O2LA 1FONA 1ID5H 3UY9A 3EGKH 2Z9JA 1QURH 5AHGH 2A31A 3WW7A 1TGSZ 1UCYE 1H8IH 1EAXA 1Y3UA 1W0JD 5FCKA 1WOFA 3TK6A 1O2YA 3W94A 4AYYB 1ETRH 4DIIH 4B6EA 5FBEA 3QX5H 2HNTC 1MTNC 3U28C 3D62A 1D4PB 4CHAB 1RRKA 3BG4C 3NK8A 1FY5A 4I31A 1SKYE 2WYGA 1WSSH 4K8YA 3A7WA 1NM6A 2BZAA 9ESTA 3UIRA 2KCOA 1TE0A 1ZJKA 4O03A 3I78A 1DFPA 2D1JA 2FMJA 4NA7A 1MKXK 1OHHD 7GCHG 1E1RD 1TBRH 4GPGA 1S85A 1YLNA 1CA0C 2GP9B 4AFSA 1AU8A 1C1OA 4INKA 1TIOA 1BB0B 1V2NT 2V3HH 5GCHG 1UVUH 2CF9H 1C5NH 3U9AH 3F6UH 2RFKC 3O8BA 5IYTA 3UNRA 1E35B 3F0PA 5T6GA 5I46H 2BLVA 2GD4B 4Y8XA 2WYJA 3PMJA 4ZKRU 3PV5A 2FOBA 7ESTE 1NFWA 1O2UA 4X6NA 4BAHB 3RMNH 3SV7A 3SQEE 3FP7E 4NWLA 3E91A 1B0EA 4JK6A 2FDAA 5A0AE 1OPHB 2XC4A 2ZWLH 3T62A
chains in the Genus database with same CATH topology
3SU3A 1AVGH 5I25A 4XBBA 3SGQE 4KGAA 4BANB 2OCVB 2FLBH 5ESBA 2FOHA 1TGTA 5C3NA 1V2WT 1D3DB 3RXUA 3PMHB 4BTIB 2ZCHP 3RP2A 3LDXH 1V2LT 1T32A 3SU4A 1BITA 5EU8A 1FY1A 1EB2A 1FAKH 2HPQH 5A8XA 4XSKU 1T31A 5DG6A 3JZ1B 3PMBB 1O3OA 2QAAA 1BTPA 1GI3A 1S83A 3GY8A 4H6SB 1ETSH 4X2WA 2BM2A 1YPKH 6LPRA 1DITH 3TVJB 3DHKH 1GBAA 2ALVA 5GDSH 1O2PA 5LPRA 2NU3E 4MLFB 1Y59T 2ZZUH 4RN6A 1MU6B 4Z6AH 1P2QA 1IQEA 1EZSC 3O8RA 1O2XA 1YBWA 3GCHC 3P17H 4YOGA 1ZR0A 4GAWA 2CJIA 3K6YA 4YLUA 2QXJA 1O38A 3RC6A 1O3MA 4YT7H 3GY7A 3C27B 1GBCA 2GMTC 3AW1A 2SGPE 1S0RA 8KME2 1SGCA 1UTOA 1TYNA 1J16A 3NUMA 3VB6A 2AFQB 4X6OA 1DS2E 2SGAA 3BN9A 2BD9A 2G5VA 1JMOH 2HGTH 2Y5HA 1HUTH 5CHAC 2B8OH 2A2XH 4OGXA 1QL9A 1O32A 2OC8A 4OS5A 1Z8IB 3T25A 1UTPA 3ZZ5A 1SQOA 3A8BA 2WPIS 1CO7E 4AG1A 1EQ9A 3HATH 5JBTA 1HRTH 3MO6A 4THNH 1CHOF 2BZ6H 4MNXA 1DLKB 1BT7A 1K2I1 2B0FA 4AFQA 2Y81A 1SQAA 2ZHQH 1O2SA 5DP9A 2ZDVH 2FTLE 1UTQA 4I7YH 2Y80A 3SUFA 2FX6A 4WMFA 