3PX0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and dctp-da mismatch (tautomer) in closed conformation
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
579
structure length
557
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 190
structure length 557
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px0A01
3MR2A 5KTQA 5KT6A 1EETA 1UT5A 1O1WA 1RXVA 2HB5A 1QTMA 4YP3A 4DEZA 4CEFA 4PY5A 2ITGA 3OSPA 1BIZA 2BGGA 2VANA 1QSLA 1SL2A 1S9FA 1IKXA 4KLDA 4CJKA 5IIKA 2XY5A 4ECTA 5EWFA 1YTAA 3G6XA 8ICBA 3OYNA 1NKEA 9ICGA 4RQ0A 4QZFA 4IBNA 5J0QA 4YG2A 3H4BA 4KN4A 4R66A 4QZBA 1ZQYA 4CEAA 5J0YA 4I2CA 1VSLA 4KHYA 3DMJA 4J9SA 4E7JA 4CJ3A 1EXQA 2EHGA 3CFRA 4QZEA 5JS2A 1ZJMA 4M47A 3KTQA 5T7BA 9ICWA 4FO6A 1BQNA 2D0BA 1T7PA 4P4PA 4IFVA 3HP9A 4E89A 2YKNA 3G0ZA 4KB0A 4QOZB 3ISBA 4IQWA 4E3SA 4I2EA 3AU6A 4O3RA 4N56A 4GC6A 1T3NA 3RJHA 3VQAA 3L2RA 3UQ0A 4DSLA 1K6YA 3QETA 2R8IA 2IBKA 9ICJA 1EKEA 4GMJB 1TKXA 3CG7A 4HHTA 3PMNA 1SKRA 4F4KA 3LDSA 3C6UA 4CFBA 2MAXA 4KFBA 2HNZA 8ICAA 4CIGA 4TUPA 3MXIA 4PWDA 5D4BA 1VSKA 3OYJA 1VSMA 5D46A 3QINA 4DOBA 2W9MA 2B21A 1RT2A 3ZDCA 1BISA 1LAWA 3VQ5A 4QCLA 4O3QA 4CHQA 2NUBA 4O4GA 5HMMA 3OHAA 1ZQOA 4QWAA 4NLZA 1RTIA 2YNHA 4JS5A 3ZSVA 3MBYA 3JPOA 4YXJA 4RT2A 3DLGA 4H4MA 2RF2A 4ELVA 1TAUA 3BQ0A 2BPCA 2F8SA 4H4OA 3Q8QB 4DQIA 4IRDA 1MU2A 4LSNA 3PW0A 4R8UB 4ELUA 4LZGA 3HXMA 4KKOA 5HNKA 4DTRA 4MFAA 4J9LA 5CYQA 5DB8A 4QWBA 4Z4HA 4BDYA 1QSSA 3OYKA 2BQRA 1S6PA 3ALYA 4NM1A 2HNDA 3MABA 3MEEA 4PGQA 4AHTA 4M9GA 5J2KA 3PV8A 1VSDA 3V9ZA 4DMNA 4ID1A 1K1QA 5IIJA 3MGHA 2X74A 5KFHA 3KD5E 2F1HA 1RILA 2W8LA 4CJQA 2IHNA 2WTFA 4O0IA 3LAMA 3TAFA 4KLLA 3SI6A 3TAEA 1CLQA 1ZQBA 1RBUA 4DOCA 4M3WA 2ASDA 5KFVA 4F4WA 1KSPA 1KVAA 2QXFA 4B9SA 1WSGA 4EZ6A 4UBBA 5IIIA 1MQ2A 3BQ2A 5KFRA 3BJYA 4M2YA 5DQHA 3VQ7A 2OPPA 4YMOA 4KI6A 2XRIA 3C2KA 3ZT1A 2G8IA 1ZQGA 3SQ1A 2AGPA 4XRHA 4PUOA 2A1JB 2P5GA 1JLFA 3IRXA 1ZETA 4Z6DA 2HHUA 3RAXA 9ICUA 2XY6A 3LK9A 1A5WA 4BACA 4KV8A 5KG2A 2NRXA 4LY7A 5CZ2A 3O3HA 4MF2A 9ICOA 4FJJA 4YCXA 1B22A 4R65A 4ECQA 1I3AA 2O4GA 2G8FA 4YFKA 1VSJA 2ETJA 5J2HA 3MGIA 1NOMA 4CFAA 5KFWA 5D3GA 4DU1A 2J6UA 1A76A 3IS9A 4QWDA 4FM1A 2FMQA 3QERA 3RB6A 4J9MA 1D9DA 2FBTA 4QZDA 3HO1A 4F2SA 4GVMA 3QEBZ 1ZQVA 4NLNA 1RDCA 2FBVA 4Q45A 3AU2A 4Q44A 3DI6A 1XI1A 4CFDA 5KG5A 2NRZA 3OYIA 4MEYA 1TL1A 4KLSA 1TKZA 3KLIA 4QZAA 1S1VA 8ICWA 3TWHA 1VRUA 5KFSA 5BOMA 5DKWA 4LH4A 4CJSA 4XIUA 3OYDA 2J6SA 2BPFA 1RT1A 5J2JA 3ZSWA 3GV8B 3QE9Y 1T8EA 3M9NB 1T05A 3AO5A 4CEBA 4JRQA 1XC9A 3LP1A 5EWEA 1ZQQA 2XCPA 2ZQBA 2EX3A 4RUCA 1QLNA 5DGBA 3GIIA 4BGDA 3JPPA 4KHWA 1AROP 7ICPA 3S3NA 1BI4A 2Q3SA 2ASLA 4DTJA 5L1IA 4DL4A 2HNYA 2P5OA 3SYZA 2VA8A 4FJ8A 1EXNA 5J0PA 4KB1A 5KT4A 1HQEA 2I5JA 2LSNA 4FLXA 4DL6A 4OGEA 1VRTA 4QWCA 1Z3EB 3G10A 4IQUA 2ZJ5A 3K5OA 1LB2B 4JLHA 4OVLA 4Q0BA 7ICFA 1RDDA 1WCLA 5CZ1A 4M45A 4F91B 1F21A 1FKPA 4DTXA 1NJXA 5KFOA 3QIPA 5K14A 3RMDA 2B4JA 1W9HA 5CB1A 3I8DA 3GIKA 2DPJA 3VA3A 3CM6A 5KFGA 2BGWA 1WSFA 3V6KA 5HRNA 3NAEA 2RN2A 4RW6A 3VQ4A 4N47A 3NBPA 1LWCA 3CFPA 3MDCA 1X1PA 1RTDA 4I27A 3LPUA 3TQ1A 4Q8FA 1DLOA 5KG0A 4FJGA 5FRMA 4M3ZA 4FBTA 5IINA 2DFFA 3V6HA 4HUFA 1NK0A 4I2QA 4F4ZA 5J1EA 5L9XA 1NJZA 4F3OA 9ICAA 2IAJA 8ICXA 4M9JA 2BQUA 4H8KA 1I39A 2DFLA 3AVIA 4RQ2A 2G8VA 3AVAA 7ICIA 1NK5A 5J29A 4CHYA 1BVSA 7ICJA 9ICNA 4B9TA 3KJVA 3GIJA 4P2HA 3MDAA 2MUTB 3T5JA 4Y1CA 4IR9A 5SWMA 3HYFA 3LDAA 4FLVA 3M8RA 4DFMA 8ICHA 4M3YA 2XY8A 3K5LA 2RDIA 7ICTA 5C25A 4DQPA 3QEPA 8ICQA 4KHQA 