3PWUB

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801(bola-a11)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
molecule tags Immune system
source organism Bos taurus
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwuB00
3G6DH 1CWVA 4LIQL 5C9JB 4X9FA 1G9ML 4WFFD 1F45A 1N7MH 3FZUD 1MHEB 5B4MD 2VDQL 3MRMB 3OAZH 3SGKC 3EHBC 1FH5L 5IBTL 3VU2A 1NANI 2C3WA 3V8OA 1AGBA 3D3VE 3OAUH 5IMKA 12E8H 4PRNB 4ZG1A 1G6VK 1NBVH 4RMVA 3HN3A 3TN0B 3F7PC 2YPKB 3MJ9L 5D8JL 1UC6A 4PS4H 3O4LE 4PJEA 3DI3B 4ODVH 4FMKA 4OZFB 5F7UA 1KLUB 5BO1L 3IDXH 1IGMH 4MNGA 2ZZUT 4RGNE 4LVNC 4Y4HC 1ITCA 4Y16C 2VL5B 3KYAA 3O11B 1CD1A 3BESR 2CRMA 1GIGH 2B0SH 4XMKL 4PR5B 3A6BL 4PRDA 1H3WM 2BDNL 2HFGH 1KXTB 1X5YA 1VGKB 4J7RA 5H37H 2Q3AA 1K5NB 2F5BH 3QQ9C 3MOBH 5SWSD 1Z9SA 5F96L 4ERSH 3ARQA 4ETQA 2NTFA 3KHOA 4AIZA 1BQLL 3QUKB 2B5IC 1MCJA 1RHHB 4QWWC 5IFJA 2Y9RT 3DXAD 5TDPA 1I9RL 3L1OL 2A6KB 1S7RA 5DJAB 1CVRA 4DOHE 4CUCA 1WBYB 4R8WL 2B39A 5MENA 1OGTB 5I8KL 3SCMB 4ZUSB 1V7NH 4RFNB 3G08A 1H3UA 3OKYA 3D39B 4YBQD 3MV8D 5HHVH 1T1XB 5GS1B 1DVFD 2YPLA 3GO1L 3QNZA 3SDDB 2XA8L 3WNLA 3WS3B 4DW2H 4XCEB 4CU6A 2EKSA 3MRBB 4G7VH 3OZ9H 5F9DC 3RVWC 2CKBH 4I77L 1F5WA 3Q2CA 3CFCL 1WBYA 2R0WL 1S3KL 4RMSA 3RU8L 3GIVB 3KPLB 2ZNXA 4PRAA 4PP2A 4D0CA 2IBZY 1EGJL 1F58H 2NNAA 4OCRH 1ONQA 1WUNT 3TPUB 1A2YA 1PDKA 3FO9B 4P2YA 4A2MA 4V2CB 3P9LB 4X6CB 5CILL 5CWSB 3O4LA 3MTRA 3G6JB 4KTDL 5C2BL 1K4CA 2FR4A 4P5KA 3VFPB 4NO5A 3RWGB 3ZKQD 4BUGA 2AJVL 5DO2C 3S6CA 3QXDB 4B50A 3NTCL 1MWAB 2CLVA 2IH3B 3MR9A 1QYGL 4UBDC 3UBXI 4HS3B 1OD7A 1OW0C 2APBA 2P48B 3VXPA 1OAYL 1LP9F 1HYSC 2H32B 4JFQB 3S4SA 1RIHH 3GMOA 4NCDA 2X4TB 4OT1H 4V1DD 3ECBB 1MHHB 1RZJH 4KU1A 3MRCB 3VCLB 1N64H 4R97C 4ZUUB 2HVKB 4HS3A 2CO6B 2IJ0C 1DEEA 3LN4A 1FNFA 5KBNC 3UTTE 4KTEH 5EPMA 1WBXA 5ADOH 1A7QL 3BX7C 3PWPE 5ESQB 3G6DL 1VA9A 2WBJB 4DZBB 3AROA 4OD2B 1QOKA 1LEIB 3SE3C 5I1JH 2XPGB 5HHOD 3VGBA 3VI4E 4FFYH 5I0DA 2BJMH 4IRJB 2H2PD 1FZOB 2FD6L 1T1ZB 2PW1B 4ZDHA 3MV9B 2D7PA 4Z95H 3WNPA 5DFTA 2AV1A 1JNHA 1L6XA 4JN1L 4F7CA 3IJHA 4LEXL 1YEGH 3H9HB 4N1CA 3V6FA 3K4AA 1AD9A 2AXGB 1A6AB 3WXWL 2NXZD 3T2NH 2ATPA 5LQBH 1U8PA 1XGQB 4P4RA 1G9NL 5EBLB 4KC3B 4AEHH 3R0NA 4JDZB 2X4NB 1OGAD 3C6SB 3HG1D 3ZDZF 1NBQA 1IC5L 3VXUE 5IQ9A 5I1GL 5KSUA 1IVLA 3V6OC 4Y88A 1TFHA 2OK0H 3A6BH 3GB7B 3HUJF 5IMLB 4H5SA 3BQUD 2FZ3B 3FMGH 1T5WA 4KPHH 5DHVH 1DQQB 1RSFA 3RRQA 3DRTB 5E6IC 2O61A 4WHDA 4NKMB 4KJWC 2DQFB 4P4RB 3WIHL 3DOSA 1GGCL 3JSSA 3VFUA 4PRBA 3U0PA 1CBVH 2ARWA 2H6PA 1F90L 2A73B 2G9HA 4P4KC 4L4TA 15C8H 5IQ9B 5IMMA 1DQTA 5C0GB 3BJLA 1PW3A 4TTGA 5D1QC 3KYKL 1YNKL 1A1MB 3MRRA 3ULSB 1BJ1J 3Q6GH 3PHQA 2X6MA 5DA4A 4U6VH 2X40A 1LNUA 1CG9B 5F88A 1JN6B 1U9KA 4OZIB 1JYNA 4QHLA 1M7IB 1YMMD 2G60H 3QDGA 3H42H 4G9DA 2JF1A 3QQ9D 5EU4A 1RK0B 3I6GA 1DANT 3IDIA 3OJ2C 2X5PA 1I7UB 1CG9A 4JFHE 1F42A 2KKQA 2ZUXA 5CJXA 3V4PL 2PXYB 3MGOA 5LKNA 1A6ZA 4YXLL 2WWMC 2P5WB 2R0KH 2CR3A 1P9MA 3S35X 2O93L 5ISZE 1A47A 1E6JH 3QPQD 1QUNA 5C0BE 3MLZL 2GJ6A 2D4FA 4F57L 5EBMB 1OT2A 1G84A 4MAYD 2Y07H 2PW2A 5FKAA 3KPLA 4AM0B 4O58H 1KTKE 1AQDB 5LGJB 2VABB 3WN5B 3G5YB 1ZEAH 1RZ7L 3EDFA 3OPZH 4RNRB 4HDIB 4P5TB 4FTVA 4DTGH 2R4RL 1GJIA 5C0AD 3O4LB 3PWJB 4PJXB 3G6JA 3JVGC 2BVYA 1N7ML 1VADA 3EYQD 3SCMC 2XXMB 1BOGA 4JFFA 4X80L 3KPTA 3ARDB 3RWEA 2HT4C 4QT5B 1R3HB 3SE4C 1S7VA 3QI9D 3FFDB 1YEIH 2XKNB 3ZT5A 1I7RA 1I85C 4IS6B 2BCKB 4QXTA 2OJZH 1EBPA 4Z7UF 5F6HI 4KGJA 4LCWD 2GSGA 4YWGL 5HGDA 1MRCL 1TLKA 4X4YA 2EH8L 5H94A 5SWQA 2HVKA 2BMKA 4XCYA 5E2UH 1II4E 1BVLB 3I6KB 2ADJB 3CLFH 3UP1A 1XGRA 1RUML 4L3EE 2I60H 3BEWA 2R0ZH 5E2WH 1WWWX 2VWEC 3FQNB 1EAJA 4YXHH 3K4ZA 3CDCA 3G9AB 2C5DC 1S7XA 2E6PA 4NKOB 1P1ZB 1H8OA 1OAUH 2I26N 4JO2L 1OARL 3L1OH 4HCRL 4OD3L 5I1GH 3AS3A 3MO1A 3UTTA 5D93C 1CLZL 4NRXA 3NMEA 4QHMB 2HTKC 4OZGF 1OP3K 2D0HA 2E3VA 4HPOL 3NFPB 3Q6FB 3HRZA 5SV4A 1QHOA 1EV2E 2NPLX 4OZGA 4CVZA 3UTPD 1HHGB 4LARL 5F97E 5C0FB 4WFFE 2HG5B 2NXYD 1KG0A 4L4VB 4APQA 1CGSL 3V7AG 4PJHA 1AQKL 3D3VA 2WIIB 1JPSL 1CXHA 1T20B 4E41A 1YEHL 5IB4B 5MEPA 1FBIL 3QHTC 1ND0A 3O45B 4KDTC 3UBXG 3S98A 5F93C 1OTUC 1AGFA 5DMKA 4OB5H 4PIRF 4CVXB 5HI3D 3ETBF 3MRJA 1VSCA 2HTLD 5HYSB 4RBPH 3VD5A 4R4FH 3HZKA 1NFDF 3SDCD 3SKNB 5CIPB 4WWKC 4M1GH 5E00B 1A6PA 4LLVA 1V7MH 4UIKH 4LPWA 2V5SA 3OKKB 1I8KA 2HKHL 2CIKB 4S1RH 3TFKC 1C12B 2XZAH 4E41D 3FAWA 2YPKA 3IETA 4K3EL 3F7VB 3W0WD 3P77B 5JW4R 4H25A 3T4YA 5IB3B 5SWSB 4KTEL 4L29B 1K3IA 4MLSA 1N26A 5I8KH 5HYEA 35C8H 3FOMA 3FT2B 1KIQB 3BT2L 1NGXB 1U95B 2QQNL 4Y4KD 5C7XL 1S5IL 2AEIT 1BWWA 4OCYH 2DOCA 4G3YH 4G7VL 4LCYB 2SEBB 1A3RL 3A6CL 2UVEA 3BN9C 3NZHL 3TBSB 4NM8L 1MJ8L 4RAVA 4JN1H 4NQDD 2EDOA 3WD5H 4OAWB 3PGCA 1R5WA 2XY2A 3DX7B 1KULA 1R5IB 3SJVB 4MB5A 1YQVH 1BIIB 3R06B 3T0DA 1MUJA 3G5XB 4MA1B 1N6QL 2OTWA 3ZLQC 3IKKA 3LOWA 5F9WB 3HMXH 2IAND 1J0JA 4XVTH 1EVUA 3CIQA 1GZPB 3TIDB 3SKUD 3TZVA 3HZYB 5FO9A 4LSVL 4LLWB 1R5WB 3SDAC 4DKFL 4BZYA 5KVGL 4I0PB 3IFPB 1YUHB 3B6SA 2YWYA 4XI5C 5K9JL 1E6OH 4Q6IB 3VXQB 1AIFB 3IU4L 1GYAA 2XZQL 4PJAB 3V6BR 4EIZC 1LGVA 1PD6A 4L8SB 1RIHL 