3PWUB

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801(bola-a11)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
source organism Bos taurus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwuB00
2NXZC 3OAUH 4NWUL 1MI5E 3ULUD 4P9ML 1N8ZA 5FIEA 4ORGA 1CGYA 4HIEB 1MCLA 1UENA 1YNLL 4MA3A 1JGUH 2ZOLA 1EJOL 3SPVB 3UC0H 3LKRB 1JE6A 4Q9CA 4LGPB 3GM8A 5ILTL 4LVEA 4D8PA 2A6IB 2P5EA 3I75B 2BP3A 1P5UA 2GK2A 4PRHD 4XVUD 3QCVH 4NQDA 3T0EE 3GDBA 4LVOB 3SY0B 5DK3A 5EUKB 3SE9L 2FSEA 3GMMB 1MHPH 3B5HA 4MD5B 2YD2A 4HDIB 4L4JA 4P59L 4OFPA 1DEEB 4GRLD 2CLZA 1N5YH 1AXTH 1FAIH 1FZOB 4B53A 3BH9A 4N0FA 4JR9L 4EI5B 2GK0B 5FYJL 2HVKA 1T7ZA 5DJAA 5BMFH 4HK0A 3TPUA 4U33A 2IBGA 5JQHC 5C0GA 4Q6IB 4J4PD 4MB3A 4J3XA 4WV1C 3S9DB 1DZBA 2DLFL 3HCVA 2NY0D 1MFNA 1MJUL 4HH8A 4HK3N 2D0FA 1MFDH 3C09C 3V79C 2WK2A 3LKPB 3DECA 2BY3A 2CD0A 3VGEA 1QFWI 4GUPA 5C86A 1DQJB 3EJZC 1BD2D 2P7TB 1X4XA 2I24N 4QYOB 1LNUB 4OF8A 5F9WC 1MNUH 4E42B 5CZXC 2G5BA 4JPWH 1KPUB 4FG6C 3L3JB 1T7WA 1S5HB 4XBEH 4HIHB 3WKML 3QUXD 3LZFH 3BD3A 5FK9A 5FGBA 5I73B 3AVEA 3TV3H 3VI4E 5FCUH 1IM3A 4ODSL 4KDWA 3SKMB 5F9DC 1XCQA 4K8RD 2LU7A 1XF4A 3MLTB 1RZ7L 2QHLA 4JM2C 2BSSA 2R0LL 4KI5C 5E6ZA 5DJXA 1FL5B 5CIPA 2NW3B 1U92B 3OKMB 3FQWA 1RU9L 4YBLB 3PWLA 4DCQB 3MLZL 1LEIB 1IAKB 3O2VH 5IBUB 3RVWC 4LSVL 3GMQB 3LB6C 1MCWW 5TF1H 3BDYH 2QLVB 3IJYB 3WXVH 3LKSA 1YECL 1D6EB 2NY5C 3T1FA 5L2JB 5ID0B 3GBMH 1XIWB 5I71B 3W9DB 2XTJC 5IFJB 4KJPD 4ZSOA 5D6DA 1OGAB 4OSUL 1UC6A 3SBWA 4PGJA 4PGBB 5LCVH 1C5BH 2DRUA 1KPVB 4RGMC 1IT9H 1AD9B 2E7LC 1U8LA 3WUWA 3HMWL 1KSRA 1WAAF 1RJYA 5DQDL 2W07A 4JE4B 3TBVB 3MRFA 2ZKHH 4XXDA 4MZ3A 2DYPB 1EHLL 4Z76B 3FQXA 4HFUL 5EBGA 1OTSD 4X80L 1IFHL 1MPAH 4MX7A 4KUZH 5F9OH 4MNQE 1U91A 4J1UB 3GJFA 5FM8A 4PGDB 4I0KA 1YN7A 2XPGB 3ZKMD 1KBGL 1I8MB 4X7SH 1G7PA 1RURL 1BM3L 3KLSA 4HX1B 2XOTA 4P46A 1MCRA 4JFFE 2NY4D 3MV9B 5DVMA 5EB9A 3IT8D 3SCMC 3MSPA 1ZVSB 5I6XB 4IOFD 3SE3A 5CSGA 3L5XL 1NFIB 1V7ML 3CIQA 3AS1A 3P0VL 3FOLB 3MXVH 5C3LD 5D71L 2WIIB 1FYTD 4OFYD 4PB9L 3HAEG 3HZKB 5F7HA 4QXGL 4ZUVA 3HI1A 4GRWB 4QOKD 4TVSa 4X8JA 1Q1JH 1P53A 3EO9H 1ADQA 1K8DA 1VB9A 1FL6A 5IB1B 1A14L 3QHTC 1CFTB 1A1OA 5IQ9B 2PW2B 2VXQL 4YHMH 5I1KH 1MCIA 3PNWB 5C0AA 4XX1E 4G6JL 1DBML 1YEJL 3QUYC 3ARGC 5EDXA 4RZCB 1JNLH 3WE6A 1PVHA 2AJSL 4RX4D 2FJFB 1Z6JT 3MLWH 5CFHA 2FL5A 3VG9C 4WO4B 3UAJC 3CFEB 4R0LC 2W60B 1OCWH 3BRFA 4WDIA 3MUJA 4FFWC 2YPLE 4YHNA 3NFSH 2EICA 2H9GB 4WIQA 5T3ZH 4EN3B 4C59B 2J8UF 3D69B 4P3CL 3RWIB 5C70A 5IIEB 2HN7A 4FXGB 2ADFH 4FQHB 4K55A 3IFLL 1T4KA 3HE7D 3IDIA 4G8FB 2GITB 4PJDE 4MQSB 5KTEH 4AM0A 4WI4A 3DBXA 5GS0L 4HJ0C 3G08B 2VOTA 3MBEA 3ABZA 3VMOA 5AD0A 5DS8B 2HFTA 2W9EL 4RNRB 5C6TL 1XGUA 3QEUB 4GKNA 1JTOA 3RJQB 4PJIE 3GB7A 3IRPX 3UO1H 2VERN 4BSJA 3MX0A 4TOYH 5F7EL 1OWWA 2CIKA 4QNPE 1S9YB 4ZAKD 4UIKH 1ED3A 2HJFA 3ARFD 4R7NA 4MMZC 2I60L 1KLUB 4ODUB 4WNQB 1N3NA 4ONFL 5EO1A 4RIRB 4Y7MA 5I16A 1FVDB 1NBYA 32C2A 2FYYA 3MMEB 1KENL 1C12A 1T5XB 5CILL 1VHPA 4L1HA 3QULB 4U7SA 5HDQH 4TVPE 3KNBA 4NQTA 2VH5L 5HI3C 3FB6B 5E6IC 3ULUH 5KBNC 1LO3L 1EHAA 2SEBB 3SOBL 3BD4A 4PGZA 2EXWD 5E8EA 3DHJA 4ZFOL 3T3PE 5JO5B 3MACH 1AR1C 1F00I 3AM8C 5EU5A 4G6AD 5DVOA 1KIQB 4IOSD 3H0TB 3U0PA 3PQYA 2BY2A 1CFQB 1KN2L 3QHFH 4HG4K 2FBJL 3CU1A 3ULUE 1JNHB 5C0CB 3GKZA 4WI2A 4HK3J 2Y06L 5DD1L 1I9IH 3ZE1E 1WTLA 2JKXA 3AUVA 2V7NB 4AT6B 3BPOB 5C08B 4CVUA 2WAHA 1VFOA 4OTXL 1MQKH 4QY8A 3EDDA 2YN5A 4KMQA 3BPNB 1OP5K 4DFIA 3KPRB 4NHUA 4LRNH 3KYAA 3UZQA 1V7NL 2OXGA 4PRHE 5AZ2L 5JHDD 4I3GA 2Q3AA 2XZZA 5IEKB 1DVFB 2F5AL 2MKWA 1HK6A 1MIMH 4Y4FB 1YEDA 1X5KA 4I3SL 4NQUA 1NCWL 3KLAA 1JNNL 1CF8H 5HYFA 4TSCH 1S8DA 4O02H 2A9NL 1S7UB 3WCYA 5F7YC 1PX3A 3F58H 3C5SB 3D85A 4NN6C 4WW2C 4YXLL 1ZEAH 5KS9F 5T3XL 1QFOA 1J9CT 1TVBA 3ULSA 4FQ1H 3KYOA 1IL1B 3FONB 4DUXA 4HCRA 3CDYA 2W0FA 4WHCA 3VH8G 1DL7L 1ZANH 2ADGA 4YUEH 1N8ZB 4LBEA 4ORGB 3TO2A 3EO0A 4XB7A 4MA3B 2ZOLB 2J8OA 1BD2E 3OQ3B 3IB4A 4JO2L 5HGAB 3DX9A 5D5MF 1S3KH 3UX9B 5DMKA 4D8PB 3EUUA 2P5EB 4H1LA 4WV1A 1NDMA 3I2CH 1QSED 1YEHH 4NQDB 5JNYA 3ARTA 2FSEB 5L9DH 3NH7L 4NWTL 1DBBL 1OQXA 1A02N 1MY5A 4G3YH 2CLZB 3BH9B 3W2DH 2X05A 5MP6L 1UACH 4N0FB 5I75B 3RUGA 1DN0A 5C7XH 1WTGT 2HVKB 2X89D 1XGTA 3P9LB 4XP5H 5DJAB 1P2CA 2YD9A 4HK0B 1F02I 2DLGA 3TPUB 1RPQA 4NYLA 1L4IA 2NY2D 5C0GB 1LP9E 4LPTA 3MA9H 5TF0A 3VRLF 3S5LG 4BKLA 1UH4A 2BOBA 3HCVB 1TVDA 3NTCH 5L2KA 4JM2A 3O6ML 3QSKB 3LIZH 1IC4H 4R2GB 5DHXB 3ROLA 2R4SH 5DI8A 2EH8H 4G7YL 2O5XL 4GUPB 1UM5H 4PP1C 4ERSL 3O3DA 3ARSA 4I0CC 5H2BA 2G5BB 3EJJX 4NNPL 2VXTL 2YUXA 5FK9B 4KK5C 1HWGB 3UZVB 3MOQA 4LSQL 4IRJD 2HWZL 4AEIH 4NM8H 3U9PH 4A6YL 2P43B 1QPXA 4K3JH 1IM3B 2XA8L 3LCYA 5FHBH 4I1NB 1XCQB 2YZ1A 3G6JF 1KFAH 1XF4B 1H5BC 1WZ1H 2EE2A 2BSSB 2VLLA 5DJXB 1IILE 2X2YA 2AQ3A 2E7LA 4CRPA 3PWLB 2A0LC 1FVEB 1F2QA 4O9HH 4CGTA 2L7JA 4Q9RH 2IFGA 1QBAA 3GMRA 4D3CH 4OI8A 4U2ZA 1U0QA 5HHQA 3LKSB 2AJYH 4S1DD 4G42A 4MJIA 3T1FB 3CU7A 2YXFA 4P5TB 4KKLD 4ZSOB 4ZFZA 4HS6B 5F1KC 1JI2A 5I30H 5HBBA 1YEIL 5GIRA 3STLA 4JB9H 4QLRA 1TETL 1U8LB 2HFFA 3WUWB 1H15A 