3PWHA

Thermostabilised adenosine a2a receptor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
299
structure length
291
Chain Sequence
SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the adenosine A(2A) receptor in complex with ZM241385 and the xanthines XAC and caffeine
pubmed doi rcsb
molecule keywords Adenosine receptor A2a
molecule tags Signaling protein
source organism Homo sapiens
total genus 105
structure length 291
sequence length 299
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3pwhA00
4MQSA 2YCXA 4A4MA 1DZEA 1S52A 2X72A 2ZIYA 4DKLA 2YCWA 3UZAA 4FPDA 2PEDA 4AMIA 1BRRA 2WJLA 4MBSA 5ITEA 1S54A 1LN6A 2ZZLA 2NTWA 3UZCA 3OAXA 3HARA 5G2AA 1XJIA 3DQBA 3AYNA 4BEZA 4GP4B 1O0AA 5H2PA 1TN0A 4TL3A 3UONA 2KSBA 4KNFA 4G72B 1PXRA 3NS0A 4XT3A 4QI1A 1MGYA 4NC3A 4XTNA 1S53A 3KJ6A 1Q5JA 4G71B 4HYXA 4DJHA 1XIOA 2KSYA 3OE8A 1QM8A 5AX0A 2ZFEA 3RZEA 5C1MA 4QRYA 4BV0A 2Y03A 1KMEA 1F50A 4WAVA 1BRDA 4L6RA 3REYA 4BVNA 1VGOA 1GU8A 5EN0A 3NY8A 1P8IA 3PXOA 1TN5A 3QBLA 4BEYA 1IW6A 3QJSB 2YDOA 5AZDA 3VHZA 4XT1A 4HYJA 1P8UA 3QJRB 5G28A 1AT9A 4X31A 3QBGA 3QBIA 1BRXA 4G7QB 5AX1A 3HAPA 3VG9A 1C8SA 2Y02A 3UTVA 5B0WA 3ZEVA 4X1HA 3X3CA 3EMLA 3OE9A 3COCA 2Y01A 4JKVA 3S3CB 4PXFA 4PXKA 3HAQA 4UHRA 5B6YA 3PDSA 4G7RB 1AP9A 2I35A 5FJGA 2L6XA 3DDLA 1S51A 4XXJA 1JGJA 4AMJA 5B6VA 5H2JA 2YDVA 3QAPA 3HAOA 5H2MA 3ZPQA 3NSBA 5AHZA 4Y9HA 5G2CA 3WQJA 3PBLA 1QKOA 3V2YA 2KSAA 4N4YB 3S3DB 1VJMA 2QPEB 3OE0A 4BWBA 4EJ4A 3VGAA 3UG9A 1FBBA 4GP8B 1QKPA 3HANA 3RFMA 1E0PA 4EIYA 1QHJA 5DHGA 2RH1A 4MD1A 5H2OA 5H2KA 1P8HA 4XTOA 4FBZA 5H2HA 3A7KA 5G36A 4GYCA 3VI0A 3NY9A 1L0MA 2I1XA 3EH3B 5KKHA 3QBKA 3QDCA 4J4QA 1UAZA 3VW7A 2R4RA 1F88A 4FAAB 5JJEA 1M0MA 3QJVB 3QAKA 3C9MA 1JV6A 2I20A 4UG2A 5A44A 1R84A 5AHYA 5B6XA 5G54A 4X32A 4LDOA 1C3WA 1X0SA 1KG9A 2LNLA 3UTYA 1R2NA 3AM6A 3BVDB 5BR2A 4MQTA 3NYAA 4G7SB 3ZPRA 1JV7A 5H2LA 1XMEB 3CODA 5B6ZA 4XTLA 1CWQA 5LWEA 1E12A 4JQ6A 4GP5B 1KG8A 1S8LA 4MD2A 2Y00A 3D4SA 2YCZA 3HASA 4N6HA 4IARA 1BM1A 5H2IA 2F93A 3ODUA 4IAQA 2VT4A 4BUOA 1X0K1 5B34A 1HZXA 1IW9A 3PWHA 4N4WA 1FBKA 1M0LA 3UTWA 1H68A 4QIDA 4LDEA 5DYSA 1L9HA 2KS9A 5A8EA 4GPOA 