3W81A 3B5HA 4OT1L 1CL7I 5AYQA 2DICA 2YSSA 5SX4H 1BQSA 2R56L 3VRLF 5CJXC 1QFWI 1GPOL 4IDLA 4R90H 5C8JA 5KSVA 1A4JA 5JZ7C 2R29L 4Q6IA 4H8WL 5D7IF 4UTAH 2B0SL 4XMKH 2JIXB 1U91A 2MPAH 2IPUG 3I2CL 3MRLA 4JHWH 1VKXA 2XT1B 4IHOA 4OGXH 3ZE2F 5T1LB 1QQDB 5E4IA 4W4OA 3FRUB 3MJ7A 4HX1A 1TDQA 3T65B 4C56A 3AREC 1KT2A 2EXWC 4IRSC 2AAVA 5FO7A 3QXDA 3GRWL 1A7RH 4P23D 1ZVSB 3BKMH 3FB6A 4WW2A 3MLXL 1FN4B 1NBZB 1XH3A 1NDMB 3FO2B 4LLQA 3BGMB 3KPRB 3QEUA 5IB2B 1MWAH 2FEDD 3L5JA 5E99L 3M07A 4L3EA 2ICWB 1K5NA 5JA9A 4LGPB 1L7TH 5D2NA 3QUXD 1HN1A 3BKYL 5EFIB 1YMME 2H2PC 4XPHH 4NQXB 3QCUH 2ZCHH 3IFNL 3VXMD 4ZPTB 3ARFD 4G9FE 5ITBL 3MXVH 5ALBH 2VLKA 2Q8BH 2G5BA 4JFHD 4GAYB 5DEFA 3TCLA 1F4XH 2J5LB 4EI5C 4MCYB 4O4YL 5B39A 5HPMB 4Q9QH 1IILE 2AK1H 4L9DA 3DGGB 1CLYL 1HWHB 4P9HC 3PXHA 4ZXBC 3RBSA 3D5OF 3IFOA 3QIBA 3BPOC 1R3KA 4BZ1H 5GJTL 1BD2D 4CVXA 4CGTA 1F90H 1FRGL 1DSFL 2PW1A 3BP5B 1I7UA 3PF2A 4ZSOB 1ADQL 3BP7A 2FX8H 5E6YA 5DFVD 5B38B 3TZVD 3VXUD 5E00A 3QA3A 2E5EA 4AQOA 5MHSE 5KAQF 5K9QI 4DGIH 5EU5B 4IJ3B 2VISB 3I6LD 2YN3A 3V79C 1JGUL 2DS4A 1W0WB 3PP3K 3L3KB 1Z5LB 4KRNA 5E9DE 2JB5L 1IEBA 2P47B 3T2PA 4PGZA 4MJIA 3UAJC 1QFOA 2OP4L 1MCCA 4Y5XA 4M5YL 1VPOL 3IDGA 2Q1EA 1OP5H 2C3VA 2C3GA 3S88H 3DRQA 2BZDA 2P24A 3VE0A 5FHBH 3U2SA 2A6IA 4Q7DA 4QKXB 5A43C 1WAAF 1QRKA 2FO4A 1E6JL 4GJTB 2WZPD 5KSAC 4NNYB 2XIDA 1OM3L 5T3ZE 1VFBA 1UB5A 3P11L 4WU5A 5CGYD 5JORB 4OF0A 2P7TA 1MRDH 3CFBB 1T0NB 2RB8A 2XWBB 3PIQB 1AR1D 4LPTA 4MMZC 2WWKO 4F15B 1PG7H 2FGWH 4XC1H 3CDFA 5EU4B 1YEEH 2R39A 5GRJH 4QRRB 5IEKB 4EKXA 3NCBB 4U6YB 5FOJA 4FXGB 4FQLH 1U3HB 1G9NH 2C4XA 3EO0A 4OLUL 3U83A 3SN6N 1UCBL 1A02N 1S8DB 1JF5A 4UTAL 3V5DA 4JO1H 4M03A 4KKCD 4FNLH 3U7AA 2R1WB 5FYJL 3SDAD 2OTUB 1AR1C 1PAMA 2H1PL 3BRGC 1S7XB 4B7LA 4ELKA 3WEXB 1OB1B 2ADIB 4HJGB 5DZOA 4KV5E 4POUB 5FKAB 1J10A 2NTSP 2Q76A 1W72B 3KYKH 2R0WH 2IQ9L 4LCUB 2ENSA 4HQQH 3AUVA 1KB5B 3IDJB 3NABL 4NKMA 1MVFA 5DUBB 4I0PC 3RWJB 3SE9H 4LLYB 1JWUA 4M7JH 1C08B 3QULB 2W91A 4GRMA 4Y2OA 1UJ3B 2PR4H 5J0BA 5ALCH 1IEAB 2L0DA 2EXWD 3LDBB 4PD4J 3HE6A 2BCKA 2ZUTA 4XWGH 1UXSA 4PJAE 4JQXC 4KHXL 1CE6A 1J8HB 4U3HA 4G42B 5AAWA 4WI6A 1ZE3C 4LLYA 1CLZH 4GRWF 2E8ZA 2E7CA 1BOYA 1WCQA 2Y6SC 4WTZA 1D6EA 5D96B 5H94B 1UJ3A 4PJGE 3KLHC 1OLLA 2GJZA 5GGQL 4ZUTA 3VD9A 1FRGH 3U6RA 3B9KB 2X05A 4G3YL 4E5XB 2GUOB 4HEME 4Y2DA 4U1SB 4D9QE 3GI8H 3KPPB 3R4DA 1T6VN 3OKLB 3FZUC 2DJUA 3H9YA 5HHXH 4N1HB 1UXWA 1ES0A 5F6IC 3LIZL 5GS0D 4PJHE 4YDLC 1IKNA 3OPZL 1P1ZA 3VG0L 2H2SD 3L5WA 2NY7L 4IDJL 4WO4A 3J8F7 1MCQA 1OD9A 4P2OB 4ZUVB 1AQDA 1HK6A 1PKQE 2NY2C 2J8OA 3RWHA 4MX7A 4M7ZB 3UTQA 2C26A 4UNUA 3BVNB 5FHBL 4WU7A 2XKUA 1LWRA 3EYFA 4MJIE 5TF1H 4EDWL 5J1AA 3UTSA 2X9WA 3C8DA 3D69B 3OF6A 1PYWB 1MCSA 2JJSA 4X6EB 2DJSA 3NTCH 3LEVL 1TQCC 25C8H 2NY0B 5T33H 3M8OL 4OGXL 1ZLWH 5C08D 4NYLA 3RWCB 3MREB 1RUQH 4HW6A 3K3QA 4I4WA 2DLHA 4LOUC 3ULUF 1CF8H 3S35H 3NN8A 4EUPB 4PY7B 2AI0H 4GS7C 4UNTA 4JRYE 5JLZB 2XTLA 1HCVA 2KQMA 4JFDE 4N8VG 3Q6GL 4OD3H 1TVHA 4X4MA 1SJEB 1KIRA 5TE4H 1RVFL 5CD5D 1FZJA 5IW3A 5SWZD 1YQVL 4K8RD 4KUCF 4CN4A 2DYPA 4HUMB 2JELH 2BHUA 4NDMA 5IFHH 1SEQL 3L3DB 5ACZA 1CCZA 1D6VH 4P9HH 1QBMH 2AK4E 1MF2L 4XVTL 3L7FA 2Q8BL 5GSRB 2IBBA 1JZ5A 4UQ3A 4ZQKB 3DO3A 1Q9WB 3VXMB 3GGWA 5KTEL 5KVGH 1X44A 1DBBH 3LH2L 4JAMB 1NEZB 1FNHA 4P99A 4CNIA 3AM8A 4JPVL 3S4SB 3ULVC 2X1XR 2LVCA 5CGTA 1PKQA 4A6YL 1IT9L 1RUKL 5J3HC 2HT2D 4I3GA 3BN3B 1MJUL 5F9OH 2B20A 4JRXD 3WXWH 1PJ9A 1QRNB 4WUKH 4PTUB 5I6XC 4POZD 3D25B 3K7UA 4YDJA 1P4IH 3H9HA 4MA8H 4H8WH 1FSKB 1SMAA 1IGFH 1LK2A 4HSQA 1LILA 4FQQB 1B90A 4B5EA 1V05A 3NCMA 2OLDA 3O2WH 5I16B 1GL4B 4PG2A 4P3CH 4Y5YB 5E2VH 1MFBL 1U2HA 4WHYH 3GMNB 3H0TA 15C8L 1U42A 1A5FL 1F4WL 2ICEB 3O2DH 1RMFH 2O61B 3SDXB 4F7CB 3TNMB 4HJJL 1IKNC 3FQWA 1EX0A 3LKNB 3U7WL 5GRYA 5MI0C 3MROB 4OQTH 3BKYH 2PTVA 5D6CB 2R1YA 3TH4T 2A6KA 5ISZD 4P57A 4X5WB 4YZFF 2Q86B 3SGJC 1Q72L 3NFSL 4XB7A 3EDKA 5KJRL 3EUUA 4O51B 1XGUA 2CR6A 4PJEF 4UT6L 5I76B 4PJIB 3UBXB 1FIEA 3L95B 1FG9C 1RUAL 4MNHA 4MNQA 4U0QB 2HRPL 1RUMH 3BZFA 1P5UA 2VLMD 1I4FB 3TO2B 4XH2B 2VLKD 1MSPA 4RAUB 5E2WL 3CMOH 3NACL 2UZYB 2R1XA 5JTWA 1NBYA 4LCCC 4PRHB 2Z31B 2NZIA 2Y72A 5DURD 5I1DA 1AXTH 2PF6A 3F7RA 3QUMB 2FNBA 5IM7B 1ADQH 2LV4A 3B2UD 3VH8G 4UU9B 5E8NA 4Y1AD 5HD8D 4MNGB 5JR1H 2FJHA 3QQNA 3LEVH 1BBDL 3IDMA 3D18A 5EIQA 2B5IB 5LCVL 3C6LB 1ZHKA 5F9JB 2XZQH 4LLUA 4K7FA 4U1KB 3GBNH 1UB5B 4U1IB 3GI9L 1KB9K 1BLNA 5HHNB 3PWPA 4MHHI 4XPTH 1QFWM 3LB6D 4R4BA 3TZVB 1PFCA 1C1EH 1FQ9C 5IR1A 1P7QD 1DR9A 4D9LH 4JHAL 1YJDH 1QBAA 4L1HA 4YC2C 3GSUA 2VUOA 4NRZA 4LVNB 3WHE1 4J23A 5TE4L 3IAGC 4NC0B 3SE9L 4KK5D 1LMKA 2E8YA 3JWOL 1L6ZA 4AQ1B 2J8UF 1OSPH 4OUUB 2Z4QA 1T1YA 2Z8WC 2NY2D 3W9EA 5C0CB 3VFSA 3WE6A 2ERJC 4K7PH 1CQKA 3PDGA 1C16B 4UILH 2ZSVB 4HFUH 3CX2A 4N0FA 4TVSa 1D5ZB 1YC7A 4XC3L 5T1LA 1NAMH 1Q1JL 5B3JF 3B6SB 2PUQT 4PV8A 4HKZB 4XPHL 3KPRD 1XR8A 2NW3A 5IVXA 1CIDA 3PQYA 1F6AA 4Z7WA 4QYOA 3GMRA 3KR3H 3UYRH 4P23B 1NGQL 1YMHB 2F8XC 2CGRL 1VFUA 4NO2A 2BRRL 1KJ2H 4XPAH 3KPMA 5IW1A 2BY1A 3RJDA 4NKIL 4NOFA 3Q5TA 4J8RA 