2I5YL 4QOKE 3BGMA 1YQVH 1RJYB 3SEPA 3SCMA 4HUNB 4GS7B 3R8QA 3MRFB 4HAFA 4XXDB 3JWOC 3ZL4H 1UCBH 3GJFK 3HC3H 3FQXB 3NPSB 4NUGH 1N5AA 4MX7B 2YUWA 1U91B 4IIQC 1DLFL 5EZLB 1YN7B 1FV1A 4I3RH 1G7PB 2OSLA 1HH9B 1I7TA 3B5GA 3UTSA 1QFWM 3OR7B 3WLWC 2FEEI 1RUKL 1C5CH 1A7OL 3MNWA 1ZGLP 1A5FL 3QUYA 3QUMH 1FSKC 2QSCL 3V52L 3ARGA 5IGXL 2F8OA 4OQTL 4YGAB 5FO9A 1MCOH 4LLDA 4OZHA 7CGTA 1B2WH 12E8L 4JFZL 2O61A 5D93B 1Z2KA 3QG6A 2I07A 4Y4HC 3BEWA 3NPZB 5D7IA 1GGIL 4ZUVB 4X8JB 5CGMA 1FC2D 1F3RB 1K8DB 4J3TA 1FL6B 1QA9A 2HFGL 1Y18A 5IQ7L 4J6RH 1XGYL 3GNMH 1A1OB 5KZCB 2CIIA 2BSTA 1NCBH 3DVGA 4KJWC 4WI9A 5C0AB 4TRPL 3UJJL 4X5WA 5DUML 1JK8A 4HW6A 4RMRA 3DHMA 2AQ2A 1P4BH 2BNRD 3WE6B 2JIXA 4FZ8H 3O4LD 1S9XA 5SWSD 2FL5B 4N8CH 2H1PL 4XPTL 2CUIA 1NC2A 2UWEA 4OZGE 4WDIB 2EE9A 2F54A 4YJZL 1NC4D 2AXJA 4DTGL 1MAJA 2RHEA 3CJJA 1A21A 4YHNB 4UT9H 4M7KH 4KTEH 4PUBH 5LBSL 5GSRA 3EDKA 4OGZA 4R4NC 4HJJH 2HN7B 4Y5YC 1RUQL 3E6FA 1MCQA 1XH3A 4YX2H 1RAMA 3U46B 1T4KB 1KB5L 4NM4L 3IDIB 4QRRD 1CG9A 4HQQL 2EE3A 3GBNH 5I18H 3ALWA 1J1XL 3IDJA 2EO1A 2D2OA 1YYLL 2VUOA 3MBEB 1X5LA 5AD0B 1TENA 3CXDL 1XGUB 5E6IA 3PABA 4XB8A 4LIQH 5GJSL 3VFGL 3GB7B 3KPPA 3TH2T 1ZAGA 4NQED 3DVFA 5IB2A 2GJ6A 2CIKB 3DMMC 1G9ML 4M7ZC 2PO6D 3AM8A 3W0WD 5EC1A 3QJFA 1QFUH 1IAIH 1FQ9C 3U82B 1ED3B 3P4OA 1AGDA 2HJFB 2N56A 2OZ4H 4JRYA 1FHGA 5EO1B 4L8CA 1T5WA 5JHDE 1NBYB 32C2B 4UDTA 2FYYB 4LIQE 1C12B 3NACL 3FRUA 1GYAA 3LH2H 2FX7H 4OCRL 3KNBB 1OT1A 2VDKL 3MRDA 3VDAA 5DMIL 3V7MA 3TIEA 5A40E 5E8EB 1DBJL 5GS0C 1MCHA 2ICCA 5TDPA 1OSPH 4ZMAT 5EU5B 2IADA 3U0PB 3PQYB 2FDBP 1IKFL 3F12A 3IVKA 3PUCA 4NHCH 4P2OC 4NJAH 3GM0A 1L9MA 2QADB 3PGFH 3VDBA 4JN1H 2AXGA 1ZHNA 4WW2A 3T04D 3PWJA 4MVBD 3S36L 4QY8B 5DRXA 3RZCD 4G8GA 3K2UL 4NHUB 4HWNA 4N0CD 5J6HA 1P7QD 3K4AA 2NY1C 2C9AA 2NXZB 3OAYH 1UVQA 2CGRL 5EIQA 2ARJQ 3DNKA 3SO3C 2YHGA 4AQOA 1ORQA 1MVUB 1DDHA 1YEDB 4Q6YA 4YGVA 4PJEA 1DUZB 3WV0A 1NFDE 3KLAB 3GMNB 5DJZA 1EFXA 2VTFA 2FHFA 4TUJB 1OARH 1S8DB 4PJBA 3RDTC 2X1XR 3K4DA 3MLRH 5E2TH 3GK8H 3D85B 4PJ9D 2DKUA 2P5WD 1V3KA 4V2BA 5FGSA 2R0KL 3ARDC 4N9GA 5DR5L 1TVBB 3ULSB 4R4FH 3KYOB 3RIFF 5CCKL 2W0FB 3G6DH 4OZIE 4XWGL 2ADGB 4GG6F 1ODAA 4LBEB 3TO2B 3EO0B 4XNUL 3VRIA 3NCYP 2UZYB 3S37H 1LDPL 4PJ7F 2LQRA 3DX9B 3TFKC 5DMKB 3N9GH 1F3DJ 4H1LB 2WP3O 3NCMA 4WV1B 5GRUH 1NDMB 3CVHL 1FO0H 5JNYB 4KAQH 3VXPA 4RFEA 1I1FA 4XBPB 1NPUA 3C09B 2CUHA 4MDIA 3C2AH 1XCTA 2AW2A 4M1DH 1AGEA 1IBGH 4HG4J 4KQ3L 3C8HA 5HYQA 2PR4L 4NBXB 1YJDC 4P4KC 5F9WB 4JGJA 4IDLA 3RUGB 1DN0B 4OLUH 4OD3H 5CINL 1XGTB 4PJAF 1P2CB 4IBLT 4WUKH 1A6AA 3TBTA 4PV8A 3BVNA 3HNSH 4L4VD 4NYLB 4NQCD 1A6ZA 5J9PA 2Z92B 5DC0A 1H3WM 3MRIA 2BOBB 3QR2A 5SWZD 5ACMA 3LEYH 1G1YA 1NKOA 1OLZA 3BN9C 1H5BA 4JM2B 3Q5OA 3UP1A 2BVTA 3ROLB 5DI8B 2KBGA 2XZAL 4OD1H 1FDLH 3D2UA 4MQ7A 1I9JL 3U4BL 3NMEA 4ALAL 3O3DB 5JXEC 4NP4H 1JGDA 5H2BB 3V0VB 1G84A 4BFBD 4XVTH 2ZCKH 4XCFH 3PGCA 4HS8H 1FG2A 1GCFA 4M9OA 1T80A 1NUGA 3IDUA 1MFAH 4FFVD 1I1CA 1MEXH 3KLHD 1INDL 4OGYL 2J6EA 3ARRA 4GKZA 1Q0YH 5CD5D 3QRGL 2VLLB 2E8YA 2XQYK 4HT1H 2ERJC 3DGCR 4RGMB 1Z3GH 1J8HA 2A6KA 2VWEE 3K4ZA 4CU8A 3BISA 4M7LT 2BSRA 4I8DA 2I27N 2EDFA 3GIVB 3ARPA 3JUZA 2E9WA 5MEQA 1KC5L 3INUH 2B1HL 3GMRB 4DKEH 5EBMA 4U1GC 4G42B 4MJIB 4M62H 3K0WA 4L9LC 3IJSB 4APQD 2HKHL 4P9HL 4IIQA 4ZFZB 4POZD 3REVA 5FV2A 5JDJA 2JF1A 4RCAA 5KW9L 3OAZK 3HFML 5TE7H 5GIRB 3STLB 5DFTA 1MH5A 3DX7A 1MLCA 2A2QT 4YEEA 2HFFB 1H15B 1KYOK 3BGMB 5JZ7D 3VW3H 3ISWA 3SCMB 4P0DA 1CD1A 2DQTL 2IANA 1JPFA 4XXCC 3A6BL 2YKLL 3T3PF 1RVFL 2NY7H 4UTBL 3IDGA 1N5AB 4GAYA 2RQ8A 4Y4HA 3R4DA 4LHJB 2BNRE 1Z9SA 3O4LE 1FV1B 5SWSE 3HG1D 2OSLB 1XZ0A 4CDHA 3WEXA 4YHLH 1YPZA 4ZYKA 1I7TB 3UTSB 5F89A 1MWAH 2C3WA 4JG0L 4Z7NF 4BZ2L 4LQ1A 5LGJA 1TPXC 2Z4QA 3MNWB 3QUYB 3ARGB 5K59E 2FNBA 3WHE1 4PIRF 5FO9B 4OZHB 4LAQH 4OV5A 3QUKB 3VG9B 4MJ2A 1B6DA 2O61B 1JP5A 3IXTA 3QG6B 4QRRE 5C2BH 2I07B 4PJGE 3BEWB 5D7IB 2GJJA 2IFFH 2YZ8A 4YHOL 2QR0A 2D0HA 1QA9B 1Y18B 2YWYA 4FTVD 4OLYH 4Y5YA 2BHYA 5E08L 2BSTB 1IM9A 1YEKL 3ZTNH 5F72S 5A2KH 3DVGB 4NQEE 1IGJA 3GI9L 2B4CL 4X5WB 3MCKA 2E27L 3GMLA 1JK8B 3W0WE 1NSNH 3QCUH 3MYZA 4Z7VA 1X9QA 2JIXB 3MCLH 3UYPA 4HBCH 4X4YA 1S9XB 3SE8H 1I3RA 3FO1A 1AKJA 1QSVA 2UWEB 2F54B 4OJFL 3FHAA 1MLBA 5TE6L 2WUBH 2F74A 3S35X 1EGJL 3DMMA 3NAAH 2C26A 5GSRB 3BSZH 1RK1A 4OZFG 2CDGB 3EYSL 3FQUA 3E6FB 3CPLA 1XH3B 5IVXE 5L0QC 3S7GA 5EOQL 3KPQA 1CG9B 5HDOA 4BQ8A 3TBWA 5ALCL 2B8OT 1C8PA 3QEGL 5ANMA 4RDQF 2YS4A 5DJ0A 5E6IB 3IAQA 3PABB 5E24E 2EDYA 3GSNL 4GRWF 3KPPB 4BSWA 5IB2B 2GJ6B 2X42A 1ZXQA 3H6JA 2P48B 3V9FA 4RAHA 3I6LD 1SJEA 4XHJC 3QJFB 1FGNH 5EC1B 2GY7B 4Z18A 1AGDB 5C0JA 1RZJH 4P2RD 5E2JA 4P2OA 3KXFA 3PP4H 1T5WB 4JFEA 3LS4H 4UDTB 2GKIA 4OCSL 1AI1H 4Q58C 4E9LA 3FRUB 3WFEH 4ZPTA 4OM1L 1FFOB 3BAEH 3X3GL 3MRDB 3TIEB 4OF5A 3JBG7 5CUSH 1M71A 4X6DA 4OKDA 5TDPB 3V6OE 2P5WE 1XT5A 4WHDA 1TNNA 3Q0HA 4X9BA 5D7LD 5GPRA 2G60L 3IVKB 2CKBH 4ZFOA 4DAGL 1G9MC 3DETC 2IQ9H 3RDTA 3ZDZE 4NGHL 2J4WH 2VN4A 3RY5A 4MS8C 2AXGB 1ZHNB 4IDJL 4NN6B 4WW2B 2PTTA 3ZKQD 3Q6FA 5DRXB 4G8GB 4FQPA 3ARDA 