4CH2B 1FNIA 1E34B 3SQHE 2XTTB 3ZZ6A 1B0FA 3BTGE 3K9XB 2FEQH 1GBFA 3U1IB 1O2JA 1O33A 3SJOA 4SGBE 1H8DH 3SNCA 4CRGA 1C1NA 1NRRH 2J2UA 3RXMA 4BAKB 1YPHC 3UOPA 1W12U 1GVZA 2PKAA 1C4Y2 1MTNB 2STBE 3EAJA 5F6MA 3BG4B 4ZKNU 1QL7A 3SUGA 1W0YH 4WF8A 2H5CA 2XC5A 3PYHA 3RXVA 2BY6X 4MPWA 1FPHH 1YF4A 2PV9B 3JZ2B 1MD8A 3HK6B 1GHAF 1TA6A 2A7JA 2ZC9H 2ANKH 5C67A 5GWZA 1S5SA 1EJNA 3TJOA 2BXTH 2BD8A 3WY8A 1GMHF 4SGAE 1CA0B 1OWDA 3E6PH 4FU9A 4A92A 2ZDLA 1F5RA 1L0ZA 5JYIA 2PFEA 4HFPB 1D3QB 1HIAA 1ESBA 1GI5A 3HKIB 3ATKA 2VIVA 2OQ5A 3GICB 5F8XA 1Z8GA 2AERH 2C90B 5AFZH 1EAWA 2ZCKP 3SNDA 4AGJA 3SORA 3TLOA 1QRWA 1BZXE 1SC8U 2XNIA 3AW0A 4JZIA 3SV2H 2AGIX 1K1PA 3A84A 1MCTA 1U6QA 3FP6E 4ABHA 3GY5A 2CXVA 1TQ7B 1TX8A 2SGQE 5CE1A 1OP2A 5A09A 3AASA 3SN8A 3V0XA 3DUXH 3ZVCA 6ESTA 1QR3E 4AB8A 3U8RH 1LPKB 1ZTKA 1ELFA 2WV4A 4CBOA 1IQJA 1C2JA 4CR5A 3MMGA 1C5OH 4FUDA 1S82A 5EOKA 5DP6A 5CMXH 1MQ5A 4O3UA 4OS4A 4NZQA 5GCHF 2B5TB 1UVPA 3DFJA 4XBDA 4Y0YE 5C2ZA 1HXEH 2ZU3A 1V2VT 3T29A 4JMYA 3ATWA 1SGDE 3MNXA 4K1EA 5F8TA 3SNAA 1SOZA 2H2ZA 1H9IE 2FOEA 4Y6DA 1J17T 2A4RA 5K7RA 1TQ0B 3M7TA 4ZUHA 3RXIA 1Y5AT 3TH2H 1O5EH 4DOQA 1TNGA 1YPLH 4WWYA 2ZCLP 1A0LA 1X7AC 4CH8B 2I6QA 3GCOA 1SGNE 4WH6A 3LOXA 1QRZA 3LH1A 3GCHB 1NU7B 3L3TA 2AYWA 2BQWB 6CHAC 2GMTB 1W3CA 5EQQA 1QHRB 3DFLA 1BBRE 1P2OA 5FCRA 5IDKA 2A32A 4ISOA 4NGAH 4XBCA 4U32A 3A7ZA 4GVUA 1XM1A 1IQNA 3RLYH 2XCFA 3Q77A 1SR5C 1SQTA 3CENA 4ABEA 4R0IA 3V7TA 1RTFB 3LGVA 3O8DA 3M5MA 1C5PA 1NY22 5C1UA 5CHAB 1QNJA 4A7IB 1ZSJA 3TJVA 5B6OA 3M35A 1SGTA 1NROH 3TJUA 2PTNA 1ANDA 4NIWA 1XUIA 3OY6U 3T28A 3EQ0H 1V2JT 3HKJB 2EEKA 1SFQB 5EODA 1BTZA 2RA0A 1VGCC 2ZECA 1O0DH 5LPFA 2GKVE 3NZIA 5AVDA 2D2DA 1OWEA 1OXGA 1EOJA 5A0BA 1GJ7B 1OWHA 