3V4IA 4EP5A 3NE6A 4LZDA 1YVUA 2HHVA 3EZ5A 3ZT0A 3DRPA 3RB4A 2M9NA 3PX0A 1RDAA 3VA0A 1K1SA 3MAQA 5EU7A 1WN7A 2IA6A 3TFSA 2FMPA 3DOLA 1VSFA 1L3VA 3V9SA 4M3UA 4W5NA 4DSEA 3P83D 1S77D 3LP3A 3CM5A 2W42A 1HPZA 1QE1A 4CF1A 4DTMA 2IC3A 3NDKA 5KG6A 3RH5A 4KO0A 4CHZA 1BHLA 1A5XA 2DPIA 3D0PA 4I2JA 4CJTA 3RTVA 3VQCA 4FW2A 3L2WA 7ICVA 8ICYA 1S1WA 2P1JA 3CQ8A 3PW2A 5J2FA 3QIOA 3MXJA 3H7IA 3AUOA 4BWMA 3NH1A 2C28A 1IKVA 3RWUA 3RR8A 5J0OA 3DLHA 4ED8A 3WNEA 3RRHA 3N97B 4PHEA 3AVHA 3OJSA 8ICCA 4M3RA 3SNNA 4KHNA 2X78A 8ICRA 4FJ7A 2DFHA 4PA1A 1RNHA 1RTHA 2P6UA 2KQ2A 5BOLA 2V4RA 4KN7A 5CR0A 5HRPA 2MUTA 5HRRA 1C1BA 4FVMA 5J2BA 1RBVA 1XS9D 1L3SA 3C1YA 1ITGA 2UVUA 3V7KA 3RR7A 3NFAA 4Z6CA 3TABA 4TUSA 1KTQA 9ICXA 3V1OA 3V7LA 4RNNA 3SCXA 4DF8A 4E7LA 3O3FA 3VQDA 4RQ4A 4RQ8A 5KFIA 4W5RA 5FRNA 1HJPA 3AVCA 3MEDA 5KI6A 3C21A 2HVHA 3ISCA 1ZQMA 2OZMA 1N6QA 2PZSA 3B0YA 5FROA 1NK7A 4FJKA 4IR1A 4I2PA 4BXOB 2QKKA 4Z6EA 1JXEA 2VG7A 4TQRA 4MEXA 4IG0A 3H08A 1X9MA 2PI5A 7ICRA 1SUQA 4IQTA 2FBYA 2YHAA 4F92B 4N41A 4ELTA 3C2LA 3AA2A 4R5PA 5I3UA 1U48A 4FJMA 3DRRA 4EP4A 4HTUA 1BCMA 3E01A 4NCGA 5DBCA 4FJ5A 1ZQSA 1KVCA 5C42A 4I2AA 4DG1A 3B6OA 5HHIA 1TVRA 1N5YA 3HVRA 1KVBA 4AHVA 4BDZA 1ZQEA 4JK1A 2KZZA 3SZ2A 4ECXA 4RQ5A 1UA1A 1C7YA 1V9PA 2OPRA 3S3MA 4DLEA 1J54A 2JGUA 4RNMA 1ASUA 3H8WA 4RQ3A 3UXNA 4CEQA 1MSWD 2D0AA 3S9HA 1RT7A 3LPTA 4FZYA 3DOKA 4F93B 3ZDDA 4QZHA 5J0XA 2D5RA 3L8BA 3V9UA 2ZTEA 2W9CB 1RT3A 3ULDA 3NH0A 4K8XA 1JL2A 3RH6A 2ZUCA 5HROA 1Q9YA 1JLCA 4DSKA 2IOCA 3MR5A 3ZT4A 2FLNA 3K5NA 5SZTA 4F3TA 3ZSZA 4GXKA 4Z0UA 4HUEA 4HVJA 4IRKA 4OKKA 5J0WA 4KLMA 3RRGA 3AVLA 4OKJA 5J2CA 1L5UA 1C1AA 3EW9A 2HVIA 4J2BA 3GFKB 2BCUA 4DSIA 4TURA 1SZPA 4ED1A 3KHRA 4Y1DA 3FDSA 2P66A 3KK3A 2JLEA 4BXOA 2ZD1A 3DRSA 5IIMA 3LZJA 8ICJA 3EY1A 2R8GA 1ZQXA 4FS1A 3NGDA 2KZMA 3WNHA 4RW9A 2YV0X 9ICVA 4P4MA 1TKDA 4Q43A 4KITB 1UWBA 1JXBA 1QSYA 3F9KA 5DQIA 2PYLA 5I42A 1XO1A 4YNQA 4F5NA 1SL1A 1RBTA 1BPXA 4F5PA 8ICOA 4OPKA 4CJFA 5J2AA 3M8PA 1RCHA 3HP6A 2Z1HA 2FPMA 4ECUA 4E7KA 1J5OA 3SQ4A 2PYJA 2KFZA 4CCHA 4FJNA 7ICOA 4O5CA 3C2MA 1S0OA 4OKEA 4I28A 3AVNA 4YD1A 3KKSA 4E1NA 3HT3A 3PY8A 2F1JA 4FXDA 3Q8RB 3M9OB 4CESA 1BPBA 4MFCA 3JPSA 3WNGA 1XHZA 2W9CA 5KFEA 4AH9A 5KT7A 3RJIA 5KFDA 4RW7A 3K57A 3RH4A 3VQ6A 5L1LA 1HUZA 5DG8A 2WONA 4CF0A 5DBAA 4IKFA 4LD0A 4M3TA 8ICMA 3V81A 4JV1A 4KTQA 1KRPA 2F96A 3K4GA 2OZSA 5DLFA 1ZQPA 3AVBA 2JZBB 5KT2A 3EYZA 3LAKA 1CXUA 1BI4B 3U6FA 1B9FA 2HHWA 1MQ3A 5J2DA 1LWEA 5KRSA 2G8KA 7ICQA 4DSFA 1S9EA 3KK2A 1ZQJA 5KFPA 1JLGA 1FK9A 1COOA 1VSHA 4CK3A 4F5QA 4YR3A 2C2EA 4UBCA 1LWFA 1ZQFA 3HL8A 8ICTA 3BGRA 4NCAA 2W9BB 5KFCA 1BGXT 4RU9A 4IFYA 7ICNA 4QZ8A 1WNSA 4KLGA 5J2PA 5F9LA 2E6LA 4JWNA 4DWIA 2ZTDA 1UA0A 4DL5A 4B9MA 1X9WA 3T5LA 4DTOA 1IKYA 1CZ9A 1VK0A 1JIHA 1S0NA 1RPLA 4RQ7A 1HYSA 4QZIA 4CHPA 1ZQLA 4J9RA 3A2FA 4G1QA 3SQ2A 1TL3A 3VQ9A 4AHUA 3CFOA 1HNIA 1RT4A 4PGXA 3U3GA 2IDOA 3KHHA 5EOZA 1QS4A 2KFNA 5KGWA 2G8WA 3ZDBA 3RMCA 4HCBA 1GOCA 1NJYA 2VG6A 4I2FA 1ZQIA 3OYFA 4J9QA 1RDBA 4TQSA 4KLFA 1ZBFA 1G15A 5KRTA 4F8RA 4YN4A 1Z26A 1D9FA 4AHCA 1RYRA 2W8KA 4C8LA 3KHGA 4IG3A 2C2RA 3OSNA 3SQ0A 4Z6FA 4RG8A 5DK5A 2JZBA 2V9WA 3QEAZ 2ZJ8A 3MXMA 2AQ0A 3ZD9A 1KFDA 5J0UA 1NK9A 3RB0A 3AV9A 5FDLA 3RJGA 2OWOA 8ICLA 1JLBA 7ICUA 1S1XA 3ASMA 3C6TA 4AILC 4M41A 4PQUA 3SPZA 4O5BA 2ISPA 4JS4A 1A77A 2A1SA 5KGXA 1ZBHA 3ZSXA 1HMVA 3BDPA 8ICPA 1JKHA 1XSNA 1L3UA 1IH7A 4I2IA 2VA3A 2BE2A 3TANA 1UAXA 2W9BA 5HBMA 1BPDA 2HW3A 1SL0A 1NK6A 3MECA 1BPYA 1HYVA 