4P2QA 3NZ8B 2AXHA 4P23A 3SPVB 5M7QA 1T04B 3WN5C 4Y0GA 5CJBA 2X4PA 1REIA 1H3TA 2G2RA 4ZS6C 1UH4A 1LO3L 2D9QB 4R0LB 5CAYB 4YE4H 3Q6FA 5TQ0H 3QCTL 4X6CE 1L0XA 3BGMA 3KPRA 3DXAA 1CXEA 5A16B 1NL0L 4WUUE 3R1GL 4HMCA 4KZDL 4PJHB 2J6EH 3KNBB 3D0LB 4KMTL 4IOFD 3IFLL 3DV6A 3O3UN 1KEGL 3W2DH 5SWZE 2WUCH 4P2QD 2IMMA 1DANU 1YYMH 4G43A 3T3MF 3LS4H 5IBUG 5IMKB 4WFGE 1HHJB 3S36H 4N0UA 5JQ6L 3VFWA 4U2ZA 4Z7VF 3CZJA 4UV7H 1UG9A 1V3KA 2XZAL 4LASH 3PHSA 4Y5XC 2F58L 1U58B 1UVQB 5I66A 3CCHA 1BQHA 5LGKA 3KDMB 4D9QD 3LIZH 5DMKB 2Q7YA 3VFTA 4XVUD 2NY6C 4KUZL 3FT3A 4M5ZH 1XAUA 3P3YA 2BVPA 1IGIL 5D1XB 5IFHL 3ALWA 5IM7A 1K8IA 3GMQB 4ODXB 4ZODA 3NOIA 1EH9A 4L4JA 3MRQB 4YIQB 4FRWA 2EYRB 4IRSA 3T04D 5SV3A 1BF2A 5I1EH 1QNZH 4JFDD 2CKBB 5FDWB 2IPKA 1C5CH 1MWAL 1VADB 1FFNB 3VWJA 5B22A 4AG4L 1BZ7B 5JXEC 5AYUL 3QXWA 5CLTA 8FABA 5L8KB 5DF0A 1T3FA 4YC2B 2P5WD 4LCYA 1MH5A 4QHKI 2Z9TA 5H2BA 1XFPA 3I50H 3P77A 1J11A 4OLZH 4H25B 1ZGLP 4HFWA 1G9EA 4GUPB 1KIRB 4LF3A 1YY8B 2MWCA 1VESA 4JKKA 2EDHA 3FT2A 2BDNH 4BFGA 1EHNA 4JHZA 5C0RH 5IIEB 3TF7C 4M02A 2H8PB 2OL3H 1V3JA 3GSWB 3ESUF 4MJID 5FGBC 1XGRB 2V9TA 5T1DL 3UDWA 1G7PA 5FHAL 4PJDF 4BQ6A 5DZLA 1J5OL 2IBZX 1N59B 3TJHD 5LAXB 2YD5A 3A6OA 4MX7B 4OQTA 1NEUA 3EYSL 5JMOC 4WW2C 5EBWA 4WFHE 1KLFA 1UH2A 1XR9B 5D1ZB 3U36A 1VFAB 5F7EH 5EZOH 2FL5B 3G5YA 4ZUWB 1J88A 4K07A 4KVNH 3BQUB 3KPSD 3HC3L 4P9HL 1XIWA 3VFRA 2BNUA 2DWEA 4Q6IC 3JWOC 3LEXA 4JPIA 4MB4A 4K71C 3VXSD 4M1DH 5JDSB 5GHWH 3JV0A 3STLB 3BPCB 3VFUB 5C6WH 2AW2A 3A0OA 4YDIH 3MRFA 4J4PC 4L4VA 2HP4A 2HFTA 1JNLL 3MBEB 1BHGA 2FECI 4KZDH 1NMBL 1MFCH 3PWUB 3TEUA 3B83A 1RZ8B 1QSEB 2FX7L 4KH2A 3CSPA 3T77A 2NQCA 3SDAA 3VXOA 4K23H 2R2BA 4HHAB 1T2QL 3F62A 1FZJB 2ICES 3OKOB 1BP3B 5HHOB 4HGMA 1QSED 4I3RL 1F6FB 3DPBA 2D31A 3QNYB 5D5MB 3HTLX 5DHVB 2ENYA 1RUPH 2Z91A 4FQHA 3GBNL 5JO5A 2I07A 2RCSH 5HI5D 3VMOA 1X5ZA 1JNHB 3QI9B 1A5FH 2NMSA 3EJZC 1T1WB 5IB5B 4UV4L 4KI5C 3FQNA 3VXTA 4X6DF 4XPGL 5E5MA 4XI5D 2JJUA 3QEQE 4KTYA 4FNLL 3ZDXE 5FUZL 4M1CC 4Q6YA 3MRGA 1AE6L 4UT9L 5ID1B 5I6XB 2R2HA 5D9SB 3HI6L 4NJ9H 1CD9B 1N5YH 3LQMA 3UTSB 1YJDC 4YK4C 4GRWE 5IMLA 4UQ2A 1Q72H 2ZCKL 4EZMA 1CF8L 5D6DA 4BSVB 2XACC 1ZT1B 1UVQA 3L6FA 5EIVA 3N0PB 4P46D 5EOTB 2R23B 2CDGB 5K9KB 1C5CL 4NQCE 4OCXH 5IW6B 1CL7L 1A14H 4X5XA 3LRSA 1HDMA 5HGBA 1ERNA 3ARGA 1CGTA 1FJ1A 3ZKXC 3V5KB 3MV01 4P59H 5C09A 1NCWL 4KK5C 3S96B 5KSAB 4KKBC 3RTQC 3EYOB 4LCWA 4PJCF 1SMOA 4IOIB 1TZIB 5HY9B 4YX2L 3WSQH 4GW1A 3WL9B 1HQRA 1XCTA 2VAAB 4KPHL 2I9TA 3VXRB 1JZ6A 1SJVA 2DYPB 3ZE0E 4OFPA 3BI9X 1P6AB 5SWSE 1KN2L 4OJFL 1MJUH 5F9OL 1WC7A 4MVBC 2PXYA 1RU9H 3MGOB 3VGFA 4WUKL 2WSKA 2OR9H 3SQOL 4YR6A 4APQC 3RVVD 2XN9A 2FB4L 1YNKH 5D93B 4TUJB 4MA8L 2UVFA 1TQBB 1ACYL 4M62H 4FQ2H 1QBLL 4HIJA 4KI5F 3LPWA 3UTSD 1TJHH 3QFDA 5A2IH 3EOYG 1NCUA 2H1PH 4N90D 3TIEA 1VFBB 2QR0A 3JWOH 1YPZA 5DJ6B 1CFVL 2AEWA 4K3DL 1T21A 3GJFH 4XCFL 1F11A 1QPXA 2AJUL 2X2YA 3JVGA 4OCSH 2EIBA 4PJAF 2LAGB 2O5XL 3GSXB 3LRHA 1OB1A 2YXFA 1BEYL 4MDJA 3ARGC 4WI8A 4IIQB 3VDAA 1V3MA 4K55A 1W72A 3ARDA 4UNVA 2KQNA 3AC0A 5F1NA 4DVBB 3RAJH 4LCUA 2CUIA 2PR4L 4W6YB 3CVHB 4R96B 3ULVL 2UWEE 2VXQH 4S1DC 5HI4D 1CDJA 1T2QH 3BIKB 2ESVB 3RDTA 2XI9A 4XMPH 2CK2A 1KJ2L 4OZ4A 4XPAL 2W59A 4XP6L 4ZOBA 5FOBB 1MY7A 3WFHA 5DEFB 3TCLB 4K94L 4UT7L 1H8NA 4R7DA 2VL4A 1KPUA 1RK1A 4NQED 1AXTL 3IJYA 2IAMD 1NKRA 4QO1A 1I7TA 2Z8RA 1UQSA 3Q48A 1KXVC 3BKJH 3QIBB 3SE4A 3LV3A 3W9DB 1QNZL 5BJTA 2FJFB 1LEKB 1U8PB 5AUMA 3HR6A 2AABL 1FYTE 3ZDZE 1WIOA 3OKEB 4FG6C 4N0UB 4MMXC 1MIML 3DECA 4UT9H 3CK0H 5GRVK 2CJUH 4MD0B 2BHZA 3GI9H 4JRWA 2ZCKH 1WZLA 2F5AL 5E8NB 2W07A 3VFTB 3W0WE 4K71B 3S37L 2V5TA 5BOPA 1DN0A 5CJQH 5HGHA 3CVHH 4MJIB 3SO3B 2BFVH 2CK0L 1CL7H 2F54D 1GGBH 4K7FB 3MUGB 4J3XA 1KLGB 4P3WA 1AXSB 4G6JH 4NC2B 3ZE1F 2KH2B 3MRQA 4YXHL 1CFTB 2YD3A 4R2GC 4UDTA 5FXCH 4AEIH 4MA3A 1OARH 5IJVB 3FTGA 2DQJL 3CNKA 1OAKH 3U1SH 4BSJA 5I1IH 4ODTL 4RWYH 2BOBA 3M8OH 3FB5B 4L8BB 5E6ZA 4HWEL 1A7BA 4JN2A 4TVPE 4WW1B 3BYTA 3LY6A 1OP5K 3MCG1 4DFHA 3GIVA 3QEHB 3P2TA 4RIRA 2VNCA 4LSDA 2R2CA 3C08H 3IFOB 2KBGA 2AK4D 2R4SL 2FLBT 3EDEA 3SE3A 4JPKH 3RVTC 5F7DB 4HC1L 1SQ2N 1UZ6E 3FB5A 3UROR 4MCZB 4FXGA 1LE9A 1A9BB 4ZFZB 1GC1C 3JUZA 1JI2A 4YHKL 1UWEL 2AQ3A 3NGBB 3W5NA 3VWJD 4OI9A 5CEZH 1T1XA 3RPIB 3ZTNL 4NQCB 4I48B 4NIKB 2AJUH 2Y36H 2MNUA 5F3HA 3HZVB 5JHDD 4JFED 3DV4A 3RVVC 5DHYA 5HHMD 3L3DA 5ACZB 2VRAA 1X3DA 4I9WD 4Z18A 2OL3L 3S34H 4X6BB 1NBZA 4GRWB 1HH6B 4UAOB 1KFAL 3QFJB 1G7QA 4M7LL 2APXA 4PYHA 4KKAC 3RAJL 1TETL 5DQDH 3ARRA 1RZGB 1WZKA 2CMRL 4JVWA 5C1MB 3PDDA 4KJWD 4MJ4A 5EU3A 1H5BA 1R5VB 5C0JA 2E9JA 4LRIA 1U8QB 4NPYA 1AE6H 4A6YB 4CVWA 2DMKA 2J2ZA 5CJOL 2V7NA 3BT2H 2EZ0C 3OR6B 3NA4A 2FHCA 4OZIF 1NEZA 3TT3H 4HULB 4L5FH 4M48L 5IVOA 1AIFA 3DROB 5CHNA 4DN4L 3L7EB 5IT2L 1H0DA 4NZUH 3ZKXB 3OXRB 3QJHB 3GHEH 1K8DB 1HHKB 2FH8A 1I75A 4J3TA 1MCNA 3C9NA 1ZV5A 2APFA 4NC1C 2IALB 3FRPG 4ZTOH 2G2RB 3TGXA 2CXKA 3GIZL 5DJ8B 3QUXA 4LCWE 4X9IA 3V4VL 4YH6A 4XTRD 1Q9OB 1UWXK 1TTFA 1MFCL 3EYUH 3FQWB 3QJHA 4ACPA 2BX5A 3DVNA 3NFPA 3S36X 2FJFA 5TFSL 