5GPIB 1ELDE 3D23A 1IQMA 3RMLH 2ZPRA 1O2RA 2M5TA 1BTWA 2A5IA 1EZQA 4D9RA 3E16B 3ESTA 1BTXA 2GT8A 1FQ3A 4O9VA 3TNSA 1CT0E 2OP9A 3E3TA 2Z7FE 3P8GA 4CRAA 5E0HA 1NFYA 2CHAB 4YLQH 1Q3XA 4Y79A 1IHSH 2G81E 2IPHA 1J14A 1Z6JH 2Z9IA 1C5MD 2ULLA 1GGDC 4OS2A 1XUHA 4CRCA 2BDIA 1ELTA 1TMUH 4I8HA 4A1VA 3FZZA 1PQ8A 1GHBG 3MO3A 1NFUA 4K5ZA 1GCDA 2Z94A 1CU1A 1GI4A 1MTSA 1Z71A 3BTKE 4NA9H 1HYLA 2R2MB 1BRBE 8LPRA 1ZLRA 2AGEX 4AG2A 1TNHA 3SGBE 1MH0A 5FBIA 2FIRH 1BTYA 1F92A 4FUGA 1C5LH 5BPEA 4YM9A 2H6MA 1C1MA 1L1NA 3QGNB 4X6PA 1A7SA 1KLTA 3M3VA 3S0NA 2QN5T 2BDCA 1K9OE 1QCPA 5EXNA 3NWUA 2FXRA 1O2IA 3MYWA 1LVMA 1D9IA 1Y8TA 3SV9A 1MD7A 1PQAA 4UDWH 1GG6C 1TRMA 1WQSA 1PPEE 4TWYA 1HAPH 1DUEA 1ELVA 2F83A 1TMBH 1ZGIA 3RU4T 1V2TT 1E37B 2W5EA 1VZQH 2G55A 1VJ9U 3K65B 4NWKA 2J95A 2BQ7B 2Z9GA 1PQ5A 1AWFH 2ZU2A 3RM2H 4YT6H 6GCHG 2QA9E 1Z8JB 1P11E 2QF0A 2AMQA 5ESTE 2QXGA 3LH3A 4BNRA 4DT7B 1AO5A 1O36A 1C1QA 4X8SH 1XKAC 1XVOA 2IN2A 2V6NA 3LIWA 1ANBA 4A6LA 1YC0A 2I6SA 3Q00A 2P8OC 4A5TS 2VWMA 1ZOMA 2FODA 2ANWA 1P0SH 1W0ZU 3K6ZA 1GBHA 5JBBS 1S6HA 4A1XA 3BIVH 4I32A 1P3EA 2PKAB 4F4OC 1C5XB 1GL1A 1GMDG 3ENSB 1HB0B 3SI3H 1VCPA 3MU5A 3TK9A 3BTQE 1AVWA 3H7OA 2YOLA 5LPEA 3U1JB 5EGMA 4ABBA 3ATMA 2R3UA 2XWBI 3NXPA 3MHWU 1GJ9B 1C4U2 1DXPA 4ABJA 5HMAA 3FAOA 1NRSH 6CHAB 2SNVA 3SU5A 3QLPH 4TWWA 1JWTA 1EKBB 2A2QH 3TITA 1YPMH 1EB1H 1UO6A 4ZXXH 2G8TA 1O2OA 1MKWH 5TCAA 2FI3E 2ZQ2A 2A4OA 4AFUA 4XDEA 1DE7H 1HIAB 1EP5A 3OYPA 2VJ1A 3OTJE 3SHAH 1TONA 3QO6A 2Y5GA 3RXKA 1V2MT 1NT1A 4ABAA 1F0SA 3V12A 2P93A 3SUEA 4MPUA 5T3HA 1CGJE 2GZ7A 3GDSA 3D65E 4FUCA 4HTCH 3PTNA 1V6DA 3RXJA 2ZGJA 4TY6A 5E0JA 1VGCB 4WXIA 2G51A 1MTVA 4K69A 3RXTA 1GBIA 1GI8B 3VB4A 1YP9A 3ELAH 4ZMAH 1GPZA 1IHTH 1O2GH 