2R4SA 3UTXA 1EHKB 3EH4B 4JR8A 5DHHA 1IXFA 2BRDA 3C9LA 3X3BA 2EI4A 5F8UA 4KLYA 2Y04A 4IB4A 3S8FB 3T45A 4GRVA 5H2NA 1M0KA 3V2WA 4K5YA 2Z73A 3SN6R 3QJUB 1KGBA 2HPYA 4WW3A 2AT9A 5B6WA 3S8GB 4LDLA 5B35A 2JAFA 5G2DA 2M3GA 2NTUA 2WJKA 3AYMA 4L35A 2F95A 4GBRA 3PQRA 2JAGA 3P0GA 5BR5A 3OE6A 3VVKA 4HWLA 5ETZA 5JJNA 4OV0A 5A45A 2G87A 4G70B 2QPDB 3QJQB 3CAPA 5TGZA 2I21A 1UCQA 1C8RA 1F4ZA 1GUEA 5B2NA 2YCYA 3ABWA 1H2SA 3MBVA 5JJJA 1PY6A 5AWZA 1GZMA 1JFPA 1S8JA 3EH5B 4FA7B 4EA3A 3QJTB 5J7AA 2J4YA 4DAJA 3S3BB 2Z55A 5ITCA 1X0I1 1PXSA 1U19A 5G53A 1Q5IA
chains in the Genus database with same CATH superfamily
4MQSA 2YCXA 4A4MA 1DZEA 1S52A 2X72A 2ZIYA 4DKLA 2YCWA 3UZAA 4FPDA 2PEDA 4AMIA 1BRRA 2WJLA 4MBSA 5ITEA 1S54A 1LN6A 2ZZLA 2NTWA 3UZCA 3OAXA 3HARA 5G2AA 1XJIA 3DQBA 3AYNA 4BEZA 4GP4B 1O0AA 5H2PA 1TN0A 4TL3A 3UONA 2KSBA 4KNFA 4G72B 1PXRA 3NS0A 4XT3A 4QI1A 1MGYA 4NC3A 4XTNA 1S53A 3KJ6A 1Q5JA 4G71B 4HYXA 4DJHA 1XIOA 2KSYA 3OE8A 1QM8A 5AX0A 2ZFEA 3RZEA 5C1MA 4QRYA 4BV0A 2Y03A 1KMEA 1F50A 4WAVA 1BRDA 4L6RA 3REYA 4BVNA 1VGOA 1GU8A 5EN0A 3NY8A 1P8IA 3PXOA 1TN5A 3QBLA 4BEYA 1IW6A 3QJSB 2YDOA 5AZDA 3VHZA 4XT1A 4HYJA 1P8UA 3QJRB 5G28A 1AT9A 4X31A 3QBGA 3QBIA 1BRXA 4G7QB 5AX1A 3HAPA 3VG9A 1C8SA 2Y02A 3UTVA 5B0WA 3ZEVA 4X1HA 3X3CA 3EMLA 3OE9A 3COCA 2Y01A 4JKVA 3S3CB 4PXFA 4PXKA 3HAQA 4UHRA 5B6YA 3PDSA 4G7RB 1AP9A 2I35A 5FJGA 2L6XA 3DDLA 1S51A 4XXJA 1JGJA 4AMJA 5B6VA 5H2JA 2YDVA 3QAPA 3HAOA 5H2MA 3ZPQA 3NSBA 5AHZA 4Y9HA 5G2CA 3WQJA 3PBLA 1QKOA 3V2YA 2KSAA 4N4YB 3S3DB 1VJMA 2QPEB 3OE0A 4BWBA 4EJ4A 3VGAA 3UG9A 1FBBA 4GP8B 1QKPA 3HANA 3RFMA 1E0PA 4EIYA 1QHJA 5DHGA 2RH1A 4MD1A 5H2OA 5H2KA 1P8HA 4XTOA 4FBZA 5H2HA 3A7KA 5G36A 4DS7E 4GYCA 3VI0A 3NY9A 1L0MA 2I1XA 3EH3B 5KKHA 3QBKA 3QDCA 4J4QA 1UAZA 3VW7A 2R4RA 1F88A 4FAAB 5JJEA 1M0MA 3QJVB 3QAKA 3C9MA 1JV6A 2I20A 4UG2A 5A44A 1R84A 5AHYA 5B6XA 5G54A 4X32A 4LDOA 1C3WA 1X0SA 1KG9A 2LNLA 3UTYA 1R2NA 3AM6A 3BVDB 5BR2A 4MQTA 3NYAA 4G7SB 3ZPRA 1JV7A 5H2LA 1XMEB 3CODA 5B6ZA 4XTLA 1CWQA 5LWEA 1E12A 4JQ6A 4GP5B 1KG8A 1S8LA 4MD2A 2Y00A 3D4SA 2YCZA 3HASA 4N6HA 4IARA 1BM1A 5H2IA 2F93A 3ODUA 4IAQA 2VT4A 4BUOA 1X0K1 5B34A 1HZXA 