3PWUB

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801(bola-a11)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords MHC class I antigen
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwuB00
5B8CC 4KRLB 2BVTA 4N90E 1CZ8H 2XQBL 5MI0C 1MCPH 3QWOA 2J8UA 1A8JH 2X4NB 4KK8C 5D7LB 5DSCA 1EVTC 4I3SL 5C70A 2UWEE 1WWCA 1GGBL 3AS1A 1FAIH 1MELA 4M7LL 1CGSH 1XAUA 2PCPB 2VZUA 3ZL4L 2BJMH 2ZZUT 5C0BD 2D7TH 5GGRA 4HLZG 1K85A 3CFCL 2M1KA 2Q8BH 3OF6D 2EXYD 3BZEA 3TFKC 4PJ9C 4ZFOB 3PP3H 1WISA 2Y6SD 3IT8D 4UT7L 1U91A 4FTVE 1CLYL 2CMRH 5TQ2L 3JZ7A 4WW1B 3TIEA 3EYUH 3PNWB 3CVIL 4LKXA 1NLBL 2EO9A 5GPRA 1IRAY 1JWMA 2PCPA 5F7LB 4HZLA 4TSBL 1ROWA 2RCSH 1U58A 2VQ1A 1U93B 2YPLE 2A73B 2BNUB 2HRLA 4C56B 1MJ8L 1EFXB 1MH5A 5ALBH 2FJHA 4KQ3H 2HVJB 3DURB 5D71L 1TZHA 1DBML 5F3BA 4PJ7A 3RRQA 4L9DA 1E6JL 5ICYA 5CJBA 3RL1A 2BSRB 3BMWA 4WFGE 3DGGA 4WI8A 4X7DC 5IFHH 1A3LL 2AJUH 5D8JL 1OOAA 4JKLA 3G5ZA 4UINL 4FQXC 4N1HB 3WJJC 4JB9L 5EBLA 2VJXA 4Y2OA 2Y4SA 4X9BA 3BH9B 4XVSL 4OAWB 4JFZL 1EVUA 4GXVH 4BZ1H 4EI5A 4DFHA 4LOUC 4M93C 5IEKB 1QKZH 1V5JA 3GSWB 1WFUA 4AQOA 4WI3A 1XGPB 1CFTA 4O2CA 3GO1L 3VFNB 1N6QH 5K93A 4N9OB 1PZ5B 4PJBA 5AYQA 3ZYOA 2G2RB 4IS6A 5JLZA 3JSSA 3NGBC 1I9RL 3VXUA 4PTTB 3ZDYE 5CSBA 1AE6H 1YEHL 1IFHH 4R90H 5HI4D 4QHMA 2K7PA 3VDAA 1KN4L 2B20A 3H9HA 4JG0H 1BFOA 5H94A 3QHZH 3TPUB 3SQOL 3AC0A 3MGOB 3FKUS 3E3QE 4WO4C 3SGEI 2E3VA 1H15A 2WLYA 3KNBA 1T3FA 3LIZL 5IVXF 4S0SD 3RNQB 5C07B 3QJFB 4K94H 5DJZA 1KJ2L 3O6LL 3EJZD 4K3DH 1QLEL 4WW2B 2NQCA 5CD3A 4NN5C 1B3JA 1S9WA 1FSKC 4ZTPH 1QLRB 1WFTA 3QEQE 3QUZA 1MNUL 3VFTA 2X1QA 3B6SA 4FP8H 2P44B 1NBYA 4PJ8B 4YLQT 4K07A 5KBNC 3AVEA 2LFGA 5CWSB 3S98A 1GHFL 3TBTB 1MI5D 2EH7H 2DKMA 2HFGH 4XMLH 5DHVA 1KG0B 5F9OL 1CDGA 3MRCA 2Z91A 4MQXD 4Z7VF 3EO9H 1S7UA 3IJYB 3ESUF 1KJ3L 3GSQB 4AQ1B 4PGDA 1JNHB 3DSFH 3T3MF 3RDTC 2DQEH 1F4WL 2DQHL 3EZJB 5HYFA 4Y5XC 4I4WA 5AUMB 5T3ZE 1EIBA 5C1MB 3ULUE 4BFIA 4BFEA 4MCZB 3FQTB 2UZXB 3U46A 4HXAL 4WWID 2C7UB 3L7EB 4BQ9A 4QXUH 1NBQA 2JJTA 1OM3L 3ALWA 3ARDB 5JXEC 2BOBB 3OHXB 5HYJA 4JM4L 2V5YA 1J1PH 4P4RA 3U0TA 2PTTA 2BVQB 1CK0H 1HZHL 3QRGL 4R8WL 4MQTB 2UZIL 4MJIB 4JFFB 3NCJH 4IRSB 1VENA 5KSAD 3P4NA 1MWAB 2MHAA 4PS4L 4N5UA 4QOKD 1P7QB 1F97A 1JF1B 1TIUA 1ZANH 3SGEH 2B1HH 1YN6A 3RA7L 3QT2A 3L1OH 1YY9C 4PRDA 3WO4B 2IGFH 1CFQA 2FECL 4N9GA 3CFDA 4HJJL 5HHXH 1KJMB 4OCYH 1Z9LA 1TJHH 2IAND 3CUPB 1J8HA 3TM6A 1DUYA 2YR3A 2IPTH 4L4VB 5K59E 3U48A 2IBZY 4NUGL 2X10A 5FDYA 1W0WA 3UTOA 1P4LA 2ITDA 1YEGL 1JWSA 5I76B 4MNQD 1AI1H 4G80B 4NZUH 5BJTB 4PV8B 2ICEB 4WW1A 4RISL 2ZSWB 4ODHH 3EOBA 2R4RH 4KJPC 3SGJA 2Z31B 5IIEA 3CU7A 5GGTL 5C09B 5DVMA 1TQBC 3PL6D 5E08H 1GZQB 5SV3A 4ZFFA 1G9ML 2FB4H 1MI5E 1CDJA 4G9FE 4AM0B 1KT2A 3PV6A 2L4OA 1QNZL 1XEDA 3P73B 5D7IA 1X4XA 3CZFB 43C9A 1ZTXL 1JNLH 1I1AC 3QBTB 3QAZB 2C3WA 2QQKL 1ZSDB 3MRFA 3N1GC 3LN4B 2RCSL 4Z8FH 2DWEB 2AJZB 1D5ZA 3O6ML 3RZCB 4YK4B 1AP2A 4UMGA 3JTTB 2DMKA 2H45A 4X5LA 4PRHB 4XX1E 1UM6L 4YO0B 3VFMB 1NGWA 2BXZA 1IVLA 3B5TA 4KMQA 2A6KA 2X41A 5C2BL 3EIFA 3G6AA 2FWOA 3FOLA 3FO9B 2AJZA 4KZDH 2D31B 1AKJD 4JFZH 4N1CA 5I2IB 4OKVB 4M5ZH 1OQXA 3KDMA 3BDYH 1JGLL 3UZQA 2FDBP 3W11D 2FYYA 3VXRA 3K80A 1BVLA 1AQKH 2WP3T 4G8EB 1Z3GL 5D1ZB 3SKJH 1U2CA 3VJ6B 4LSSL 2DWEA 1E6OL 2DD8H 4ODXB 1CXKA 1QQDA 5L9DL 4S1DC 3VXME 1I9EA 3BGMB 3QDGA 3QA3A 3WJLA 3EYUL 2LU3A 3B9EA 3G04B 1CWVA 3DVNA 4KK6C 2P5WA 4QRTA 4Y19B 1AO7A 4XVTH 2YEZA 3ARFA 4AIOA 3ALXA 5CEXB 4KUCF 5EZJB 1KT2B 3PV6B 3NIGF 1XR8A 1C7SA 5I73C 1IZJA 5HJ3A 4WI5A 1UACL 3AY4A 32C2A 1NCWH 4MCYA 4N8VA 3W2DL 5HGDB 1KLUA 4HUXB 3C5ZD 5HGGS 2JB6A 3OX8A 1IM3B 4OZ4A 1KEMH 2CXKA 2VABB 5E2JA 1MQKH 5DUBA 1SQ2N 5FGCB 4YHLL 1LHZA 2NXYD 2CH8A 4OCSL 2CLZA 2XACC 2D4FA 3NH7H 4TUJB 3IXAA 3IAPA 5TDNA 2R8SL 1KJMA 4PUBL 5DHYA 2JIXB 3V4UH 4DEPB 3ULVL 5CJOH 3FO1B 3GIZL 4CNIB 4P3CH 1MRFH 4K7PL 2DI9A 4G7YL 4A6YB 3DOSA 4MD5A 1QQDB 4FZEL 4JO3L 3MV8A 4ZOAA 5C0DB 4L8BA 5DVLA 3ZE0E 5H35A 3N1MC 1CT8A 4NO0B 3LEYH 5GZNC 1W0YT 2GAZB 3BEWB 3FMGL 1FZOB 4EN3D 4U7KA 3B9KB 3I75B 4YC2B 4LLMA 3BPCB 4RFNC 3RWCA 4QHKJ 4KAQL 1G7PB 4MWFA 4QXGH 1MCFA 2YUZA 4WTZG 2EC8A 3RPIB 5E8NA 3RWGA 3H3BC 3HNSH 4WGWB 2J2ZA 4PD4J 5HYIA 3DRQA 4PJCF 4HWZA 3IFOA 5FECB 3L9RA 1QSED 3WXWL 1V7NL 2J8UF 1DQJA 1KTLA 2GJZA 1U8OB 5DHVH 3HZYA 4OCRL 3MLTA 3CFJA 2HG5A 1HH9B 4JRWA 1HQ4B 2D3VA 4FMKA 2AJ3A 1H0DA 4PJFF 1RVFL 1OWWA 1NKRA 3V0WL 4MA7L 3ZKQD 4NSKB 5CGTA 1HHKA 3QHFH 1ZSDA 4XVUD 5IESH 1BZ7A 5JR1L 1NAMH 3LMJH 3GK8L 2WQ8A 2DQJH 1I3UA 4L8SB 4NM4H 3IGAA 1GC1L 1TZIB 1TMCB 3WL9A 2A83A 1X9QA 4DUWA 3NABH 4Y5YC 4DK6A 1PZUB 3CK0L 3PHSA 2BVYA 3KPRB 3I85A 2EZ0C 3L3KA 4KPHL 3NIFF 3A67H 4NO0D 4HLZH 4BUGA 1N0XH 5JO5A 3WS3B 4PJ8C 2GT9B 3V5DA 4W70A 3TV3L 3MJ8B 2VUYA 4DKFH 1U8IA 2YN5A 1JV5B 4YHPB 4KKCC 4HWZB 1K4DB 2EXWC 2V7NB 3NIDE 3G6DL 2VC2H 3S9DB 2X1OA 1GJIA 4Z95L 3SJVB 1B0GB 4PJGB 4UBDC 4FXKB 1RZFL 3ZDXE 1ETZA 3QUKA 3HRZA 3I75A 1FZOA 4KDVA 5CP3H 2X4RB 4UV7L 3QFJA 3HB3D 4DGYL 1DVFC 4JFEE 1K8IB 3LY6A 3TLRA 4CVZA 3QQNA 2F74A 5JOEA 3MQIA 2P5EA 3KPLB 3TCLA 4LVOB 