2IGIA 4NM2A 3QNOA 2R8KA 5L1KA 1S6QA 2QK9A 3Q8LA 3NH2A 4CK2A 5HP1A 4M04A 4NLGA 3OGUA 4GLXA 3QESA 4DTNA 4RQ1A 3C5GA 1HQUA 1N48A 7ICGA 1RTJA 3K2PA 4UQGA 3AVFA 2W9AA 2VA2A 1TK0A 5HRSA 3VQPA 4DSJA 4QZCA 4YR2A 4W5OA 4KLJA 3DLBA 2JEJA 2DFEA 2HHTA 3OYLA 4M0AA 4KI4A 1WAFA 5EWGA 4O55A 3OYEA 4RPZA 1TV9A 2R8JA 2GBZA 1X2IA 4RNOA 1Y97A 4FJ9A 3TAMA 3T5KA 4FZXC 3K75D 1WSEA 2XHBA 4UB1A 3Q8SB 2BKEA 9ICHA 4F5RA 2BR0A 2HMIA 2FPLA 1S5JA 4DL7A 1BQMA 5KT3A 5KFZA 4CJVA 3PVXA 3PR5B 1TK8A 3IM1A 3UXPA 5HP4A 4CK1A 3HK2A 3GV5B 4IQVA 4EBEA 3DLKA 4B8AB 5J2MA 3OYHA 4O3OA 1WLJA 3N4MB 4ED0A 1XSPA 7ICHA 9ICKA 8ICKA 1SV5A 3P1GA 2XC9A 4CEDA 3QNNA 4ED2A 3DYAA 4KREA 3JPNA 4RPYA 4ECSA 1JN3A 4K4IA 4M3XA 2PFQA 3SPYA 4YVZA 5J2IA 3QLHA 3AA4A 3AO1A 2ALZA 4DFJA 1U45A 3LP0A 5KG1A 3BQ1A 1Z25A 1YT3A 4CF2A 4N5SA 2FBXA 4L8RB 1BL3A 2E6MA 3RMBA 4DFPA 8ICSA 2C22A 4UB5A 4B9LA 4FW1A 3ZT3A 4DS4A 9ICBA 9ICMA 5DMRA 4CIEA 3HJFA 4B9VA 4HUGA 1UOCA 5DG7A 2H5XA 3ZSQA 5KFMA 5L1JA 1LAVA 4C8KA 1HYZA 2AJQA 4BDPA 9ICFA 4CHNA 4YQWA 4Z4FA 5CWRA 2IS3A 5KFQA 3PR4A 3NGYA 4HYKA 8ICEA 9ICTA 4WE1A 4DFKA 1IKWA 4CJ5A 3OYBA 1S97A 3EWAA 4FCYA 4O0JA 3LWLA 3AVJA 3S3OA 4K4GA 2JEGA 4KLQA 2BDPA 1XU4A 3OYGA 1RBRA 1ZQTA 1WSHA 4Z4EA 3ZSYA 2VG5A 1TKTA 3QZ7A 4M9NA 1ASWA 2ZUDA 1LW0A 4E19A 4E1MA 3VQQA 4CFCA 4EBCA 1C6VA 3T5HA 3KK1A 2R7YA 4TSXA 1YTUA 1J9AA 4CJWA 2NRTA 3RJFA 1RBSA 1T03A 4CGDA 3QZ8A 1JLAA 2ZUBA 2ASJA 1LV5A 2Z1IA 3B0XA 4Z4CA 5HMLA 1ZQZA 1ZQHA 3TAPA 5KFKA 2OPQA 1XHXA 4FK0A 3THVA 3DM2A 4FM0A 3OYCA 3HPHA 1S76D 4QWEA 1IM4A 4ZTFA 4B9NA 4FK4A 1ZQUA 2A1RA 1IXRA 1C0TA 3P5JA 4FYDA 5J2GA 1KEJA 4QZ9A 1JXLA 4NCBA 4M6WB 4KMUA 1RYSA 2D0CA 2I9GA 2KTQA 4K8ZA 2Q0ZX 3SJJA 3RJEA 5F9NA 4ECRA 3ZSRA 3JSMA 1WAJA 1B9DA 3IHQB 2FLLA 3TI0A 1DTTA 2XY7A 1ZBIA 4LH5A 3ORYA 1DGSA 3RJJA 1NK8A 1EP4A 5CJ7A 1KLNA 8ICZA 2PFPA 3AO3A 4AHRA 5JS1A 1C0UA 4QZGA 2PFNA 3SI8A 3MR6A 3OYMA 3M9MB 2WOMA 1BPZA 2B6AA 4KHSA 3V1RA 4KLUA 5DB6A 4W5QA 3O4NA 4RPXA 4J9PA 3RB3A 3BQTA 4B8CA 3GV7B 4EZ9A 4ECWA 2RKIA 9ICIA 4JUZA 4J9KA 3FFIA 3PX4A 3RBDA 4I7FA 3HPGA 3O3GA 3UIQA 2LYHA 4ICLA 1DOQA 4I2HA 1U49A 5DGAA 2YNGA 5DBBA 3OS0A 1ZYQA 4JRPA 3PMLA 4CEOA 4DU3A 4F2RA 4RW4A 2P6RA 3HWTA 2X6SA 5DB7A 3O4QA 5HLFA 3QEXA 3L3VA 2BCRA 1WCNA 3LANA 3V72A 4EEYA 1SKSA 1HRHA 4R64A 4DF4A 3AO2A 1IG9A 3V9WA 3T3FA 1HJRA 2DTUA 3QEIA 4DQRA 5BPCA 4J9OA 2XCAA 3ETLA 3HW8A 4Z4IA 3RAQA 2PY5A 4YXMA 1ZQDA 5DG9A 4KTWA 3LP2A 2AQ4A 2YNFA 3OJUA 4C8OA 4EYHB 5J2NA 1D8LA 1Q8IA 3LWMA 5KFFA 1IO2A 2OPSA 4KAZA 4DTSA 4M6WA 4DQSA 3QEVA 4O5EA 4C8MA 1BPEA 2Y1IA 4UAWA 2BCSA 4OLBA 3AVMA 5DQGA 3Q8PB 4DL3A 2BPGA 1GOAA 5KG3A 5J0SA 4DL2A 4CJLA 5KFTA 3B6PA 2UVVA 1TGOA 5DDMA 4PGYA 9ICLA 3OYAA 4CE9A 4Q8EA 2AU0A 3KLEA 4XA5A 2Z1JA 4NY8A 3IAYA 4BE1A 2ZTCA 1FKOA 4NYNA 1MC8A 5DLGA 3VQEA 1S1UA 1NKBA 4DLGA 3G6YA 4KLHA 3HSTB 3V7JA 4CGHA 1XSLA 3K5MA 1RT6A 3WNFA 1RT5A 8ICFA 4GXJA 3SV3A 4CGFA 3OY9A 3ZD8A 4PHPA 4QAGA 4QW9A 4OLAA 1Q9XA 1RXWA 3H40A 3C95A 5KG7A 2P51A 2XGPA 4CJRA 4ECZA 4FLUA 4GC7A 4KTZA 2VWKA 4FS2A 3NF9A 3ISDA 4FJHA 1TFRA 3PUFA 1ZBLA 1NKCA 5KFXA 5C24A 5KG4A 2G8UA 3MFHA 3ZDAA 2B5JA 1U47A 1T4GA 3MFIA 4DS5A 3DLEA 7ICEA 3HX0A 4UB3A 3ISNC 3PW5A 2BCVA 5IILA 4KLOA 2FC0A 4YR0A 3MEGA 1D5AA 1ASVA 5TZVA 4RQ6A 1J53A 1KCFA 3V9XA 1TK5A 3AVKA 4CEEA 1U9LA 4XUSA 3KLHA 4ECYA 3KKRA 4LSLA 1BIUA 4G3IA 3SUPA 2RDJA 3HPOA 3C1ZA 4O9MA 3SV4A 3E2EA 9ICPA 1UT8A 4CIFA 3LALA 4BE0A 1U04A 3K59A 4O44A 4CERA 1ZBUA 4JV0A 4I2GA 1L3TA 1W0HA 2X6NA 4R8UA 1U4BA 4RT3A 4KHUA 