1IW9A 3PWHA 4N4WA 1FBKA 1M0LA 3UTWA 1H68A 4QIDA 4LDEA 5DYSA 1L9HA 2KS9A 5A8EA 4GPOA 2R4SA 3UTXA 1EHKB 3EH4B 4JR8A 5DHHA 1IXFA 2BRDA 3C9LA 3X3BA 2EI4A 5F8UA 4KLYA 2Y04A 4IB4A 3S8FB 3T45A 4GRVA 5H2NA 1M0KA 3V2WA 4K5YA 2Z73A 3SN6R 3QJUB 1KGBA 2HPYA 4WW3A 2AT9A 5B6WA 3S8GB 4LDLA 5B35A 2JAFA 5G2DA 2M3GA 2NTUA 2WJKA 3AYMA 4L35A 2F95A 4GBRA 3PQRA 2JAGA 3P0GA 5BR5A 3OE6A 3VVKA 4HWLA 5ETZA 5JJNA 4OV0A 5A45A 2G87A 4G70B 2QPDB 3QJQB 3CAPA 5TGZA 2I21A 1UCQA 1C8RA 1F4ZA 1GUEA 5B2NA 2YCYA 3ABWA 1H2SA 3MBVA 5JJJA 1PY6A 5AWZA 1GZMA 1JFPA 1S8JA 3EH5B 4FA7B 4EA3A 3QJTB 5J7AA 2J4YA 4DAJA 3S3BB 2Z55A 5ITCA 1X0I1 1PXSA 1U19A 5G53A 1Q5IA
chains in the Genus database with same CATH topology
4MQSA 2YCXA 4A4MA 1DZEA 1S52A 2X72A 2ZIYA 4DKLA 2YCWA 3UZAA 4FPDA 2PEDA 4AMIA 1BRRA 2WJLA 4MBSA 5ITEA 1S54A 1LN6A 2ZZLA 2NTWA 3UZCA 3OAXA 3HARA 5G2AA 1XJIA 3DQBA 3AYNA 4BEZA 4GP4B 1O0AA 5H2PA 1TN0A 4TL3A 3UONA 2KSBA 4KNFA 4G72B 1PXRA 3NS0A 4XT3A 4QI1A 1MGYA 4NC3A 4XTNA 1S53A 3KJ6A 1Q5JA 4G71B 4HYXA 4DJHA 1XIOA 2KSYA 3OE8A 1QM8A 5AX0A 2ZFEA 3RZEA 5C1MA 4QRYA 4BV0A 2Y03A 1KMEA 1F50A 4WAVA 1BRDA 4L6RA 3REYA 4BVNA 1VGOA 1GU8A 5EN0A 3NY8A 1P8IA 3PXOA 1TN5A 3QBLA 4BEYA 1IW6A 3QJSB 2YDOA 5AZDA 3VHZA 4XT1A 4HYJA 1P8UA 3QJRB 5G28A 1AT9A 4X31A 3QBGA 3QBIA 1BRXA 4G7QB 5AX1A 3HAPA 3VG9A 1C8SA 2Y02A 3UTVA 5B0WA 3ZEVA 4X1HA 3X3CA 3EMLA 3OE9A 3COCA 2Y01A 4JKVA 3S3CB 4PXFA 4PXKA 3HAQA 4UHRA 5B6YA 3PDSA 4G7RB 1AP9A 2I35A 5FJGA 2L6XA 3DDLA 1S51A 4XXJA 1JGJA 4AMJA 5B6VA 5H2JA 2YDVA 3QAPA 3HAOA 5H2MA 3ZPQA 3NSBA 5AHZA 4Y9HA 5G2CA 3WQJA 3PBLA 1QKOA 3V2YA 2KSAA 4N4YB 3S3DB 1VJMA 2QPEB 3OE0A 4BWBA 4EJ4A 3VGAA 3UG9A 1FBBA 4GP8B 1QKPA 3HANA 3RFMA 1E0PA 4EIYA 1QHJA 5DHGA 2RH1A 4MD1A 5H2OA 5H2KA 1P8HA 4XTOA 4FBZA 5H2HA 3A7KA 5G36A 4DS7E 4GYCA 3VI0A 3NY9A 1L0MA 2I1XA 3EH3B 5KKHA 3QBKA 3QDCA 4J4QA 1UAZA 3VW7A 2R4RA 1F88A 4FAAB 5JJEA 1M0MA 3QJVB 3QAKA 3C9MA 1JV6A 2I20A 4UG2A 5A44A 1R84A 5AHYA 5B6XA 5G54A 4X32A 4LDOA 1C3WA 1X0SA 1KG9A 2LNLA 3UTYA 1R2NA 3AM6A 3BVDB 5BR2A 4MQTA 3NYAA 4G7SB 3ZPRA 1JV7A 5H2LA 1XMEB 3CODA 5B6ZA 4XTLA 1CWQA 5LWEA 1E12A 4JQ6A 4GP5B 1KG8A 1S8LA 4MD2A 2Y00A 3D4SA 