3G5ZB 4Q6YA 4KUZH 1I7RA 3ARDC 4BUHA 1MCDA 4JFFA 5BZWA 3R06B 3M8OH 1AO7D 4Z0XB 2J6EL 2J88L 1RU9H 1I1RA 3O11A 5IM7A 1F6AA 5EUKA 4LVHB 2C7UA 3L7EA 1A4KA 2LTQB 1HHJA 2R4RL 3ZTNL 5CSZB 4MCYB 1KCLA 3QUMA 2IPKB 4NRXB 4V1DA 4DGIH 4PRIE 1HOCA 5JHDE 3RIFF 4JPKL 3BP7A 2QQLH 3T0BA 4WDIB 2HJLA 3OGOE 1OGAE 2OK0L 1LE9B 4G6AD 3UTTE 1J8KA 3PIQB 4RFEA 3T1WA 1R3IL 5EB9A 3CC5A 1BM3H 3BESR 4HWEL 4HH8A 4AH2A 3BQUC 4MXWH 5E6IC 1ZT1B 3GJFK 4G6ML 4QTIL 2B39A 2VQ1B 4GSDH 4JAMB 1ZT4B 2Q6WA 3MREB 4JKPH 4E0RA 3VXTB 4XVTL 4ZO6A 3U1SL 1G7LA 1HH6B 1JK8A 5EOTB 4H1LB 2VDKL 4ZOCA 1OP5H 4FA8A 3HI5H 3IRZA 5EOQL 5TH2B 2E9WA 1XH3B 1HHJB 1L0QA 4YDVB 1ZLWH 5T33H 1A9BA 3RY5A 5FGCE 3P2TA 5FCSH 3ARGA 3BSZH 2NY3D 3DSNA 3VXRE 4CU8A 1Z6JT 1I1AB 2Z4QA 3HFMH 1Q94B 4I3SH 3WFBL 3PWLB 5T3XL 1AHWC 2H3NB 5M95B 3AB0C 3C5JA 4LAQL 2G5BB 1DBAL 3RWEA 2P46B 2KZWA 1HCVA 4IHOA 3I2CL 3GNML 4XHQA 4KK9D 4JFYA 4I0PC 3VFMA 1KCUH 4JO2L 1XCTB 2MCG1 5EOQH 4JFPA 4I18A 4WFHE 1EJOH 1SEQL 2V5MA 5L2KB 3H0TA 3NCFB 1Z3GH 2ZJSH 4FOMA 4PUBH 1KJVA 4LSVL 1QFHA 2BC4A 3C8KA 4PTTA 3QZWG 1RZ8A 4GRMB 3ARBA 4OD3H 5E9DE 3THML 2NZ9C 2R2BA 3CVIH 3JWOH 3VRJA 3DO3A 5GS3A 5FOBA 1RUKL 1HHIA 1YQ2A 2QQQA 3PQYB 3F5WA 3WSQL 4J1UA 5MHSE 1DP0A 1JGVL 5KSAA 1VA9A 1KYOJ 4F7PB 5DRNA 3IDMB 1IGIH 2EIZA 4UQ2B 2XN9D 2BP3A 4G6FB 4APQD 5IOPA 2J12B 3IYLW 4TUJA 4KTEH 1JI1A 1FNEA 2CXGA 2ATPB 2BVOB 5B21A 3T65A 1Q9WB 1FL5B 5TPWH 2YPLB 2Q76A 4O58H 1SJEB 4H5SA 3WXWH 7FABL 4H0IA 1EXUA 2YD3A 1DE4A 1FC2D 5F96L 4P4KA 4ZNEE 1ND0A 4HIHB 3L3OB 3QWQB 4L8SA 5HGDA 3HNTH 4K3JH 3QDGE 2AXFA 2OTUB 2UUDK 1LEKA 4F8TA 5I1IL 3KJ6L 4BM7A 1P4LB 2ITDB 4QHKI 4DOHB 4JZOA 2AP2A 1RY7B 3ZE2F 1U8JB 5EU6E 1A3RH 1HIMH 2NX5B 4N9GB 3TBVA 3N50A 3OR7B 3MJ9L 1ZA3A 3O9WA 4K3EL 2X4TA 1MRFL 1U8MB 1VGEL 2ZCKL 1Q72L 1VEMA 4X4XB 3RAJH 4YH6A 3RY4A 1RJLA 3ZYJA 5IFJA 5AWNH 1RUMH 1XF2B 4GLRI 5E0QA 1MWAA 1NUNB 3EFFB 5CLWA 1IEAB 5E7FA 2R29L 5IROC 1F2QA 5GS2H 1F8TH 4L4TE 5FUCE 2APFA 3UCRA 4LLQA 4OUUA 3WNPA 2HTKC 5EUOE 3CU1A 3HNSL 4QHNB 5K9JL 3WFHA 3D5OF 2VZTA 3MNVB 1DLHA 1UZ6F 5GGUB 1QA9A 1UT9A 2A6JA 3KHQA 5C6WH 3IXTB 3DX7B 2MOVA 4FHBD 4K8RH 3UJJH 2Q86B 4ELMB 4JHBA 1HCFX 4EIZC 4QRUB 4AK1A 1FLRL 1MFBH 1NUFA 3MLPA 3GI8H 3Q5TA 3VD9A 3B9KC 2ITCB 1NCAL 2NY1D 5FOJA 3IJYA 4KKAC 3BUYB 1ZGLB 3W82A 3AAZB 4BSWB 3QH3A 5C0EB 3DYMA 2DM3A 3SKOA 3UBXG 3IFPA 3MCKA 3BPNB 4HUKB 1U8QA 5E2UL 4EI6B 1JHKL 3B2VL 2GHWB 4NKIL 5KS9F 3TO4B 2NR6C 1KCSL 1KJ2B 5FF6B 4EIGB 4UNUA 4NNPH 3OJMB 5IK3B 1L9NA 5JQ6L 1Y6NR 4HF5L 2OCFD 1SYVB 4AEHL 1B6DA 3BMVA 3K2UL 3HS0B 1EFQA 2DQGH 1J12A 5DQ9B 5DS8B 2MQCA 3LKQB 2CRYA 1YC8A 2LVEA 5D72H 3MACH 4YHOH 5K9QI 1NGQH 4H1LG 4PD4K 5JW4Q 2E8ZA 1CFVL 3S35L 1EZVY 5TF1L 4F57H 2PNDA 2WINA 4NKIH 4JVWA 4JANB 1IL1A 3FTGA 1A6TB 3BHBA 4P3DA 3QHTC 3T3PF 4HS6B 4YBQC 1U8QB 3LV3A 3MR9A 5I30H 1ZHLB 1FVCA 1VEOA 3P4MA 4D9LL 3RKDC 4PRDB 5TQ2H 3MCKB 3UTQB 2XFXA 3ARWA 3SN6N 5I16B 1EHLL 3AAZA 5TF1H 4PG9B 4YDJB 1Z0MA 3FRPG 2BY0A 3MA9L 3KXFE 1KOAA 4LASH 4EOWH 3O4OB 3MV8D 3EYOB 1OAZH 3G6JB 5EU6D 1BECA 3O6FC 2Q7NA 4B7LA 3FQWA 1QSVA 3DXAB 4KROB 4R4ND 4TVPD 1NAMB 4RGND 4R2GD 4ZSOA 3BEWA 3CZJA 2B5IC 1QHPA 4LSVH 1SBSH 1TQCB 3MNWB 2EDHA 3WJJA 2AEPL 4HIXL 4X6CA 4YNYB 3VFRB 3VI3F 3HE7C 1JNLL 1NSNL 2X9WA 3MLUH 3REVA 2QQNL 4EQ2A 3KPQA 5GS0L 3D69A 1F3JA 5A1AA 1X5YA 1AGBB 4UV4L 4DVRH 3LDBC 1B0RB 1QEWB 5DHVB 5T1KD 4JN1L 3NCMA 1QR1B 5B38A 4W4OA 4QRRD 3HR6A 3LAFA 5C0NC 3MUJA 3LHPL 2VLKE 3B5HA 4OZGA 1H5BB 2NNAA 4PRAA 5SX4H 1YEIH 2OZ4L 1AC6A 1MFDH 4PRIB 3B3IA 1ULVA 4NRXA 4V1DB 3MLUL 3V52L 5DTFA 5B8CB 1RULH 1ONQB 1C16B 4FFVC 4PJAA 2WWKT 1J5OL 2R1XB 1MPAH 4A6YH 3KPOA 2OR7A 1S8DA 1BD2D 4FQIL 1SYSB 1AO7B 5CMAA 1NGPH 4G5ZH 2AEQL 5D9SB 3W11C 4Y7MA 5DD6B 4AEHH 4XNZC 1X7QA 3X13A 3BD5A 2G60L 1UWGL 1CDHA 5IFHL 2ATPA 3V4PL 3JTSB 4IEFB 3ZT6A 5FO7A 4X5WB 1FNLA 3CFKB 3UTZA 2O5YL 4IOFC 4I18B 2BOBA 3OHXA 2H41A 4NGHH 5CIPH 5HHNB 1NBVL 3BYYA 2DQCH 1P9MA 4W6XB 4GBXD 5CP3A 4F57L 4U1MB 1GYAA 4JHAH 4ONHB 1DQMH 5J89A 2Q87A 2IAMA 3S34L 5F9OH 1IE5A 3R0NA 4TPRL 3BPOC 3EKCA 1F4WH 3ROLB 4WEMB 1B4JH 4JFHD 3CFKA 5HBBA 2QJDA 1BOGA 3W2DH 1WWBX 4OGZA 5L2KE 1XCTA 2FD6L 1IAKB 4FFZL 5C0CB 1KEML 2CKNA 1DEDA 4PRIA 2DLHA 4KJPD 3RWJA 3P30H 4OZHA 3T77B 5HYSG 3HUJE 5DHXB 5J1AA 5I15H 2VLRE 1A02N 2J5LC 4JJHA 3O6KL 3MZGB 2DQTH 1MCRA 4NQEA 1BD2E 1K4CB 2XWJB 1L7IL 3VG9B 2ZUWA 2NY5L 2XZAL 4WU7A 4CN4A 1DLFH 5FA4A 4Q2ZA 2NTSP 1QFUL 5HYQB 3FT4B 1IGTA 3QI9A 4OQTL 1EMTH 4Z7VE 2DQFB 1G7QA 4NHUA 4XRCA 1RFDL 3P11L 5FFLA 5EFIB 1FHGA 3VXSA 3VXUD 2XIDA 1T89C 4R7DB 3HE7B 4OZIF 3MBXL 3MSPA 1ZT4A 1D5MB 1N8ZB 5DJ6B 1C08B 3BSZL 2ADGB 2QKIA 3F58L 5IVNA 4MS8D 5D5MA 2BNQB 1U3ZA 2CDGB 3B8YA 1WK0A 3TN0C 3NAAH 4K7FB 1NCCH 1KNOB 5T3XH 1MHCB 1FLRH 1MFBL 2WMPA 2PYFA 3RWIB 3T2OA 5JW3H 1ORSB 4JJ5B 3WN5A 3GI8L 5E8PB 2VLJA 5IBTH 5A2LH 4P46C 4RDQG 4MNGB 1UYWH 1QSFA 3RDTA 2COQA 5HDBF 1Q9LB 3F7YB 1A3LH 1INEL 2EDJA 5IVZB 1RZJH 4WW2C 5BMFH 1RZGA 4G8GA 3ARBC 1L0YA 3TYGH 3DMMA 4ZS6C 3VH8B 3OPZL 4HFWA 4JZNB 4ZD3L 1R3HB 1OHQA 2YD1A 5I1CL 1GPOL 3C6SA 3QFJB 1UKQA 1MWAL 1FGVL 