5J6HB 3MRCA 2APXA 1D6VL 4Z7OE 1IGMH 1NMCC 2O5YL 1UVQB 5C0BA 3S35H 3GGWA 1UWEL 1ORQB 1DDHB 1IC7H 3DSNA 3KYKH 5TDNA 4YGVB 4X6BB 2VSDA 3G6AA 1EFXB 1FZKA 4EI5D 1TMCB 4PJBB 4LP5A 4KVNL 1YEFH 4GW1A 1S7RA 3FN9A 3ECBA 5K9OA 5AWNH 2PTVA 4L4VE 4NQCE 3CFIC 4N9GB 4XX1G 3H42L 1NBVH 1CD8A 3TWCL 2BFVH 5SWZE 3FJTA 1VACA 3WL9A 1HKLH 1NLDL 2ZWLT 3MV11 4P4KA 1NGZA 1MCWM 1F90H 3VRIB 5LGHH 1SYSA 4GSDL 1QBLH 3MLYL 1URLA 4I13B 4BELD 3V6BR 2C3VB 4C4KO 1OP3K 2X10A 4NKMA 3SDCC 3T1WA 5JUEL 4YPGA 4ZD3H 4RFEB 1I1FB 4EUPH 4MDIB 2VDLH 2V7HA 4PYGA 4JKPH 3VXME 4XTRD 5D8JH 3KDMA 1AGEB 5I76A 1VESA 2DQHL 5HYQB 2AJVL 1GHFL 4OLEA 3WFHA 5JXEA 3CZJA 1PJ9A 4GG8B 1YDPA 3OXRA 1H3PL 2WSKA 3BEVA 2DMBA 4HHAA 5DC4B 5KG9A 1L7TH 2AK4D 3OSKA 5DHYA 1A6VL 4TNWK 4PV8B 1MVFA 1RJLA 2D7MA 1WEJH 1KB9K 1A6ZB 4M5ZH 4U1NA 5J9PB 3QG7H 1JPSL 35C8H 3TM6A 3MRIB 4I2XE 3DROA 4HZAA 1UA6L 4PG9A 1H5BB 1U41A 5SX5K 1ZGLM 2KZ1B 3HUJE 2FIKA 3N1FC 1OQOA 2AV1A 5BO1L 3D2UB 4MQ7B 2X4NA 2NQCA 3NA9L 1JGDB 1ROWA 1K85A 1AH1A 3QNZA 1JGLH 3PDGA 3PGCB 1FG2B 5E99H 1CLCA 4GW4B 1WZMA 4L9LA 1DFBL 4OFVA 4GKZB 3LQAL 4UV4L 4QKXB 4HUMB 4Y8AA 4WHTA 5KAQG 4A6YA 1QR1A 1J8HB 3CXHK 5TE4L 2A6KB 4YDIH 5HI4C 2R0WH 1U3HC 1YC8A 1G9NL 3HG1E 1J88A 5GS2D 5MEQB 4LSSH 1NAMH 2KQMA 4XXCA 5IFAH 2Z0BA 5EBMB 4GXUN 4XP1H 2IGFH 1U36A 2HLFC 5CGYC 4LCIL 4R26H 4IIQB 3REVB 1CVSC 2B2XH 1BIIA 3WIIH 2WINA 1JHKL 3H7BA 4ODVL 3DX7B 1MLCB 3HR6A 2PXYD 3D6GA 2R29L 2NYYC 3G04A 2BVUA 3EYQD 4EBQL 1CD1B 1FSKB 1JVKA 1TTFA 2IANB 3RAJL 1LWRA 1JPFB 2AABH 4FTVE 4YBHA 5EUOA 3MZGB 1JRHI 3IDGB 4K3EH 1T22A 4GAYB 4LCYA 3GSQB 4Y4HB 4XNQA 3OGOE 4WO4D 2LVEA 3QCTL 4X6CA 3KPOA 3CFCL 5EU3A 1JPTH 1XZ0B 4KQ4L 5D7SL 3WEXB 1YPZB 1RULH 4ZYKB 1I1AB 4C56D 1JV5A 5F89B 4Z0BL 1T03H 4LCWB 1BWWA 2JELL 5LGJB 3U79A 4TSBH 5JR1L 3C9NA 3EFFA 2CUMA 2VDRL 3MQIA 5IHUL 4YBQD 4OV5B 1YUHA 3DVIA 4GKSA 1AXIB 4F2MA 3EYUL 5ISZA 2W0KA 4KJYA 3E3QE 3IJHA 5FOJA 3V4VH 3V6ZA 3ZE2E 3MJ7A 2QR0B 3MLSL 4OQTA 1X6LA 1W0YT 4KV5F 5FOBA 4ODHL 1NCDH 4Z8FH 3I3DA 5IB4B 3RBSA 4Y5YB 3RZWA 3UMTA 1IM9B 1F4AA 2DLEA 2Q76A 5IB4A 2Y7QA 3MCKB 4PJFA 2UVFA 3GMLB 3PWVB 3I6LE 3OF6D 3FHQA 3MXWL 5DT1H 4X4YB 5L8LB 5JXAH 4P2RE 3FO1B 1K6QH 1AKJB 2WLYA 1U8HA 3RY4A 2DQGL 3PWPA 5JW4N 2DQUL 3BN3B 4WWID 1F3JA 2F74B 1ZWIA 3BMWA 5I1JL 3DMMB 4P49A 4M7ZB 4FXKA 1MAKA 3RWFA 4S1SH 3FQUB 3CPLB 5DD6A 1JZ2A 3IU4H 5KVGH 2FX8L 4ELME 3KPQB 3OHXA 3N1PC 4IRSC 3TBWB 4GQ9L 3WDHA 2XZCL 2CJUL 3OKLA 5D7LE 1QKZH 5HI5D 3OZ9L 4ZDHA 1RZGB 1IGIL 3ZE0F 3PXHA 2YC1A 3RVXD 2B4CC 5KANI 3HB3D 4EOWH 5GGTH 2Y5TA 2AJ3B 4XI5C 4MLSA 5BCAA 4KMTH 4BSWB 5D9SA 5C08D 4C54A 5KSBA 1TXKA 3HI6L 1SJEB 3KPRD 2YD8A 5C0JB 3LKNB 1Z9LA 3TYGL 4P2OB 3KXFB 4JFEB 4TUKH 25C8H 3O8XA 1WCBB 1LO5A 1EO8L 1NBZA 8FABA 3MNVA 3ZZ1A 3SGKC 3AGVA 4MWFA 4ZPTB 1YYMH 4HUXB 4DKFH 2IAMD 2F58L 5KVDL 2K1MA 5ADOL 1U6AL 2IBZY 4PRPA 4X6DB 2NY1B 1TTUA 3TA3B 2R1XA 5I1HH 4W81A 5HY9A 1IQDA 3SO3B 2Y6SC 1A4JA 5D2LA 4ZFOB 4X7FC 5EIIA 2DQEL 3H3KA 1UZ6E 2R2EA 2B1AH 4PBWD 4JPVL 3RDTB 4G9FA 1EMTL 3X17A 1MCCA 3WXWH 4JGUA 3U7WH 2UY6A 5F3HA 4TTGA 4PRID 2PTTB 3DI2B 5EIVA 3ARDB 3MRCB 2ZUWA 4YWGH 4WI6A 1E4KC 3GGWB 3RPKA 2FATL 4TPRL 5KANG 5TDNB 3G6AB 4S0SD 4JG1L 3NIDF 1GGCL 4H88L 1FZKB 1A6WH 1UWGL 2V9QA 1OAKL 4R8WL 5HSFA 3FOMA 4GW1B 1S7RB 1CXKA 3QPXL 2AEWA 3RVUC 3ECBB 5K9OB 3SDCA 2AK4E 2DQIL 4AIOA 5HYSG 3QA3A 4GXVL 4NRYB 1F42A 1FNFA 1BECA 1WSST 1VACB 4K3HA 3WL9B 2C1OA 1KJ2H 1NGZB 2CSPA 5IW6A 2D7TL 1RUAL 1SYSB 4O00A 1IVLA 3MLVH 2AV7A 3QIWC 3CAFA 3WHXA 1MFEH 4ZNCD 2KH2B 3S3SA 4O2FA 3IRZA 1LK3H 1LGVA 1R5VA 4AL8L 2AP2A 4NKMB 3VFPA 4JFDD 5E95B 1A3RL 3FFCA 4YPGB 3GSUB 2VXVH 2V7HB 1CL7H 3S88H 3KDMB 5I76B 4JVWA 3CVHA 4OUOA 5HHNA 1ITCA 3WFHB 1UKSA 3TJHC 2I26N 1YDPB 3OXRB 3BEVB 4V1DD 1ZSDA 3CDFA 4HHAB 4OGXL 5KG9B 5DHYB 4LCUA 3OKNA 1RJLB 2I9TA 4QRUA 4U1NB 1U2HA 5I1AA 4JPKH 3LY6A 3DROB 2V17H 3CFKA 4PG9B 2MTPA 3MJ9L 5ESAA 2FIKB 4Z6AT 5JW3L 1T0MA 3QFJA 3KJ6L 4FZEL 4D9LH 2ERJB 2AV1B 5DUPL 3MRKA 2F19H 3X3FH 2X4NB 3MBXH 3B2VL 4OF0A 1CK0L 4JANA 3I50L 1U3HA 4LLAA 3Q1SH 3L1OH 3T2NL 3QNZB 2H6PA 4MHHI 5GHWH 3B43A 1OTTD 4MXVE 1EBPA 1KXQE 1MFCL 4L9LB 5I1EH 4JFQA 4YHZL 2AEQH 4GBXB 4X99A 5CJQL 4WHTB 4UAOC 4A6YB 1QR1B 3C8DA 4OD2A 3BRGC 3ZHDA 1Z5LA 3QIUD 4L3CA 4LEXL 4RGOH 5FYLH 4P46D 2OR9L 3MRLA 1GOFA 4C56E 3VG0H 3OAUL 3H7LA 3TN0D 1ZVHA 1FYHB 1QNZH 3RWDA 1QVOA 1JGUL 1UM6H 3CUPB 2JCCA 3UC0L 1Q0XH 2DIBA 1BIIB 4KI5F 2Z93A 2WINB 3H7BB 4Z78A 4ZS7L 2B0SH 4NJ9H 4OB5L 1BX2A 3MRRA 3ZDYE 1R3IH 1CU4L 1KB9J 3LMJH 3LQAC 4KRNA 2NXYC 4J7RA 5DFVC 3ORJA 1TPXB 2LTQC 3HAEA 1MHPL 5KZCD 4UT7H 4N0RA 2G5RA 4NSKA 5C0AD 1X5AA 1FLRH 1N5YL 1AXTL 2FR4B 5EUOB 2O93L 4K07A 1T22B 4LCYB 5CJXC 2V2WB 1G9NC 4X9GA 3RIAK 4Y4KB 4XNQB 3LPFA 2O5ZH 5BMFL 4EXPX 3EO1A 4LLVA 4HWZA 4NZRH 3EJYD 2F5BH 3PWUA 1KN4H 3KPOB 4X6CB 5EU3B 2HAZA 1DSFH 1EO7A 3AU1A 1S9VA 1JV5B 5CSZA 2AKRA 1IAOA 4ZG1A 1SM3H 1MFDL 1A3QA 3C9NB 3EFFB 4FA8A 2HT4D 1A22B 3RU8H 1XR8A 3VWJC 1YUHB 3BOVA 2WV3A 4MSWA 4QO1A 1MNUL 4GKSB 4PP2A 4F2MB 5ISZB 4JPWL 5LAXA 3NZ8A 4KJYB 4DVRH 3IJHB 3NABL 3V6ZB 1QHPA 