2YCZA 3HASA 4N6HA 4IARA 1BM1A 5H2IA 2F93A 3ODUA 4IAQA 2VT4A 4BUOA 1X0K1 5B34A 1HZXA 1IW9A 3PWHA 4N4WA 1FBKA 1M0LA 3UTWA 1H68A 4QIDA 4LDEA 5DYSA 1L9HA 2KS9A 5A8EA 4GPOA 2R4SA 3UTXA 1EHKB 3EH4B 4JR8A 5DHHA 1IXFA 2BRDA 3C9LA 3X3BA 2EI4A 5F8UA 4KLYA 2Y04A 4IB4A 3S8FB 3T45A 4GRVA 5H2NA 1M0KA 3V2WA 4K5YA 2Z73A 3SN6R 3QJUB 1KGBA 2HPYA 4WW3A 2AT9A 5B6WA 3S8GB 4LDLA 5B35A 2JAFA 5G2DA 2M3GA 2NTUA 2WJKA 3AYMA 4L35A 2F95A 4GBRA 3PQRA 2JAGA 3P0GA 5BR5A 3OE6A 3VVKA 4HWLA 5ETZA 5JJNA 4OV0A 5A45A 2G87A 4G70B 2QPDB 3QJQB 3CAPA 5TGZA 2I21A 1UCQA 1C8RA 1F4ZA 1GUEA 5B2NA 2YCYA 3ABWA 1H2SA 3MBVA 5JJJA 1PY6A 5AWZA 1GZMA 1JFPA 1S8JA 3EH5B 4FA7B 4EA3A 3QJTB 5J7AA 2J4YA 4DAJA 3S3BB 2Z55A 5ITCA 1X0I1 1PXSA 1U19A 5G53A 1Q5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQS A;  2YCX A;  4A4M A;  1DZE A;  1S52 A;  2X72 A;  2ZIY A;  4DKL A;  2YCW A;  3UZA A;  4FPD A;  2PED A;  4AMI A;  1BRR A;  2WJL A;  4MBS A;  5ITE A;  1S54 A;  1LN6 A;  2ZZL A;  2NTW A;  3UZC A;  3OAX A;  3HAR A;  5G2A A;  1XJI A;  3DQB A;  3AYN A;  4BEZ A;  4GP4 B;  1O0A A;  5H2P A;  1TN0 A;  4TL3 A;  3UON A;  2KSB A;  4KNF A;  4G72 B;  1PXR A;  3NS0 A;  4XT3 A;  4QI1 A;  1MGY A;  4NC3 A;  4XTN A;  1S53 A;  3KJ6 A;  1Q5J A;  4G71 B;  4HYX A;  4DJH A;  1XIO A;  2KSY A;  3OE8 A;  1QM8 A;  5AX0 A;  2ZFE A;  3RZE A;  5C1M A;  4QRY A;  4BV0 A;  2Y03 A;  1KME A;  1F50 A;  4WAV A;  1BRD A;  4L6R A;  3REY A;  4BVN A;  1VGO A;  1GU8 A;  5EN0 A;  3NY8 A;  1P8I A;  3PXO A;  1TN5 A;  3QBL A;  4BEY A;  1IW6 A;  3QJS B;  2YDO A;  5AZD A;  3VHZ A;  4XT1 A;  4HYJ A;  1P8U A;  3QJR B;  5G28 A;  1AT9 A;  4X31 A;  3QBG A;  3QBI A;  1BRX A;  4G7Q B;  5AX1 A;  3HAP A;  3VG9 A;  1C8S A;  2Y02 A;  3UTV A;  5B0W A;  3ZEV A;  4X1H A;  3X3C A;  3EML A;  3OE9 A;  3COC A;  2Y01 A;  4JKV A;  3S3C B;  4PXF A;  4PXK A;  3HAQ A;  4UHR A;  5B6Y A;  3PDS A;  4G7R B;  1AP9 A;  2I35 A;  5FJG A;  2L6X A;  3DDL A;  1S51 A;  4XXJ A;  1JGJ A;  4AMJ A;  5B6V A;  5H2J A;  2YDV A;  3QAP A;  3HAO A;  5H2M A;  3ZPQ A;  3NSB A;  5AHZ A;  4Y9H A;  5G2C A;  3WQJ A;  3PBL A;  1QKO A;  3V2Y A;  2KSA A;  4N4Y B;  3S3D B;  1VJM A;  