3AM8C 4NKQB 3MRIA 4HS6A 4UILH 5F6HJ 3ESVF 3VA6A 4ODSL 2E6PA 3QXTA 4Q58C 2FGZA 1QVOB 2X4UB 3C8HA 3VFUB 2VYRE 2IJ0C 3DGCR 4BSJA 4M62H 4XAKE 2E8YA 2CUIA 5JMRA 4Y5VB 3RY6C 3MMEB 3TO4C 4XAKD 2EDXA 4NQDD 5A3IC 2CLRA 3AM8A 4P2OB 4DN4H 1LQSR 5C0BA 4NKDB 1S9YA 4JHWL 3DV4A 3B2UD 5GGQL 3QEUA 1CLOL 4OB5L 4XX1G 1YEEL 3O8XC 2IALA 2W0FA 3OF6A 1T2QL 1MREH 2OR8A 2MTPA 4HFUH 1S9XA 3MRNB 2BCKB 3VXOA 2HLAA 5L2JA 1QO3B 2BMKA 1GH7A 4BK5A 4KGLA 2AABH 1NMBL 4WW2F 4X7TA 2R23A 1QHOA 4CVXA 3IETA 3CFJB 4QXWA 2N7BA 2FD6H 4LHUG 1YEIL 1CICD 4GXVL 4ORGA 15C8H 3T0XA 2DM7A 1LDPL 3RBGA 5JZ7D 1NMAH 1F58H 3NMEA 4JDZA 5KZCB 1YEKH 2P43B 4WEBH 3T2QA 4UUJB 3ELAT 2IH3A 3VGHA 1UJ3C 2GCYA 3DXAE 4M6NH 4GRWH 3HG1B 3ZDZE 1WZMA 5FECA 4OF8A 25C8H 4P2QA 2DMBA 2FRGP 5AYUH 5SWSB 1O7VA 5KVDH 3S37H 1QP1A 1I75A 1CDYA 1MFEL 4PRPB 3PXJA 4PJDB 4RGOH 4GRLD 3NTCL 5CKGA 4P0DA 4FABH 4WY7H 5KZCD 5KJRL 1MCLA 3AS2A 2VDML 4EXPX 3T0ED 4JRXA 4YHYB 4M3JA 3HI6H 2XA8H 1KXVC 5I75B 2DMCA 3X3FL 3UJTL 5BZDA 4QRQB 4QHNA 1JPSH 1FAIL 2NXZD 5GSRA 1TVDA 3SGDH 2B5IB 4D3CH 4KK8D 1MFAL 2Y5TB 1E4KC 1ED3A 4WJ5B 2HFTA 3RP1A 3VXMA 5DJCA 1GIGH 4QRPA 5IBTL 4PV9B 1MHPL 2GJ6B 1MFEH 1WT5C 3H9YA 1JE6A 1X5KA 5FB8A 2R0LL 1UYWL 4YK4C 1OP3H 2R9HC 3TO2B 1Q38A 2DQDH 3DVGA 4BH8B 1P5UA 4H0GA 4XC1H 3BFOA 4FFZH 2V2WA 1NC2D 1K6QH 1L4IA 5T1LB 1P2CB 3QQ9D 1KENL 1EEYA 4JFXB 3SDXF 3TFKD 3CMOH 3CPLA 1FZJB 2A73A 2BNUA 4NQUA 3UYRH 4EKXA 4Y1AA 1BFTA 3QQ4A 3AUVA 4KVNL 5FYJL 3QDMD 4YHKL 3BN9D 1H5BC 3QO0B 3DSFL 4CN1A 3QI9C 4HJ0D 5IWLA 3HAEB 3GKZA 5DMYA 4NRYA 4FQPA 3ZO0A 3WE6A 3C6LD 3UTPE 1IKNA 3KXFA 1H8NA 1DUZB 5E1AA 3HB3C 1MCWM 3RVXC 1CDBA 1IQWH 1IM9A 5EIVA 3VU2A 3Q3GA 4JRXE 3KJ4B 1HILB 4F7TB 4O4YL 4JM2C 2D31A 2HFFA 3ARDD 3IU3B 2CSPA 4L8DB 4RMUA 3OQ3B 1UB5B 4XPGH 3SE9H 4ZDHB 5I1KL 1FFPA 4PJDF 3WEXB 1F4XL 1Z9SA 1KXTB 4M7LH 4J3OC 3QIUC 4IDJL 4ELME 4G8EA 4PB0H 4XPBH 2AJYL 5J6HB 1HXYB 3ZDZF 4S2SB 4OZGE 1F6AB 5M7QA 2VH5L 3C87A 4B7IA 1AP2B 2GJ6E 4QRRA 3QXVA 2Q8AL 2AGJL 4RAVA 1XF3A 2QR0A 3D0LB 4YDVA 2RQ8A 3LKNB 3ZKXB 5E4EB 3OXSA 5J3HC 3MRLA 5I8KL 3WEXA 4AL8L 4MNQE 4G6AC 4HV8A 2X6MA 5CHNB 5ICXB 4GW1B 5HI4C 1FAKT 1G7LB 1J8HE 1GPOH 3NZHL 3SOBL 5GJTH 2BSSB 3PWPA 5T1DL 5EO9B 1R3LB 1WWAX 1HILA 2YKLL 2Z92B 3CX2A 5DLMH 4FG6D 1U6AH 4HK0A 4LCUA 4DGVH 5IMOB 3PDOB 3EOTL 2CDFB 3MCLL 3BWUC 5IROA 4DZ8B 1TNMA 2F15A 5ACLA 4KRPB 4M1DH 1IM9D 2VH5H 4CJ1A 1XH3A 2DD8L 5D7JA 3WFCL 5F93C 5I9QB 3WE6B 1MOEA 4U1SA 3SDAC 3GMRB 3ZT5A 1M05B 4P3DB 3IKCA 5IK3A 4YEEA 4ZO8A 1G9EA 1NCCL 1QTYT 1VADA 5A2JH 1XR9B 2A9MH 2EH7L 2EXYC 4EI6A 1PSKL 2Y6SC 4MAYD 4S1RH 4QHMB 5JIKA 4N68A 3VE0B 5ERWB 4HDIA 4JFQB 4MXVF 3O4LD 1I7TB 1NGXB 3SCMD 1LO5A 1PD6A 1QBLH 3DUSB 3T1FA 5F1IB 2CGRH 2X1PA 3F7YA 1CBVL 1NPUA 2FH8A 3SGKC 1T04B 4X4ZA 4XWGH 5GS0C 1JPFB 4NC0B 4U0QB 4XCNA 4QXUL 4J2XA 2FX9L 2EDFA 4HGWA 1MEXL 4LSRL 2CD0A 1OPGH 5EZLB 2BNQE 3H2WA 3ZKND 2OM5A 4GAYA 3SKJL 1BD2A 3L3GA 3FHQA 3TVMD 1IC1A 3LEXB 5EIQA 3SKNA 3OAZK 4PS4H 1MCOL 3FQTA 2PO6B 1CFVH 3QUYC 5T3ZL 3WIIH 2F8XC 1XF2A 4OTXH 2WP3O 1H3PL 1T0PB 4R6UA 2F19H 1ACYL 2Z8SA 1E4XL 3MLWL 4WUUB 3HI1A 5HYJD 5GHWH 1TJHL 3QIWC 2NY6B 1G9NH 2NX5A 1F4AA 3A6BH 1B2WL 4YWGH 4EQ3A 3NA4A 3B8SA 4RMVA 4DGIL 3QFJE 5ID0B 1I8MB 4QO1A 2ILLA 4ZFOA 5IR1A 3MXVH 2EYSB 5HGAB 4U31A 1EBAA 2ICWA 4Y1AB 1JZ8A 3BD4A 3B4NA 4OZHB 4RWHA 4NOBA 5F8QC 3T77A 3HKFA 3TBSB 1OLZA 3O9WB 4HCRH 2X89A 2WWMD 2HT3D 5EO1B 2HA1A 4MD4B 3O8XB 4R3SA 3S5LG 1YY8A 2MJWA 3C5SA 4QEGA 3X14A 1OTUC 1FFNB 4Y4FA 2MQ0A 2R8SH 2EO1A 5JR1H 5HI3D 4D9QD 3PHOB 4K94C 4FQCH 1BZ7B 3MRQA 4ISVB 4D9QE 4MNQB 3HCVA 1EGJH 4X6CE 4MHHI 4TTDC 5IP4A 4Y1AE 1AQKL 2JIXD 4F9PC 5HXMA 1NFDF 1BLNA 5I19L 3J8F7 5I1JL 2D7TL 5I8CB 3RJDA 4R0LA 4WHTA 3KS0H 1AY1L 1KCVH 1T6WA 1FL5A 5IKCB 4KRNA 5EA0H 5HYEA 4Z7QF 1U3HB 5IF0A 3PWVA 1G1YA 3WFCH 1KB9K 4V2CB 4M4RA 1D5IL 3WFBH 1YEDA 3KAAA 5KJRH 3IU4H 4DKFL 3MUHL 1OT2A 2VLJD 3P9MB 1H3VA 5TDOA 4CNIA 2ADIA 3LD8C 1D6VH 3CSBA 4WHYG 4LFHD 3L6FA 3MODH 2B4CL 4NQDA 2IBBA 2QR0B 2UVFA 3QEHB 1G84A 3EO0B 3IJSB 4TUKH 2F54B 4NZRH 1ZT7B 3AS0A 2WBJA 4PJXB 5D7SH 3MLYL 5EBMB 4ODHL 2FGWH 5CMAB 1OAYH 1N26A 1LD9A 2PW1A 1S5HA 3D25A 3H8NA 4LF3A 4MNGA 3GSWA 5IESL 1A2YA 1G9MH 4GBXA 4Q9CA 5KOMC 2PF6A 3DUSA 3T1FB 3FN0L 3MLZL 2F53D 4KY1L 2DQJL 4OBSA 4YO0A 2PETA 3HZMB 5KSAC 1V05A 1AGCB 1Q0YL 4S1DD 3E1F1 1C7TA 3Q3GB 1WAAF 2JELL 2EDLA 1MH5B 3QNXB 3ARGB 2ADJA 2H26A 3AB0B 3MLRH 1TCMA 5DGRA 5TH2A 1LE9A 3DBXA 1AFVH 4HUNB 2CRIA 4ENED 1F11A 1DEEA 3SY0A 4HT1H 4UZGA 2BXYA 1FG2B 3DUHA 1K8DA 4KDTA 5HYQA 4IMKA 1HI6B 5CD5D 3EW3B 1U8KA 5D1ZA 5ADPH 4ZUVA 3L7FB 1BM3L 2NY2C 2X1XR 4KVCL 2YSSB 1RURH 1RUQH 2J8HA 1J88A 5CBAA 3MFFA 4KJYA 5IQ7L 5T1LA 1VFMA 4WUKL 4Y89A 2ESVA 2HT2C 3HZMA 5GGSA 3G04A 4LPYA 3BE1H 3QDJD 2FSEB 4RRPA 2YRZA 4JRXD 1F13A 5TFSL 4WFGD 5DSCB 2FLBT 3DXAA 5EO0A 4FZEH 4JO3H 2WW8A 2QLVB 1KELH 4HUVB 3LN9A 1BF2A 3GHEH 1T20A 1KACB 3G6JA 1XF4A 5HHPA 1UENA 4NNYB 2VE6A 4JM2B 4RGNC 3F7PC 4MJ5A 1ZT7A 3RQ3A 3EO0A 2AK4D 1A6UH 3UPRB 3NA9H 3O3EA 3NCYS 3QIUB 4N0UB 4X4YB 4TTGA 5FKAB 1L6ZA 4KMTL 1ITCA 1YDPB 