4F4XA 4YMMA 5CA7A 4YFUA 4AHSA 3ZDEA 4CF8A 4KLTA 3V6DA 4E7HA 3NGIA 1Y88A 3L3UA 3RMAA 1S10A 1JMSA 5C5JA 1ZQCA 4FLYA 8ICUA 2FPKA 4YMNA 1TV6A 5J2EA 3SUOA 4UB4A 4FJIA 4FLWA 3NCIA 1QHTA 4GW6A 1KFSA 3QEWA 2NRWA 1ZQNA 2HHQA 4RZRA 3CYMA 1XWLA 4ED3A 4KRFA 8ICGA 3UPQA 2PFOA 3T1AA 1KFTA 3K58A 3IG1A 2ZJAA 4EYIB 3KIOA 4OJRA 2I1QA 5J0TA 2AGQA 2GWSA 4M42A 4Z4GA 1ZQKA 2YHBA 1WSJA 3TR8A 4X5VA 3KD1E 3PO4A 3V6JA 1REVA 3OS1A 4QW8A 3C23A 2R8HA 2V4QA 4EBDA 1ZQWA 2BCQA 4GXIA 4KPYA 2F8TA 3UXOA 7ICSA 4UAYA 1VSEA 4CJUA 2ISOA 2A1JA 2YNIA 3F73A 3OVNA 1QQCA 4BE2A 3L2UA 2G8HA 4RW8A 2KN7A 3ZSOA 4DTUA 3JPRA 4CGJA 4PHDA 2UVRA 2IHMA 3KHLA 3MR3A 3GILA 2ATQA 4DQQA 3KLGA 3H8SA 4CGIA 5J0RA 4KLEA 1FXXA 3PO5A 4O3PA 4PHAA 3U3YA 2QKBA 3KLFA 1JLEA 4YD2A 5KT5A 3L2VA 2KW4A 4M9HA 3ZT2A 1VSIA 5KFJA 1Z00B 5KFUA 1TVAA 3HVTA 3EPGA 2F1IA 4O3NA 4MQ3A 3NGZA 4OPJA 3SUNA 4I2DA 2HHSA 1D8YA 3TAQA 5KFNA 2Y1JA 3DLRA 3PW4A 1GOBA 2PI4A 2HHXA 2GUIA 4J2EA 3NF7A 3L2QA 3UQ2A 1R0AA 4PH5A 4O3SA 4NYFA 3AA5X 3PNCA 1X9SA 1BCOA 2RPIA 3AO4A 4F50A 2ZE2A 2PXIA 2O4IA 1RZTA 3NF6A 3AVGA 3VQ8A 3JYTA 8ICNA 3Q8MA 9ICQA 4E0DA 1WSIA 4W5TA 5CHGA 2BHNA 3VQBA 2XGQA 3ZCMA 4M9LA 1DTQA 4DTPA 4XQ8A 4FLZA 2OYQA 4K4HA 2IMWP 4ID5A 3PX6A 2YKMA 3M8SA 2Z1GA 9ICEA 3NTUA 3RBEA 4ZH4A 2UVWA 3HM9A 1B92A 9ICSA 3T19A 4FLTA 3RJKA 8ICVA 4N76A 4FJLA 2NRVA 3D45A 3TAGA 2BANA 4ECVA 3NHGA 4I9QA 4LVSA 4F5OA 2JEIA 7ICKA 1JX4A 4JWMA 7ICLA 4CJEA 4J9NA 4IRCA 4P4OA 4KLIA 4MFBA 4TUQA 5E41A 2VWJA 4F4YA 4MFFA 3Q8KA 4ED7A 4NXZA 3NF8A 4UAZA 4E7IA 4PPXA 4FZZA 3H4DA 4C8NA 4DOAA 3C94A 1NJWA 3H8JA 9ICRA 2FLPA 1Z00A 5KFAA 9ICCA 5CYMA 3V1QA 4DO9A 3PW7A 1PZNA 3OS2A 1S9GA 4B3OA 1ZJNA 2GV9A 4FBUA 3EPIA 5IIOA 2JEFA 1S0VA 1HUOA 4MF8A 2J6TA 4CJ4A 1CEZA 1B43A 4Q5VA 4OGCA 3ITHA 1TAQA 2E4LA 2DY4A 4ZHRA 1NK4A 3VN5A 1ZQRA 4J2AA 1CUKA 2KZ3A 5KFYA 3JPTA 2FMSA 1JL1A 1LW2A 1H38A 3JPQA 4CGGA 3AA3A 2C2DA 4B9UA 3GDXA 3TFRA 3C5FA 3FYHA 1SKWA 1NOZA 5KFLA 4IDKA 3TARA 3LZIA 4FK2A 5DB9A 4I29A 4NLKA 1ZQAA 4CEZA 1A5VA 5CP2A 5J2QA 2BQ3A 4O5KA 4CECA 4R63A 1C1CA 1KLMA 5KFBA 4I2BA 3QO9A 4ED6A 4HCCA 1CZBA 4CF9A 5CY4A 4CJPA 8ICIA 2ATLA 4DU4A 3SUQA 3G6VA 1KDHA 1NOYA 1S0MA 4JV2A 5HHHA 3M8QA 7ICMA 1CXQA 1C0MA 4I9LA 4ZTJA 4BWJA 5JUMA 4FM2A 2XO7A 5D49A 4UB2A 3I0RA 1JLQA 1EX4A 2AGOA 3I0SA 4J2DA 2OA8A 5DDYA 1HNVA 4FJXA 1N56A 3OHBA 4B08A 3GQCA 1S1TA 3GIMA 4CHOA 4RUAA
chains in the Genus database with same CATH superfamily
5KTQA 1UVNA 5KT6A 1IVZA 4FWMA 4BR7A 5ETOA 1VFJA 4WKYA 4DV0K 3D2QA 4CEFA 1BMQB 2ITGA 4LBIA 1CC8A 3NVVA 2BGGA 3HVAA 4HHJA 4FVUA 3RYLA 4KLDA 1UCVA 1JXVA 2I6WA 4CIOA 2XY5A 4ECTA 2L9NA 2D3OR 2D9PA 1YTAA 3IM8A 9ICGA 4B1ZA 4QZFA 4IBNA 5J0QA 4ILMA 3N6LA 2KG1A 2A1AA 2MPUA 1HIWA 4YOYA 2AW0A 4I2CA 1S6PB 1VSLA 4KHYA 3DMJA 4DX5A 2ABYA 2XEXA 2HNDB 3MURP 4HDGA 1EXQA 2W54A 3KDOA 4BRHA 2ADBA 3QWPA 5JS2A 2LEBA 4NYOA 5ALYA 4BR5A 1FHTA 5LMNF 2PO4A 1YQHA 4FO6A 2HCFA 1RJJA 3F5EA 2D0BA 3UN5A 3HP9A 3AJDA 4ALZA 4QS9A 3G0ZA 1OSDA 1L7OA 4E3SA 4I2EA 3AU6A 2QWLA 5I3PA 1N61A 1ATSA 3UD5A 1KN6A 1HUXA 1EJ7L 3THTA 4DSLA 1K6YA 3QETA 5HJYA 2R8IA 1T0TV 2P9GA 3MN9A 2FVPA 1HIYA 1IG6A 4GMJB 4J9VA 4ISFA 3D6JA 2RB7A 1PC4A 4UW9A 2LYAA 1DXSA 3UDCA 4OJ1A 3LDSA 2XMTA 2DGZA 4KFBA 1E6VB 5ETLA 4TUPA 1KNZA 3MXIA 8ATCB 4DOBA 2W9MA 3KG1A 3E3XA 3ZDCA 1BISA 3HHLB 4UOGA 2WB4A 4O3QA 3VENA 4K0KK 2E20A 1ZQOA 1NM1A 2W2MP 1RTIA 4KV8B 1YAGA 3B4DA 3MBYA 3BBFA 4QS8A 1X0FA 2IFXA 3DLGA 4H4MA 3M8WA 3ZTQA 3I56N 1N52B 1T11A 5DM6Q 2BA9A 2UUTA 2B7BB 1YJ9S 1WEYA 