3MJ7B 4XBEL 1QEWA 3LZFL 3KGRA 5FOBB 2CDEA 2DN7A 1OP5H 3V4PH 5FCUL 3GSOA 4Y19A 3UYOD 2GSGA 5L0QB 1EIBA 5F21B 4LLWB 2Q76B 5C08E 5I74C 1R3LA 1WIPA 2Y7QB 4JEGB 4PJFB 5DHVH 4HUUA 5F7KC 3DSFH 4IRSA 4EVNB 3B2UD 4UNUA 5HVHC 1BGXH 3TBSA 2H2SD 2UZXB 1U8HB 2FHBA 3PWPB 2WWKT 1MJ8H 3O2VL 1HOCA 1F3JB 4GOSA 1F8TH 1SJHA 1ZWIB 5TF1L 3BFOA 2HMID 4DK3A 2L7UA 1VADA 3B6SA 3KYMB 3WXVL 5J8OA 4FXKB 2P44B 5L8JB 3GBML 5DD6B 3MOAL 4IOIA 5FV1L 5JLZB 3QRFM 3SHSA 3OHXB 2DJ4A 4UDUA 1EGJA 3PQYD 1C5BL 2D31A 1MAMH 3OKLB 4OF6A 1K4DA 1XR9A 1QFPA 4OZHF 4ZDHB 3UBXI 2FWOA 3SGKA 4HPOH 1L9NA 2YC1B 4MQXD 2Y5TB 5D7IF 4TYUA 2ZKHL 3VD5A 1CIUA 4PJHA 3T2PA 3EGSA 4PRIE 5FKAA 4KKBD 5KSBB 1MPAL 4NCC2 4K71C 4KUZL 4XBGA 5F9OL 1FBIH 3ARZA 3C5ZD 3W11D 5C0EA 2AGJH 3O8XB 4X7SL 3P4LA 5DYOA 3V7AE 3T2QA 2OTUA 1LO5B 1VGKA 2HP4A 3P0YH 3SN6N 3MNVB 5BRZA 4GAJH 4MWFB 3PHSA 2Y1VA 1AO7D 5DMGD 2UWEF 2Y36H 5KVMC 4FFZH 4PRPB 1EEYA 3AB0C 4OCXH 2R1XB 1NMCB 2Q20A 5DD0H 4H20H 1INEL 3MXVL 4X4ME 1DQMH 1E4KA 5HY9B 1BWMA 3O6LH 3LVEA 1AJ7H 4G80A 1Q8MA 1O7VA 3EW3B 1Q1JL 3MRMA 3EO9L 5EIIB 2BZDA 2R2EB 5F7UA 2OP4H 2W0LA 4G9FB 2VDNH 4GMSL 4OI7A 5F3HB 3VH8A 4YHML 1QG3A 5I1KL 1CGWA 3U83A 2GSIA 5IJVA 1T21A 4LPWA 1WIUA 1JNLL 3MLWL 4AEHL 4JHWH 2HRLA 4JFDE 4UILH 1OCWL 4B41A 5K9QI 1FNAA 1J12A 3RVVC 3NFSL 4M6AA 1HCVA 5K9JL 2FO1A 5T3ZL 3QIWA 1C7SA 1U8KA 4RMUA 1HSAA 3FOMB 5GS1C 2ADFL 4V1DE 5JPMA 2GFBA 3SDCB 4JKKA 4OGAC 1I7UA 1AIFA 2MOVA 3QA3B 5L2KD 3QJHA 1FL3A 5D2NE 4JM2D 5KOMC 2C1OB 1GC1L 4DOHB 3BKJH 5DUBA 3C6LD 3S5LA 4Y5XC 3UO1L 4KJQC 4ZSOE 5CP3A 2AV7B 2WBWB 4TOYL 5A3ID 1N6VA 4PGCA 3WHXB 1OB1A 5GISL 4FQXC 4O2FB 4UIKL 2HT3D 4HXBH 1R5VB 1EAPA 2VABA 4ODTH 4WW2F 3VFPB 3VCLA 3FFCB 3U9UA 1E28A 1WAAA 4U0RB 2OK0L 3FO9A 2W91A 5JMOC 2XTJD 3N06B 4ZUUA 4AIXA 3CVHB 5HDQL 5A2LH 3RGVC 4ZO9A 3RWCA 5FUCC 4R96A 3ULUL 3ZDXF 4G6FB 3RGHA 3ME0A 1ZSDB 1TZHA 2BXZA 4KMLB 4LCUB 1WJ3A 3OKNB 1BLNA 2I9TB 2WW8A 4PJBF 4QRUB 1R0AH 3EAKA 4JREC 1AGFA 5I1AB 4PS4L 1F6LL 3CFKB 4HULB 2A77H 5ESAB 1T0MB 1U2CA 1Z9OA 3QFJB 5ITFA 1NLBH 4YHIA 4DW2H 1I9IL 3QHZH 3MRKB 1G7IA 3WIHL 4NFBA 1NCTA 3O11A 2FBOJ 3ARED 3E2HC 1VFBA 4JANB 4P5MA 5ICZA 1U3HB 2VB5A 1MQKL 1VSCA 5CSBA 4LRNL 4M02A 2H6PB 4CL7A 1M7IA 4TTDD 5KSAC 3MJ6A 5DEGA 1OAXH 1E0OB 4WUUD 1JZ5A 3HPJA 2A73A 1MIML 1TQCC 4KVCH 4JFQB 4PB0H 3RX8A 5C0AE 1H3UA 1CF8L 1NEZG 2NTFA 2P46B 4TSCL 1UYWL 4X99B 4O02L 4OIAA 3SDDD 4XPAL 3FQRA 4OD2B 3BT2H 3F58L 3QXWA 3TVMC 5FFLA 4ETQA 1ZEAL 5A2IH 4MYWB 1Z5LB 4L3CB 4RGNE 1MF2H 1A1MA 1WFOA 3I6GA 1T1XA 4HXAH 4FQ1L 3LHPH 3QUYD 1JI1A 1ZANL 4NC2B 4R90H 2J8UA 4YUEL 5CJXA 1YY8B 4KGLA 3VD4A 3RNQA 3NCBB 1EA9C 1FFPA 3RWDB 3QBTB 1QVOB 2XKNB 4OCYH 2JCCB 1OAZL 2BNUA 2Z93B 1S3KL 4Z78B 4FFWD 1W2KT 1R5IA 2EECA 3I2CL 1S78D 5LQBL 1BX2B 1YEHL 3H9YA 3MRRB 4BQ9A 4WY7H 1XGRB 5L9DL 1FORH 1EHXA 4WGVB 3HAEB 2VO5A 4XHQA 4Z5RA 3JV0A 4NSKB 5I1GH 2M2DA 4G3YL 3HNTH 3MRHA 4JZOA 3VWJA 3VXUA 3W2DL 1UACL 2XWTB 4U1MA 5C7XL 3G5VA 3VWKC 1UM4L 4HJ0D 4W6YB 3MV7A 4LLVB 3T0EC 4HWZB 1NC2D 3PWUB 2R8SH 3QEQD 1LILA 3WFZA 4IRZH 1B6UA 1CFSA 3AU1B 5EA0H 1S9VB 3MA9L 2AKRB 1IAOB 1JUFB 2HTKC 4UMGA 2VDMH 3NTCL 4PRNA 3Q5YA 3LIZL 1IC4L 3R0NA 2VC2H 2R4SL 2VAAA 5B38G 4I18C 3C5JA 2EH8L 2WP3T 4TNVF 5IK3A 1UM5L 1XR8B 2DTMH 4MSWB 4BH8A 2EEAA 3W39B 4PP2B 4U1LA 4MXQC 1OD7A 4N8VG 4HBQA 3PQYE 5LAXB 3NZ8B 1XFPA 3UCRA 1TJHH 1QEWB 3N85H 2CDEB 4K3DH 1KELH 4NM8L 3U9PL 3CX2A 3GSOB 4K3JL 4GH7B 2GSGB 1AR1D 1B3JA 1KFAL 4EUPG 1WFUA 1WZ1L 4H5SA 1SY6A 1R3LB 4HUUB 1T2JA 4IRSB 4QCIA 1RIHH 1N26A 4JRYD 3FT4A 2JB5H 5K33A 3TBSB 2AJZA 4KH2A 5MERA 1KCVH 1HOCB 4O9HL 1DANT 4KTDH 1BFSA 4W4NA 4U1HA 1SJHB 4D3CL 1VADB 3B6SB 1HIMH 1UGNA 3VI3F 1AO7E 2AJYL 1YEGH 4LARH 4N5UA 4IOIB 1KPRA 1S7XA 1JL8A 4Y2DC 4JZJC 4UDUB 5ETUA 5I30L 4HPYH 5KS9A 2D31B 3IDMA 2LE9A 1K4DB 4JB9L 5AZEH 1XR9B 3UTTA 2FWOB 1YQVL 4DGYH 2R4RH 1R24A 1H8NA 1KLGB 1CE6A 3LQZA 2HVJA 3ZL4L 2OTWA 1UCBL 5C2UB 4PJHB 5TFSL 3OKDA 4LSPH 4Y88A 4CJ0A 3EGSB 2VKWA 1ZVYA 3F8UB 5FKAB 4NQXA 4ZNEA 1KCRH 4G8GD 4NUGL 3TT1H 4XBGB 2QSVA 1ACYH 5DC9B 1CGSH 1JGEA 5IBTH 3GKWH 5C0EB 2NY6D 5DYOB 4ZOBA 2OTUB 1VGKB 1DQLL 3D9AH 4MAYD 4L4TD 1OAUH 4M9PA 4J3WA 4F7TA 3RUGE 1F6AA 4MMXC 4LPCA 4XMPH 5B39G 5MENA 1CDGA 3TESA 2Z8SA 3WSQH 1QFWH 1NGPH 5I0ZA 1EEYB 1ZS8A 2OBGA 5IHLB 3ZSSA 4MB4A 2M8XA 5C8JA 3WMSA 5GRVK 3ULVD 4W6WB 5E8NA 3B83A 4G80B 5AUMA 1CR9L 4JO1H 5EPMA 1HI6A 3UPCA 5L2KE 3BPLC 4YDLC 3IETB 1KJMA 2XNAA 4JVPA 3WIFB 1JPST 4J6RL 3GNML 3EOBA 1LEGA 2PUQT 5GS1A 3VH8B 1NCBL 3SJVD 5D7KD 1B4JH 4XCYA 2C4FU 5JHLH 5IJVB 2GSIB 2JJWA 4PGEA 3KPTA 1T21B 1X5GA 3IFNH 5AYUH 1FZMB 1P4BL 4FABL 1CQYA 5FHAH 2DDQH 1G6VK 2GW5A 4N8CL 1YN6A 3P30H 1FZJA 5I19H 1U3ZA 5J56B 1OPGH 2X1WL 4Y5XA 4WVRA 4UT9L 2XTJE 4JM4H 4OFKA 3NIFE 4M7KL 3QIWB 1U8KB 4KTEL 4PUBL 4FQXA 1HSAB 1K3IA 4JHAH 1NUDA 2GFBB 4Q9BA 4YX2L 1UH2A 4I0PC 4F80A 4NO0A 1S9WA 2H26A 1QTYT 2FH6A 1SYVA 5IESH 1I7UB 3MJ8A 1AIFB 1OM3H 5FYJD 5I18L 3IAPA 5JTWA 5IMMA 2JB6A 2X4QA 3IDNB 4X6DF 3QJHB 1FL3B 3QDJD 3RGVA 1JGVH 4WWKC 5DUBB 3S5LB 3OAZH 4DUWA 4LIQL 1YY9C 5DDHA 5IEHA 