2HFGL 4Z18A 3U6RB 1BGXH 3SHSA 4YGAB 4P2QD 3AGVA 2YWZA 4Y1AD 3BAEH 3BKYL 3U0WH 2XN9A 4NM8L 5ERWA 1EX0A 4EN3A 2XNAA 4LRNL 5JHDA 2EDKA 3SDAA 4PGEA 4K9EC 1A5FH 3CSGA 3D39B 3S4SB 4FRWA 4Y16D 4XNUH 4M6OL 2HWZL 1U42A 2UUDH 5GIRB 4IRZL 1QFWL 2I5YL 4PJBE 3ZE0F 3OKLB 3IDGB 1UC6A 4UTAH 4WO4D 3LD8B 2D03H 3V5KB 4MXQD 1RIHL 2NW3B 4JDZB 2O5XH 2ICEA 4GO6B 3T2NH 3O81A 1PLGL 3BQUA 5E6IA 5LGKA 4CDHA 3HI5L 4YHZL 1T7ZA 5I74C 4FQLH 3DX6A 2FNBA 3HA0A 1NGYA 3L3KB 3VFWA 4QWWD 4JR9L 2J8UE 2APWA 3PDOA 4YBLB 3L5HA 4X8XA 1EUTA 2JCCF 2CKBB 2WWKO 4LRIC 2ICWI 1NC4D 3DV6B 2XY1A 3OR6B 3QDJE 1Y18B 4JREC 1BQLH 2QEJA 4KY1H 3GMOA 4YGVB 1OW0A 4QRSB 2KKQA 5C0BB 3PHQB 4IOFD 3VI4F 4M1GL 4CMHC 5MEOA 3D69B 1N6UA 3ZTNH 4YXHH 2VXQH 4NCC1 1XFPA 5BRZE 3CD4A 4CMMA 2VXSH 3FQNB 4UAOB 1EO8L 5TDPA 5LGHL 3PQYE 5I19H 1KCRH 5F9WC 2M26A 1AJ7H 3SDXB 3GMMB 5ALCL 5J0BA 4X6DF 1D9KA 5JDSB 3MRBB 1CLOH 2AGJH 1RSFA 2ATKB 2WK2A 4K3GA 5HDQL 5EOCJ 1IM9B 3T8XA 1CQKA 2VLRB 3RGVC 2G2RA 4IS6B 2YBRB 5J1SC 2B1AH 3HE7A 1IM3A 4OZ4B 5CWSA 5GS1A 1JI2A 4Z76A 2I9TB 3KWWB 4IBLT 2JK5B 4CMMB 4PY8J 2GY5A 4Y4HA 1T1WA 3HE6B 1L7TH 3G5VB 2X09A 3OL2A 2E9IA 4Z7UE 4OV5A 3TPKA 4P9HL 4NUJB 5JTWA 1C5DB 4LCCC 5ACMA 3BIBX 3WS6C 4L3ED 1HEZA 1Y18A 3BZ4B 2XKNB 5KS9B 2N4IA 1CCZA 5IT2H 1AC0A 4HUWA 1KCSH 2J3SA 2DBLL 2ZSVB 4G9FA 5D7JD 1JYWA 1MHEA 5EC2B 1T66D 4FXGA 4BH7A 5I73B 3V0VB 2BNRA 3C9NB 2ZP0T 3O9WC 2M8XA 1SEBB 4XP5L 1ED3B 1J18A 5EUOB 3PWJA 5ESVB 3NFSH 4JFOA 4XC3L 2DI8A 1EUUA 1OT1A 2D7QA 4LPVA 1A6WL 3TJEH 2CGRL 4NC1E 1M05A 3QUMH 4KUZL 3VGAC 4AEEA 3TIEB 4NQXA 3T04D 3C6LB 4R96B 4XWGL 5DWUH 4M9PA 3HMXA 5GRYA 3BZFB 2VO5A 2GTWB 1QRND 4LLWB 2NY6D 2A9NH 4DEPC 4X9HA 1NGPL 4RMSA 4NBZB 5I74B 5E2VL 3B9AA 4OM0L 2G9HB 5FGSA 3RWEB 1MHPH 3LDBB 2YC1B 2CDFA 1U3HC 3FQRA 1CGXA 3X12B 1U92B 5FO9B 4KK9C 4HLJA 1C12B 3I02A 1G6RB 5GRVK 1PZ5A 4Z7VB 5B4MD 3THMH 2APXA 1KELL 1FZKB 3MLZH 1MFCL 1MIEH 4JY4B 4OD1H 4LLWA 3NAAL 3TYFB 1RI8A 2AV7B 4Y2DA 1IAII 3MV01 1S7XA 1DVFD 5IJKC 3QEQA 3ARPA 1H3GA 2EDBA 35C8L 3V4VL 2YSSA 1VGEH 1PG7W 5DUMH 4OGXH 3BPLC 3LKOA 1EAPB 2I26N 3D18A 3SJVD 4JFOB 4XNYH 1GL4B 3BUTA 5K33A 3H9SB 1W72A 1A7PH 2E9JA 4LU5H 4APQC 4M48L 1M7IA 1X5ZA 5E7BA 1AKJB 5I8EB 1LO4L 3ZE1F 2Z31A 2IPTL 1QRNA 1C5BH 1NBZA 4FFYL 3RVXD 2JCCA 2VXTH 5HHOE 1T83C 3UPCA 2W9DH 1ZWIA 4X6BA 3PWPD 3WNMA 4K9EL 1AR1C 4JRYE 4GKZA 4E42B 5DQ9A 1I9IL 3PUCA 4F8QA 3MJ9H 2Q3ZA 5GGTH 2AJYH 4LLAA 1PG7L 4ZFFB 3CJJA 5DVNA 2C4XA 4LPCA 1EGJL 3ARXA 5GXBB 3QCUL 3OTTA 1A14H 1WJ3A 1R5WA 4TNVF 1P7KA 1PFCA 2ZSWA 1MLBB 1LP9B 3BT2H 4P5KA 1MHHA 1DE4B 3ULVD 4OI7A 1EXUB 5JPNB 3IDYC 4P23A 2HJFA 3TH4T 4XNMB 1JHTA 3NIGE 3S4SG 1FV1A 4NQDE 5C8JA 2ZCLL 5E8DH 1N64H 3HUJB 4JDVB 3HN3A 4CGTA 4KI5C 4WHDA 4QRQA 5KN5B 4CBPA 4POZC 5EU3B 1KIPA 3FT3A 4F7MB 3X11A 5KS9E 3C5ZA 4YPGB 3WKMH 5DD1H 3MLVL 3NCJL 3PWVB 4WCYL 4HKJB 3PWUA 4LVOC 5ELIA 4EN3C 3BP4A 4HIXH 3IDUA 1SBBA 3CAFA 3VFPA 3OWEA 4KV5F 3OPZH 1ZK9A 4WFFE 3T4AA 3EYFB 4OSUL 3D2UD 2NXZB 5I1CH 3QG7L 2R0KH 3LVEA 3EDEA 4OZFB 4TSCL 4M5ZL 2VR9A 3BH8A 4JPVL 2E9BA 2R0WH 4RBPH 4U2ZA 1T4KB 4RCAA 1YEDB 5EORL 3SDCC 4JO2H 2GT9A 3HNVH 5EUOF 4I9WD 1EHAA 4E41A 2VLKA 3F7QA 3EBAA 3CDCA 2A74A 1CXIA 2NR6D 3AU1B 1Q72H 3A6OA 4H1LH 4L9LA 3HG1E 5DD3H 3CDGA 4HBCL 4QLRA 4RAUB 3OKOB 4MDIB 3I3DA 1OGAD 4P59L 4DQOH 3RY6A 4U6HB 3QI9D 4HJ0C 3R8QA 3C08L 3BDXA 5HGBA 5F44A 5KSVA 4QHLA 3VDCA 5GS0D 4C83B 5EORH 2XQYK 4M7LT 1WBYB 2J88H 4OLVH 4JZJA 5HHMB 2WINB 3E6FB 4B53A 1R5VA 2DN7A 3V4VH 1MQ8A 4KUCD 3HLAA 4TVPH 4OLXL 2CRZA 4MDIA 3JWOC 4Y2DC 3K46A 1PQZB 1UWEH 2EYRA 4HX1A 4LPWA 4X6FA 1FE8H 4AG4L 2VAAB 4I2XA 15C8L 2P5ED 4JREB 3TNNA 3L5XH 4A2MA 4NQCA 2PW2A 3RNKB 2SEBA 1XF5B 1NMAL 2IG2L 4JHZA 3EYFA 2AKRA 4YDLB 4OT1L 4XP1H 3BH8B 1YMME 2OQJB 2GQHA 1KEGH 3QIWD 4X7EC 4Y16A 3IVKA 2WUBH 3HRPA 1B4JL 2BFVH 3U1SH 2OYPA 5CGMA 3OAYK 4PJ5B 3QDME 1FJ1A 4WI6A 4GKSB 1GAFL 2P8LA 1YMHA 3K2UH 3FO1A 5IVZA 1NCTA 3DGGB 1VERA 4U3HA 1E6OH 4NQVA 3F12A 2NYYD 5FA3B 4YZFF 1X5AA 3UTQA 1ZHKA 3IVKB 3FFCE 4L1HA 1VFBB 4LSUL 2BVPB 2W9EL 4JM2A 4KK5C 4TULH 5IHUH 3RX7A 2I5YH 5F7EL 2NY1C 5D5ME 2UY6A 1BIIA 3F6LA 5TE6L 2O5XL 2Q7YB 3T2NL 4OUUB 5JHDD 4PRID 1BQSA 3QXWA 1QSEB 4XI5C 2G60H 1UJ3B 2YA0A 3L3OA 8CGTA 1PY4A 3L95A 1DL7L 1CD1B 2B8OT 2ZG3A 4NC2B 3S4SA 5ITBL 3KPRA 3BRFA 2VISA 3JWOL 3FB5A 4BYHA 4FFWC 2R0KL 4G8GE 3QQ3B 4DN4L 4JQIL 3ULSA 2IMNA 5CZXC 1MUJB 2DQFA 3JUYA 3MGTA 4JN2A 3UPAA 2P7TB 3GMPB 1CDUA 3RA7H 1VFOA 4I0KA 4LBEB 4LMQI 5IQ9B 4OZGF 1Q9KA 4J3SA 5E99L 3O3AA 4PJ5D 3OGCB 3U0PA 2IF7A 4I0PA 4HC1H 2DL9A 3DIFB 3TZVB 5DD0L 4MMZC 3FQRB 3H9ZA 1TJIL 4MXVE 4N0CC 4Y0GA 4OFYD 3L3HA 4ZS7L 2BSTA 4UTBL 2Y25A 4PRBB 3QWOB 5FAAA 1DQML 4KQ3L 4B50A 3FONB 1YYML 3AROA 5BS0D 3LN4A 4CVZB 4DVBA 2WSKA 5DRWA 3ROLA 1TVHB 5IQ9A 1EMTL 5CBAB 4G9DA 5GRUH 5KTEH 1QUNA 3ROOB 4K71B 5FHBL 3SDYL 3OJDA 5T1LD 3P77B 1RUML 4HIIB 1BLNB 3BJLA 4U6XB 1XIWC 2W91A 3DVFA 1MCSA 4E9LA 1S7TB 1B0WA 4OCNC 2VMFA 4HKBA 4AT6A 2DTMH 4NO2B 4PJFB 5DD6A 4PFEA 1IGYB 4HSQA 5F7DA 4PJHB 1OPGL 4R4NC 2L7UA 2UWEA 2VDMH 3QQ4B 3S3SA 2DM2A 5HHQB 3GSXB 2HT3C 