5FAHA 1C5UA 4HGCA 1M9UA 1CGIE 2ZFQH 2ZGHA 4AYVB 2FP7B 2P3UB 4R8TB 1W2KH 1CT4E 3A8CA 4X1RU 1C2MA 4D7FA 3RXLA 1LPGB 4X1NU 1QQUA 2VU8E 1ZYOA 3ATIA 1TB6H 4Q7ZA 3K2UA 3UUZA 3T26A 1DPOA 4X8TH 4H42U 3BV9B 1UTJA 1FJSA 3BSQA 2FM2A 1NRNH 5F8ZA 1GGDB 1ZRBA 1DLEA 3BTEE 2NU0E 1L2EA 1P3CA 1EATA 1ZPZA 2H9TH 1BA8B 2UUKB 3M5OA 3DA9B 1C2LA 1O31A 3MNBA 2ZEBA 1GHWH 1IQLA 1GI7B 1ANEA 1BMLA 1HBTH 2G5NA 2BDGA 2ZFTA 3M5NA 2GDDA 3U8OH 1C5SA 2A45B 1SG8B 2FWWA 2H5DA 1K28D 2F3CE 1J8AA 4JZFH 2PSYA 4IBLH 4PROA 2OBQA 2ZHEH 1ZMLA 3QN7A 2RDLA 4DY7B 1RTLA 1G30B 2WUCA 5EW1H 2ZTXA 1TNLA 3ZVEA 3A87A 1Y5UT 4FU7A 2UWPA 1W7GH 1CSOE 2FYRA 2IOTA 1MAYA 3BIUH 3RXHA 1GG6B 2CV3A 2UUYA 1QB1A 4JZEH 1BHXF 5G4BA 2ZTYA 1GHBF 2TGDA 2BY9X 1PPHE 1SSXA 2QF3A 1AKSA 2Y7ZA 2VGCC 2Y5FA 2ZFRH 3I29A 1HAIH 3MI4A 2JH6D 2BD3A 5FXLA 2VIOA 1DUAA 2VVVA 2AH4X 1P2KA 2Y7XA 4TY7A 5JBCS 1Z7KA 4MVNA 1SGEE 4JYUH 1C4V2 1O2TA 3LJJA 3PB1E 1GJCB 1BTUA 2P16A 2FESH 1C9TA 2P94A 4DG4A 2P8OB 2WUBA 1C2DA 4RKJB 1LTOA 2GV7A 2H9HA 3UTUH 3LJOA 1K21H 1UK2A 1UVSH 1G3BA 4AGKA 8ESTE 1AB9C 3BTHE 2BVSH 4GCHG 3EDXB 3B23B 3UNSA 1O39A 2J9NA 4X1QU 1A61H 3IWMA 1PYTD 2FYQA 4A1TA 4ESTE 1UCYH 4WH8A 3UFAA 2H9EH 1C2KA 3W95A 4Q80A 5E2OA 1TGNA 3LGTA 2ZIQH 2ODYB 2AGGX 3LT3A 4Y11E 6GCHF 1HAVA 2P3TB 4LXBH 1EAUA 1QIXB 1C2FA 1UVTH 9LPRA 1GI2A 1O5DH 1UHBA 1L4ZA 3F9GA 1BTHH 2FPZA 2TBSA 1C5YB 4BAMB 4Y8ZA 3RXAA 1Z6EA 2Z9KA 4ZKOU 1AFEH 4I8LA 1V2KT 4ISLA 1IQKA 1SLXB 2ALPA 3KIDU 2C93B 2QCYA 4E7RG 1JRSA 3A7TA 2VNTA 4ZHMU 1T8LA 2RG3A 2R9PA 1GMDF 1AD8H 4UONA 2A7HA 2BVXH 1O5BB 1QJ7B 1O34A 4UEHH 1PPFE 3RXEA 1QRXA 2BXUH 1XUKA 1IQGA 4X8VH 1PPCE 3SNBA 1RS0A 1UVOA 2ZPQA 2Y82A 1SL3A 4IS5A 1TX7A 4ZROA 1O2ZA 4KELA 1O3BA 1YGCH 1DANH 1ACBE 2OUAA 2XW9A 