4HH0A 4CNYA 2DITA 4FPBA 4Z4HA 2HFSA 1QSSA 1TL5A 3V6DB 3I82A 1U6ZA 3ALYA 3THYB 3IG5A 5BJRA 4NM1A 3FZLA 2VOOA 1TL1B 1T3VA 4CZLA 5J2KA 3HSZA 2X74A 4KH5A 4HHHA 3ZTPA 3KD5E 4BCAA 4BRIA 1D8BA 2IM2A 1KN5A 2R7WA 2WTFA 3Q22A 2AP6A 3RUBL 1VQ4N 3H90A 3LP1B 2EPIA 3O9SA 1ZQBA 1RBUA 1WACA 2ASDA 1UFLA 4F4WA 2KXFA 1KVAA 1HI1A 5D0EA 2DXDA 4EZ6A 4RQNA 3CCTA 3SXLA 1MQ2A 5KFRA 4F04B 3BJYA 2V2ZA 1QY7A 4AE5A 4IO9L 2EZZA 2IIRA 3RRKA 3VQ7A 4YMOA 2HBYB 3K8VA 4FWPA 3R6MA 5GADI 5C15A 2G8IA 1ZQGA 3AN1A 2C2ZB 5AJ3F 2MRLA 2Z8QA 1FX2A 3IRXA 4Z6DA 2FHMA 4OJGA 4NL9C 2C3PA 3RAXA 3FMWA 3ELHA 2CNNB 5GIPA 3WQPA 1XMOJ 3RBZA 2V7ZA 2NRXA 4LY7A 5CZ2A 1FDDA 9ICOA 4YCXA 4R65A 1XMQK 1RHJB 4A57A 5M1KA 2ETJA 5J2HA 1NOMA 2VASA 3BYPA 2JLGA 1WUAA 2LHTA 2CVEA 5D3GA 3KZXA 4YHHJ 1FEZA 3WZ0A 1VQYA 4DCHA 2FJXA 4WFXA 5BN8A 4MK8A 4CT9A 3QEBZ 1TFWA 4URQU 1WC0A 2V8DA 1VIXA 2H5JB 5KG5A 2AYGA 4C23A 4MEYA 2DGVA 1UVJA 4KLSA 2MSNA 4CLLA 3UM9A 2UXBJ 2FB0A 2AYMA 1RLDA 4LH4A 1X40A 3E9PA 2XI9A 1F5SA 4CJSA 1Y5IB 4RNHA 2DGXA 2Q0UA 3B4MA 2HAIA 2B9WA 1R0AB 3M9NB 1PK1A 1T05A 3J7AN 3ZEUB 1DGKN 3MUMP 2XCPA 3I56S 4LRDA 4RUCA 2E1MC 2JC1A 3KJVB 1QLNA 2QA4N 3JPPA 4KHWA 1QD1A 5GAHU 1AROP 7ICPA 2MKJA 4DX6A 1BI4A 4UAUA 2LPEA 2XNQA 2HEKA 2LXFA 3NCRA 2HMXA 4QNLA 2HNYA 3JQMA 1U1KA 2QWNA 4CJ7A 4KPCA 2F4VF 2OP5A 2VA8A 3U9DA 4FYXB 3FEXB 4U67Q 2YPZA 2I5JA 2IYIA 2QLXA 3DRPB 1VRTA 4DPUA 1UWAA 2CDRB 1J27A 3K5OA 3I4HX 4OVLA 4JI0F 3VAIA 3J7Z5 2W01A 4M45A 4OYWA 4F91B 3ENHA 1BNPA 4B3MK 4DTXA 4HACB 4WP3A 2CYYA 4YB6A 3NNCA 2EWHA 4WQ4A 2KB2A 3F56A 1TR0A 3LPEA 3S41A 2DPJA 3D2FA 3H5UA 1UL3A 1WSFA 2CADA 2FYXA 1LWCA 3OHRA 3L5KA 4E98A 3CJKB 4LF9F 3LPUA 4FJGA 1GMWA 1SJRA 2XMWA 4B3OB 1W26A 3R7NB 4FWRA 1QJHA 4LF7J 2RMLA 4I2QA 2ZIXA 5LMUJ 5AQQA 3CPEA 4F36A 2MKKA 1NJZA 9ICAA 8ICXA 4M9JA 2KOBA 3D2SA 4PXCA 4RQ2A 1JI7A 1WHYA 4CM0A 2OXOA 5EE0A 1MN7A 5J29A 3O9UA 2DO4A 4J5OA 2XQCA 4P0QA 2VBZA 2UXCJ 1RTHB 2RQCA 1Q8LA 2OTJN 3MDAA 1SV4A 2HHHF 4P72A 2MUTB 4OJPA 4QIFA 5SWMA 3LDAA 3HFZB 2L41A 2BV3A 4M3YA 1AW0A 5AXKA 5GMEA 1X4AA 1TL7B 7ICTA 5C25A 8ICQA 2OFGX 3EZ5A 3ZT0A 1V85A 2ZDOA 3RB4A 3DRXA 3PX0A 1RDAA 3J7YU 1FNOA 3D68A 1W7AA 4LBHA 1BU6O 3TEGA 4DCPB 2HFNA 1HPMA 4ZVRB 1HNVB 4P2MA 4I2PB 4W5NA 1FA0A 1U8WA 4W92B 2VG7B 4IG0B 1NNDA 1ZXOA 1QE1A 3JXUA 2IC3A 3N6NA 4F0HA 3RH5A 3G8QA 4CGZA 1A5XA 1T9VA 4F72A 1B0TA 5HVGA 1WYGA 4GO7X 4I2JA 4LMZA 3VQCA 2YWKA 5C42B 3L2WA 1HWUA 4DOZA 3CQ8A 1H74A 2H3IA 4YY3F 2ZH3A 4FWOA 1QQ5A 4C0OC 3SQGB 3SQOP 2R2TA 3QIOA 1PVQA 3FC4A 4FF2A 3OA9A 2OPRB 3QT8A 2C28A 4TU9A 4NZ0A 2J0WA 2DD8S 2HF4A 3A0BU 2L3MA 3RRHA 1NEEA 1U25A 3N97B 4FOEA 1GFWB 3OJSA 8ICCA 4M3RA 3VGLA 3HZ6A 1N62A 2F65A 4KHNA 2WAQC 3D7SB 1RNHA 5BOLA 1EZZB 4MO4A 2YTUA 2KV2A 4K0KF 3UR3C 2NRHA 1KTVA 1XS9D 3C1YA 2UVUA 1JLCB 1Q95G 4NYZA 3IFEA 4JI7K 2GJFA 4DHVA 3UVJB 1KTQA 3U4LA 1X4BA 4XDCA 3V7LA 3SCXA 2HOEA 1LKYB 2DNRA 2P5VA 3I5AA 5AKXA 3SAFA 1ULRA 2AJ2A 4W5RA 2CXYA 1WNEA 4PWDB 3MEDA 2D74B 1HNZK 4B1VA 4JKAA 5A8KA 2OZMA 5B66U 1N6QA 5KAKA 3B0YA 1IJJA 1KBUA 4DV7K 4UY8T 2PZSA 3O08A 4O4GB 2B8QA 1HNWF 1IBCB 5HJXA 4ED4A 1VBKA 1MA7A 3NOGA 2PI5A 7ICRA 2FBYA 4N41A 4F92B 2Y8WA 4BREA 3T6BA 1RABB 5IZHA 2V51B 4R5PA 3OFEA 4EP4A 4JI8J 3N4QA 1RACB 4X66J 2OTJS 1KVCA 2FVQA 2M5YA 4GMKA 4NA1A 2W7PA 3B6OA 3KNAA 1N5YA 3HVRA 5CYQB 1KVBA 3PRBA 4BDZA 1ZPVA 2E9RX 4NPOA 1V9PA 4OYXA 1G1XA 2Z2MA 3GDQA 3ZZYA 4WXOA 4DV2F 2JGUA 2ZBPA 1UVMA 1R27B 4NXMK 2NXJA 2HG4A 3DNCA 2D9OA 3UXNA 1V6HA 4M5MA 4CEQA 3LPTA 3GYNA 4FZYA 5BR8J 