2Z8VC 4AH2B 1UZ8A 2IC2A 1T7YA 4FQQA 2PYEE 3O2WL 2VN4A 3HE7D 3WL9B 4NRYB 1KPRA 1EHNA 4L3EA 1A0QH 4PR5A 4YDIL 4PGZA 5E5RB 2XZZA 4ODUB 5C08E 4IRSD 1FFNA 1KJ2A 4Q9QL 4GW4A 3CUPA 2WIIB 4NGHL 2AAVA 3G5VA 1A6VL 2XKNA 5D1XA 3VG0H 4MA8H 5C07E 3BDYL 1H0DB 3IDIA 3K4AA 4YJZL 2VLRA 1EO5A 1MCIA 3D85B 5ID1B 1REIA 1UH4A 3QB7C 2FR4A 2R2CA 2UWEB 1UM5L 3NZ8A 3PABA 5HTSA 3QXAA 4YX2H 3P9MA 5DDHB 1RQ5A 3IDYB 1KIQB 3H9SD 4NFBA 1AGBA 1UFUA 3U2SA 1YEFL 1LVEA 4HIIA 4KGJA 2H2PC 3EGSB 4UU9A 3ARSA 3QG7H 2R56L 1NFDE 1ZAGA 1PKQA 3HI1B 1IBGH 3L5XL 3RTQB 4LLMB 3O4OC 4OB5H 5E56A 2A2QT 3O11B 3P0YL 4PP1D 5J6GA 3MJGX 1BQHA 5C0IA 3ARFC 5HHMD 4PJFE 1DSFH 3AREA 4FQLL 2HVKB 4QRSA 2XZQH 1NAMA 1R3KB 1BBDH 1A6AB 2F9BT 4GRLA 2DQHH 3GSQA 3TA3C 5HDOA 5GRJL 3QISA 3OKMA 2FR4B 3BN3B 1TQCC 3CDYA 4QNPF 1IFHL 1OTTC 4WFEE 2YK1L 2X4TB 1OGTA 1K6QL 2K3TA 4JG0L 4PBVC 2VABA 3CMOL 2NPLX 6FABH 1JJUA 1F58L 3EYSH 1DZBA 1QZ1A 3L5WB 5DD0H 5BQ7B 4GAJL 3MRFB 4RWYH 4Z9KB 3GZKA 4U4BA 5F7YC 4OIIL 4P99A 4WFHD 1IT9H 5DJ8B 1XGYL 4U6HA 3C09B 5A3ID 4QYOA 1EV2E 4PTUA 1HHHB 1BZ9B 1GOGA 3EYVA 3RIAK 1KPUA 1I8IA 3S96B 3S8WA 1DBBL 4AENA 3L1OL 5IEHB 2BVOA 1HDMB 4NN6C 2IGFL 3FAXA 1IQWL 4QT5A 4N0FB 3U4EA 4QXGL 4HPYL 1WV7T 2XN9B 1DQLL 1NL0H 1TZIA 4D0BA 4XWOC 2I07A 4HUWB 4NPYA 2NW2B 1V3LA 5JOFA 3GBLA 3GMRA 4PGBB 3WUZA 2P5EE 2D7PA 1T03H 1YNTB 1DANT 4Z7NE 4HC1A 2HRPL 1MWAH 2YUWA 5F88B 3LPFA 4F80A 3D39A 5F1NA 2FO1A 3V2AR 5ALBL 2VOTA 4PLNC 1GAFH 3DX8A 3P11H 2E27L 1ZHNA 4HT1L 4NNYA 5FF6A 1JPST 3QIUA 4G9FD 4N0UA 4X4YA 4I5BB 1K5NB 1QBLL 3QHFL 4GMSH 1B9ZA 3H7LA 1NDGB 1UA6H 4GRLB 4OFKA 1IAOB 4PJDE 1ZKAA 1BJ1H 1LO2L 2MCPH 2VDNL 1XMWA 3PGCB 4BZ1L 4P2RD 4ELMF 2XA8L 2HN7B 2IH1B 1WAAE 5ESAA 5C07D 4HAFA 3DRTB 4P4KC 3HG1D 5DJ6A 4R2GC 1OVZA 4PJEA 5CEZL 4L8BB 3F7RA 4LNVA 4PJ5E 4UIKH 5EFIA 1T6VN 5ISZE 1QA9B 1MCOH 5KOVC 3VWKC 3RWIA 1T0MA 1HI6A 3L3DA 1F42A 1JN6A 2KUTA 4GJTB 4TSBH 1ZEAL 4YE4H 5HVHC 1S9VB 5I1AA 2XZCH 1RMFH 4DAGL 1D5MA 1N8ZA 1CD1A 1YMMD 2DLIA 5FCUL 2AQ2A 1DN0A 1BPVA 4Z78A 2OXGA 5KG9B 3BZEB 3LRGA 1ZGLM 3QQ9C 5C0ND 2X42A 4KDTC 3U0WL 2HJLB 3G6JE 1BBDL 5AG9A 4WI4A 3H6JA 5JW4N 1AGDA 3KLHC 5TE4L 1FL6B 3MRLB 1CF8L 3LS4H 1YECH 1YYLL 4NKOB 3UTSD 5GISL 4NJAL 3DPBA 3ZLQC 3V6OC 1F5WA 3HC3L 2QADD 12E8L 2D0GA 5DQDH 4Y5XB 2XPGA 3TBYA 2V2WB 3SGKA 4IOIA 1A22B 4F2MA 1YJDH 4XP6H 5I71C 4XH2B 3DVNB 1A2YB 2WANA 4IIQB 2F53E 2F54A 1PY9A 3QEHA 1CF8H 3NVQA 2EIBA 4W6YB 4ELKB 4OF6A 2BVQA 3LZFL 3QFJD 5DEFA 3KPPB 3GHEL 3MRKB 1LMKA 4JO4H 3TZVC 4LAJH 2VZVA 5F7MC 4H8WL 1NLDL 3OAUH 3B9VA 3GHBH 5EZOL 5DZLA 4XTRC 3ARBB 1SY6A 4DK3A 4TNWK 3V6BR 5MEPB 2C3HA 1A7QL 3DLQR 4XVJL 1QNZH 2P49B 3IU4L 5FOBB 5L2KA 3WLBA 3V8OA 4NQCB 3FT3B 1B2WH 4YWGL 4FNLL 3ULVH 2ZOKA 4JEGB 3WO4C 1JGLH 4NZJA 1PSKH 4LCYA 2LABA 3UJIL 4K71C 4KI1A 2JIXA 2OI9B 5AYUL 1XGQB 1J1XL 5DTFB 1NEUA 4N0FA 4H26A 2D9CA 1KCRL 4JY5H 3BD3A 3PL6A 2ZNWA 4J6RL 5D7IF 3G5YA 3R8BB 4CVUA 4LPTA 3GHBL 3T0EC 4ODVH 2EE6A 4LLVB 2VUOA 5DT1H 4NDMA 4OLWH 3QXUA 1DL7H 2CLVB 1CU4L 3CXHK 4IOIB 1K2DA 4K2UL 3C60B 5KG9A 4GMSL 1I1AA 4OGAD 5KS9A 2VDRL 5ITBH 1AGDB 2FX9H 2IFFL 4FQ2H 2P42B 3WUWG 3ZHLA 5C2BH 4JKKA 5FYLD 5EG6C 1MRDL 3V7AG 5CJ5A 1GZPA 1JPSL 5D7IB 3MV7D 4HS3B 4TN9A 4GAJH 1CR9L 4HZLB 3M1BA 2R9HD 3CDGB 1JRHL 2CIIB 3GB7B 4ERSH 3IDNA 3ORJA 2ARWA 5BO1L 5A16A 1DEEB 4HZAA 3F7VA 1XGTA 1HXMB 1JIBA 1BVZA 1ES0A 2D7NA 4KFZC 4ODTL 3ULVE 2CUHA 2AXGA 4P2CG 4F9LC 1AGEA 1DDHA 3D1MC 4U7MA 3UMTA 4HJGB 1U3HD 4H0HB 2HMIC 1D5XB 3GK8H 4HPYH 5GHWL 1BX2A 2CKBH 4GMTL 3M8OL 3OV6A 4XCEB 1QSFE 3SE8L 5C0RL 5J6GB 2OL3H 1N0LA 3VCLA 3EYOA 1BVLB 1MAML 5KANG 4XBGA 3F65A 4P2QB 4U0RB 2WBJC 1PYWB 5TPWL 4OJFH 4C54A 7FABH 5D7LA 2VXSL 1P53A 5E6ZA 3FN3A 1SVZA 4NNXB 5I2IA 3D3VE 4JCMA 4OZIE 3SPVB 3RUGE 4S1SH 2KQNA 4LEOA 4P9ML 1E4WH 5E03A 3ETBF 4FQ1H 5IB1A 3ARBD 2R1YB 5B3JE 4YFLI 1LO5B 3OKNA 4OTXL 4PJ5A 5SWZB 3FOMA 2W92A 3IRPX 3HC3H 4YR6B 3QCVH 4ZAKD 5HYJB 3QUYD 1DN2A 4XCNB 4NPYB 1ETZB 4Y4HC 4BA8A 1MLBA 3S36L 4LHUB 5IHBA 5BS0A 2GFBB 1MCCA 4OIBA 4PJAF 2DTSA 5AUMA 5C9JA 3TNNB 3RVVC 4I0CC 4C56A 5F1NB 1JTOA 2HP4A 1JGUL 3HZKB 4MX7B 5KVDL 5AEAA 2H8PA 3BAEL 2PYFB 3NPZB 1UM4L 3P0GB 1UH3A 3WHXB 1HQRA 1IAMA 4PJXF 2DKUA 1WZ1H 5K9JH 4RSVA 4X6BB 5A43C 1R5IB 3VGDA 3VW3H 4NWTH 4XNUL 1VKXA 3S96A 1D5BA 5F71A 3FO2A 4HIEB 1H3TA 2RGSA 4K7PY 4UQ3B 5GIRA 1Q1JL 4BQCA 3U4EB 4U1JA 4PV8A 4OQTH 1MRCH 4NHUB 2F8OA 3CNKA 2X4QB 1R0AH 4QHUA 4JFEA 1FVEB 4NQSB 2W0KA 2ZPKH 4RDQF 4X6DB 5HI3C 1BVKB 1FO0H 5D1ZD 3QO1B 4GQ9L 5DEZA 3S97C 5ICXA 1A9EB 3BUYA 4MQSB 1ZGLA 1CFQB 5I1EH 3AU1A 3CFEB 2X4NA 4LCUB 1BEYL 1S3KH 4EDWL 4OLWL 2EIEA 1JHKH 4E5XA 4MAYC 5KVGL 3LEVH 3HC0B 5DWUL 5GS1B 4Z95H 1JFQL 5I0ZA 2GJZB 1HINH 1INDH 3DX9B 5D2LE 2VLJB 2RFXA 3SCMC 5IHZB 3H9HB 3OBAA 2VE6B 1HH9A 1QRKA 3DIFA 3GM8A 3WBDA 3OKNB 1P1ZB 3P9WB 1ZLSH 1R24B 5DFTA 2ZUQC 1S7SA 1Q9KB 2VNCA 3AFLA 1OCWH 3ARDA 3QUXA 2NY0C 4XI5D 3ISWA 1S5IH 3GMPA 1CBVH 4ODTH 1M6OB 3W5NA 4A2LA 1MFCH 3VWJB 3ZKXC 5MI0B 3ZKNC 2C1OB 1G7PA 3RVUC 5IB5B 2O5ZL 4NP4L 3BZDA 1IC5H 5JOPE 5EZIH 5DJ0B 4HS8H 5T5FL 2IPUG 3HTLX 