3TJEH 4PGCB 1JYWA 1OB1B 3FCTB 2HG5A 2DLTA 3QO0A 3O4OC 4NCDA 1QFUL 1IAIL 4FQQA 3H9SD 1VDGA 1EAPB 2VABB 4Q2ZA 4L29A 3U0WH 2OZ4L 3VCLB 2A6JA 4PRDA 3U9UB 3GO1H 4P4RA 3RA7H 3DXAA 3FO9B 4WUUE 5ITBH 4ZUUB 1NDGA 1A9BA 2FX7L 3RWCB 3MGAA 4R96B 3MGOA 4QRPA 4KK8D 2VDPH 5IUSA 5HYJA 4KROC 1TZHB 4K9EL 1OSPL 1S7TA 1BLNB 3KPSE 5KSAA 1AGFB 3S3PA 5FA3A 2BMKA 4NPYA 4YR6A 4X6FA 5ITFB 3PGFL 3MRNA 5C71A 4YHIB 4JN1L 4UAOB 1G7IB 1I3UA 1ITBB 2VISA 3TVMA 3O11B 4XAKD 1VFBB 4P5MB 5ICZB 1U8MA 3MJ9A 1QHOA 2BCKA 3WUZA 1EVTC 3UJIH 3WLWD 3MROA 1M7IB 4FN0A 4DEPB 4Y8DC 5C07A 3TH4T 1MCPH 1HHIA 3ULUC 1CS6A 3HPJB 2YA2A 2A73B 1WWCA 2BRRL 1IEBA 5B21A 4F8QA 2NTFB 3KPNA 4F15C 1OARL 2IPUK 3FQRB 3MLRL 2CO7B 5E2TL 3GK8L 2HRPH 5JPNA 4ETQB 2Q86A 5BZWA 1A1MB 1D5XA 7FABH 2NXYB 1MI5A 4PJCF 1T1XB 2LTQB 4ZXBD 3QEQE 2YRPA 1XIWC 2W1NA 3GSWA 1J05A 3P2TA 4R4FL 1UH3A 1RV6X 3ZSTA 2HT2D 3G6DL 4LSTH 4GRLC 5TDOA 2FD6H 5D70H 2J8UB 5FA4A 2XG5A 1FFPB 3VWKA 4OCNC 1F11A 1ZT1B 3S37L 3T0EA 2BNUB 5JIHA 3STBA 3M17A 5GRUL 1R5IB 4J4PC 4G6KH 1CE1L 1FO0L 2YK1H 5LJYH 4KAQL 4R4ND 3T8XA 4Z5RB 5I66A 4BSVA 1CDUA 4HWEH 4I18A 1JZ6A 1N59A 3FB5A 4M1DL 1GXEA 1IBGL 2PF6A 3MRHB 3O2WL 2I9LA 4JZOB 5HHOE 3VXUB 1J87A 1FFQA 2MNUA 4U1MB 4OLUL 4HWUA 3G5VB 1EUUA 3HR5A 4JRYE 3MV7B 4WUKL 3BWUC 1MIEH 3HNSL 3T3MF 3QUXC 1CFSB 2X7LA 4JCMA 5D7JD 3LEYL 4PRNB 3LRGA 15C8H 4LF3A 2VAAB 3C5JB 2Y72A 4OD1L 4BZYA 2R15A 4JFYA 5IK3B 1FDLL 5HVHB 2EDWA 4BH8B 4OZFA 4U1LB 2Y23A 5FO8B 4XVTL 5DZOA 2ZCKL 4XCFL 4HS8L 2X41A 1L0YA 1EDQA 4HSQA 4PTTB 1VPOH 1MFAL 2EE6A 3B5TA 4JO4H 1RZIA 1MEXL 3RKDC 4QTIH 5GS0D 4LHUD 2J12B 5FECA 5MEPA 4U49A 2X4SB 1Q0YL 2VQ1A 4H5SB 3LKQA 3V5DA 2B39A 4Y2DA 4JZJA 4KJPC 4HT1L 4QCIB 1MCBA 1DQDH 4FNLL 1Z3GL 3SDXB 4P2OD 3FT4B 3NFNA 5EUOF 2QKIA 3QXTA 5JOPD 1NANH 2AJZB 5MERB 1X5FA 5HGGS 3BZ4A 2BY1A 3ULVH 3GMOA 4PJEE 5INDB 3INUL 4U1HB 1X5YA 4L4TE 1CXLA 4X6CF 4DKEL 2FB4H 1TZGH 1ZTXH 1OTSC 2V5TA 4M62L 3O9WD 4K71B 3OPZH 1S7XB 4CN1A 3BKCH 5ETUB 5JIIA 1EJ6A 5KS9B 2E6PA 3IDMB 5CS7A 5TE7L 3ULVE 5F7NC 1K5NA 3UTTB 3U2SA 4OIIH 4Q0XL 1R24B 2YD7A 1EJOH 3VW3L 1SMAA 3LS5H 1OSZA 4HKJA 1CE6B 4J12A 3LQZB 3BP4A 4R4BA 2HVJB 2OTWB 5E8DL 1OP3H 4IOFC 5MEOA 3OKDB 3AB0B 3HE6D 2DD8H 3MCG1 4NQXB 3SJVE 2NY7L 5D7KE 4J23A 1FCCA 1HILA 3ARDD 1CYGA 5JW4Q 2EXYD 4FFYH 3QISA 1M05A 1EXUA 1I7ZA 5F8RC 3MODH 5C0BD 1JGEB 5GRWA 4LLUA 4OCMC 4RBPH 4PJFF 3SO5A 4JFFA 3RI5F 4YHLL 1FGVL 4ZOAA 4F7MA 1MWAL 1EEUA 1RFDH 4F7TB 1F6AB 2NX5A 5MENB 3SKUD 5FDWA 5F1SA 4YFLI 4NN7B 3G5XA 1ZS8B 4DZBA 1P4LA 4LAQL 4LKCB 3TCLA 3VXSD 5IG7A 5C8JB 5CZKA 2N7AA 5C2BL 5E8NB 4KKNA 5AUMB 5EPMB 1HI6B 5FYJE 2IFFL 3M45A 5I8KL 2UVEA 2IPTH 2CMRL 3BPOC 4P4KD 1KJMB 1L0XA 4NC1E 3MUGA 3O3EA 2XNAB 1WISA 1A7RH 3QDJE 5T3XD 4WU5A 4OLYL 3MOBH 2ZG2A 1W8NA 1FNSH 5E9DE 5GS1B 4JFPA 5BVJA 1JWMA 3ZTNL 1BVLA 1QLRA 5J13C 4I0PA 5HD8C 3WKMH 1KJVA 4XCYB 4PGEB 3UTZB 3H3BC 1NSNL 3OKYA 3QCUL 5M94B 3H9SE 5DZNA 4HBCL 4ZTOH 3SE8L 5JQ6H 5KSBF 2EDJA 2YPLA 1YN6B 2GI7A 1CZ8L 1FZJB 4WWKA 2R0LH 4R7DB 1TVHA 2ICEA 4X6EA 3OB0H 4Y5XB 2WUBL 5JXED 5AYQA 3NAAL 4FQXB 3BSZL 4PJDA 2NZ9D 4NO0B 1S9WB 2H26B 1ZGLB 3ARFC 1SYVB 4U1SA 1YECH 3MJ8B 1JIBA 2EDEA 2JB6B 2X4QB 5SX4I 3OJVC 4PJIA 1UWXK 4ONOA 2V2TA 3OGCA 3RGVB 4OSUH 4U3HA 3K7UA 3AFLA 2F8VA 3NFPA 5T1LD 5DDHB 5IEHB 3OXSA 4XVJH 2R2HA 2EXWC 4XAKE 2HG5B 5TH2A 3QO0B 5DURD 1EPFA 5D1QC 5DQDH 4FQQB 3MGTA 4JREB 3MV8D 4OLXL 4Q2ZB 1LMKA 1J8KA 1RZJL 1DQJA 2A6JB 4PRDB 1EHLH 2DWDA 3LPWA 3PP4L 1UB5A 4P4RB 4LNVA 1J86A 3DXAB 4X80H 5B3JE 1IFHH 3LS4L 5KOVC 1AI1L 4PJ5D 1KIRA 1NDGB 4YPJA 1A9BB 4D94A 3E2HB 3MGOB 1KBGH 4QRPB 3BKMH 5HYJB 2DM2A 1YA5A 4QWWC 5CUSL 1S7TB 5KSAB 1MJJA 3R0MA 5I8CA 2NW3A 5E0QA 1YPZE 4XC3H 3BIKA 1A47A 2WUCL 5FA3B 3NCJH 2BMKB 3P73A 1HCFX 2XN9A 1TQCB 3B9KD 4NPYB 1JYVA 1CGXA 2CKBL 3RWJA 1V7MH 4YR6B 4LQFH 4X6FB 3RP1A 1VFAA 1LEIA 3MRNB 2IQ9L 2EDTA 3ZKSD 2J4WL 1E6OH 4M8VA 2VISB 2FZ3A 3TVMB 3V7AG 2JJSC 3K3QA 1ES0A 3QI9D 3O41A 1MY7A 2Q8BH 1PEWA 4PRHA 1U8MB 4FRWA 4F7CA 1E4WH 4WTWA 4IM8A 4ZTPL 2BCKB 3ILQC 3RL1A 3MROB 5IFJA 3Q3GA 1IGML 4QGYA 4MXWH 4F7PA 3S35L 5HVGB 4GRLA 1T7YA 1HHIB 1KXVC 3C08H 5CEZH 4M1GH 1IEBB 2EC8A 2AJSH 2OJZH 3TLRA 3GSRA 4NO5A 3KPNB 2IC2A 2X9YA 4IS6A 2DMCA 4Z7VE 5GQBA 1YEFL 2DYPA 3VMPA 5JPNB 2X1OA 4J4PA 2Q86B 5BZWB 5LXGL 1D5XB 3F7YA 5AWNL 4BK4A 1MI5B 4BFIA 4BA8A 3PP3K 4P5TC 2ZUYA 3GSWB 1NBVL 1J05B 4J1UA 1KULA 2J88H 2NR6C 5JMRA 2BFVL 1F58H 1HKLL 5TDOB 1H9VA 5DVNA 1BD2A 5FA4B 1QSFD 1A7NH 3VWKB 5LGHL 1HHHB 1F11B 3T0EB 4Z7UF 3L3IA 3UPAA 5A1AA 1V5JA 3QUXA 2XXMB 3M17B 2MJWA 5LWYL 2IG2H 2ZUSA 4GT7A 5ANME 3E1F1 3C8KA 1KCUH 4ZD3L 3T8XB 3OKKA 5I66B 2VDLL 4M5YL 4PJXE 2ZPKH 4UNTA 2K7PA 4JKPL 2VLRD 4I18B 1N59B 3FB5B 5D8JL 1T04A 2I9LB 3A6OA 4JGMA 4OBSA 5GRXG 4UI2A 4P2YA 3HR5B 5FGCE 1PG7W 1LP9A 5C0FA 1L7TL 1MHHB 8CGTA 3PWPD 2ZSWA 1U8OA 5JOPE 2VH5H 5DRWA 4M5ZL 4IRJC 35C8L 1LO3H 2DQDH 2X7LB 2UZIL 2O26U 4R3SA 3VGAC 4XHJD 4LF3B 4G9DA 4EZMA 4JFYB 1J1OH 4HV8A 5DJ6A 1RZKH 4OZFB 5C9JA 1A8JH 5FEBA 5EU6D 1TTGA 1BVKA 4XPBH 4WFHD 1JGLL 4JRXA 5CZVH 1MELA 1MQ8A 1HEZA 5E99L 