3K8MA 5JPMA 4I3RH 4X0KA 4PB9L 3DTXB 5FO7B 1DQJA 3Q1SH 1ZLVK 4NFCA 1AD0B 1EFXB 4APQB 3BKCH 1X5LA 2YD7A 5DMGD 4PJDB 1KCKA 3CMOL 1NUFA 4LLMA 4HPYL 32C2A 3KPOA 2DI7A 4L1DA 4DKDC 4MNHB 4GS7B 4J12A 4QRPE 2QL1A 4YFLI 1SBBA 2VUYA 1JHLH 4TYUA 3MROA 4NZRH 1HSBA 5IW6A 1A0QL 1PGRB 5JHDA 4Z7OF 4KROD 5IBLC 3X3FH 4FQ2L 4LBEB 5I1AA 2ZOLB 2E9BA 3I2CH 4JHWL 4KXZI 2VN4A 3ZDYE 3ZE0F 2E9WA 3LRGA 4UU9A 5I19H 3QBTB 3VDCA 3VMNA 4ODUA 1FO0A 4JREC 1U8KB 5I18L 2V7HA 1IARB 2ZJSH 5L8JB 3TNNB 1T7YA 2NY0C 5T5FL 4XH2A 1KC5L 4JY4A 2GITA 3WUWA 2F53A 3HNSL 3H9SB 4S2SA 4EOWL 2I24N 3GMPA 5L2KA 1QKZL 5KVFL 1UXWB 3ME0A 3UJJL 3BWUC 4W4NA 5CEZL 1VEPA 3ARBA 2YA1A 4M7ZC 1L7IH 3ZTNH 5ITBH 4XAWL 3M1BA 2C1PA 1MCIA 5AG8A 2VDKL 3VFOA 4ZPVB 4DGYL 4EN3C 1XF1A 3IJSA 3V4PH 3DX9B 4FQJL 1HNGA 4FQXD 3AAZA 3SGEI 4F2MA 4YDIL 5IBUB 1F3JB 4HWBH 1B9ZA 1IQDA 1P84K 1ZT1A 1G7IA 2O5YH 3L6FB 4R4BB 4AT6B 4OKVB 3PGCB 4OGZA 5JIHA 1XIWB 2EEAA 1RU9L 3VFRB 5B3NA 2D2OA 3BAEH 3MUJA 4J4PD 3BKJL 4ZPVA 4FXKB 3GSWA 3RGHA 5GISH 1MLCA 2XKSA 4TSAL 4HJ0D 1OCWH 2NY4B 2CMRH 4GXVH 3FT4B 3T3ME 1WBZA 2PNDA 2R8SH 1X5HA 5D96C 4C56D 3V5KA 1FVEB 1TNNA 1X9QA 3ISWA 4OCWH 5IEHB 2DQTL 4EN3D 3BUTA 4M00A 3VJ6B 1OOAA 3D1MC 4NKDA 1CFVH 4F7TB 3O6MH 5DD3L 4OI7A 1UXSB 5ADPL 1INDH 1TZIA 4NQTA 4CDGC 4XRCB 5B21A 5F71A 1D9KD 4PG9A 1FCGA 2EYTB 1MCEA 1TZHB 2DMBA 1UKSA 3NN8B 4EUPA 1HZHL 1ZAGA 1I7RB 2GJZB 5FA4B 3T2OA 1AGEA 4NKDB 1LP9E 2YR3A 1FFPB 2BY2A 4JFXA 3KPNB 1H15A 1WT5C 4JQVC 4D8PA 4LRNH 3S9DB 1AO7A 1G7JB 2R69L 3UCRA 3MYJA 1FAIL 1J0YA 3MV8A 1K9TA 4FFVD 3RY6C 3PGDB 2LTQB 4LAJH 3NCYP 5L8LB 5ETUB 1QSEA 1OAKL 3WEXA 4N0CC 2ADIA 2WQ8A 3VWKC 1P7HL 1YPZB 4G7YL 5DJ6A 3RA7L 2VZ3A 3SKOA 1AFVH 1D5MB 3LS4L 4ZO6A 3X12B 1DBMH 1QZ1A 3MA7A 1M6OA 1BJMA 1A21A 1YEEL 5DWUH 4Z7VA 5E08L 3G6AA 1DQML 3VXSA 4AENB 1A6VL 4QTIH 1NC4D 2HLFC 1NCWH 4JO3L 4G43B 5EOTA 3UTQB 3RI5F 3F8UB 1B4RA 3QI9A 1D5MA 4N1EA 3U7YH 1LQSR 2EDKA 1V5JA 1U3JA 5J4MA 5KSUB 4GAFB 3EYVA 3MRKB 1T89C 5JZ7D 4KUZH 4P2QE 3WS6C 3LD8B 1INEH 5L88H 3IAPA 5IB1B 3MNZB 3HZMB 1CE6B 1J8HA 3GSNL 4F9PA 1B0RA 5FM8A 3WXVH 3QQ4A 4XNQA 4X7TB 2DLFL 1J9CT 2GTWB 3TO4A 3HFML 2MQCA 4GMSL 4Q9CA 4GLRH 4BSVA 4HQQL 4JCMA 4QRRD 3H3KA 2VXUL 1RFDL 2EEBA 1EXUA 5L0QC 4PJ8B 1EZVY 2EYRA 4IRSB 2X1OA 4OZIA 1ZMYA 1JFQH 4GQPH 3QUML 4M7LH 4LMQE 1DQLL 3UJJH 3O0RL 2VLRA 4QRPA 4PV9A 2NY1D 2NY6B 3CDGA 1IGTA 2WP3T 1G6RH 3VRIB 3VWKB 3V2AR 3L3KA 2MMXA 5DD0H 5JHDE 1Z5LA 4WCYL 4FA8A 1U0QA 2B7DT 4QTHB 5ACMA 3ZZ1A 4NNXB 5GSRA 3RL1B 4R2GD 2C3VB 3TO4D 2VAAA 5IKCB 1ZTXH 3ARBB 3DMMA 2AJYL 1FFNA 4RX4D 4RFOL 1I1RA 3VXSE 1KACB 4PJEE 1VACA 4WHYG 2F8VA 2CLVB 2IH3A 4P2OC 2X09A 4Z7NE 1F97A 1G7PB 4P0DA 2EDYA 2IFFL 5DJZA 3CFBA 2AXFA 4BKLA 1A6TB 4P46A 2A9ML 3E6FB 4P9MH 1J1OH 3SY0B 1JGVH 4GQ9H 4X6DE 2P5ED 3PJSB 4UDUA 3O6FA 1XR9A 4LFHG 4ZXBB 4P49A 4JKPL 5EO9A 4U1KA 3HB3C 4FFZL 5BVJB 1CFSB 1KUMA 2WQRA 4OGAD 5K59F 3P0VL 5FK9B 1TTUA 1JPTH 3OKMB 3GKWH 4KKLD 5FYJU 1M7DB 2VB5A 5E8EB 3DUSB 4GBXC 3G9VA 3OAZK 1D5IH 1SYSB 3RUGA 3WFCL 5IHBA 4GFTB 3HE7A 1NUGA 1OTSD 3ZHLA 3OKNA 1J8HD 1NMBH 3MJ8B 5FUOH 3S4SG 3UC0H 5C9JA 1T0MA 1TETH 5IHUL 3OXRA 1R3IH 1ACZA 5BJTB 1FZOA 3D0VA 1QEWB 3OAUL 4MZ3A 2C7UB 4YX2H 3QUYC 1KT2B 1ZVHA 3QIWD 1LHZA 2ADGB 1HHHB 5E6IB 2VITA 1IGCL 3VFSB 3WE6B 5CJQL 1EHXA 1LO2L 1JGEA 2YPLE 5D8JH 3QIUA 3GJEA 2DDQH 1N3NA 1QSZA 1IZJA 3AREB 5DWUL 3CVIL 5C0ND 1NEZG 3LZFL 3HZVA 5JDSA 2WAHA 1YN7B 5KSVB 1C7TA 4L9LC 2VDOL 3E2HB 3UPCA 1KC5H 1TCRB 3C6LC 4PJFE 3G04A 4NQXA 1AXIB 3HNSH 3UZQA 3UTZA 3GZKA 3GMRB 1UJ3C 2VLME 2JKXA 2EDWA 4ONHA 4YHLL 3WCYA 2WK2A 5J1TC 3RP1A 4WDIA 4XNZB 5HPMA 2RJMA 5BZWA 2DQHL 3SQBA 3FQXB 1YEJL 4LLQB 2QSTA 4CADA 5DQJB 4JPKL 3BO8A 1U8QA 2QHRL 2X44D 7CGTA 1AC6A 1JPST 4CMMB 2VMFA 5KN5A 4PRHD 3NIFE 3RGVB 4A6YH 5MP6H 3FQXA 4HPYH 1KCVH 3DROA 5CHNB 4XXDA 3QUMH 1X6NA 1QFWH 3ULVH 1IC4L 1JNNL 5SX4I 4F15C 3EO9H 5AWNH 1Q9LB 2VLJE 5DK2B 4KK9C 3LEYH 2R8SL 4U05A 4GG6F 2EO9A 1MFEH 4NWUH 3DX8A 5EO0A 4X99A 1JNJA 2DQTH 3WFBL 4ELMF 1JZ8A 5IFJB 3UJTH 1J1PL 3O6FC 2AEPL 5ANME 4HK0A 1IC1A 1TZGH 4HKBA 5EWIH 4GW1B 3WL9A 4P5MB 2V2TB 2EE6A 1Y0LA 4C83A 3PE9A 4WW1A 2DI9A 4RFOH 4YDVB 2XG4A 1YDPA 3DVGA 4P5KB 3VFPA 5I73C 1JYWA 4DKEL 4NZTH 2ZSWB 4D0BA 2FBOJ 5EOCL 5L0QB 2WNGA 3TBWB 1FJ1B 5HI5C 4YHIA 1FFOB 3MMEB 5CMAA 1VGEH 3TT1L 3MLWL 4K8RL 5FV1L 1X5JA 2VSCA 5JORA 5E1AA 1Q94A 3VXPB 1T89A 3N1PC 1Y6MR 1J1OL 2Q7YB 1BFSA 4HBQA 4LL9A 2XV6B 3IDMB 2AS5M 4FQPA 5BOZG 5L2KE 4OF5A 5IFAH 1N6VA 4XAWH 3I75A 3CZFA 3OHXB 1QPPA 5BXFA 4DCQB 1H3PH 4OFVA 4J8RB 1BD2B 4Y7MA 3SOBL 3IDYB 4JRXB 3QZWG 4HWBL 4X4ME 5FKPB 4CBPA 4ELMB 1ZHNA 2BNQD 2ZUSA 3X3GL 2JCCB 3BAEL 3SKMA 1OM3H 1ED3B 2V5RA 2HT3C 1RZKH 3B8SA 5IHUH 4DCQA 4JO3H 3QISA 1MREH 4EJ1C 3BZDA 2BNRB 3MOAH 3PWLA 1X5XA 1IAKB 3B2VH 3W0WA 4ODTH 3ZE1E 3QDHA 4QXGH 4JQVA 3TA3D 2CLRB 1SBSH 1Q9WA 1SY6L 1IGCH 3VXMA 1BWMA 4EVNA 4FQIL 1A9EB 4OLWL 4U3XA 2X4SA 3FO1A 4I2XB 3WS6A 2ZSVA 3C08L 4BZ2H 2OMBA 4H20L 4RGOL 4S1SL 4NM4L 1TIUA 1UCBH 2HT3D 4GRLC 1J0ZA 1B88A 1I1YA 1UWGH 3RTQB 2V5MA 1KOAA 4N5UA 4HIXL 5FYJH 3NIDF 1KGCD 