3DOKA 2BTFA 4F93B 3ZDDA 2B56A 2D5RA 2HWHA 3V9UA 2ZTEA 3BP8A 2FQQB 2UUCK 4RW7B 3CO0P 1JL2A 3BZKA 2GMLA 3H45C 3FBEA 2QX0A 3MR5A 2IOCA 2FLNA 4PR6A 3K5NA 5SZTA 5JVGL 5F41A 1FVQA 2JDJA 4OKKA 4KLMA 3QAEA 2V8HA 4B3SJ 3VGSA 1C1AA 2XZDB 4J2BA 2CWXA 2Z56B 3H5XA 2R2RA 4Y1DA 3IKMA 1WWVA 1SC6A 2HFOA 4HTIA 4M5LA 4DUYK 4BXOA 3DRSA 2KIWA 1KD1T 3SEIA 2H4WB 3UPFA 3FCVA 3M32A 3NGDA 2G5HB 4X64J 3T41A 3C29A 4RW9A 2YV0X 3P45B 2WVEA 1HNXF 4Q43A 4MO5A 1UWBA 4J37A 1CJKB 2PYLA 4JI2J 3DU6A 3QAUA 1XO1A 4K8RA 2R7XA 2B9EA 4CO2A 1Q82O 8ICOA 4CJFA 5J2AA 3M7DA 3BZQA 1RCHA 2EFGA 2Z1HA 2FPMA 4NLVA 4IYQA 2X1BA 3MPUB 3JQJA 4ZVQB 5JMVA 3G87A 2IBOA 2PYJA 3C0BA 1R59O 2ROEA 3AOAA 2JRSA 4O5CA 5CD4H 1TKZB 3AVNA 3KKSA 3CJ3A 2E8NA 2F1JA 5D77A 2XMVA 4C0ZA 3DHXA 3QJJA 3M9OB 2VQFJ 4QR2A 4ITSA 1JCEA 4ZA1A 3CXCM 1NUEA 2A5XA 2R7RA 4ILRA 5KFDA 1FERA 3I5CA 4UOFA 2H4YB 3L4PA 5DBAA 2Q2RA 4K43A 8ICMA 3GMGA 3MMVA 1T94A 1KRPA 4AP9A 1S49A 2RU3A 3CNQP 3H6EA 3AVBA 3N5FA 3LAKA 1CXUA 1J6ZA 4DU8A 2NPFA 4B3MF 3AL0B 4NZ6A 2VBYA 1LWEA 3BH7B 2G8KA 2CJAA 4LFAJ 2K60A 1HA1A 1ZQJA 4M5DA 1JLBB 1S1XB 4P0PA 3NGKA 5ALEA 5RUBA 1RHMB 2XIDA 5CCMA 4TVAB 5MLCV 3VWSA 5AR0A 3CJBA 4Q7AA 1N54B 1HMVB 4UBCA 3EX7B 4PL8A 2GMJA 1JKHB 1ZQFA 3HL8A 3SSQA 4RUBA 1N36K 4EMDA 5ALIA 3CCJS 2WBRA 1ZPWX 3BGRA 3TQEA 1APSA 3OBYA 2RS8A 2W9BB 2CGLA 3T7ZA 3Q83A 4JK8A 3FLCO 5M1OA 2ERRA 1GXLA 4RU9A 2RUGA 5KQDA 5M1PA 3SDEB 7ICNA 4TLRA 3CJTA 4AL6A 1V3RA 5J2PA 1F3VA 3CDEA 5ETRA 3ZLJA 4DL5A 1X9WA 5ALQA 4FWLA 2ZWOA 1DLOB 1KEKA 3D3CJ 4IO9Q 3Q2TC 1RQLA 3MC1A 3CC2N 1X8DA 3M2UB 2HKEA 1RTJB 3F2CA 4QZIA 1NZ8A 3H0PA 3A2FA 4PGXA 2QWPA 3TA0A 3KHHA 3POTB 5KAIU 5AI8A 5B5EU 2KJVA 4CM2A 5KGWA 3W3DA 1UVIA 2G8WA 1S5LU 3RMCA 5GMKa 2EAPA 3M2VA 4YS2A 2VG6A 2R4FA 4KLFA 1RA7A 2J9DE 4F8RA 1NDCA 3KHGA 1U2VA 2BE9B 2CH5A 3DOMB 3ZX0A 3RZAA 2HMIB 4Z6FA 5DK5A 2JZBA 2XMKA 1J5EF 3VV2B 2AQ0A 1KFDA 1SH2A 3RB0A 3AV9A 4M5JA 2P9EA 4A4JA 3PIOQ 3RJGA 2OWOA 4NE9C 3THXA 2V50A 4PZOA 2IDLA 3ASMA 3C6TA 1N34J 4AILC 1SC3B 3N4PA 1F9FA 2ISPA 1NZAA 2A1SA 1ZBHA 3ZSXA 2ZVIA 1XSNA 4LQ9A 3L09A 1IH7A 4B3RK 5JU5A 3SSSA 4P9SA 2CQ2A 1KQSR 2V68A 1NHUA 3C66A 4NLCA 5ALLA 1SL0A 4Y0WA 5AQUA 1NK6A 3NGTA 4KO0B 1FO1A 4NM2A 4Z7CA 3IG8A 1R7IA 1E4GT 3QNOA 4C6AA 2QK9A 4ZN1A 3Q8LA 1WORA 4XH1A 5HP1A 2M0NA 1MLAA 2GGPB 4UASA 1JCFA 3J7ZT 4CI6A 2VL1A 4JI5J 3FEYB 4GLXA 5AQPA 3C5GA 2CQ4A 2JZ5A 1HQUA 4U8VA 3WIVA 2IOFK 5EDWA 2F8HA 5DJBA 4LF8F 1R0BG 2CQIA 2DNLA 3VQPA 2FF6A 4JI3K 4W5OA 4JI7F 1NH7A 4F7VA 1YLXA 1GLAG 4WTOB 3FZHA 4OCZA 2MHEA 4DR6J 3GU3A 3W63A 3QSYB 3PSIA 2BACA 1X2IA 3UMCA 2DXFA 3CPWR 2M4MA 3THWB 4F67A 1WSEA 4UB1A 3Q8SB 2BKEA 1JB0C 4OX9J 1TUVA 4O8KA 4F5RA 2V8GA 1NU0A 1VI7A 2DHSA 4PEOA 5KFZA 2KJ9A 4W98A 3PVXA 2W24A 1S7IA 1RBOB 1T9UA 3LGMA 1HBMB 5A2QO 3GV5B 2RQKA 5LJWA 2DF4B 2CPZA 1H98A 3L95X 1T03B 4ED0A 2RE1A 1UETA 4PXDA 4CEDA 3VAJA 4DV4F 4EK2A 4FFDA 2MQ8A 3F44A 2V0NA 4KREA 4GVBA 2GX9A 1Q79A 1N32J 5IWAF 3QLHA 1OKJA 3H5SA 2DPNA 3SMZA 5KG1A 3Q2SC 2R7VA 2FBXA 1DQ9A 3F5TA 4DB3A 2J9CA 3RMBA 1FJGF 2C22A 2ITMA 2RT3A 2K1RB 3CDUA 4E8UA 2MSTA 9ICBA 3VTIA 3HJFA 4ERDA 1R8CA 1FWKA 1X31C 4QR1A 3MAHA 1M1KT 5DG7A 5CZXA 4NLBA 3QMQA 4NMXA 4X4NA 1GLDG 3ZTSA 3JSMB 3KYLA 2CXEA 1P27B 1DTTB 2RSQA 2J0SD 1HHTP 2CNLB 2GCFA 4A8WA 2AJQA 3W0LA 4EHTA 2QARB 2FHJD 4BR4A 5CWRA 4NB4A 1IM6A 4OO1J 2QFJA 8ICEA 4DFKA 4NZ7A 4DFDA 3OL8A 1LK7A 1H3DA 2RHSB 2DWQA 5M1NA 3J8AA 3AVJA 3OYGA 3CJ0A 5ALWA 3OTEA 1WSHA 4K4SA 3BB5A 3ZSYA 1ZRNA 4YB7A 2VG5A 4I7FB 1ZBTA 5GINA 