1G0DA 1KEML 1ONQA 1KF9B 1RZIB 2X4RA 5MEPB 5FECB 1V7NH 3G08A 3LKQB 2B5IC 3V5DB 4Y2DB 4JZJB 4KKLC 5CJOH 3QUZB 5IR1A 1U8IA 5KSVA 4Y89A 5FCSH 5HGDA 2GJZA 1KGCD 3NFNB 4M03A 2QKIB 4YDIL 5C0BE 1LK2B 1E27A 2R0WL 3DETD 4FMFA 3GMOB 5K93A 4LSSL 4YZFE 1NAML 2WZPD 5IFAL 4YH6A 1LO4H 4F37F 2H2PC 1Z9MA 1PQZA 5EO9A 1FVDA 4M6ML 3U36A 2IGFL 3VXRD 1CGTA 3L3HA 3JXAA 4R26L 4OFYA 1ETZA 2YA1A 2B2XL 2VWEC 5HDLA 3VXSE 3HZMB 4QOKA 3WIIL 2BVEA 4M1CC 4U31A 3QPQC 3U2SB 4KK6D 4MA7L 3CCHB 3TF7C 1ZKAA 1OSZB 4HKJB 4MDJA 3BP4B 4YXHH 3DRTA 4R4BB 1WCQA 5T3XE 2AABL 5MEOB 3S98A 4X83A 2PNDA 4MAUH 2RFXA 1JWSA 1WUNT 4HMCA 2ORBH 4POUB 4RX4A 4K3EL 1HILB 1CFNA 1G0YR 1EXUB 3QDMD 5KN5A 1I7ZB 1AGBA 2MKLC 4LLUB 3BPLB 4YDLB 4JFFB 1JPTL 2BRQA 4KUCF 1WQVT 2APBA 3G9AB 4CKVX 4F7MB 5HGHA 4QT5A 2AQ1A 1T03L 2Z35A 3EOYG 5FDWB 4TSBL 3G5XB 4DZBB 1P4LB 1VFMA 5HHVH 4N0YH 2ZNXA 3TCLB 5IG7B 1XF1A 3FAWA 4QRTA 1AY1H 3DX8A 2A83A 1A9EA 3QUMA 3C5SA 4G7YH 3V4VL 4O5LL 1KT2A 3DYMA 5HYSA 3MUGB 3O3EB 2IQAA 1NCDL 3V6FA 4WU5B 1F4HA 1KCSH 1FNEA 1VKXA 3RVTD 2EDKA 4JFPB 1JWMB 2GAZA 5H35A 3OJDB 4R97C 1BVLB 1QLRB 4I0PB 1KJVB 3ARFA 5IBLC 5EH1A 4J3UA 4OZGA 4PJHF 3FFCD 3MV8E 3BP7A 5JXAL 2WIMA 1L6XA 2YPLB 1KJ3H 1K6QL 4ZPVA 1BJMA 2YD6A 4WWKB 5HGAA 1TVHB 2ICEB 3MLPA 4X6EB 3P3YA 3MA7A 3MFGB 4PJ5E 4DQOL 1A2YA 1GGYA 5A16A 5F3BA 2PO6C 3O4OB 1RZFH 4PJDB 2WBKA 4S1SL 5D1QA 5CJBA 4U1SB 3D3VD 4XNYH 4K7PH 1QKZL 3P9LA 5DSCB 4PJIB 2C1PA 2V2TB 3OGCB 3BH8A 3VA6A 4TUOA 5FM4A 3DYPA 1DBAH 1G1CA 4HZLA 3NFPB 1TETH 4KMTL 4KROB 3OXSB 4OZFH 2MQ0A 2R2HB 5HXMA 2I5YH 4ISVA 3HRZA 5TH2B 2OI9C 5JHDA 3MGTB 3O45A 3SGEH 1MRDH 1TJIH 3I02A 2BHUA 2DWDB 3MUHL 1UB5B 2HTLD 4HF5H 4B7IA 4TUKL 25C8L 3D5OF 4PTUA 2J6EL 1OOAA 3UTQA 4EXKA 1KIRB 3EHBD 1L6ZA 1V3JA 4UNVA 2JJSA 4PR5A 2OZ4A 1YYML 4DKFL 5IT2H 1B0WA 2AEIT 1B4RA 4KRPC 2IWGA 4FP8H 1CVRA 3RZCC 5C09D 3OL2A 1MCKA 3ARWA 2BJMH 4JJ5A 4LFHG 2ZP0T 1MJJB 4WEMB 5I8CB 3JWOL 3D25A 3BIKB 4L8SC 4PLKD 4G6ML 3V52H 3P73B 2XN9B 5IGXH 4BH7A 2FJHB 2KQNA 3RWJB 4QHKJ 3WNLA 2FECL 4RQQA 4F15B 1VFAB 1FVEA 2LVCA 4UT6H 2EC9T 2HLAA 2L4OA 1PAMA 1QSFE 3WXWL 3U7WL 2FZ3B 3LOWA 1ES0B 1D9KD 1RZJC 1T3FA 2F15A 2OMNA 3HMXH 3O41B 3V6OC 1VERA 4PRHB 4N1HB 4PJ9C 3QXUA 4F7CB 2VDOH 1II4E 2IJ0C 4P5TA 4URTB 3RL1B 3Q3GB 1I1RA 3RY6C 3UYRH 4F7PB 4HS6A 2RGSA 1NFDA 4GRLB 2AAVA 3ZT6A 4L5FH 2VLRE 4Y5VC 3GSRB 4NO5B 2X89A 1A6WL 5FDYA 1BEYH 4IS6B 3FMGH 1U58A 4XPTH 5A2JH 2ATKA 1F6FB 4JN2A 1BZ7A 2NY0B 3F7YB 4BFIB 4OZIA 3GHBH 2EYTA 2MQCA 1LHZA 1YEEH 5EZLA 1PGRB 1KB5H 2CLRA 1BD2B 4CW1A 1KJ2L 2XACC 3VJ6A 1HH9A 2ZSVA 1J1XH 4NC0B 3MLVL 3OR7A 4MA1C 3KJ4C 2HJLB 1MFEL 3L3IB 2CKNA 3QUXB 1H3XA 1LK3L 4XP9H 5EU6E 4IRJA 3VD3A 5GJSH 3VFGH 1T66D 1NGWA 4W4OC 1UXWA 4WFHE 3C8KB 3IFPA 5D1ZD 4Q9QH 2VXVL 3OKKB 4Y19D 1CL7L 3S88L 3GIZH 4U7MA 3N1QC 1T04B 2XQYG 4OLVH 4IRSD 1FO0A 1K3ZA 2D9QB 2P47B 3T0WA 3CLEH 1WC7B 3I85A 1LP9B 5C0FB 5EC2B 1KGCE 2ZSWB 1U8OB 4OCRH 5DRWB 5E8OA 4JPKL 5DMIH 2NPLX 2V17L 3UPRA 2BXYA 1ZLUK 1T0NA 3OV6A 4R3SB 3KLHC 4G9DB 4ZS6C 2VLMD 5CGTA 3VXRE 1E4XI 4F8TA 4HV8B 3X3FL 5DJ6B 3MBXL 3VRJA 5ACLA 1MSPA 5C9JB 3Q1SL 6FABH 1G6RH 1BVKB 3QQ4A 3QZWG 3CGTA 4JRXB 5D2LE 2OR7A 2XRAH 3U46A 1IRAY 1HEZB 4LNRA 3EYFA 4LKXA 1ONQB 5KSUA 2X4RB 3RX7A 3WNKA 1QYGH 3TNNA 4RISH 5IR1B 2BVQA 1U8IB 5KSVB 3FT2B 3BGAA 5HGDB 5EU7C 2GJZB 2VIRA 3T0BA 3QDME 4TVPH 1E27B 5IW1A 1UJTA 2PYED 3G5YA 3BYTA 3FN0H 5FYLL 4LOUD 5BRZD 3RWEA 3VG0L 1PQZB 5EO9B 1W0WA 1K4CA 3U36B 4AMKL 1QNZL 1SHMA 2YMXH 3L3HB 4JDTH 1HZHH 2EDRA 1ETZB 2DB8A 4NOFA 4QOKB 1MREH 1JPGA 1Q0XL 3NIGF 3REWA 2IBBA 1VCAA 3K8KA 4KI1A 4YHKH 2GQHA 2B0SL 5BJTA 4NJ9L 4G5ZH 1R3IL 3FO2A 5D96C 4L3EA 3VD7A 4C55A 1EHNA 3E6HA 4MDJB 3DRTB 4NRZA 4UT7L 1QPPA 1FLRL 1F13A 2RFXB 1JWSB 2BNRA 1QUNA 3O4LA 1CFNB 1S7SA 4Z7WE 4NQVA 5KN5B 1AGBB 2O5ZL 3FFCE 1NC4A 1ERNA 2APFA 4NZRL 2F5BL 1KN4L 5GGQL 3SDXF 4W6XB 5HGHB 3QIWD 5HHXH 4QT5B 5J13B 3TGXA 4JRWA 2Z35B 2WLZA 2YD4A 1MVUA 4M00A 4MCYA 4PJGA 1DUZA 3RU8L 3GMNA 2F9BT 1FNHA 1MWAA 4XAWH 4QRTB 4TUJA 4WTXA 3D3VE 3DX8B 1PY9A 2A83B 5FM5M 2NNAA 4D0CA 1A9EB 3QUMB 4DVRL 1KT2B 1YJDL 5HYSB 1HINH 4Y16D 3TJHD 4TQEH 1NANI 2IQAB 3V6FB 4N0UA 1FNEB 1VKXB 2PO6A 3S6CA 3V4PL 4ZAKB 1CI5A 3W0WA 2GAZB 5E6YA 5H35B 1QRND 1JN6A 5ICYA 4KC3B 4B0MM 5FM5O 3ARFB 3DSFL 3PG2A 3DRQA 4OZGB 4ESKA 2EEDA 3BP7B 4K8RH 1BGXL 4OGYH 4ZPVB 2BVOA 4LSUH 3ARBD 1VFUA 1MJ8L 3V8CA 3MA7B 1A2YB 5A16B 5F3BB 1WWWX 4FQLH 4XBPA 4BQBA 1NAKH 5D1QB 4BYHA 3MRBA 2B1HH 4MNGE 4LPXA 5C09E 2BNQD 1OY3B 2E6QA 1MAML 2CXGA 2JJUA 5J06A 2GHWB 1I3GH 2C1PB 4ZUSA 4PRAA 4HPOL 4P9HH 3BH8B 43CAA 4TUOB 4QXTB 2Z92A 1T1WA 4HZLB 4UQ3A 1S7WA 3ROOA 3RZCA 3QIBC 2JCCE 1JRHH 3VD9A 1P7QA 4ISVB 3HRZB 5AAWA 4KHTH 5I8OH 5JHDB 2QQNH 3O45B 4L8SA 1L7IH 1K9TA 3I02B 1U42A 2LAAA 2AGJL 3V0VA 1RVFH 4PTUB 1T2QL 3P0YL 3UTQB 2YUZA 2DICA 4Q97A 4GAJL 5DQJA 4PR5B 1EERB 3V6OA 4PJ9A 3SGJC 2Y36L 4FFZL 1D5MA 5GRZA 3M8OH 5J57B 1ZK9A 1NEZA 4NKQB 2XZQH 4OCXL 3RY6A 5DD0L 4JJ5B 5JA8B 4BZ2H 1DQML 3MTRA 5IVOA 3D25B 3O6LL 1AJ7L 1X5HA 4BH7B 4PD4K 4Y5VA 5EOCH 4JCLA 2EKSA 4RQQB 4QTHA 