3E2HB 3P40A 4YFEA 3MROB 1ADQH 3AMKA 3BKJH 1FNFA 4EDXB 4XGZB 1F4HA 5DRXB 2BNRB 1AGEB 1DDHB 2VTFA 2AI0H 4M3KB 2Z35B 1S5IL 5EBWB 3QULB 5I1JH 1OD7A 4ALAL 4X4XA 4WU5A 4HDIB 4JFQA 4CDGC 3MOBL 2A1WH 2Z93B 2VXTL 3BZ4A 4D8PB 1HEZB 1BQLL 2R0WL 5DI8A 1FYTE 3TJHC 2UVEA 4DTGL 1A6ZA 2P4AB 3X3GL 4HS8L 2RAMA 4H25B 1BOGB 3QIBB 2VZOA 4S10A 1G0YR 2VRAA 4W4NA 2CDEA 4S1QL 1ZHBB 4QCIA 4QRPD 4RNRA 1ZHKB 2DJSA 3GIZH 4F3FB 5IVOA 4KHTL 3VFSA 5DMGD 3M07A 3VFRA 4WUKH 4P23C 1TTFA 4NRZB 2VLMD 2J6EA 2NY2D 4R4BA 3M17A 3IF1A 2UZIH 3VWJA 3EYQD 3OSKA 5L0QB 4OLUL 5DRXA 4L5FH 1QEWA 1V3MA 3D2UB 5I1GL 2BC4B 3C8KB 1QG3A 3GJEA 4NO5B 1R24A 1EAPA 2YHGA 4FQHA 1CLYH 4ELKA 5I0DA 1KB5A 4PRNB 3A0OA 4BKLA 4Y4FC 4DKAA 2XTJD 1U3JA 4YHMH 5DC0A 1KTRL 5GJSH 5D9SA 4HWBL 3V8CA 5JXAL 1FG9C 1OAXH 4ODXA 1KPVA 5MEPA 4G3YH 2JELH 3V6ZA 4MZ2A 5CEZD 5FUOL 3K3QA 4LHQB 2FYYB 2Y7QA 4G43A 1BAFH 5ANMA 5F9AC 4UDTB 5SX4I 5EN2B 4V2BA 1FNHA 2NY4D 4FABL 3PHQA 2Y07H 4ISVA 1JZ5A 5CCKL 4MAYB 3C2SA 5MP6L 2FB4L 3Q6FB 5J3HD 1JGDA 2ADFH 2AK4A 1OAKL 5J7CC 1GGIH 1QFWH 4LP5A 3KG5A 3REWA 3SCMB 1J8HD 3QQ3A 1TZHB 4PRHA 5E95B 3HZVB 4JHWH 4OFIA 2DIAA 2EDOA 1I7UB 4G8FB 2NXYB 1J87A 4WI7A 3CZFA 43C9B 1BAFL 1NGYB 1XT5A 1FRGH 2DQDL 5JHLL 1XGUB 3NGBB 3BP5B 3SDAD 4XC1L 3N1PC 4K7PX 1W72L 2ZWLT 4WDIA 4XZUB 3WFEL 2R1WB 3CLFL 1J0IA 1YN7B 2DKSA 1J0HA 3OZ9L 4MB3A 4D0BB 3EDFA 5EBGA 4FQJH 1JGEA 4RGNE 4E0RB 5HHVH 1WCBA 3MUY1 1FO0B 4G9FB 4JPWL 4RAHA 4ZSOB 5TE6H 1KIRB 1N5AB 3FQWB 4OJFL 4O02L 3P4LA 4N0CD 3LSOB 3ZDYF 4XMPH 3P4OB 3QNZA 5D6CB 2XXCB 5CD5C 1H3WM 1LO0H 1SM3H 5BVJB 1MCEA 5DJDB 3RX5A 3PQYD 4JO4L 4NQVB 4UNVA 5C6TL 4XP9L 4L4VA 1LILA 1FORH 5DFVC 4KVCH 2HAZA 1BEYH 1S3KL 3PWNB 3MJ6A 2AK1L 5FHAH 3FL7A 2QQNH 5K9QG 3Q0HA 2G75A 4FXKA 5DJYB 5IW6A 4JZNA 2FIRT 2DBLH 3I6LE 1C5CL 1UXWA 1HINL 1QSFB 4XMPL 4X99A 3MR9B 5D5MF 3MLSL 5ETUA 2NX5E 1N5AA 2PTVA 2F74B 3MV7A 3RDTB 4P57B 2XWTB 2IBGA 4J6RH 3PL6C 1AY1H 1KCVL 2GKIA 1JPGA 5I1LA 1KTDB 3MA9H 3HLAB 4P5TA 3O3DA 4DJMA 4QTIH 4PJGA 3VXPB 1WCBB 5IG7B 3MRCB 1WBYA 5IBLD 4I4WB 3RWFB 4JZOB 2AJXL 1T83A 3RI5K 3JWNC 3KLAB 3EFFA 5CUSH 2V6HA 1HHKB 1H3UA 1R6VA 4QOKE 4WGVB 5D7JB 4GXUN 1AKJA 1MJJA 5GGRY 1F4YL 3OKOA 1HN1A 2DWDB 3CK0H 3J7HA 1XCQA 4QF1A 1UWGH 5E6YA 3WNNA 2PXYC 1ZVSA 5JPMA 2BMKB 2HKHH 3S3JA 4KTDL 4HEME 1T66C 2A83B 5EU6A 1DBJL 4P2QE 4UDTA 1FFOA 2ZCLH 4YIQB 1CGVA 3C08H 1RAMA 4PB9H 4JQIH 1FGVH 4NQEB 4HJJH 4N8PA 4ZFGL 1M7DA 3GSNA 3WNKA 1P7QD 5DZNA 4ZG1A 4TTDD 3RPIA 4I3RL 5EDXA 2YRPA 3UO1L 1J7VR 5GGVH 5E2VH 1UZ6E 3RTQA 1IAKA 5C0CA 3MV9D 1MFDL 3NIFE 1EHXA 1SY6L 2DQGL 5CINH 3OKMB 5F7NC 3CVHL 1FZMB 4G6JH 2K1MA 2IADB 2F5BH 1NDMB 1W72H 3TPUA 3WFEH 4OGYL 2VLLB 5ITFA 1F90H 1NCUA 3TA3D 3W0WB 3SKNB 4MA8L 3OZ9H 5B39G 5F7UA 1IARB 5FKAA 1WFOA 1AXTH 2H3NA 4UDUB 4EUPH 1YYMH 3MXWH 4FN0A 3KPMB 1P84J 4NHCH 4TNWF 3KYNA 2ZNXA 2HFEB 1FDLH 4K8RL 8FABA 3PWUB 1VGKB 1EO8H 4MVBC 1GC1H 3RZCC 2IQAA 4EUPA 2P24B 3G5XB 1I85A 3EOTH 1JHTB 3BW9A 4NRZA 4HUXA 1KLUB 2BX5A 3JTSA 3HNTL 4K3JL 4GUPB 3MRQB 4F37F 5HI5D 1CFNA 3DUUB 4J3VA 1ORSA 3QHZL 1T0NA 2EEAA 5GZOC 2A6IA 1PKOA 4NIKB 1AXTL 4CU7A 3OJ2C 3KPNA 3MFFB 4KJYB 2BNQD 4EOWL 2YPLA 5L8LB 4FTVD 1UH2A 1ZT1A 4Q74A 1Y6MR 5B8CA 3G9AB 4LLDB 3ZT7A 3E6HB 5EIIB 5EU7E 3KYOB 5F9JA 1HKLH 2NY7H 4S0TD 5AWNL 3MRHB 2F5AH 5CEZE 1JGEB 1QLEH 2JLLA 3KPSD 4B5EA 2OMBA 1FE8L 1X5FA 3NIDF 1OF2B 1VFAA 4GRWB 7CGTA 4TVSa 1F8TL 3R0MA 2BOCA 1J0JA 2P24A 3G5XA 2EECA 1N3NA 3TZVD 5GSRB 5C92A 3OKDA 3LKOB 3OMZA 1FBIH 1M7IB 1NANH 2XY2A 1MJUL 3PNWA 5IGXH 4LLDA 1MIML 1PX4A 1W72B 2VLME 1ZS8B 1U91B 4M6AA 3SKMB 1QRNB 1KJVB 4UDUA 3DETC 3K4DA 5AZ2H 2AQ3A 3FONA 4G6KH 5F6IC 4P5TC 3BVNB 5CILH 1CFNB 1DBMH 4F15C 1AR2A 3P77A 4ODSH 1WT5A 3OJDB 4PG9A 3BW9B 3VXUE 2V2TB 2G75B 1DQLH 1NL0L 4RX4D 3SDDD 4P59H 4DQOL 5ESAB 3WIFB 4ETQB 4YC2C 4D94A 4OZFH 4RFNB 2W60A 8FABB 2ADFL 1MFNA 2J8UB 3D3VA 3CCHB 1H3XA 2ENSA 2NLJA 1H3PH 3L6FB 3BIKB 1CR9H 2CJUL 1MPAL 2V7NA 4GKSA 1AD9A 3PE9A 4D9RD 1T2QH 4UIMB 5CILL 1YC7A 3WXVH 1FRGL 4JGMA 4X7TB 5HVWA 3STZB 4AM0A 1FVEA 1UEYA 4R96A 4YHOL 4BFGA 1FCGA 5F1SA 3O3UN 4M43H 1DUZA 1MVUA 3LEYL 5TGBB 3EOBB 5EUOA 3B83A 2B0SH 3BKML 3MV8E 4PGCB 4Q9BA 2HTLC 2NW2A 4XZUA 3TP4A 1JWSB 1JF6A 5C0AE 3WS3A 2GSIA 5SWZD 4DVRL 2VISB 4LSDA 5EU6B 1QFUH 4O00A 2YS4A 4N0UE 4XNYL 4PJGE 1RK0A 4HK3J 2X7LB 3MUGB 4UIKL 1SJHA 5FDWA 3G08A 1R5VB 4PJBF 2QHRH 1FIGL 3D3VD 1NFIA 4NUJA 5TQ0L 4TUOB 3HAEG 3DVGB 4BH8A 3FQXB 1YUHB 3FB7A 3HZYB 3WLWC 3RI5F 2P5EB 3KPLA 4LASL 4GS7C 4EJ1C 3VXMB 5E1HB 1I8KB 1D6EA 4PGJA 2NLJB 1GHFH 2IQAB 2OSLB 3TWCL 1A6VH 3VG0L 4L8SC 3X3FH 4MJ2A 5JW3L 2PYEA 3AMLA 3S88H 3O6MH 3MCLH 3WIFA 1MCNA 1N6QL 1DLHB 4ZO7A 1HQ4A 2P8MA 5IB2A 1I4FB 3LS4L 4Y5YB 3ULVC 3MUZ1 1T22B 4Z76B 2AS5M 1T20B 1DVFB 4GOSA 5EC1A 3C09C 2LV4A 1IEHA 3DI2B 1XF5A 4NJ9L 4XXDB 4P57A 2BRRH 5GQBA 2DQIL 1HSBA 3BOVA 3FO0H 2C3GA 1YPZA 3LEXA 2IFGA 4KI5D 4GRWE 3NFSL 2DQUH 3GRWH 2ESVB 3LQMA 1OGAB 5C0IB 1YEKL 2O5YH 4OGYH 1KENH 3MFGB 2KL6A 1IAIL 1UGNA 3S35X 1N6VA 1YZZA 2AKRB 3KXFB 1WFNA 2GCYB 1BGXL 2L7JA 3C60D 2MWCA 2HH0L 1X5XA 2ZPKL 3QCTL 