2H2SC 3WIIH 2LABA 3ZKND 3GJEB 1D5XB 1ADQA 4ONFH 3IS0X 3EFFB 3KPQA 2W1NA 5FCUH 1HHGA 4YK4B 4KDVA 5D7JA 3VGEA 3L3GA 1AJ7L 1KV3A 5KSBF 4Z0XB 2BNUB 2YPVL 1I8MB 4QRTA 5DRWA 2G75A 4H0HB 4U6VL 4QRRE 2Z31D 3QXAA 3HZMA 4R2GB 4XCCH 4JG1H 1JN6A 4ENEC 5JOFA 5E08H 4Y89A 1DVFC 2COQA 2B2XL 2VQTA 5I8EB 4I0PD 1JUFA 3RIFK 5FUCC 4TPRL 4CADB 3B9VA 2VH5L 1EO8H 4DAGH 3F5WA 1NMAH 5JUEH 4M93C 3EJYC 1BPVA 2DBJA 3U0PB 4QF1A 5ISZB 3CFEB 1YYLH 3EYOA 4LCWB 4LSUL 4PGEB 3F7QA 3T4AA 5CJOH 3GJFK 2W60B 4MA3B 5DJ2B 2P5WA 2LU4A 5D5MA 4H8WC 4LCCB 4MA1C 4G9FB 1CFQB 1M71B 2Q3ZA 2GEEA 5DK2A 2EDXA 2GK0B 4OSUL 1OCWL 2UZXB 5D4QA 3VG9C 5SWSA 3CSYA 3QDGB 4JEGB 5EO0B 3VA2C 5HHXL 4LSTL 4Z7VB 2P45B 3O4OB 4NNPH 3V0AC 1CD8A 1JIBA 3WO3B 4TQEL 3JXAA 4DTGL 3H7BA 4M6ML 4MXWL 1BFTA 1Q0YH 4Z5RA 4MQ7A 3OXSA 1YNLL 4MD5B 2QR0B 1UM5L 2GI7A 1JHTA 1RIUL 3KG5A 1FHGA 1NC4B 1EJ6A 4MDIB 4JFFB 4IOSD 3E8UH 3WDJA 2VQUA 3BQUA 2GCYB 3GUTA 2VDNL 2VLKE 4HLJA 4XVSL 3PJSA 2N7BA 4AY0A 2GYSA 5J8OA 1JTTA 3L5HA 3T0EA 5LGHH 2J88H 1FZMB 4LIQH 2P42B 2AJYH 4ZFOL 2F19L 1EO7A 5M95B 4ODSL 1A9BA 5FK9A 5E24E 4YZFE 4ISVA 2FYYB 1A0QH 5CCKH 3ARPA 4F9LC 5E8OB 1TVDA 3BPLC 3V6OE 2V9QA 2IH1B 2FRGP 4K7PY 4NYLB 1SYVB 3QUYB 1DQDL 4RZCB 1ETZB 2R2BB 3N9GH 1PG7W 2FDBP 4HS8L 2FLRT 1B4JL 2CPCA 4U1JB 1WZ1L 2VC2H 1R0AH 5CBAA 4S1SH 1OSZB 1MNUH 3JV6B 4HUNB 4Z77B 4TRPH 2HTKD 3HC4L 1S8DA 5ANMB 4L8DA 3MA7B 3WIIL 4ZAKA 3L9RB 2BMKB 2JELL 4X6FA 2F5BL 1PX3A 2FIRT 1YN7A 5E70A 1AY1H 1AGEB 4KVCH 3EYUL 3RVTD 4LSQH 2H41A 3GSRB 1IQWH 1T1ZA 2XRAL 3QXTA 5DZNA 4ZDHB 4F7PA 3EO9L 2H26A 3MRGB 5J12B 1XF3A 1DZBA 5ANMA 2DQIH 2WBWB 1SY6A 5IF0B 3ZMRA 1LE5B 1EPFA 4HLZH 1TJGL 1G9NC 5BVPH 2J8UB 3K2MC 1S9XB 2X70B 2EC9U 3GMMB 1RURH 2DDQL 2HKFH 5HJ3A 5INDA 5BS0A 5HD8C 3MZTA 4XHJC 2WUBH 1EUUA 5AG9A 4YUEL 2D7QA 5GISL 1KYOJ 4XBEH 3O3DB 5BW7C 1JHLL 3LRSB 1IEAA 2NY6D 4GXVL 2X70A 2Z93B 1DQQA 1BJ8A 2ED7A 4ETYA 1P7KB 4X4ZA 2W0FA 3QWOA 4PJ9A 3RU8H 4XPBH 2GAZB 2QSQA 5SWZA 3TT1H 4ELME 3LN5A 1OP3H 1MI5B 3E3QC 5IMMB 4DN3L 3TFKD 1NGWA 4OZ4B 5IVXE 5CILH 4UUJB 2D3VA 4PJGF 3B4NA 5C09D 4HWUA 2Z91B 3D9AH 3VRJB 2GUOA 2ICWJ 2JK5A 4Y19A 1JGEB 3B9KD 1Z3GH 2EKJA 4YXKH 1GGIL 3ORJA 5C0AB 4HCRA 1AKJD 3HA0A 5E5MB 2LAAA 4CMHC 3P4MB 3FN0H 1N4XH 3MCLH 5GRVL 2WINB 4P9ML 1CFQA 5EU6D 4KROB 4EBQH 1ZT7B 1E4WL 5D1XA 1RZJL 3OJMB 1HHIB 5I1CH 5E94B 5ID1A 4WO4B 4L3CA 3LEYL 4QLRA 5HYSG 4E0RB 1NCDL 5D7IA 3HI5L 2CKBA 3CX5J 4OGAC 4TSCH 4RMUA 3NACH 3WFCH 4D2NA 2I25N 3MFFB 3NIDE 1I85A 5C70A 3BPNC 1QFUH 4KZEH 2UWEF 4TVPH 4JY4B 3MR9B 4QEGA 5HDOA 4U1HA 1GXEA 2HFFA 1JZ3A 3G6JF 4H26A 3OKDB 2Q8AH 1N8ZB 1FVDA 4YEFA 2X9XA 2Y25A 3B9DA 4H1LH 1QLRA 4TUOA 1I8IA 4ETQB 4Z95L 1XF5B 3FTGB 4DGVL 3BDBA 2GJ6D 1VACB 1GHFL 1NJ9B 4GG8B 4XNMB 2Y1VA 1U8NB 2FIKA 3N9GL 1H5BB 4JPWL 1YMMA 5FGRA 3L3JB 4OD1L 1XCTB 3NPZB 3QDGD 4LAQL 4OLXL 4S11A 5B39G 4M6OH 5IR1B 3RBGA 3IU3A 1NFIB 3ARWA 3ULUE 2VDOH 4GMSH 1YJDL 2ERJB 3QDAA 1QSFB 2Y06H 4JZJC 1EMTH 4NCC1 4AT6A 3JV4B 4PTTB 5J6HA 1A14L 1T7XA 3MRBA 4HBCH 1I1FB 3BXNA 1QLFB 3LQAC 3L3HA 1BQHG 1FO0H 5DSCB 4JRYD 1KPVB 1NCAL 3MRPA 1GVIA 2Y6SD 4C56B 5FA4A 4LEOA 4NRYB 5BRZD 4IMLA 5D7KD 3HG1B 3AXLB 3VI4F 5MERA 1A2YB 1WICA 2VQ1A 5CWSA 4J3OC 2P5EA 4UILL 5GS2D 3QFJD 4HFUL 4W6XB 1JMXA 4PJCA 5E99H 3UZVB 1H9VA 1U8JB 5T3XE 1DBJH 1PEWA 2AJXH 3V0WH 1DQMH 4D0DA 2HKFL 3H8NA 5BZWB 5EU6A 4Y4KA 4CDHA 3ILPB 3WIFB 1AHWB 4M61B 1CD1B 3QCVH 3H42L 3RX5A 4WI5A 2X4RB 3PQYB 1ORSA 4XBEL 5EUOB 4ZPTA 1BZ9B 3QXAB 3P4OB 1YMHA 1S7WB 4LSTH 1OPGL 1AH1A 2L7JA 2XFXB 5HGAB 5KSBA 1XGPB 4X7FC 2IG2H 1JGVL 4GQ9L 2RBLA 1P7QA 1MQKL 2UYLB 4G6AD 3QUKA 4LBEA 4ZFOB 2YKLL 2BC4A 1EHAA 4Q74A 3W0WB 4XX1G 4MXQC 3CXHK 3PV7A 4F57H 3HCVA 3N85L 4HF5L 2ICEA 2B8OT 1T20A 4E41B 3T0EE 5FF6A 1H8SA 4JB9L 3GKWL 4NUGH 1ZA6B 1PLGL 1BEYH 5GGSA 4MQXC 4PJXE 3PP3H 3BSZH 4GMTL 3ZTJG 2NYYC 3BEVA 2IALA 3OKEA 2DLEA 3UAJD 4JG0L 3EOTH 1G6RL 4CKVX 4G5ZH 4R4ND 2BNRD 1BVKA 2PYFB 3AB0C 5ECJE 1MJ7L 3FAXA 4ZYKB 2WUCL 5FAAA 1J0HA 2HLFD 1BAFH 4JM2C 3UTTD 3W11D 5ICYB 2F74B 3MRDB 2P5EE 1I4FA 3TO2A 2DN7A 4APQD 1EK3A 1KNOA 3VFVA 1R3JA 5C86A 3QUMA 4L4TE 4M4RA 2XWJA 1K2DA 3WJJC 3PP4L 5TDNB 1PX4A 2A6JB 5FYJD 1Y6NR 3KDMA 3QFJA 3ARSA 1UJTA 1YDPB 5CUSL 3SDDC 4MB3A 5T1LD 4NZJA 3Q0HA 3KPSE 4LFHD 3MV7E 2P5WE 3WJLA 4JM2F 4HXAL 1JTOA 4XBPB 1CDGA 2ICCA 1TENA 1WWAX 4G8EA 3DX6A 4NQEB 1XGTB 2GT9A 5DJCB 5GIRA 4HAFA 1YNTB 1D5IL 4DUVA 7FABL 1S7UB 1GZQA 1RJCA 3INUL 4G6MH 1FNLA 2OQJB 1CI5A 3STZA 4JM4L 4ZFZA 3VI3E 2NY5H 5E9DD 1E0OB 2XWTA 4ELMA 1FC2D 3VFNB 2IANB 3OQ3B 4GH7B 3U4BL 1A6TA 2CKNA 4JVPA 4MA7H 3U1SL 5I1IL 4RDQF 4S1QL 1DBAL 4LP5A 4KRLB 3U79A 3K4DA 2ATKA 2J8UE 4HS8H 4NQDB 2XZZA 5C07D 4PTUA 5TH2B 1T22B 5FHAH 1NLBH 2EICA 4JFEB 5JNYA 4PFEA 1URLA 5F1IA 4P5TC 4JZJB 1DDHB 3C5ZA 2PTTB 4FQQA 3CVHA 4O2CB 4U7SA 1W2KT 4DJMA 5EZJB 2GK2A 4NT6B 1I9JL 2YUZA 1CQYA 4KQ3H 3DVFA 2BSED 4KVCL 5IVXF 4JKWA 3GMNA 3H0TB 1HIMH 4PPTA 3QEUB 2IPUK 3WIHA 2QQLH 5C0BD 3BQUC 4M6NH 1Z6JT 1WEJH 5INCB 5DUPL 3RFZC 4X7SH 3BPCA 5GHWL 4LNRA 3X17A 4F58L 1ZK9A 1C5BL 1S7TA 3AMKA 4I5BB 3ROOB 1YEDA 3O11A 