2TGPZ 3GDVA 2XBXA 3BTDE 1GJDB 3VXEH 4CBNA 3SBKA 1QY6A 4IN1A 3AVZA 1CA8B 1N6YA 1SVPA 1ABIH 2STAE 4GHTA 2CHAC 3IG6B 4ISHH 3LGYA 1AFQC 1YPJH 3BTTE 4D7GA 1GWAA 2AMDA 3RDZA 8GCHG 1GDNA 2UUJB 1CHGA 1HAGE 2J92A 1MU8B 1L1JA 3PWBA 3TGJE 5EQSA 2VIWA 2G4TA 1VR1H 3RU4E 2UUFB 1C2IA 3SJKA 3RXRA 2NU1E 1BMAA 1NPMA 1C2EA 3M5LA 1MAXA 4NG9H 2WPJS 4X8UH 5L30H 4I8GA 4ABFA 2BVRH 4OGYA 4LZ4B 3PM3A 2HPPH 3LKWA 4TPYA 5EPYA 4I8KA 1D6RA 1FMGA 1YKTA 1HAYB 2EA3A 3P8NA 3RXPA 3D49H 2FOCA 4JYVH 2FOMB 2FS8A 1UK4A 5C5OA 1BDAA 3MO9A 3ZZ7A 4NIVA 4Y0ZE 1A0JA 3KCGH 1NU9A 1TX6A 1GVKB 1P12E 2ZKSA 1KYNA 1NN6A 3UQVA 1HCGA 1GJAB 3MU8A 3OSYA 3V13A 4JK5A 3PROA 2B9LA 3TPIZ 3T2NA 3KGPA 3QWCH 2CN0H 5ABWA 1ARCA 2RA3A 1A0HB 3TNTA 3V3MA 5DKMA 5C5NA 3VB7A 3R0FA 2VGCB 2ZGXH 1AZ8A 3SV6A 2C8WB 2VB0A 1GVLA 3RC5A 2TPIZ 1DY8A 4IC5A 2VIPA 1GBLA 3U98H 2BY7X 2OC1A 3CS0A 2OTVA 1FY8E 3M3SA 1UTMA 1GBMA 4MNYA 1TMTH 2BX4A 3FANA 2J94A 1F7ZA 1TAWA 4LOYH 2VINA 2ZDMA 4ZHLU 2P95A 4FUEA 1AB9B 4B1TA 4BOHA 1SGIB 4Q2KA 2GVFA 5FPYA 1MUEB 3U8TH 3VPKA 2BLQA 5EXMA 2VH6A 3F9FA 3ODDA 1AZZA 4Y7BA 1HJAC 3UOUA 5AF9H 4X2YA 1O30A 1THPB 1BRCE 3M36A 2HNTE 1ZSLA 1P02A 2PGBB 3VB5A 5FHTA 1O3DA 2QV1A 3ZV8A 1H9HE 2GZ8A 1H1BA 1A5IA 2ZI2H 3SJIA 1A5GH 2V0BA 3R3GB 1O35A 4MG3A 2BDBA 2VWNA 1BHXB 3KN2A 5HGGA 2QGRA 3HK3B 5GJ4B 3ZVAA 4BXSA 4HI3A 4CRFA 5C20A 1H4WA 4GCHF 1A46H 1PYTC 1C1RA 1THRH 4VGCB 1EJMA 1OSSA 3TJNA 1MZAA 4KTCA 1N1LA 4GLYA 2GT7A 1KLJH 1BIOA 1KDQA 3SZNA 5JDUB 3N7OA 1GJ4H 1AKSB 5L2ZH 1MTWA 3TK5A 2Q1JA 1O3AA 4AZ2B 1BJVA 1DWCH 2FOGA 4D76A 3GY3A 4INHA 1EP6A 1DSUA 2W26A 1CVWH 4H4FA 1TRYA 2ASUB 1UTNA 2YNBA 3PV4A 4YO9A 1O2VA 7KMEH 1AFQB 3KEEA 1UMAH 1EXFA 1TA2A 3GYMA 3MH7A 2RCEA 2UWOA 2VIQA 3Q76A 1AUJA 3H5CB