3S37X 5CEZH 2VQTA 3N9GH 4X9IA 4XAWL 5C08B 3QUZB 1ZLWK 3RAJL 2ESVE 1ZXQA 4Y19E 5F3HB 3QEGL 3VA2C 3HUJA 4WEUD 3P3YA 4TUOA 1RJLB 1NC4A 3U4BL 1I3RA 2CIKB 4AJ0A 5FGRA 2HJFB 3CLFH 2FEEL 2XTJE 3BQUB 5D7IE 5E6IB 1TNNA 2FX7H 3HZVA 4IMLB 5HHXL 4P5KB 3GSRB 2YEZB 2VDLL 4QY8B 5D7JC 5A2FA 3FTGB 4N8VB 3IDMA 2CRMA 3H7BB 2DF3A 4M9OA 2OMNA 4GBXB 4UT6H 1OCWL 1WBZA 1X6LA 4L8CA 5DK0A 5DMIH 1Q9WA 3O9WD 5TE4H 3ZSSA 4QOKA 4WHYH 1XR8B 4WJ5A 3DO7B 5EWIH 3IDGA 3BP5A 3OKLA 4P4KB 2CQVA 3EDKA 1VFUA 3WNOA 4CADA 3BP6A 3QJFA 3MA7B 2HT4C 4R2GB 3WDIA 4Y5VA 1F90L 2P1YA 4LCWB 1RZ8B 4GRMA 5E5MB 5C6TH 1Q0XL 1OQOA 2GFBA 2DJUA 4G42B 4ZFOL 1CIUA 3CVHB 5IV2A 3MXWL 1L0XA 2IANE 3KXFD 4Y2DD 4AL8H 5J06A 3V4UL 4G6MH 3O2VH 4YXHL 5JOPD 5IMMA 2VLLA 1TPXB 2BSTB 2IADA 3MV7E 4QTHB 3VD3A 3UTZB 4F7EB 2DLGA 4LSPH 3H3PH 1KB5L 3ZL4H 4M61B 2LAAA 3U0PB 3V7AE 3VXRB 2R1YA 5C71A 4Y4HD 3JTTA 1UJTA 4NN7B 5JA9A 5B4MC 1TVHA 4UOJA 2C5DC 3DTXA 1LEGA 4X98B 1UQSB 4EI5D 3HCVB 3IDJB 4XNQB 5HYJE 5T3XE 3SBWA 4UNTA 1C8PA 2OP4H 3CXDL 3VXSE 3UBXI 1EFXA 3O2VL 5EU7C 4L3CA 1V7NH 3S6CA 3VFVB 2MPAL 5GS0H 1KB5B 4Z7OE 4GKZB 5LXGH 5B3JF 5L88L 4I0PB 2CPCA 4R26H 3BXNA 3LN5B 3B3IB 5IW3A 5DMGC 4F7CB 2IMMA 2R0ZH 5LQBL 3PP4H 2BCKA 3VXOB 1P7KB 4LSSH 4EXKA 2GTWA 4NCDA 3CX5J 4UQ3A 1F4YH 2Q8AH 5AAMA 1F6FB 3L3JB 3QA3B 1D5BB 3VI3E 3QEUB 5GRWA 1U8MA 4NCC2 5I1AB 3F58H 1GVIA 2JF1A 1KUMA 1UKTA 1QYGH 3HPLB 3FT4A 3LH2H 3MOAL 4TULL 5IHUL 3UYRL 1WIOA 1T2JA 1JCKA 1JGVH 1SJXA 5BVPH 4PJXE 2C1PB 2ADJB 4P2RE 4ZTOL 4Q9RH 1RUPL 4WRLA 3DBXB 5E2WH 3ZSTA 4LARL 5LG1A 5IIEB 5IVXA 4Y2DB 5CZKA 2X4SB 3UO1H 2ZSVA 4X98A 3R06A 3N9GL 4HIHA 2B1HL 3D39E 3RWJB 1OARH 1JGDB 3L3GB 3OG4B 3RWHA 5CZXD 4KXZI 3WIIL 5FO9A 1GGCH 2BK8A 4OFVA 2ERJB 4OM1L 3RTQD 3L5IA 3HMWL 4MYWB 3N06B 4DUVA 3TCLB 1JZ2A 1MLCB 4PYGA 3QUKB 4TQEL 2FO4A 3SE3C 4JY4A 5D71H 1GOHA 1A3RL 1HIML 2BERA 1W0VA 4PB0L 2VLKD 1BREA 5L8JB 1ZA6B 1U95B 5E08L 1DBBH 4NQXB 4YAQA 2R2HB 4YUEH 1IMHC 4R0LC 1PW3A 2YA1A 4LIQL 3PF2A 2G5RA 3QNYA 4M43L 1QSEE 4HKXB 1ZHLA 1YNTA 5AZEL 3LEVL 4X7SH 4X8JA 3MRGB 2VXUL 4U1GB 4GAGL 3QAZC 4ZPVB 1P4IH 1E28B 4OM1H 4OZHF 5JNYA 4O5LH 4PRPE 3SE3A 5I8CA 5ITFB 3VWKA 1RJYA 4BZ2L 5CEYA 3U36B 4M5YH 2ORBH 1JF5A 1ADQA 3LKSA 2NZIA 4YBQD 3VFSB 4NYLB 3UJTH 3CGTA 4F3FA 4W68A 2DAVA 4M7JH 1QLRA 2VLJE 3EYVB 4U0RC 2UY7A 3U83A 1S7UB 4LIQH 3VFOA 1NMBH 2NX5D 5M94B 4QYOB 4EZMA 3CSPA 5AZEH 3WIHH 4WU7B 3V0VA 1KB9J 3BEVA 3VW3L 5C09E 3CIQA 2V17H 2IEPA 2AK1H 4XP4L 4YIQA 5DK2A 2V9TA 2FBJH 2LU4A 4MA3A 2YMXH 4WI2A 4QNPE 1EDQA 4Y88A 3FHAA 3OJVC 4NDMB 1DN0B 1R3JA 3QUML 1IBGL 1TCRB 3BWAA 3KGRA 5DMKA 3PGFH 5F97E 4OZIB 4PJCA 1BFOB 1T03L 2DWDA 5FYKE 5IG7A 2NY4B 5I8OL 4KVNH 1F3JB 4KMLB 4C58B 4WWKA 5TJWK 1X5IA 4XXCA 5T33L 2P47B 5BRZD 4G43B 3RWCB 2ZUVA 1A7RH 4JQVA 1RZ7H 4HCRL 3MJ7A 4NOFA 1LO3H 4E41B 1OTSD 1KYOK 2Y5EA 1KCKA 2EC9T 4U3XA 2P8PB 4ACPA 5J13C 3L9RB 1G1CA 4PG2C 1RZJL 1FH5H 4L8DA 4LKCA 4U1NB 1QYGL 4HHAB 4F7TA 4WWKB 1HNGA 1YEGH 5C8JB 1UM5H 2X4OB 2GK0B 3FCTA 1J11A 3MRMA 3TEUA 1W8OA 4R4BB 4PJIE 3DECA 3RZWA 2IAMC 5JDJA 3JV0A 5T3ZH 3X11B 4CAGA 5IB2B 3TGXA 1CD0A 1OAQL 2NYYC 3LQAH 4NQED 4D9LH 3DX8B 2Y9RT 3O0RH 2WUCL 3DYPA 3MV9A 5E8PA 3CSYA 3Q48A 3P4OA 3QNZB 5I9QC 4LQFL 4H25A 4X6CF 1WWWX 3ARQA 4FQXB 4G6FD 1KF9B 3IS1X 3CXDH 2FL5B 5T1KA 4LDEB 3MODL 3IKCB 3JWDC 3ARTA 3PGDA 2WZPD 2QKIB 1D7FA 3RL1B 1VADB 5LGHH 2AV1A 4RGMB 2OL3B 4U1SB 5F3BB 4JFDB 1FPTH 1RZIA 4NT6B 4AT6B 4PY8I 2BSED 2A1WL 3QCUH 2QHRL 5JHDB 5ICZA 5ISZA 1S9VA 2P5WD 5JIHA 3JXAA 2IANB 1CLCA 4OD2A 3QXDA 3RIFK 2AEPH 1KN2H 4JPIA 3LB6D 4O4YH 1INEH 3ECBA 4F9LA 1TTUA 5C2UB 3VWJC 1NCNA 3QDGB 4GBXC 5TF0A 2NW3A 3ZKMC 2F58H 4DZBA 1K9TA 3RDTD 3OB0K 4OKVA 2JJTC 4RZCB 1P4BL 2QV2A 3LKNA 3TO4A 1AGFB 1FVDA 3SE4C 1T1ZA 4HH9A 2YPVL 4BJLA 4OCWH 5L7XL 4IJ3C 4XWOD 3U82B 4PJIA 3JVGC 3NN8B 1E27B 4PJ7E 3WKML 3PV7A 5JXED 2BSSA 3PWPB 4NJ9H 4KQ4H 5F7KC 3TNMA 3BVNA 3WN5C 2FCBA 1UWXH 4U1IB 1AXIB 3ZMRA 5GZOD 3PWLA 2HVKA 1H8OA 4GT7A 4OLYL 5L88H 1LEGB 1RIHH 5L8KB 2XPGB 1P4BH 3ZE1E 4LEXH 1FFPB 5DUPH 3GBMH 4ORGB 1I7ZA 1G6RA 1NCDL 3QIWB 5IJVA 2QL1A 3MGAA 4UU9B 2OK0H 2H1PL 4OLZH 5MHSD 4O51B 3PWJB 5D2LA 1TENA 3CFIC 1GCFA 1QO3A 5DD3L 4A6YA 4MXWL 1QFPA 4I18C 2E7HA 4U6VH 5JIPA 4OD2B 2DIJA 4K2UH 1P69B 2AV1B 1SYSA 3C6LA 5SV4A 4MGXA 1WBXA 4X9GA 2H6PA 1EEYB 3FJTA 3VGEA 2CUMA 3UC0L 4XBEH 2IANA 4XCFH 1HKFA 4R8WH 2H8PB 1JRHH 2X70A 1DQTA 3IFNL 4L4JA 4LLUB 3T3ME 1K3ZA 3EOAA 3UTSE 3MZTA 4P46D 5F3HA 3QO0A 4OLXH 4D8PA 1A5FL 3QUMB 3O6LH 4IRSC 3L3IA 5MEQB 1BJ1J 4EDWH 2VR4A 3QIBA 1OAQH 1UWXK 5K9OA 3INUL 2YK1H 3W9DB 4NBYB 1CTOA 3OAUL 4M7ZB 5EO1A 2OJEB 2XG5A 3CXHJ 3G5YB 3P30L 4QRPB 2Y36H 3WKNA 1GGUA 3GSOA 5FK9A 2QSVA 1DBKH 1DUYB 3TC9A 5FEBA 5IMLB 3QG6A 2MHAB 4NO2A 4PJFA 5F7HA 2OQJA 1LDSA 3V79C 3FFDA 2JK5A 3BGMA 1BJMA 1J1OL 4IRSA 2VR5A 4JDTL 1QFWI 1A21A 3VGGA 4KKBD 3VGBA 2EDNA 2Q86A 4ELMA 5BCAA 4LCWA 4MVBD 2F19L 2Z31C 4D0CB 4MJIA 4PB9L 1LO3L 4XBGB 5HVGB 1RJZA 3U46B 5IWLC 2VXVH 3C8DA 3BKJL 4RFOL 3TN0B 3LMJL 1NAML 1I8KA 1YPZB 4P46A 4U1HB 3ULUL 4GKOA 4I2XB 4O2FB 1D6VL 3QUXB 