2QPE B;  3OE0 A;  4BWB A;  4EJ4 A;  3VGA A;  3UG9 A;  1FBB A;  4GP8 B;  1QKP A;  3HAN A;  3RFM A;  1E0P A;  4EIY A;  1QHJ A;  5DHG A;  2RH1 A;  4MD1 A;  5H2O A;  5H2K A;  1P8H A;  4XTO A;  4FBZ A;  5H2H A;  3A7K A;  5G36 A;  4GYC A;  3VI0 A;  3NY9 A;  1L0M A;  2I1X A;  3EH3 B;  5KKH A;  3QBK A;  3QDC A;  4J4Q A;  1UAZ A;  3VW7 A;  2R4R A;  1F88 A;  4FAA B;  5JJE A;  1M0M A;  3QJV B;  3QAK A;  3C9M A;  1JV6 A;  2I20 A;  4UG2 A;  5A44 A;  1R84 A;  5AHY A;  5B6X A;  5G54 A;  4X32 A;  4LDO A;  1C3W A;  1X0S A;  1KG9 A;  2LNL A;  3UTY A;  1R2N A;  3AM6 A;  3BVD B;  5BR2 A;  4MQT A;  3NYA A;  4G7S B;  3ZPR A;  1JV7 A;  5H2L A;  1XME B;  3COD A;  5B6Z A;  4XTL A;  1CWQ A;  5LWE A;  1E12 A;  4JQ6 A;  4GP5 B;  1KG8 A;  1S8L A;  4MD2 A;  2Y00 A;  3D4S A;  2YCZ A;  3HAS A;  4N6H A;  4IAR A;  1BM1 A;  5H2I A;  2F93 A;  3ODU A;  4IAQ A;  2VT4 A;  4BUO A;  1X0K 1;  5B34 A;  1HZX A;  1IW9 A;  3PWH A;  4N4W A;  1FBK A;  1M0L A;  3UTW A;  1H68 A;  4QID A;  4LDE A;  5DYS A;  1L9H A;  2KS9 A;  5A8E A;  4GPO A;  2R4S A;  3UTX A;  1EHK B;  3EH4 B;  4JR8 A;  5DHH A;  1IXF A;  2BRD A;  3C9L A;  3X3B A;  2EI4 A;  5F8U A;  4KLY A;  2Y04 A;  4IB4 A;  3S8F B;  3T45 A;  4GRV A;  5H2N A;  1M0K A;  3V2W A;  4K5Y A;  2Z73 A;  3SN6 R;  3QJU B;  1KGB A;  2HPY A;  4WW3 A;  2AT9 A;  5B6W A;  3S8G B;  4LDL A;  5B35 A;  2JAF A;  5G2D A;  2M3G A;  2NTU A;  2WJK A;  3AYM A;  4L35 A;  2F95 A;  4GBR A;  3PQR A;  2JAG A;  3P0G A;  5BR5 A;  3OE6 A;  3VVK A;  4HWL A;  5ETZ A;  5JJN A;  4OV0 A;  5A45 A;  2G87 A;  4G70 B;  2QPD B;  3QJQ B;  3CAP A;  5TGZ A;  2I21 A;  1UCQ A;  1C8R A;  1F4Z A;  1GUE A;  5B2N A;  2YCY A;  3ABW A;  1H2S A;  3MBV A;  5JJJ A;  1PY6 A;  5AWZ A;  1GZM A;  1JFP A;  1S8J A;  3EH5 B;  4FA7 B;  4EA3 A;  3QJT B;  5J7A A;  2J4Y A;  4DAJ A;  3S3B B;  2Z55 A;  5ITC A;  1X0I 1;  1PXS A;  1U19 A;  5G53 A;  1Q5I A; 
#chains in the Genus database with same CATH topology