4P3DA 4NUJB 4UIMA 3RWIA 1UB6B 1FORL 5C0AE 2Q86A 3TP4A 1KEML 3RI5K 2ADJA 4FFWD 4PLOB 1DE4A 2QQNH 3UZEA 4O2EB 2DM4A 1OLZA 1A8JH 1W72H 4OCYL 3C5JB 4G8IA 5A3IC 5GGSB 1OVZA 2Z92A 2ZUWA 3IS1X 5KSBE 4J2XA 4BM7A 1MI5E 3MJ9H 2AK4A 5D7JD 1LDPL 2H9GB 1FNAA 1EVTC 2MJWA 5IF0A 4RGOH 3VGAC 1M05B 4HXBL 1OGAA 1U6AH 1HEZB 1OF2B 5E0QA 2HMIC 4LDLB 2V2TA 4GKZA 4Y8AA 3A67L 4C58B 3N06B 3UDWC 1AGCB 1AKJB 2DQEH 3CGTA 2IANE 3D3VB 3RUGE 1HXYA 4DVRL 3O3EA 2ZUQB 2DQDL 4GLRI 1MNUL 3QIBD 1I9RH 2PCPA 4PB9H 1N0LA 5DC9B 2R29H 3GK8H 3GBML 1ORQA 5HHPA 2GSGB 3TO4B 5JHLL 4FN0A 4JY6A 5HGBB 1DBJL 1WCBA 4PY8J 3UXFA 2H32H 5H37G 1KSRA 2P1YA 3FFCD 1F8TH 2BSRB 4Z78B 1BD2A 1T83A 2E9IA 2ZG3A 3MV9D 5GGVY 5BRZE 1IQWL 1MREL 2H32A 1R3LA 2XRAH 1G7MA 4QGTA 3VA6A 2DWDB 3TPUA 4DWHA 4JFXB 4DZ8B 4HD9A 3OZ9L 4JY6B 4XVUC 3EOBA 3JBG7 4CNIB 2WBJD 4NP4L 1YYLL 4LSUH 1FZKA 4CAGA 1JYVA 2FR4B 4OCRL 4PJFA 5JLZA 4X98B 4U6TA 4NQEE 4AIOA 5FGSA 3ULVE 1HH9B 1U36A 1T0PB 3OGOE 1IBGH 1XF3B 2IEPA 4TUJA 5LWYH 1M6OB 1MFAL 4I18A 5CP7B 3BMWA 1GIGL 3RHWF 1UWGL 5ICXB 3KPSB 2HN7B 3DI2B 3GMMA 2NXYC 1QKZH 4H26B 1PQZA 5D71L 3UTZB 4DN3H 1N6UA 2W9EH 5D1ZD 4PREB 1Q0YL 3QNXB 5FCUL 5GS1C 5EN2B 3V6FB 1RIUH 3O8XC 2X1WL 5DFWH 3LQAL 1VDGA 1CE1H 1FL6A 1KYOK 4JANB 1NCBL 5DJDB 1UEYA 1CZ8L 3JTTA 1JL8A 5GGUB 3C6SA 4IRJA 4PJ7E 4Q0XL 4JDTH 2DYPD 1JWMB 2DQCL 3I84A 5E8EA 1WAAE 5KN5B 2VDRL 1U93B 4EBQL 4XCYB 3C8KB 5FYLD 3NCYS 1UKTA 2J4WH 1A6WL 2X89D 2OL3A 2Y5TA 2Z35A 4Y4HA 3RVUD 4WIQA 4L4TB 3MJGX 3MV8B 1IAII 4CRPA 5CUSH 5JPMB 2VOTA 3PGDA 2EYSA 3RJQB 1CXLA 3F12A 2VIRA 5I8CA 1QA9B 3HG1A 1UQSB 1I8MA 5IHLB 4ZOAA 1OY3B 1TPXB 32C2B 3C5JA 3KPOB 1MI5A 5I66B 4OSUH 3P11H 2IAMC 3ZYJA 4WFEE 2OJEB 3SGKA 2E27L 3IRZA 1QYGH 2OSLA 4KWUA 1Z9OA 2RR3A 5HYJA 4WW2F 3RWDB 1KXQE 1PG7L 1U41A 2FGWL 4XC1L 3SEPA 4OZHF 5TGBA 4HT1L 4NC1E 4P2RA 3NAAH 3PHQB 4S1DD 3CSYB 1KLUA 2VLRD 5I17A 3PWVA 4FQLL 4G5ZL 4LGRB 3VE0B 5DJAA 2D9CA 3FQTB 3S37H 1NGPH 4JHAH 1TJGH 3N1FC 1XF5A 3ZDXF 1AP2A 5BVPL 2ZPKL 4G9DB 4PR5A 5C07B 3ES6B 5F89B 4LCCA 3TM6A 1PZUB 2GITB 1KTLA 1KJ3H 2VDPH 4ORZC 3SDDA 4X8JB 4QNPF 4DEPC 5F44A 2IAMA 1ZWIB 2HT4D 2J12B 4YDKL 3WKNA 5B39B 4JFPB 4ODSH 1BGXL 5E2JA 4AEIL 2QKIB 2DQGH 3C6LA 1YNTA 1HQ4B 3QG6B 2IQ9H 3E6HA 1JTPA 4HH9B 4X6CA 1G7LB 3DIFA 1E28B 4Y16B 5HXMA 3MREA 2ADFH 3MGTA 4I48A 1U3HA 4ISVB 2QQQA 3MOBL 5T5NG 3ZL4L 3DX8B 4XNXL 4JM2A 1W0VB 4LLAA 3AS1A 3F7YA 3IAQA 4LP4A 3CC5B 1BQLH 2WIMA 4YEEA 4EEEA 1FG2B 3OTTA 5ILTH 1SYVA 3QUYA 2VISA 4G6FD 2OTUA 3TN0C 5ICYA 3MBEC 4U7MA 4G8FB 4XGZA 4XWGL 2UZIL 5AZEH 5CSBA 1ZGLB 4GKSA 1C5BH 1G0DA 2BVQA 1S7SB 4PRNA 4AEEA 4NN5B 3D85D 1OSZA 4FS0A 5DVMA 1MCWW 1FVEA 1EDQA 1MQKH 2D03L 4JRYA 4K9EH 3RTQD 3MRHB 5D7SH 1DEEB 3VD7A 3QRGH 5DUBA 2A6IB 4JDVA 1T5XA 3OBAA 3O81A 4KJQD 3EFFA 4HZLB 1CDUA 2HTLC 4OLEA 3DWTA 4OD2A 1SJHB 2VL5A 2X9YA 3L7EA 4HIIB 1FSKC 3SGJA 4MVBD 1B6DA 2NR6C 1AC0A 2YHGA 3UTTB 4P2RD 1I1AA 2WUBL 4ODHH 4Y4FC 1NSNL 3TJEH 3MRCA 2AJVH 2N1KA 2VE6A 3VXQA 1ED3A 4AIZB 3N50A 2C4FU 4WI9A 5KANI 1AD9B 2IFGA 3STZB 5FYKL 1A64A 1BZ9A 1GHFH 1OAYH 2V7NB 3BP6B 1CTNA 5ACLA 3WUWG 1XF2A 4EI6B 2ADGA 5JQ6H 1ZLSH 5TQ2H 5BO1H 5JA8B 4R26L 2W60A 4M48H 4DN4H 1MIEH 1P7QB 2UYLA 4FFZH 5M94B 1U58A 3AY4C 3MRMA 2MCG1 4F58H 5GS1A 4U1MA 5CIPH 2DJ4A 2WM0A 4EXKA 3ARFA 3GIZH 3EAKA 3STBA 3RHWK 2AKRB 2GHWB 3MV8E 1IEBB 3PXJA 4D0BB 3NAAL 3FOLB 2FBJH 2IPTH 4O2CA 1S78C 3OB0K 4WI7A 4XTRC 4Y1AB 1FYTD 1CTOA 1FL3B 2ZCLL 2FD6H 2FEEL 5DVLA 2DLGA 3KYNA 2BXYA 3QHZL 3UO1L 4QCIB 1KCUL 3QYCA 3BPLB 4JO4H 3CZFB 4I0CC 3BH9B 1KJ3L 2EDJA 2VDPL 1KN4L 3QAZB 3WFEL 4NHUB 1RJYB 5FFLA 2GSIB 4HXBH 1I8KB 3V95A 5FKPA 12E8L 4BUHA 3F6IA 3RDTD 2JCCA 3SKMB 2ARJB 1A4KA 2BP3A 4GOSA 3IB4A 1PZ5A 2DMCA 1LO0H 1Q9LA 4P4KD 3QDJB 2BNRA 1IT9H 1HHIA 3RGVD 4XP9H 4ZD3H 5I15L 2Q87A 1BBJA 2GSIA 4XNXH 4BQCA 4Z7QE 2AJSL 3E0GA 1CDHA 1C7SA 1BIIA 3S7GA 1EBAA 2IANA 3R06A 4EVNB 1RK0A 2HMID 3WFDH 5GGTA 5L9DL 2D7NA 2AK4B 1PZ5B 3BPNB 3I02B 5F72S 2Y06L 5J6GB 1X4XA 2Y7QB 4PB0L 1GZPA 3TC9A 3TIDA 3DO7A 5GGTL 1J86A 3IU3B 1CK0L 2EIZB 1UCTA 4LQFL 1XGTA 4CN1A 1NCAH 1CU4H 1QLEL 3RVWD 2B1AH 4JAMA 1MFBH 1QSFA 4XP1H 2O5ZL 5J89A 1S7VB 3FQUB 1NDGB 3QH3B 3NIGF 3QRGL 4L8SA 3QDGE 1FNSL 1R5IA 1G1CA 4KMLB 1Q94B 3ARBC 5EBMA 4HUVB 4J3SA 1KJ2A 4HJJH 1EHLL 3DO7B 5L6YL 3UMTA 2NCMA 4NFDA 4NP4H 3DV4B 3T3PF 3ARED 1XF4A 3I75B 5C0DB 3QT2A 1I3RB 1JNLH 3E1F1 5EC2B 4H5SB 2X4QA 4NN6B 3OGCB 1LK2B 4J3UA 3HI1B 1T80A 4N9GA 4WJ5B 3RIFF 3BHBA 3GO1H 4GBXB 3DURA 2NY2B 1W72L 1RZGA 1JGDB 3CFDA 3QEQA 3CFCH 5EOCH 5EU6B 4J1UA 5C0IB 3QWQB 5C8JB 4ZFFA 5KZCB 5E8PA 5A3ID 1LP9B 3QUZB 2VXSH 3CPLA 2XTJE 3EHBD 4PJBB 4BK4A 1I7TB 6FABL 1KB5H 2BNRE 4M8VA 3U46B 2VQ1B 4YQXL 1PG7X 2HFEB 3L5XH 4X80H 2DL9A 2H3NA 4N5EC 2DQUH 1NGPL 3UPRA 4NUGL 5FM5M 3RKDD 5DRXB 3HUJB 5DJXB 2HJFA 1HSAA 4U1GB 4UI2A 4JLRB 2NY1C 5CEXB 1G9MH 4N0RA 4HJ0C 3WLBA 2ESVD 3RWFA 1LVEA 2OBGA 4X6FB 3S8WA 3BKML 3EGSA 2AGJH 2GFBB 3B2VL 3PQYD 4U1NA 1JWSA 2YWZA 1KENH 2LVEA 5I8OH 1DBAH 3GK8L 2CD0A 3WKML 1RZKC 1GOFA 3MLRH 2AKRA 4N0CD 2FO1A 5I17B 3MRJB 4WY7H 1A7PL 1WISA 5F3BA 