3U7JA 4HEA9 1XJWB 1LW0A 2QGFB 2VC1A 5K9FA 3VAGA 4DUYF 3VQQA 2YNGB 3GFYA 3KK1A 5IV4A 1WUUA 1YTUA 3HHDA 3NP5A 3GE9A 4BRPA 2NRTA 2YH1A 2X7IA 4PXBA 3JB9k 2Y9TA 2E2OA 3QZ8A 2VCPA 2KH9A 1JLAA 2ZUBA 5ALFA 5AKJA 1ZQHA 5E5NA 3OD2A 1MA9B 2PBDA 3DM2A 4FM0A 3UMBA 1B3TA 2ZDPA 4IOCQ 1S76D 3BN4A 2YN4A 4B9NA 4FK4A 2BOPA 5J2NB 4FF4A 3P5JA 3CQYA 3MMCB 4HHUA 4C7QA 3Q8UA 3CF5Q 4OZLA 3H46O 1QTNB 4M6WB 4KMUA 2EEYA 2NUUG 4K8ZA 2Q0ZX 1RDRA 3HF5A 1TZ0A 4H5NA 3WXLA 4TU8A 4LF5J 2B4VA 4EIAA 1ITPA 5J1NA 4DPOA 4KGKA 1WAJA 2ASPA 3IHQB 3M6XA 2WBMA 3R3LA 3M3ZA 1ZBIA 1YX2A 5AK3A 2CPJA 3RJJA 4I6YA 3KKFA 1NK8A 1EP4A 5CJ7A 4B3TF 1BWFO 2PFPA 3NEKA 1LKZA 3I31A 2R7UA 4Y2XA 4JK9A 5FPNA 2K89A 4KHSA 4QZVB 4KLUA 3FCWA 1NSAA 4RPXA 3QYPA 3A3NB 2DHXA 4J9PA 2PFUA 3O4NA 4A2AA 2HYIB 4B8CA 4EZ9A 4ZVTB 1RFQA 2QLFB 2BMBA 3MI7X 4JUZA 5AE1A 3WQUA 3PX4A 3O3GA 1OYDA 1RHUB 4ICLA 2XICA 2Z4PA 3ENQA 2HSEB 3HFKA 3D67A 3OS0A 1ZYQA 3V81B 3A8IA 4CEOA 4DU3A 4BRGA 2P6RA 2YKPA 1N36F 2KKVA 2B6GA 2GJ2A 5E3AA 3QEXA 3PXGa 3L3VA 3BY5A 1QH9A 2BCRA 3LANA 4DUZF 5AFUA 3V72A 4JAXA 4R64A 4K25A 4DF4A 1X3MA 2UYTA 1HJRA 2DTUA 3FJ2A 2CPRA 2GAGC 4YORA 1PC5A 1NH8A 1S9EB 1WB9A 3RAQA 5DG9A 4A8KA 3GSIA 3MM5B 3LP2A 4I56A 2AD9A 5A8WA 4GVEA 1LWFB 1UAWA 1JNZB 1D8LA 1Q8IA 3GFZA 1NNEA 1WSVA 3AY9A 5KFFA 9RUBA 2YMQA 4DTSA 3TVZA 2A2CA 3M6WA 1T3QA 4C8MA 3VPZA 2BCSA 5AXNA 3MGJA 2KO1A 1Q16B 2Y0SD 3PSTA 5JVGQ 5ETNA 3BS5B 1NDLA 1X66A 1LQ9A 3WXJA 3QU7A 2UVVA 1TGOA 5DDMA 2OUGA 3RAMA 4WZMA 3OW2M 2YX6A 4Q8EA 2JH1A 2E5LK 4NY8A 2ZTCA 1FIQA 1FKOA 2QA1A 3Q8VA 3Q89A 3GTYX 5AQKA 4OHWA 4J8FA 1TL3B 2GW8A 1S4EA 1XSLA 1BHNA 2HOFA 3WNFA 2WC9A 1VS3A 4NRUA 3QUTA 1NRKA 1LOUA 2Z58B 3OFGA 1IJFB 5KG7A 5CR4A 2DR7A 2P51A 2XGPA 4ISGA 2UUAK 5GAGU 3QATA 2KYZA 2G06A 2MMYA 4KTZA 1H7WA 2GHWA 3V5RA 1B99A 3UKUB 3C2PA 2X1GA 3NF9A 3M8YA 2NRRA 2F2AB 1NKCA 2A6AA 5EX3A 2PMZD 4OX8A 5DM7Q 3BKFA 4KHPK 2JX2A 1OYEA 2ZJRQ 4C9DA 1SQFA 3L4IA 4DS5A 3NXZA 3AAPA 3HX0A 1Y00A 1K73O 1RU2A 5TISU 1RWVB 4ZP8A 4HT5A 2LECA 1DGJA 4DCCA 3C8YA 5LXYA 4EENA 1BNOA 2BJ9A 1E6VA 1FNXH 1FCAA 3U8XA 3MEGA 2BUNA 4PZNA 3OFHA 5TZVA 3V9XA 2HWIA 1ZM2A 1U9LA 4ECYA 1HEKA 3A1YG 4A8MP 4O9MA 1KQFB 5E84A 3E2EA 4JI3F 9ICPA 5K20B 2W2OP 1EKRA 4PG7A 4BE0A 2XSJA 2ZGYA 3K59A 1R8AA 2VQEJ 1AT1B 3HLUA 4C98A 2GZOA 1DFDA 2J8SA 1U4BA 3KLGB 5F8HA 5KPZA 1FWLA 3DXKA 2DUYA 2W03A 4YFUA 4FO0A 1GO3F 2EFQA 4KLTA 3V6DA 4B17A 3NGIA 3L3UA 3E9LA 3QU5A 3NGUA 3THYA 3CCUS 3QJPA 3PG9A 3JAMU 3J81j 2ADCA 3K9JA 4P71A 3AB2B 3DC2A 1YJTA 3C65A 3SUOA 2W2NP 4UB4A 3J80Y 1WEXA 1DQ8A 1QHTA 2GTDA 2MKHA 3QEWA 3O4WA 2EFVA 3LYSA 2ASMA 5M2RA 1AB8A 1KFTA 2RLTA 4MDAA 1R3NA 5DO2A 3DLKB 2I1QA 5J0TA 1VOMA 5J2MB 4CBXA 2GNKA 4M42A 3DJCA 1NMNA 1REVA 4QW8A 1D09B 2VPWB 1ZD4A 1ZQWA 4GXIA 2XULA 1YJWN 5F8GA 2K4HA 3AAQA 3J81U 5BRHA 1SVDA 5AQIA 3F73A 3CO9A 2O8CA 5FLXU 5D4LA 1EQMA 1SV0A 3HSDA 2DNMA 3DXMA 2QG9B 3TUJC 3GZ7A 1DURA 4CQ1A 2DNGA 2BANB 4ANEA 2KM8B 4DTUA 2L08A 1WOSA 2UVRA 2MZSA 3KHLA 3MR3A 3GILA 5BN9A 3H8SA 1Z4UA 3H59A 1U0HB 1FXXA 1NM2A 4O3PA 4PHAA 3U3YA 1QVGM 2QKBA 2EFOA 3M1FA 1H72C 2O8BA 4V1Ak 3IP0A 4YD2A 3MCOA 4WE1B 2VPXB 3MCSA 2F1IA 1Z1ZA 4CDIA 1HKAA 3LDPA 4Y2TA 4YEAA 4MQ3A 3C3LA 2N7CA 3HT0A 2HHSA 2MU2A 3A13A 1PK3A 2IVMA 3NS6A 1W2BM 3ONQA 1GOBA 2PI4A 2I5HA 4DI6A 2ZH2A 2HHXA 4A48A 5BREA 3QNWB 2Y0SF 3UQ2A 1R0AA 2NQPA 4JV5F 4IDKB 4DL0C 3BGLA 3PNCA 4EU0A 4OJOA 3NG8A 3NMUA 1BCOA 2ZBRA 4K50A 2ZE2A 1RWKB 3R7SB 1SJFA 5J2QB 2O4IA 2Q31A 1RZTA 1UCNA 3VQ8A 3QO9B 1R43A 3O5TB 