 4MQS A;  2YCX A;  4A4M A;  1DZE A;  1S52 A;  2X72 A;  2ZIY A;  4DKL A;  2YCW A;  3UZA A;  4FPD A;  2PED A;  4AMI A;  1BRR A;  2WJL A;  4MBS A;  5ITE A;  1S54 A;  1LN6 A;  2ZZL A;  2NTW A;  3UZC A;  3OAX A;  3HAR A;  5G2A A;  1XJI A;  3DQB A;  3AYN A;  4BEZ A;  4GP4 B;  1O0A A;  5H2P A;  1TN0 A;  4TL3 A;  3UON A;  2KSB A;  4KNF A;  4G72 B;  1PXR A;  3NS0 A;  4XT3 A;  4QI1 A;  1MGY A;  4NC3 A;  4XTN A;  1S53 A;  3KJ6 A;  1Q5J A;  4G71 B;  4HYX A;  4DJH A;  1XIO A;  2KSY A;  3OE8 A;  1QM8 A;  5AX0 A;  2ZFE A;  3RZE A;  5C1M A;  4QRY A;  4BV0 A;  2Y03 A;  1KME A;  1F50 A;  4WAV A;  1BRD A;  4L6R A;  3REY A;  4BVN A;  1VGO A;  1GU8 A;  5EN0 A;  3NY8 A;  1P8I A;  3PXO A;  1TN5 A;  3QBL A;  4BEY A;  1IW6 A;  3QJS B;  2YDO A;  5AZD A;  3VHZ A;  4XT1 A;  4HYJ A;  1P8U A;  3QJR B;  5G28 A;  1AT9 A;  4X31 A;  3QBG A;  3QBI A;  1BRX A;  4G7Q B;  5AX1 A;  3HAP A;  3VG9 A;  1C8S A;  2Y02 A;  3UTV A;  5B0W A;  3ZEV A;  4X1H A;  3X3C A;  3EML A;  3OE9 A;  3COC A;  2Y01 A;  4JKV A;  3S3C B;  4PXF A;  4PXK A;  3HAQ A;  4UHR A;  5B6Y A;  3PDS A;  4G7R B;  1AP9 A;  2I35 A;  5FJG A;  2L6X A;  3DDL A;  1S51 A;  4XXJ A;  1JGJ A;  4AMJ A;  5B6V A;  5H2J A;  2YDV A;  3QAP A;  3HAO A;  5H2M A;  3ZPQ A;  3NSB A;  5AHZ A;  4Y9H A;  5G2C A;  3WQJ A;  3PBL A;  1QKO A;  3V2Y A;  2KSA A;  4N4Y B;  3S3D B;  1VJM A;  2QPE B;  3OE0 A;  4BWB A;  4EJ4 A;  3VGA A;  3UG9 A;  1FBB A;  4GP8 B;  1QKP A;  3HAN A;  3RFM A;  1E0P A;  4EIY A;  1QHJ A;  5DHG A;  2RH1 A;  4MD1 A;  5H2O A;  5H2K A;  1P8H A;  4XTO A;  4FBZ A;  5H2H A;  3A7K A;  5G36 A;  4DS7 E;  4GYC A;  3VI0 A;  3NY9 A;  1L0M A;  2I1X A;  3EH3 B;  5KKH A;  3QBK A;  3QDC A;  4J4Q A;  1UAZ A;  3VW7 A;  2R4R A;  1F88 A;  4FAA B;  5JJE A;  1M0M A;  3QJV B;  3QAK A;  3C9M A;  1JV6 A;  2I20 A;  4UG2 A;  5A44 A;  1R84 A;  5AHY A;  5B6X A;  5G54 A;  4X32 A;  4LDO A;  1C3W A;  1X0S A;  1KG9 A;  2LNL A;  3UTY A;  1R2N A;  3AM6 A;  3BVD B;  5BR2 A;  4MQT A;  3NYA A;  4G7S B;  3ZPR A;  1JV7 A;  5H2L A;  1XME B;  3COD A;  5B6Z A;  4XTL A;  1CWQ A;  5LWE A;  1E12 A;  4JQ6 A;  4GP5 B;  1KG8 A;  1S8L A;  4MD2 A;  2Y00 A;  3D4S A;  2YCZ A;  3HAS A;  4N6H A;  4IAR A;  1BM1 A;  5H2I A;  2F93 A;  3ODU A;  4IAQ A;  2VT4 A;  4BUO A;  1X0K 1;  5B34 A;  1HZX A;  1IW9 A;  3PWH A;  4N4W A;  1FBK A;  1M0L A;  3UTW A;  