2OP4L 2JK5A 1ZLSH 2HLAB 3I6KB 3GIVA 3FT3A 2VDNL 1J0ZA 4DN3H 1PY4A 4X0KA 1T3FB 4YQXL 2CKBA 4HKBA 4NO3A 4G8IB 3GHEH 4JQXC 3IJSA 2Z8RA 3OWEA 4UILL 3ZO0A 1NFDB 3EIFA 2XWJA 4NCC1 2E27H 1IGFL 2VDQH 1SBSH 2VITA 4Y19E 5T1DH 6CGTA 1FYTE 2ICWA 5F8QC 3VWJD 3VXUD 4WI7A 4Z7QE 4ZUTA 3SKJH 4KKCD 1U58B 1G9EA 4L4VA 4NQCA 3MV7D 5TE6H 1BIHA 2ATKB 1C1EL 3BQUD 4W4OA 4E5XA 1J5OH 2OL3B 4JN2B 2E5EA 1BZ7B 4OZIB 1B0RA 5HDBF 1KLFA 2EIEA 3QWRD 4LK4A 2EYTB 4PLOB 4XTRC 2Y4SA 2CLRB 4XMKH 1BFOA 4CW1B 3BKJL 3VJ6B 1WVZA 5ALCH 1BBDH 2ZSVB 2VLME 4O58H 5F44A 3EFDH 5JA9A 4HGWB 3QEGH 2D3VA 1JMXA 5EORH 4YAQA 4HUKB 3Q6GH 2WBJC 5B38A 2F53D 4IRJB 5EO0A 4HXBL 3GSNH 1NGWB 1UXWB 2FGWH 4ODTL 3VXMA 3DIFA 3QUKA 3IFPB 4N8VA 2DQJH 3VGAB 2YPKA 4ONGH 1EEZA 2P49B 5CJ5A 2QV2A 3ZT5A 1FO0B 4YHYC 1WFTA 4AENA 2QQLH 1I1AC 4GQPH 4EUPA 3ZHKA 4B5EA 4I2XA 5E8OB 2PYEE 1R0AL 1PDKA 3QB7C 3U6RA 5BRZE 3UPRB 3EDEA 1T0NB 3JV4A 2A77L 2B5IB 1M7XA 2IBZX 2QBWA 1NLBL 4DWHA 5FYKU 3QHZL 3L9RA 4JY6A 1TZIA 4WI3A 3VRJB 3LEXA 1JF1A 3RNKA 2CDGA 3HC0A 3QQ4B 2IH1B 3IS1X 2J7LA 2Q3ZA 4LNRB 3GRWA 1OAXL 3EYFB 3MYJA 4LKXB 1HKFA 5KSUB 4HC1H 4C58B 4KVCL 4PB0L 3TYFA 3TNNB 3P0GB 3SQOH 3W5NA 1PEZA 1BQHG 2BVQB 3AS0A 2VIRB 3HG1A 5TPWH 2G2RA 5HVWA 2DKMA 2JE8A 5IW1B 1EFQA 1WZKA 5IMLA 5E00A 1MF2L 3G5YB 1BJ1H 3RWEB 4HXAL 3EYQC 1EZVY 1GVIA 1UB6B 4KVNH 3PDDA 4RWYH 4WU7A 3LHPL 5MEND 1W0WB 2ZUTA 4R90L 1K2DA 1K4CB 3UDWC 3X11A 4HWBH 5EZOH 3EKCA 3H42H 4OCYL 2Z31D 5H37H 2Z8WC 1NAMA 4YLQT 3VXQA 5B39A 1JPGB 1FFOA 1JFQH 3REWB 3RVVD 5BJTB 4FTVA 4TSAH 4XPHH 1P4IL 3MLYH 3FO2B 4WY7L 4L3EB 2ESVD 1FORL 4QGTA 3E6HB 3RFZC 3FL7A 4HLZH 1W0VA 3TT3H 4NRZB 3VI4F 1L0QA 5I1GL 3HNTL 5F7WC 1QRNE 3OKEA 2BNRB 4M43H 4YBQC 3O4LB 2PCPA 5SWSB 1S7SB 3MRPA 3IU3A 4NQVB 3PV6B 1J0JA 1NC4B 1DBKH 1WAAE 4U6VH 2R8SL 2VE6A 1CD9B 1NGYA 4IRZL 4KXZI 2OYPA 5EA0L 1GZQB 2WWMD 4NZDA 2D03H 1QSEE 4R97B 3TA3C 4YXKL 3ZT7A 2VDML 4CMMB 3BDBA 2R56H 1JZ7A 3WO4C 1X5IA 3OMZA 4MCYB 2OL3H 2H41A 4PJGB 3VE0A 4X6BA 4LSRL 3SGDI 2ITCA 1MWAB 5B8CC 2BNQE 4LHUG 3H8NA 2NNAB 1JF6A 4D0CB 5I1CH 2JTDA 5FUZH 1TJHL 3RGVD 4NNXA 3T08A 4Z95H 3N85L 1UZ8A 1AC0A 3ALXA 3NA9H 4K3DL 1BBJA 1KELL 5BS0D 1NMAH 1N7MH 4N0UB 5HHMD 2PO6B 2P42B 3W0WB 5ICYB 1JN6B 4QHNA 5E2WL 2XA3A 1CFVH 4P2RA 3F6LA 3GSVA 3CH8A 1RIHL 3DRQB 1BJ8A 4ZOCA 2ENYA 5F71A 2JB5L 3X14A 5HI5C 2BVOB 3DXAD 2DLHA 5EZIH 3MRQA 4UOJA 1KCVL 2C3VA 1D3CA 3HB3C 4KTDL 2ADIA 4HGMA 3E8UH 3QIBA 1FFRA 1HIML 4ELMA 3TO4D 2OI9B 1E4JA 3WDIA 4P5KA 4B50A 1YC7A 2E9BA 3MRBB 5T1MA 5A2FA 2K3TA 4WJ5A 5ALBH 1DTUA 4GXUM 4HPYL 4GG8A 5AZEL 3MLUH 1H0DA 2CRMA 4LP4A 4LU5H 4ZUSB 4PRAB 3EOAA 3W81A 3STZA 4EQ3A 1KXTB 4DGYL 43CAB 2R4RL 2J8UE 4QHMA 3SGJA 4KRPB 2IAMC 1JHKH 1T1WB 4P2QD 4UQ3B 4JJHA 1S7WB 4FOMA 3ROOB 3RZCB 4LSPL 3BJLA 1P7QB 4FS0A 1KCRL 4WHYH 3TT1L 4EBQH 1V3LA 4L8SB 1PZ5A 1CDIA 5DGRA 5GGTA 5GJTH 5M95B 1OVZA 1PKQE 1ACYL 1CGSL 5C07D 4U1KA 5IBTL 5IM7A 3GKWL 4RFNC 1D5BA 1DE4A 4KKAD 4P3WA 1KV3A 1Q94A 3D9AL 4XZUA 1OAUL 5DQJB 3VXUE 1A0QH 4FHBD 5IMOA 4PJ9B 4XMPL 4CVZA 2P5WB 1KTRL 3CFCH 4GW4A 4CAGA 5BV7B 5D7SH 3WSQL 1D5MB 1QFWL 1NGPL 1AFVL 4JQXA 3MV7E 1NEZB 4GLRH 3WNPA 4PJDF 4MCZA 3O6KH 2ZUXA 2ID5A 4JO1L 1J11A 2VDRH 5F6IC 4Y5VB 1MHCA 1PD6A 2EKSB 4QTHB 2ZJSH 5DF0A 2JK5B 3JWDH 4NBZB 3VWKD 3P4MB 3FT3B 3ZKND 1DQQA 4PJIF 3C60D 3D39D 3THMH 4X0KB 1RQ5A 4OZ4A 5T5NG 5AAMA 1HNFA 2CKBB 1B4JL 4QNPF 4HKBB 5JHLL 4NO3B 2H32H 3ZYOA 2E6JA 5AYUL 4LEOB 2F53E 4M48H 2HTKD 4WFGD 5ESVA 4D0DA 5FHAL 2DDQL 3R1GH 3DURA 1XF3A 1R3HB 3P30L 2XWJB 4GBXC 5I19L 1LO0H 1E6JH 3FZUC 1MOEA 2VITB 1OPGL 5BVPH 2ICWB 3A0OA 1YNKL 1G7LA 1W72H 4JM4L 4MA1B 3KJ4B 4LMQI 1OTUC 4ZUTB 2OXHA 3ZMRA 2WBJA 2NLJA 2P1YA 5JW4M 4L4VB 4NQCB 1C5DA 4JHAL 3K2MC 4E5XB 2ITDA 3TIDA 2YOCA 3DLQR 2YXMA 2BOCA 3BXNA 5E5UB 2ENSA 5IESL 3GSQA 1B0RB 1OM3L 4E41D 2IH3A 3FRPG 2DBJA 3SGEI 4KZEH 1RIVL 1FAKT 4IJ3C 2FX8H 5KAQF 1BFOB 2JLLA 3HZYA 3ULUF 5JOEA 1I1AA 2XZCH 4NZTH 3O2DH 3ZE1F 3TJEL 4LCWA 4YAQB 5C3TA 2DI9A 3DUUA 5KS9E 5B38B 4DGIH 1FFNA 2PW1A 5EO0B 1KJ2A 3U0WL 3VXMB 3DIFB 5D2NC 3GO1L 4N8VB 3H9HA 2YPKB 3M1BA 2CRIA 2CRYA 4WFFD 3RA7L 4WCYH 1EEZB 4NDMA 4Y4KC 5ITBL 3BE1H 1SEQH 4PD4J 3J7HA 3H3PL 3RX5A 4X7DC 4ZNEE 2QSTA 3EYOA 5D5ME 4AENB 1LO2H 2VDPL 1UFUA 4EUPB 5KVFH 1EO8H 3RTQD 1AC6A 4I2XB 4F9PC 1QBMH 5CEXA 1GOGA 3PWVA 4YDVB 2W9DH 5ADOH 3U6RB 1UG9A 1U6AH 4IMKC 3MZTA 5JW5B 3BIAX 2NY3D 3JV4B 1QRKA 5MENE 1J10A 4JY6B 3L9RB 2D7NA 1TZIB 2FCBA 5SWQB 1HHJA 1HNGA 3T0XA 1GH7A 3LEXB 4YK4C 1JF1B 3RNKB 2Q7YA 3HC0B 2ZG1A 3QIUC 3VRLE 2D0GA 4DKAA 4I5BA 2MCPL 3RBGA 4X8XA 1MCPL 2ESVE 1N64H 3MYJB 2VQTA 1XAUA 3TN0C 3UDWA 1RZGA 1KG0A 1U8JA 3TYFB 3V2AR 2EKJA 3ZYZA 1QLEH 2AJ3A 5B4MC 4TPRH 3HG1B 3V8OA 2G2RB 4Y1AD 1XF5A 1ACZA 3FFDA 5H94A 5D96B 5E00B 5CBEA 5D1XD 2X09A 5CKAA 5IMLB 7FABL 2RCSH 5DD5H 3QWOA 4H26A 1LP9F 1JHLH 3LKOA 2X1PA 2ZUQB 3G6JE 3LKNA 2R2CA 3K46A 4WU7B 2NX5D 4LSTL 5BV7H 2FD6L 5D70L 1WCBA 1K2DB 5IF0A 2J5LC 3X11B 4GXVH 4TULH 4X9FA 1NAMB 3VXQB 1UWXH 4BZ1H 4XP4H 4HUXA 5B39B 4JVUA 3QDGD 4JKLA 4RGNC 1DP0A 1IQWH 3EJYC 4NKIH 2KPNA 1NFKA 