1UYWL 5C92A 4CJ0A 5JPNB 3LKPA 5DMIH 2NZ9D 5ILTL 3CU7A 5FGCE 1J0IA 1NUDA 4R3SB 3GDBA 4HS6B 4DKFH 4FHBD 3O6LH 5HY9A 1IJ9A 1HQRB 4B0MM 3T0EC 1A7NH 4KDWA 1E6OL 1NKOA 2A74B 2XWJB 3LKPB 4HPOH 4OLVL 1Q0XL 2X4UA 1EJOH 2FH6A 2WBJC 4OZFG 4BZ1L 4GW4B 3GSNH 1JPFB 3LMJH 4R3SA 1M7IA 3QNZB 4RZCA 3LN9A 3UTOA 1MFAH 3MRDA 3QEQD 3KR3L 5DRZB 4LKXB 3EJJX 4URTB 2VKWA 2JCCF 2F8OA 4R8WH 4N0YL 5FO8B 5KANG 2PCPB 2GK0A 1XGUB 5KSAA 1ZS8A 3VXRD 4M8QA 2E7HA 3LKSB 4KV5F 1FORH 5I73B 5F6HJ 2FSEB 4Z77A 1YY9C 4E9LA 4ZUVA 3V5HA 1MCWM 5DRZA 1T03H 3HMWH 4LVOC 3TA3C 1FNSH 5DD0L 3LQAH 3RUGF 5HYJB 5E5RB 3L3IB 1LO3H 2LE9A 4POZC 1HILA 2LQRA 2O5XH 5FYKH 4BYHA 2PW2B 5HPOA 4LGSB 2P49B 4EI5B 3U9PL 1OAQL 4PBWD 4JZNA 4U33A 2YEZB 4PREA 3QNXA 3EZ8A 3QSKB 3NCFB 3KWWA 2J6EL 4FTVB 1ZLUH 3E3QE 2FWOA 4KI5E 3MV7B 4K3EH 4OFIA 2Y4SA 1OT1A 3OKDA 3BP4B 3JTTB 1IAIM 3RWCA 2YEZA 4Q9QL 1CICC 1ZSDA 4W4OC 2I27N 1R3HA 2B4CC 3RVXC 3VGAB 4O02H 2A9MH 3O3DA 1WBXB 2DRUA 1PY9A 2PO6A 1KB5A 4X9GA 3TVMA 1U93A 5GRJL 4ZXBA 1P7KA 3BOVA 3GSXA 1JHKL 4DZBA 5ABDE 3H3BC 1A3LL 1P2CA 2MCPH 3QG6A 5HTSA 1MCHA 5HGDB 3V52L 1N64L 3CFDB 2A6DA 3GHBL 1YEFH 1SHMA 3LV3B 1D9KB 2Y07L 3MRFB 4HCRH 4PJHF 2DKUA 2XYCA 4G9FD 3MV9A 1T6WA 3MUHL 3U0WL 1QFHA 4RMRA 4IEFB 1A7QH 1FL6B 4KI1A 4KROC 2AJZB 5IBLD 2JJWA 3KS0J 3HUJE 4G42A 5C71A 5FUOL 4LNRB 1WLHA 1VEOA 1A6AA 5I75B 3MYJB 4GRLA 5DD1L 3TJEL 5IWLA 1ZA3B 2BJML 5IV2B 4LARH 3L3OB 4I13B 3GSRA 3B2UC 1XIWD 3H3PH 3TYGL 5K9OA 5F1OB 5AYUH 3BE1L 3D39E 3X12A 1NLDL 4XBGB 2AEQL 2DTML 3BZEB 5DS8A 3HAEG 1ES0B 1TVBA 5LQBL 4OB5L 3VXSB 1YQ2A 2R56H 2OM5A 5DEGB 3ZKMC 3FT3B 5L9DH 2YD1A 1FDLH 2W38A 3LKRA 1D3CA 4ZUTB 4M1GL 1NCCL 1KGCE 1MPAH 4H88L 1IFHH 1MQ8A 2N7AA 2I60L 3AVEA 3WIHH 2OR8A 2R0ZL 1FLRL 1S7RB 4AL8H 1FP5A 4ODUB 4YHOH 2DAVA 3X13B 3FRPA 4GKNA 4QHUB 5EFIA 4GG6B 4RFEA 1JV5B 2IF7A 3KPRE 3G08B 2ZCLH 1OAZL 4XMLH 1XCQB 3ZSTA 1I9IH 3GSOA 2VLJB 3QZWA 1OTUD 43C9A 1KELH 1I8LC 5IQ7H 2JB6B 4JCLA 1J12A 4JJ5B 2FHFA 3MPCA 2N4IA 3O41A 4NQEA 1RHHA 1DUYA 3F58H 3KYOB 3NFNB 1DP0A 1I1CA 3MXWL 4LSRL 2OQJA 4U6XA 3VFGL 3CFKA 3QXUA 3HMWL 3ARFB 4NQCA 4AIXA 3RZCD 4H1LB 1A3RH 3ARGD 2FATL 3OXSB 4JJ5A 1CGWA 4MD5A 4ZS7H 1RJLA 1FGVH 3AAZB 4O4YH 1CLOH 3PWPD 4NQVA 1S7QA 2D0FA 1MHPL 3FN3A 1CLYH 4OF3A 3WFBH 3T0VA 4PD4K 4PJ9C 1ZS8B 3NCEB 2DD8L 3V8CA 4RNRA 1RZFH 2YPLB 2NW3B 4FZEH 4HKJB 4P5MA 3EFDH 5D7LA 1U3YA 1T0NA 1MVUB 4GRLD 5F7HA 1NSNH 2O26U 3B5TA 5LJYH 4HEPG 1S9VA 4PJFB 2PXYC 4WHCA 4U49A 5EUOE 4YXKL 3MLVL 4YHIB 1B3JA 1K8IB 2GIYA 4F8QA 1K2DB 1IM9A 1ITBB 5I1HL 1ZEAL 1CK0H 4HUWB 1U8LA 5DD5H 3EDDA 2P24B 3QWRA 4HAGA 5GGRY 3SPVA 3MBXL 4JFZH 3BHBB 5C6PB 1H3XA 3H7LA 1JGUH 5BV7H 5ICXA 1G1YA 5I9QC 3EOBB 3QEQB 2XZCH 2MCPL 5J06A 4R26H 2VR5A 3HPJB 4QRUB 4YO0A 1PKOA 1IM9B 4R9HA 4RGNC 1VPOH 5IHZA 2VR4A 3CD4A 1G7QB 4LVOB 3QR2A 3PWUA 4NQSB 4PJBF 3CPLB 5INCA 2XXCB 4Y4FA 3QHFH 2NXZC 1J05B 4LPXA 4YPGB 3NBNA 4WY7L 2EH7H 2XOTA 3B8YA 3VCLA 5EUKB 2MOVA 3CXHJ 2VDRH 4O5LH 5C0EB 1C5DA 1VFOA 4A6YA 5IVZA 3HUJA 2YD9A 3BP5A 4ZSOA 1UGNA 5EBGA 4DFIA 3OR6A 2F53E 3V5DB 2ADFL 1MHCA 2QLVB 5GZNC 4PGDB 3CUPB 4JO4L 4JPWH 2OR7A 3MRLB 1VKXB 4WGWB 5BMFL 2UWEA 3P4LA 1RV6X 3DMMD 1VFAA 4ELKB 2RFXB 4YQXH 4P59L 1DL7L 2E7LA 1P6FA 5D6CA 4OCNC 3JZ7A 1P4IL 5DJ8A 2DQUL 3MXVL 5ALBL 5D1ZC 5IW1B 3C09C 4NZRL 5F70A 3PGFL 4Y4KB 1CT8B 3TN0A 1KTRL 1JUFB 5E8DH 3HAEA 3DGCR 5DD6A 3X3FL 1FLTX 4LDOB 2FECL 3C5ZB 5EUOA 1L0YA 4Y5VA 1T04A 4UOW1 2APTA 1F3DJ 4GBXA 4RBPK 1U8MA 2ITCA 2XTJD 4GKZB 4UTBL 5CGMA 3KLAB 1AGFB 4YHOL 4LPVA 4ORGA 1T03L 4L4VE 1NBYB 4Z0XA 1CGXA 3ARTA 5I71C 4CL7A 1VFMA 1EZVX 4M7KL 2P7TB 3QDJA 1QD0A 3HMXA 5E2TL 2HFEA 1A7PH 4WRLA 4UDTB 4QCIA 3ESVF 3HE7D 2NTFB 1AP2B 2X1QA 4YFLF 4XP1L 1I3UA 3NFSH 5IGXL 4A2LA 4RAUA 5JXED 5KJRH 3I85A 4K2UH 1XIWC 4V2BA 3VFMB 3FO0L 3N1QC 3PL6A 4HG4K 4O2EA 2XICA 5KTEH 43C9B 4JKMA 1QBBA 1EEYB 4P2RB 5CINH 2BXZA 2YS4A 4O02L 3C8HA 4IRZL 3ZYIA 4GG6E 1CFBA 2A77H 5LXGH 4OLVH 5C3TA 1RUKH 1Q0XH 1DLFL 4NRZB 3ZHDA 3EFDL 3E6HB 4HH9A 1S9KC 5C09E 5EBWB 4QXWA 5F9JA 4BH8B 3GI8L 3G6JE 4YDVA 1ZVYA 3KYMB 1GC1L 4U1HB 4FFVC 3VG9B 4FABL 4NQVB 2UZIH 4UQ2B 3CX5K 1MLBB 2QV2A 2XQYG 4P2CG 4Z0BH 4OFYD 4OM0H 2ILLA 5F7MC 1NH6A 5F1IB 1NAMB 3ILQC 3DX7A 3SE8L 3C5ZD 2C4FT 2D03H 1OTTD 3T08A 1D5ZA 3P9MA 5ERWA 5CP3H 4I8DA 1DSFH 2W0KA 5JOPE 2XZCL 2W0LA 4G6FB 2Q20A 5C3LD 3LKQB 1MJ7H 4XXCA 1ZSDB 1NBVL 5CSZA 3REWA 2YRLA 3VRLE 1X5KA 1EAPA 1W0VA 4WEUD 1OAXH 1KJ2B 5L2KD 1T5XB 2YZ1A 4QRSA 4BJLA 5GGUA 4HZLA 1C16A 3MSPA 3RDTB 5DMJB 3VGHA 3JWDC 5GXBB 1UENA 3BXNB 5IP4A 1FDLL 3VWKD 3P73A 1KIPB 1FPTL 3RX8A 4JFYA 3TLRA 4NQSA 5DRXA 3GMLB 4KI5D 1TVHB 4L3ED 2MKWA 3BH8A 3OKLA 3QIUB 1DVFA 2CK0H 4N8VA 4PJ8D 1G6RA 4DOHB 4D94A 1JPGA 1RUQL 2P8MB 4BFIA 3KJ6H 2HAZA 4NDMB 3S35L 4X98A 1MIEL 3LKOB 1IRAY 4YAQA 1M7XA 1TCRA 3TIEB 1FFPA 1RIVL 3DYPA 3MNWA 4PLJD 1HYSD 1V3LA 4JFEA 5JNYB 4F7MB 4ZUWA 5IQ7L 3O4LD 4Y5YA 1I1AB 4PGDA 1WT5A 4XCNB 3L9RA 4ONHB 3INUH 4G6ML 3FCTB 5I75C 4Z7WE 5DJYA 3WDHA 4BSWB 2WP3O 3EBAA 2FBJL 2IPTL 2PN5A 1F2XK 3CAFA 1QVOB 4XHQA 5DQJA 3CH8A 1HE7A 3MLTB 3O9WA 1V8HA 3HPLB 3VXUA 1S3KH 5EN2A 5EA0H 3TV3H 5JIPA 3MODL 2EDEA 5DJYB 1T83C 2OMNA 3MLUH 3CXDH 1AO7D 4RCAA 1FV1A 1IGML 3Q5YA 4XXCC 1KG0B 5IVNA 5IOPA 2DM7A 3P4MA 3DLQR 1ZT4B 2CH8A 2W0FB 3QWOB 4PJ9B 4K7PL 1RZIA 1QR1A 5JO5B 3QDMB 1XZ0A 3KPPA 1DUYB 4CW1A 4WWKB 1DUZB 3D2UB 1TJIL 3U9PH 4QTHA 4XP9L 4Z7UB 5LXGL 4BQ8A 4PJ5D 5F96H 5KG9B 4U1GC 3HNVH 3IT8D 3SKNA 3IDIB 1WK0A 3KLSA 5EOQL 5HHME 4M6NL 2F58H 4XNYH 3B43A 3QPXH 5ESAA 3OJDB 4PUBL 4LPYA 4FABH 4NJAL 3IDNB 1NMCB 3FB7B 4HKJA 2BRRH 4DGIL 1IGTB 4EN3B 2CXGA 3V4UL 3SE8H 4UBDD 3KWWB 3RWHB 3UEZA 3PDOB 2EDNA 3OJDA 3G5XA 3TPKA 5CBEA 3MV7A 2XNAA 1J7VR 3FB8B 3CFJA 4FP8L 2VN7A 1P5VA 3UJIH 3FB7A 2RIKA 4IIQA 1FGVL 2WBKA 3PWVB 3GHEL 5DUMH 3OB8A 2DF3A 4I3SH 4NN6C 2DB8A 4FXKA 4R96A 4KFZC 5DJDA 4WEMB 3LN4B 1D5BA 4PRPA 4AEHL 1WSST 3RGVC 2EC8A 3T0BA 4IRJD 4JJHA 5JR1L 1I3VA 4WHTA 2YD4A 1KEGH 3O6LL 4Y5VC 5DLML 4DGVH 1FIGH 3NFNA 4WUUB 2F53D 3ZYZA 3HKFA 1ZANL 2X89A 3OB0H 2VXSL 3H9SD 5D2LA 1A6UH 2A9NH 5IMOA 4G8GE 5D1ZA 3U36B 3KJ6L 1X5GA 4WHTB 3L5IA 3MBEA 1KIPA 4S10A 3ARDD 2DQDH 5D5MF 3IXTA 4ZFFB 3WLWD 3F12B 4WUUA 3ZKSD 1KCRH 3KJ4C 1P2CB 1CXFA 2PYEA 4YBLB 5E1HB 3MJ8A 1GGYA 4GAJL 4KK9D 4N0YH 1TNMA 3BZ4A 5ADOL 3OKOA 4PRPD 4HBCL 4XBGA 2FX9L 1EO5A 2YN5A 1F4YL 4ZFGL 3O3BB 3BZFB 4TULH 5E2VL 4N8CL 1C08A 3L3GB 1F4WH 3RWDA 5IVXB 5BQ7B 5T5FH 4FTVD 3D25A 5DI8A 1LE5A 5CINL 4GAYA 4YXLH 1YEHH 4HHAA 3EGSB 1ZHBB 4LRIC 1EFXD 2CO7B 4I5BA 4EDXA 1CS6A 4KJQC 2L4OA 3HLAA 3GNML 5DMIL 3MLZH 5HHVL 2B4CL 2R2HB 4OLZL 3BH9A 3VI3F 5JW5A 1GC1H 3SGDH 2X4PB 3SDDD 4Z6AT 4Y2DB 1D7FA 2VO5A 2VDKH 3FQRA 4Z8FH 2NY3C 3LH2H 3PQYE 1HKLH 4JGJA 4EUPH 2HRPH 1F58L 4KK6D 5DK3A 4G9FA 1FCCA 1R24A 1NGWB 3WUWB 3TYFA 5JW3L 1NGYA 5I74B 1K6QL 2EKSB 1MJJA 4IMKC 4HF5H 2VIRB 5I8CB 4LSPL 3DGGA 3MV11 2Z4QB 1RZIB 1OGAE 1XZ0B 1GSMA 3MACH 2K1MA 2M8XA 4YFDB 2AXGA 3QP3A 4Y5XB 2OJZL 4RMWA 3FO9A 5LCVH 4IOFC 4WV1C 3PWNB 4N0FB 1IAOA 4LKXA 5DD3H 2IPKB 3DX9A 5FM5O 5C7XH 3U9UA 5IBTH 2YUVA 4XPTL 3FONB 4KHTL 5BS0E 3IF1B 2EC9T 3D69A 1I3GL 3UJIL 4KKAD 1HXYB 2FSEA 3TYGH 1MJ8H 1IM3A 4PRHE 5EU7E 4OBRA 2Y5EA 2YD6A 1OAQH 1WFTA 5B8CB 2ZG1A 3QHFL 2AEQH 2DTMH 3PL6D 4YHYC 2J5LC 3C60C 4D0CB 2R69H 3ECBA 4LHQB 5I1AB 3P0YH 5D7LD 1YY8A 4O5LL 2GJJA 5H8DA 3TWCL 1G9MC 3RY5A 5DJ0A 1RIVH 2BOBB 1A1OA 4HWBA 2H8PA 4U3CA 3NZ8A 4C57C 4YHPA 3VWJB 2P43B 4QRSB 1JGDA 5IG7B 5K9JH 3OR7B 1JF1B 1GGTA 1UACL 5KS9B 2X4SB 3FO1B 3LD8C 3L3IA 2XWBA 3PIQA 2RQ8A 4JHBA 1GPOH 4R90L 3AGVA 3BP6A 3BGFC 3KNBA 4N68A 3MODH 1T1YB 3U46A 1JPSH 3U0WH 4FQ1L 3RY4A 2D7MA 1J18A 3NH7L 3QUZD 3U4AA 2P8LA 3CXDL 2FX9H 3F58L 3IKCB 4YAQB 2V2WB 4Z9KB 3T1FA 1N5YL 4NKIH 5DTFA 3I50L 4UTBH 3RVUC 3BP4A 3VFGH 4X0KB 4XCFH 4HKXA 4KJYA 5J11C 2OI9C 3MLXH 2UUDH 2DLFH 4J3VA 5EO1B 2FATH 4ZS7L 4OCSL 2BERA 3RWFB 4XCNA 3P40A 3HAEB 4JPVH 5DD6B 5C0EA 1MHPH 4QRTB 2WMPA 3E2HC 1N3NB 2DLIA 3JTSB 1LEKA 3KLHD 3CCHB 3C87A 2CDFA 4Y1AA 4HX1B 4WEBL 3T65A 1FL3A 3T77B 4NO2B 4CVZB 4PJ7F 3R1GH 2X7LA 1AO7E 5CZKA 1NFKA 1MFDH 4ZOCA 5T3ZD 1I3RA 1ZXQA 4CU8A 4KMTH 4YLQT 4D9RE 4JZJA 4G8GB 5D1XC 5CZXC 1NMAL 3ZT7A 4MWFB 1L0QA 3RX7A 2AP2A 3WSQL 2ZNWA 4XMPL 1I9JH 5TF0A 5FDWA 5L2JB 3SDCC 3D48R 2BSSB 4J1UB 1NC2D 2VZSA 4S0TD 4ERSL 3AS2A 5GJTH 3WLWC 5JW3H 1DFBH 4PJIE 1O0VA 1MH5B 4KRMB 3D6GA 3QO1A 1MFNA 3Q5OA 3PNWB 3F6LA 3ULUD 3LS5L 5E95B 1EEYA 3MQIA 3RQ3A 4OZFA 1HINH 4NO0A 1TJHL 3QDJD 2NY3D 4TNVF 3C6LD 3TYFB 3MXWH 3GSOB 5KVMC 4JFFE 3P30L 2A83A 3U82B 1HHJA 4FFYL 5MEND 4FOMA 2F54A 2ID5A 3O4OC 4R4FL 4XZUA 3QO0A 3EYQC 3P0VH 4KXZH 4PJXF 4YE4L 3DMMB 5DLMH 2HWZL 3FHQA 1YEIL 1X4YA 1CDIA 1L4IA 3PL6B 1TJIH 1OAXL 4XCEA 1LDPH 4G6JL 5T3ZH 5ERWB 3TN0D 3OWEA 5EC1B 5HHMB 2ED8A 5JHDB 5F7YC 3DYMA 2W92A 3G5VA 3REVB 1N8ZA 3RNQA 2VXQL 1U6AL 5IB4A 1FFOA 3MMEA 1J0KA 5MENB 4PY7A 3MLVH 3RPIA 3QEHA 5E9DB 4K8RC 4RIRB 2WV3A 3BIBX 3MRIA 2CDGA 3VXNB 5FUZH 2Q6WA 3KYMA 4AK1A 1YYML 5F7KC 4X9HA 4X7CC 3WDIA 4GRWH 3RWGA 3LQZB 4TULL 5KW9H 4DEPB 2QEJA 3BJ91 1QSFD 2VLRE 4UV7L 4LIQE 4P5TA 4PJ8C 5GGSY 1SYSA 1U8LB 2MKLC 1ONQB 4JO2H 1BVLA 3I6KA 4U4BA 2MQ0A 3WD5L 2NX5A 4M7KH 4JR9H 2FGZA 1I1FA 4QT5A 2EE3A 3Q3GB 1XT5A 1QEWA 5I30L 1F11B 4YO0B 1C12A 3TVMD 3K1DA 1HNFA 4KVNL 5GJSH 4QY8A 5FYLE 2P46B 4ESKA 4C4KO 4JFOA 3HC0A 4M9PA 1I9EA 2AJ3A 3EIFA 4YPGA 4FTVE 2CDEB 1XGYH 1JVKA 2QHRH 4GRLB 5JIKA 5ESVA 4WFED 1MCDA 4ZO8A 3FQUA 2WANA 1NGXA 4ZO7A 3WV0A 1TPXC 1YEGL 5CBAB 4XHJD 1T2XA 4K3JH 4LLDB 2EECA 5LVEA 3HRZB 1T7WA 3D87B 4R6UA 2DI8A 4M7JL 3T2NL 5C9KA 5CEZD 3FT4A 5CEYB 4QGYA 3GGWB 2ESVA 5IB2A 4L4VD 2PETA 4P46B 4ALAL 2BRQA 3E6FA 1MHCB 2IADA 4OGYL 1Y18A 1LK3L 1CXIA 3MACL 2AVGA 1KPUB 2VWEE 3I3EA 5EZJA 1RZ7H 5BVJA 2GAZA 5SWZB 1F4YH 1D5BB 1FYHB 4PRPB 2R4RH 3AB0B 1RI8A 5E03A 5HDQH 1C5DB 3H9SE 4YDJB 5F7FA 2VLJD 5KAQG 3WJJA 43CAB 4G8GA 2EYSB 4F33A 1TTGA 4J3WA 5EOQH 3D9AL 4RSVA 4AMKL 5C09B 4PJ8A 1JV5A 3K2UL 3MLSL 4OZFH 4LLVB 3V7MA 5TPWL 3QCTH 1CZ8H 4I9WE 5TJWK 5I76A 1HINL 3D0VB 1QTYT 3MLWH 3MRNB 4K8RH 5C08B 3X11B 5A2FA 4CU7A 2X42A 1RD6A 4HUXB 1EIBA 4DUXA 1RJZA 4J6RH 3P30H 4W6WB 2Z31A 2OCFD 2OL3B 2Y5TB 6CGTA 3AS0A 3FO0H 3BZ4B