1H68 A;  4QID A;  4LDE A;  5DYS A;  1L9H A;  2KS9 A;  5A8E A;  4GPO A;  2R4S A;  3UTX A;  1EHK B;  3EH4 B;  4JR8 A;  5DHH A;  1IXF A;  2BRD A;  3C9L A;  3X3B A;  2EI4 A;  5F8U A;  4KLY A;  2Y04 A;  4IB4 A;  3S8F B;  3T45 A;  4GRV A;  5H2N A;  1M0K A;  3V2W A;  4K5Y A;  2Z73 A;  3SN6 R;  3QJU B;  1KGB A;  2HPY A;  4WW3 A;  2AT9 A;  5B6W A;  3S8G B;  4LDL A;  5B35 A;  2JAF A;  5G2D A;  2M3G A;  2NTU A;  2WJK A;  3AYM A;  4L35 A;  2F95 A;  4GBR A;  3PQR A;  2JAG A;  3P0G A;  5BR5 A;  3OE6 A;  3VVK A;  4HWL A;  5ETZ A;  5JJN A;  4OV0 A;  5A45 A;  2G87 A;  4G70 B;  2QPD B;  3QJQ B;  3CAP A;  5TGZ A;  2I21 A;  1UCQ A;  1C8R A;  1F4Z A;  1GUE A;  5B2N A;  2YCY A;  3ABW A;  1H2S A;  3MBV A;  5JJJ A;  1PY6 A;  5AWZ A;  1GZM A;  1JFP A;  1S8J A;  3EH5 B;  4FA7 B;  4EA3 A;  3QJT B;  5J7A A;  2J4Y A;  4DAJ A;  3S3B B;  2Z55 A;  5ITC A;  1X0I 1;  1PXS A;  1U19 A;  5G53 A;  1Q5I A; 
#chains in the Genus database with same CATH homology
 4MQS A;  2YCX A;  4A4M A;  1DZE A;  1S52 A;  2X72 A;  2ZIY A;  4DKL A;  2YCW A;  3UZA A;  4FPD A;  2PED A;  4AMI A;  1BRR A;  2WJL A;  4MBS A;  5ITE A;  1S54 A;  1LN6 A;  2ZZL A;  2NTW A;  3UZC A;  3OAX A;  3HAR A;  5G2A A;  1XJI A;  3DQB A;  3AYN A;  4BEZ A;  4GP4 B;  1O0A A;  5H2P A;  1TN0 A;  4TL3 A;  3UON A;  2KSB A;  4KNF A;  4G72 B;  1PXR A;  3NS0 A;  4XT3 A;  4QI1 A;  1MGY A;  4NC3 A;  4XTN A;  1S53 A;  3KJ6 A;  1Q5J A;  4G71 B;  4HYX A;  4DJH A;  1XIO A;  2KSY A;  3OE8 A;  1QM8 A;  5AX0 A;  2ZFE A;  3RZE A;  5C1M A;  4QRY A;  4BV0 A;  2Y03 A;  1KME A;  1F50 A;  4WAV A;  1BRD A;  4L6R A;  3REY A;  4BVN A;  1VGO A;  1GU8 A;  5EN0 A;  3NY8 A;  1P8I A;  3PXO A;  1TN5 A;  3QBL A;  4BEY A;  1IW6 A;  3QJS B;  2YDO A;  5AZD A;  3VHZ A;  4XT1 A;  4HYJ A;  1P8U A;  3QJR B;  5G28 A;  1AT9 A;  4X31 A;  3QBG A;  3QBI A;  1BRX A;  4G7Q B;  5AX1 A;  3HAP A;  3VG9 A;  1C8S A;  2Y02 A;  3UTV A;  5B0W A;  3ZEV A;  4X1H A;  3X3C A;  3EML A;  3OE9 A;  3COC A;  2Y01 A;  4JKV A;  3S3C B;  4PXF A;  4PXK A;  3HAQ A;  4UHR A;  5B6Y A;  3PDS A;  4G7R B;  1AP9 A;  2I35 A;  5FJG A;  2L6X A;  3DDL A;  1S51 A;  4XXJ A;  1JGJ A;  4AMJ A;  5B6V A;  5H2J A;  2YDV A;  3QAP A;  3HAO A;  5H2M A;  3ZPQ A;  3NSB A;  5AHZ A;  4Y9H A;  5G2C A;  3WQJ A;  3PBL A;  1QKO A;  3V2Y A;  2KSA A;  4N4Y B;  3S3D B;  1VJM A;  2QPE B;  3OE0 A;  4BWB A;  4EJ4 A;  3VGA A;  3UG9 A;  1FBB A;  4GP8 B;  1QKP A;  3HAN A;  3RFM A;  1E0P A;  4EIY A;  1QHJ A;  5DHG A;  2RH1 A;  4MD1 A;  5H2O A;  5H2K A;  1P8H A;  4XTO A;  4FBZ A;  5H2H A;  3A7K A;  5G36 A;  4DS7 E;  4GYC A;  3VI0 A;  3NY9 A;  1L0M A;  2I1X A;  3EH3 B;  5KKH A;  3QBK A;  3QDC A;  4J4Q A;  1UAZ A;  3VW7 A;  2R4R A;  1F88 A;  4FAA B;  5JJE A;  1M0M A;  3QJV B;  3QAK A;  3C9M A;  1JV6 A;  2I20 A;  4UG2 A;  5A44 A;  1R84 A;  5AHY A;  5B6X A;  5G54 A;  4X32 A;  4LDO A;  1C3W A;  1X0S A;  1KG9 A;  2LNL A;  3UTY A;  1R2N A;  3AM6 A;  3BVD B;  5BR2 A;  4MQT A;  3NYA A;  4G7S B;  3ZPR A;  1JV7 A;  5H2L A;  1XME B;  3COD A;  5B6Z A;  4XTL A;  1CWQ A;  5LWE A;  1E12 A;  4JQ6 A;  4GP5 B;  1KG8 A;  1S8L A;  4MD2 A;  2Y00 A;  3D4S A;  2YCZ A;  3HAS A;  4N6H A;  4IAR A;  1BM1 A;  5H2I A;  2F93 A;  3ODU A;  4IAQ A;  2VT4 A;  4BUO A;  1X0K 1;  5B34 A;  1HZX A;  1IW9 A;  3PWH A;  4N4W A;  1FBK A;  1M0L A;  3UTW A;  1H68 A;  4QID A;  4LDE A;  5DYS A;  1L9H A;  2KS9 A;  5A8E A;  4GPO A;  2R4S A;  3UTX A;  1EHK B;  3EH4 B;  4JR8 A;  5DHH A;  1IXF A;  2BRD A;  3C9L A;  3X3B A;  2EI4 A;  5F8U A;  4KLY A;  2Y04 A;  4IB4 A;  3S8F B;  3T45 A;  4GRV A;  5H2N A;  1M0K A;  3V2W A;  4K5Y A;  2Z73 A;  3SN6 R;  3QJU B;  1KGB A;  2HPY A;  4WW3 A;  2AT9 A;  5B6W A;  3S8G B;  4LDL A;  5B35 A;  2JAF A;  5G2D A;  2M3G A;  2NTU A;  2WJK A;  3AYM A;  4L35 A;  2F95 A;  4GBR A;  3PQR A;  2JAG A;  3P0G A;  5BR5 A;  3OE6 A;  3VVK A;  4HWL A;  5ETZ A;  5JJN A;  4OV0 A;  5A45 A;  2G87 A;  4G70 B;  2QPD B;  3QJQ B;  3CAP A;  5TGZ A;  2I21 A;  1UCQ A;  1C8R A;  1F4Z A;  1GUE A;  5B2N A;  2YCY A;  3ABW A;  1H2S A;  3MBV A;  5JJJ A;  1PY6 A;  5AWZ A;  1GZM A;  1JFP A;  1S8J A;  3EH5 B;  4FA7 B;  4EA3 A;  3QJT B;  5J7A A;  2J4Y A;  4DAJ A;  3S3B B;  2Z55 A;  5ITC A;  1X0I 1;  1PXS A;  1U19 A;  5G53 A;  1Q5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...