4FTVB 4G6KL 3TA3A 2YK1L 4GMTH 2P8MB 5BS0E 1W0VB 3LEVH 1IGYA 5HHME 1NMBH 2GTZA 1T1YA 4HWEL 4I0PD 3OKEB 2HT4C 3OB8A 3O8XC 2PCPB 5B8CA 1RZ8B 3IU3B 3MRPB 3L5WA 4AZ8A 5CLWA 1MIEL 2G9HA 1XF2A 1MCEA 3DXAE 2VE6B 1NGYB 1UT9A 4OM0H 1YY9D 1MCJA 3ARYA 1U95A 2EDBA 1CDHA 5IKCB 4XNXH 15C8L 3PF2A 2YN3A 3VE0B 3CMGA 3B2UC 3MRJA 2ITCB 5T3ZD 3F5WA 4KGJA 2H2SC 2XIDA 2X9WA 4PLJD 4EDXA 1H8OA 4NNXB 2ILLA 1CK0H 1M4KA 1UZ8B 2HMIC 1FPTL 1BBJB 2VZVA 4PREB 1VPOL 4JO4L 4M7JH 4RWHA 2OM5A 3HN3A 2VZUA 4P2QE 4QTIL 1T7VA 1BQSA 4NRYA 4QHNB 4KPHH 4XC1H 3AXLA 5EN2A 4P2RB 4YDKL 3GSVB 1QD0A 1DQDL 1IC1A 2RR3A 2G75A 2N4IA 4XPFH 3X14B 5C07E 3MRQB 5DHVA 3ULVL 2IAMA 2KL6A 2ADIB 2DBLH 3CH1A 4KY1H 3QIBB 5J4MA 1R3JA 1A7QH 3GSUA 1TZGL 4ELMB 1ZTXL 1AQKH 4P5KB 3PP3H 1AQDA 3OPZL 2Z8VC 1NUNB 5T1MB 1A3LH 1TQBC 5D7LB 4WJ5B 4KZDL 2E7HA 2Q8AH 1T7XA 3BKCL 2DQCL 5F96H 3C5ZC 1BQLH 2V5YA 4PJCA 3W11C 2XN9D 1S7QA 1H0DB 3TZVC 3EOAB 4M6NH 3STZB 4OIIL 3LS5L 4PRIA 4QHMB 5DMGC 3QP3A 1YMMA 1FIGH 4ZS7H 3D39E 1R5WA 2DD8L 1WICA 4OB5H 2BSED 3IFOA 4QHLB 4U0RC 1CU4H 3HLAA 5DA0B 1XIWD 4FFYL 1PZ5B 1GSMA 1OGAD 3GRWH 3MODL 4U1KB 4WFGE 5IM7B 1D5BB 1DE4B 4OCWH 5J7CC 4OZGF 4ZFGH 1Q94B 4KDVA 5FYJU 3UROR 4XZUB 5DMYA 3M07A 3QNXA 1RFDL 5IMOB 5C92A 1JCKA 2EDDA 1KIUA 1OGTA 3U1SH 4CVZB 4X4MA 1FE8H 2DYPD 5SV3A 3DWTA 2YEZA 1P84K 3CDGA 4OFDA 1CCZA 3ARQA 4U6HA 4GBXA 4MCZB 1HYSD 4XRCA 4TNVK 4E41E 2W65A 1MHCB 2IPTL 2XV6B 5SV4A 1JMZA 1A7RL 1DQQB 3MOBL 1F97A 1FNSL 4OZ4B 3VA2C 3MV9D 3KS0J 3NABH 4N90D 2AEPL 4JFDA 3B9DA 4F33A 1O0VA 3BP6A 1BZ9A 4D0DB 2E9JA 5ESVB 2B7DT 4ZTOL 5JQ6L 3DURB 1XF3B 3CUPA 3GFUA 1RUPH 3HI5H 3DUSA 4JQIH 4AIZA 5L6YH 2H3NA 4UINL 4WFFE 2HJKA 3C6LC 1G7LB 1N6QH 3FN3A 2FIRT 4LDLB 4V1DA 2IF7A 5A3IC 1JZ8A 2AK4B 3RRQA 5I1LA 5EU4B 2WBJB 2NLJB 1C5DB 1MRFH 2HT3C 1BREA 2ITDB 3TIDB 1FIEA 2FR4A 3VU2A 2BOCB 3BXNB 5D2NA 3GZKA 3SDYH 5I1IH 2V2WA 4XWOD 5FKPA 3RKDD 4LSDA 2X9XA 2IH3B 1IE5A 4Y4KA 5ESQB 2VL5A 4HJGA 4NRXB 3WFBH 3KR3L 2V9TA 3MOAH 1G7MA 4LDOB 2AJUL 4JAMA 3WFCH 3W9EA 3HZYB 4YHYB 1KTKE 2CK2A 1OD9A 4EN3D 3NZHH 2RBLA 1JWUA 2OCFD 4XVJL 3ZYJA 4F9PA 3DUUB 3IYLW 5E5RB 1FFNB 4KDTC 2PW1B 4JRXD 3KHOA 5C0IB 3B8SA 1KJ2B 4IMKA 4G43A 1QO3B 4NZJA 3H9HB 3M1BB 4GG6E 3AS2A 4NDMB 1CLYH 3LN4A 5DD3H 1QQDA 1AP2B 5J3HD 1SY6L 2FEEL 4YO0B 5C0RL 3WHE0 1NFDF 1IARB 4PJ7E 5M7QA 3EYOB 3AREC 3BKML 3QIUA 1AD0A 3VFSA 2VXSH 1LEKA 4LLWA 4Y1AE 5CEXB 1BMGA 5E7BA 1CTNA 2ICWJ 4TTDC 4EVNA 3HRPA 2VLKA 2HFEB 4XC3L 3TN0A 1CICC 2XT1B 2XQBH 3NCJL 1PYWA 3RHWF 4RMTA 4LQFL 4OZIF 2NX5E 1INEH 4RAVA 1S7VA 4Q74A 4ODWA 1E6OL 1WITA 4PJAE 2ZCLH 3SDDC 1HHJB 5KJRH 3KYMA 2Q8BL 2PXYB 3FTGA 1S5IH 3QDGE 4U0QB 4Q7DA 2Q7YB 1FG9C 2P45B 1E4WL 3CSYA 2PYFA 4I5BB 5DVKA 4F57H 1HN1A 4GMSH 3Q5TA 5JLZA 1NGQH 4MXWL 1V3MA 3C08L 5CEZL 4AEFA 4M1GL 4WEBH 2Y07H 4ODXB 5IHZA 1U8JB 1KG0B 2OJZL 3DYOA 1NCUA 4AEHH 3BI9X 1EH9A 2MPAH 5C0CD 3FO0H 5F7MC 3WFDL 1U8PB 1B88A 1A7PH 1FP5A 5K9KA 5BQ7B 1XF5B 1KTLA 3FFDB 5H94B 5K9JH 1S78C 4C56B 5CBEB 4AG4H 1BHGA 3ZLQC 3QWOB 4H26B 3LKOB 5HD8D 2J88L 3KVQA 1JF5A 1F58L 4FQCH 3KWWA 4XPGL 1DVFD 5IF0B 1A7NL 4Y4FD 2VR4A 2OR8A 2DLIA 2R69H 1SQ2N 5T3ZE 5T33H 1WBZA 1GC1H 4RA0C 3T0AA 5D4QA 2IG2L 3PHOA 4PJ8C 3H9ZA 4QRSB 4JO3H 5ABDE 1KCUL 5GISH 4S1QH 3S8WA 3SDAC 1IGYB 2ZPKL 3WO4B 2GTZB 1T1YB 1WBYA 5B8CB 2OK0H 4MNHA 2VZ1A 4L8BB 3L5WB 2G9HB 1IC5H 1XF2B 1CN4A 4MA8H 1HHKA 2P5ED 4UBDD 4Y0GA 4C83A 3MNZA 4NQDD 1U95B 2DQDL 3QEHA 3MRGA 4HS3A 5TQ0H 4P99A 5DO2C 5D1QD 1QZ1A 5F1NA 4PS4H 3MRJB 1J1OL 3I9GH 2OQJA 3K1DA 1RZKL 3F5WB 4H8WH 1I8IA 1Y6KR 1ZOXA 3NVQA 4XVSH 4XPBL 2XN9E 5CZVL 4EDXB 5ENWA 3WIHH 2QQKH 1XMWA 2K7QA 4Z7NE 3DGGA 3VGHA 2A1WH 3S34H 3MR9A 4QWWD 3AAZB 4OFIA 3AXLB 4R2GD 5EN2B 5CJOL 1Q72L 5E2UL 3KHQA 1T0PB 3C5ZA 4QXWA 2R9HC 4EDWH 2G75B 3F7PC 2PN5A 3TZVA 1OGAE 1G7QA 3EOTH 5CWSA 4M61A 1UYWH 3ZHLA 5DHVB 1AO7A 2IAMB 4EEEA 4XPAH 1T1ZB 3GMPB 3CH1B 1EEQA 1LO4L 1R3JB 5I17A 1CBVH 5DMJB 3ILQD 1AQDB 1V05A 3T77A 5GS2H 5K59F 3L3DA 1N4XL 4DVBA 3T4YA 4RFNB 4M6OH 2VRAA 4PJCB 1JHTA 4PG2C 2NY6C 1S7QB 3CVIH 4PJGF 4YNYA 4MAYC 3I3EA 4WTZG 4U3XA 4JQVC 4PRIB 1OAZH 4YXHL 2APTA 1YMMB 2X4UA 4GRWH 4EQ2A 1R5WB 5LQBH 4MAUL 3IFOB 3MV9E 3HLAB 2ORBL 4N90E 4Z7UA 4P5TD 3ULVC 2NR6D 2AI0H 5F6IB 1HE7A 2XWBA 2HYMA 4GRWE 1UM4H 3QNXB 3KG5A 4DUVA 4XCEA 1OGTB 1AE6H 4HGKC 2YEZB 3CDGB 1BVZA 5ERWA 4K2UH 5HHVL 5IVXF 4N0YL 2XY1A 1ZLUH 1HQRA 4U6HB 5H37G 2WWKO 2AXFA 1AY1L 4XRCB 2HH0H 4LLYA 4CDGC 3VFWA 3C6LA 2W65B 3U7YL 1IAMA 2WQRA 5TQ2H 3QQNA 1IKNC 1KCSL 1W8OA 3DX6A 1A6TA 4DEPC 1KOAA 4HLZG 5DFWH 4JFDB 1YY8A 2ZUVA 4F33B 3BP6B 1BZ9B 4JRXE 4JZNA 4LLQA 3S3JA 2XKNA 1U8QA 4X5LA 3BPCA 1KJ3L 3DUSB 4IJ3B 5F1IA 3V5HA 4AIZB 4ZO8A 2HKFH 4NC1C 2H3NB 5CIPB 1LVEA 2HJKB 5FO7A 3QCVL 3FQWB 1F4XH 1XGRA 4V1DB 2EZ0C 5MI0C 5I9QC 5I1LB 2LU4A 5FYKD 2PKDA 4KDTA 1RZFL 4BM7A 1CLZH 1CXFA 1FAIL 2C7UA 5D2NB 1NEUA 3UZEA 4NFDA 2XWTA 4XNYL 5FKPB 4K7PL 1D7FA 4P23C 2VL5B 4HJGB 4CU6A 4UUJA 3P11H 1G7MB 1I3VA 3QWQB 4JAMB 3W9EB 2VUYA 3WLBA 4MHHG 3AREA 1DBAL 1OT2A 1Q38A 1RHFA 5C0ND 1T6VN 3ZDZF 5D72H 2ZCHH 2DM7A 4KK8C 3E0GA