3QDJB 3O3BB 1H8SA 1MSPA 4P2OD 1G6VK 4KKNA 4AEFA 1FIGH 3QSKB 5JO5B 1K5NA 1YY8B 3C5SB 5F1OB 1Z9MA 2DYPD 3N1QC 5F8RC 5TDPB 1AJ7L 3DI3B 3W39A 5FUOH 4U1GC 4DFIA 5TE7H 4XP5H 3T4YA 5C9KA 4YXKL 1I8LC 4JFFD 4R4FL 3KPRE 4DTGH 4Y8DC 3UYPA 3MRNA 2R23B 1HK6A 2BHYA 1MAKA 4LK4A 2D7MA 3RVVD 3V6FA 5CZVH 2CR3A 4F58H 4CW1A 2W07A 4NUGH 4CVXB 1Q0YH 4XNXL 4RAUA 1M71B 2E7LC 3GBML 3TBSA 1SJEA 1S9WB 1R5IA 4QKXB 4YXKH 3LKSB 5EA0L 5D70H 4KJQC 5JHLH 4MZ3A 4OSUH 3HZKA 1N4XH 2R69H 1V7MH 3TN0A 2D7OA 4NKDA 3V5KA 1QVOA 4NWUL 3UZVB 3ES6A 5FGBA 3WHXA 4GH7B 5DJYA 4RGNB 3QRGH 1IKNC 3SDCA 3WS6A 2RR3A 5HVFB 3ZYZA 2W60B 5A2IH 4PRHE 2GSGB 5F6HI 3NZHH 3R1GH 5IB3A 4Z0BL 1EAJA 2FGWL 2NY5C 3MV7B 3QH3B 3GO1H 4XC3H 1N59B 3U6RA 5FUZL 1X6NA 1YMHB 1OSZA 4AIZA 1KBGL 3NACL 2WUCH 4JRYD 1UVQB 3FAWA 3MNZA 1YNKH 4NJAH 2LAGB 2YXMA 3O3EB 5IW6B 4Z7WA 5E8EB 2NY0D 1XGPA 5E4IA 3UZEA 1MAJA 1MLCA 2GITB 2YZ8A 1ACYH 5EBLB 1VACA 2FJHB 5ADOL 5CAYB 4J3TA 1EEUA 3DX7A 1SMOA 2A6JB 4NZUL 2D0FA 1PKQB 4P4KD 3WFHB 2FZ3B 1CL7I 5CBEB 5FYJD 5D2NB 4BSVA 1T04A 1I9IH 2EKJA 1RIVL 1M1SA 1OB1B 2R29H 1I85C 3MPCA 3WHE0 1UB5A 1JV5A 1KPRB 5J11C 1A1OA 2KBGA 4ZAKC 4LRIA 4P2YA 4TRPH 3UTSA 1S7RA 3DROA 2JKXA 2XKSA 4XHJD 4Q6IC 2CDGA 2Z8WC 1YMMB 3FMGH 1OW0C 2V5SA 3LRSA 4H8WH 2QSTA 1RJCA 1LE5B 3IJHA 4M6OH 4JO1L 5JUEH 1ZTXH 1RUQL 3X3GH 2O61A 1K4CA 2XWJA 2WBWB 2HKFH 1JYVA 2JJSA 4RGMC 3T2PA 3UDWA 3WLWD 3B6SB 5DJAA 4OCWL 5L7XH 1P7HL 4OF0A 2W9LA 3QI9B 4GFTB 4DW2L 1S5HB 5FM4A 1DQQB 3L5WA 5DO2C 5D2NA 4BSVB 5BQ7A 4X0KB 1KJ3H 2X2YA 4RAVB 5IJVB 5EPMA 3RKDD 4P23D 4DZ8A 4XB8A 4ETQA 5IM7B 1B6UA 2AJ3B 3I84A 1IILE 1P2CA 1CTNA 3T0VA 1RUKH 2AV7A 4OI9A 2VDQL 2VDPL 3JV6B 4OLYH 3TVMA 1U8OA 4HF5H 4XCCL 2N1KA 4HCRA 4OM0H 4PRNA 1MVFA 4YDJA 5T5NG 1HWHB 1XF3B 2CK0L 5LAXA 3OGCA 1FZMA 3A6CH 4EUPB 1CI5A 1AO7E 5D7KD 4CU6A 1CL7L 2OR9L 5MERA 1U8LB 3MLYH 5BRZB 1NSNH 2NMSA 3UROR 4HIJB 4EBQL 3VMOA 5FO7B 3HAEA 4FMFA 1OF2A 3VMPA 1U8IB 4JFHE 2I9LA 1CDCA 3HE6C 4OF3A 1GGIL 4PLJD 3O4LB 4CADB 4AYFA 2OJZH 4DCQA 5F9JB 4GRWF 1CDIA 5D1QD 1P6AB 3I50L 4N5EC 4G7VL 3ARRA 4Y5XA 5BXFB 1X4ZA 4PRAB 1JUFB 3NBNA 4PJ9B 2EIDA 2A6IB 4QY8A 2H9GA 4ORZC 1FNGB 1QLFB 3D0VB 1CGTA 3INUH 2I25N 4XVUC 4IMLA 3WJLC 2EYTA 1Y0LA 2O5ZH 2AXHA 4NP4H 4X4ME 2FL5A 1JHLL 1ONQA 1IC7L 1YEEH 3HC4H 4FQXA 4M93B 4M1CD 5HHVL 1GSMA 4NFCA 3QPXH 5DEGB 5J1TC 2RJMA 3MRRB 4IRJA 2JJVA 1C5CH 4UB0H 2XWBA 4OQTA 4FZ8H 3REVB 4ETYA 2EKSB 4P3CL 2O93L 2GUOB 3IAGC 3V0AC 5INDA 4N8CL 2E7LA 2HLAB 5L2JB 2C1OA 4ODBD 4Y4KD 4ZUWA 2VL5B 4DKEL 3GJFA 4MHHG 2ATKA 1A1MB 4Z5RA 4PJ9D 3ZTJH 5TFSH 3OAZH 5FIEA 3F6IA 4ALAH 4M7ZC 2VDOH 5B3NA 4C4KO 1CGYA 4F7CA 4Q6IB 1RIUL 1OB1A 4XGZA 4O9HH 3FB8B 3H42L 3DRQB 1UM4H 1G7JA 5FUCC 3BXNB 4D0DB 3HC4L 4I0PD 3RVTD 4RBPK 3QEQD 5DRZA 2FZ3A 3VFPB 1FORL 5I6XC 4M6NL 1KC5H 4GG6A 1JZ7A 5HY9B 2BZDA 1I3GL 2FJFB 1CGWA 1CT8B 4NO0A 1S7XB 1J0YA 1HYRC 3EAKA 3WUWB 4ONOA 3TT3L 1BFVL 3PGCA 4RA0C 3W9EA 3EDJA 3OB0H 1EEQA 3QXAB 3DRTA 3MLRL 2F54E 1L7TL 1VB9A 3GJFB 4X6EB 5SWSE 1NGZB 1IKFL 1FSKB 2FJGB 3EUUA 4PJIB 4YXLH 1RULL 5IHZA 3DMMB 4QHUB 2I24N 4KZEH 2X7LA 1EGJA 4JPVH 1WLHA 5C0BE 1G6RL 5E70A 1I1FA 3O2DL 1T1YB 3E2HC 3UJIH 4PREA 4WO4B 1BIHA 5E2TH 1N7ML 3I9GH 3KLAA 3QCTH 2XZCL 3RNKA 1JPTH 1MEXH 4LSRH 1AHWB 3K1KC 5FCUH 1NCAH 4MQ7A 4CL7A 4HAGA 1NUDA 1HYSC 2DDQL 3IFNH 3VXPA 3O3DB 4NN5B 1YA5A 2OR9H 2YD2A 4XPHL 1T7XA 2APVA 2BNQA 5E00B 1FL3B 1WQVT 4KZEL 2DS4A 1MIMH 3VFUA 4JZJC 1OTSC 2Y06H 1NBZB 3RX8A 3LKQA 5I1HH 4PP2B 1MHEB 1B88A 3KYKL 4PJHA 1R3IH 2Y72A 5EC2A 3T0WA 1Q9OA 1T4KA 3BKMH 3I9GL 4MS8C 1KLGB 1E28A 4ERSL 5ENWB 4RRPG 1IC5L 2CLRB 2DICA 3U79A 5T1KB 3V6FB 4KHXL 3Q6GL 4PTUB 3UPRA 3EJZC 1JNNL 4G7VH 2DLEA 5JLZB 4LSTH 1NUGA 3HE6A 5DURB 5FUZH 1YDPA 1F3RB 3U9UB 2AABL 1FYHB 1WAAA 3GKWH 2Y06L 3I3BA 4LEOB 5LGJB 4JFPB 1CD8A 4PREB 4GW1A 1S7VB 3KR3L 4EUPG 1MAMH 3BDBA 4MJ6B 3WV0A 5A40E 3IU3A 4OZFA 2UWEF 5SWZA 4OGXL 2FECI 1MHCA 2GK2A 1Q94A 4LLYA 5E8DL 3X12A 4HG4K 2Y1VA 1RZGB 4G8GB 1TDQA 3LQZB 4MWFB 3MRBA 5H2BB 4HUUB 2FEEI 5B39A 5JQHC 4YHZH 3QUYA 1G7MA 2CK0H 4KU1A 4IOSD 1U9KA 4MCZA 2PKDA 3A6CL 4NNXA 3MGTB 5E8OA 3S5LA 2FHFA 4ZUTA 1HH6A 4ZNCD 4NKMB 4ZQKA 2DIBA 1S9KC 5GGSY 3WSQH 1K8DB 4HFUL 1U8JA 3HI6L 1EPFA 1WUNT 4LGPB 4A6YL 3ARGC 4RFEB 2BY2A 2IQ9L 5IFJB 3NABL 3KYOA 3JWDL 1Z2KA 5ACZA 5C0GB 1A1NA 1D3CA 4BQ6A 4NZRL 4K23L 1CXHA 3NFNA 1ZA3B 2YWYA 2Q76B 3PJSB 1IGFL 5EH1A 2VWEE 3TJEL 5EBMA 5HD8C 4UV4H 2ZUYA 2DQCL 3HAEH 1OAKH 2GTZA 1IGCH 4D2NA 1G6RH 2OTUA 4GUPA 4GMTH 2AJSH 3D25B 4JHAL 4LF3B 1CQYA 1II4E 3QWRD 3RFZC 3HR5B 5FO8B 3M45A 4JRYB 3JWDH 1U8HB 2IPUK 4V1DE 1CL7H 3NCBB 5DMIL 3TN0D 3U7YH 4E41E 4JFFE 5KVEH 4YDIH 4PGEB 2RBLA 3FRUA 3KPSB 5JW4M 1EZVX 2Q20A 4RQQA 5HHQA 2YD4A 3QIBD 4EDXA 4YBHA 2VERN 1BWMA 1WTGT 4N0YL 2YMXL 4UT9L 1AFVL 4F7PA 2VITA 1J5OH 1QKZL 1L6XA 4J1UB 5GGQH 3IAQA 4IHOB 3VGFA 4U05A 4Z77B 2IH3B 1KTKE 4F2MB 2J4WL 3ULUF 3HC0A 3TESA 1NMCB 1RZKH 3O45B 1K4DA 4P2RA 4ZXBC 4ZS6D 5HHNA 1G7HA 1FZKA 3TIDB 2R1XA 3CFEA 1A7OL 5IEKA 3B9KD 1JWUB 3U7WL 2ARJA 5GISH 4HPOH 5DEFB 5MEOB 4AMKH 4DN3L 1NFDB 1U92A 4OCMC