4I6MA 5CHGA 2W41A 2BHNA 3VQTA 4XQ8A 2G0AA 4A2BA 2ZBQA 1QQNA 5BXIA 2YQ1A 3PX6A 5F8JA 2ZOFA 3OL6A 4WTYA 1SIWB 2H9ZA 1K8KB 2IDEA 2CG4A 1C0TB 2MKCA 4FJLA 5DRKA 1LXNA 4I4BA 4I9QA 2FF3B 2CQ1A 1NNLA 3TKAA 2DY1A 1X4DA 4IC9A 2RHQB 3VEZA 1A6LA 2VZ9A 2PDAA 1FRIA 4P4OA 2XVTA 4IEEA 4MFBA 4M63A 2PMZF 4TUQA 1CG2A 4YOVA 2VWJA 4ED7A 4GKJJ 3PSFA 4E7IA 4BLGA 4X2BA 3H0LB 2LQ5A 4I1TA 2EI5A 1HBOB 2AZ1A 2WMMA 2XLIA 3CJKA 1GNKA 1YZ6A 1UPHA 4ES1A 5C2FA 2NZCA 1DRZA 3NL0A 1EHWA 3PW7A 2WOMB 2B6AB 2QLBB 1RCXB 4B3OA 1PVPA 1I5OB 1NSPA 1S0VA 1YJWS 1HUOA 4MF8A 3DRYA 4Q5VA 3ITHA 2E4LA 5D8HB 5AKIA 4ZHRA 3FRYA 1NK4A 3VN5A 1ZQRA 5KPRA 4J2AA 1MWYA 2KZ3A 1LW2A 3JPTA 2L9DA 2QTWA 3GG0A 1HKBA 3GDXA 1MROA 3M05A 5BRFA 4F25A 4NLKA 4RW4B 2XTJP 5CP2A 4O5KA 4CECA 4WK3A 4AQYK 4I2BA 2DRBA 4ED6A 4LF2A 4U96A 5E3RA 3EGNA 2Q66A 4Y34A 1VC5A 4CJPA 2CPDA 2ATLA 1KDHA 3UE5A 1S0MA 4JV2A 1VK3A 3ONNA 2O6KA 1NB7A 3N0VA 2EW9A 3T1HK 2BYCA 2HQCA 3BUZB 2YWWA 5ETMA 4ZTJA 5IS2A 2DYAA 3W5XA 5ADZA 4MDBA 2RRNA 4FM2A 2YNFB 3QDKA 3O2IA 4KFBB 2CJBA 4C80A 5D4PA 1AUDA 4UB2A 1RQNA 4RBUA 3I0RA 4OI1A 2ZWHA 2AGOA 2ZJPL 4J2DA 5DDYA 1BY9A 1DAXA 2VFRA 5LL6d 1N4LA 1HNVA 4FJXA 1WWUA 4PPZA 2VWBA 3OHBA 3CD0A 3GQCA 4CHOA 1NGCA 1NPRA 4AD6A 1RTIB 4PRFA 5B7WA 1AUSL 1O1WA 2FJEB 2HB5A 4Q2LA 1VDVA 3PRVA 4DEZA 3HZEA 3OSPA 1M6YA 1FDAA 2VANA 1QSLA 2WK4A 1S9FA 4CJKA 2FZGB 4I68A 5F8MA 3CJ8A 5EWFA 3PYDA 2W7OA 4IQMA 4RQ0A 2WF7A 2KI2A 2IRXA 3H4BA 4KN4A 4KHPF 1QAIA 1SH3A 4KH0B 1ZQYA 3QFPA 1B0PA 3H0RB 1RT6B 1RT5B 4J9SA 1SZHA 1YF5L 2MZ1A 2FJWA 3MN7A 5GAEP 3W2VB 2D3O1 4M47A 3LPYA 2G2OA 1Q53A 3E51A 3QFUA 2EAOA 5HL7L 1BQNA 2DISA 2VB6A 4CO5A 3R97A 4LRBA 3FZKA 4QOZB 1JK9B 2CA9A 4LQ3A 3OQ2A 1N5XA 4GC6A 3RJHA 1RAJA 4MKAA 5C24B 4JKHA 2NXNA 2B0GA 2BJ7A 3NLCA 5HMYA 5HI7A 1IG8A 1SQGA 3QRPA 3UVJA 1OWXA 1U2RA 2N3OA 3WXIA 4HHTA 4PZVA 2EC2A 2UXDK 1SKRA 3HKZC 1UVLA 5C0YA 2DBBA 4H5RA 3HI9A 4FWQA 2HNZA 4CIGA 2UXCK 1CSJA 4Y2YA 4PWDA 5D4BA 3K17A 4IS7A 1MMLA 3OYJA 5D46A 3SQIA 3KLHB 2B7CB 4QCLA 2D7SA 4O4GA 3AQEA 3Q0AA 4OJ5A 5HMMA 3VETA 4QWAA 2LA6A 4JS5A 2AT1B 3ZSVA 3R5CA 5IOLA 1GH8A 2ZF5O 4RT2A 2UZAA 5A2QY 4ELVA 2QA4G 1TAUA 3UB5A 3BQ0A 4PWWA 2BPCA 3NY0A 4LSNA 3ZTRA 4NXNK 4ACOA 1VJQA 3TO8A 4KKOA 5HNKA 5D3GB 2AX0A 3NMRA 2KK0A 5CYQA 5DB8A 1VHIA 2R7SA 4NASA 2HK2A 3C15A 2F40A 5E3CA 1M90T 1SGGA 3TVYA 1SB6A 4N77A 3FFKB 4USUA 4RWTA 4M9GA 3ILIA 1VK8A 3ETRA 2HQDA 3V9ZA 4DMNA 2A40A 3HD1A 4ID1A 1K1QA 5IIJA 3MGHA 1M0SA 3TYTA 5KFHA 2VOPA 1RLCL 3T1YK 2W8LA 5EOYA 4P75A 4NLDA 2XBPA 2OD4A 1C4AA 2XB2D 4C7YA 3EGVA 1P1LA 4K5RA 1V3SA 4K4YA 4KIAA 3TTFA 3T9NA 1T9TA 3TAFA 3VZHA 1T05B 3IG1B 1RWNB 4QIEA 4MK9A 3BS7A 5CAAA 4QPTA 4BRMA 4M3WA 3PHTA 5KFVA 4DR7K 1KSPA 4H5TA 2F8LA 2Y0SC 2LCWA 2EWSA 1NPKA 1EWQA 1WSGA 4PXEA 4UBBA 5IIIA 3D6RA 3BQ2A 2FTRA 3GJQB 4P2XA 3DLLQ 2HNYB 4WU2A 4CTAA 3VF6A 4M2YA 4CF3A 4NL5A 1I94K 5HSPA 4PL7A 1IQTA 3F41A 3SQ1A 2I5JB 1LOTB 3TSUA 2A1JB 1FO4A 5B09A 1VRTB 1RA6A 1ZETA 4NLSA 2HHUA 4DN0A 3VCDA 4FJJA 3NS7B 1B22A 3A12A 2G8FA 2WFAA 4IOAQ 1VSJA 4CFAA 4MKYA 1CJKA 2AF6A 4DKWA 2DNNA 4BR9A 1VCTA 2RH3A 2CNKB 3WXKA 4DU1A 2J6UA 4QYZJ 3D2FB 2AA4A 4FM1A 3MMAA 3QERA 4KRWA 3RB6A 4J9MA 1D9DA 4OD0A 2P6TA 3HO1A 4OL8A 4PAAA 1LNQA 1ZQVA 2PMZC 4NLNA 4YOTA 4ZLLA 4DR1J 4Z7YA 4TKTA 3DI6A 4EWTA 3M6ZA 3OYIA 2NRZA 3W8GA 3P96A 4IDHA 1TKZA 3R1LA 1UJ5A 3EMTA 4E1JA 4QZAA 3ED5A 2ZIXB 3TWHA 1VRUA 3VF2A 5BRDA 5DKWA 2BM1A 4MIWA 5KAFU 4CRJA 3OYDA 2J6SA 3B82A 3IWNC 4LT6A 2OIHA 3P6YC 4EFAC 4RPFA 1T8EA 2XZWA 3AO5A 4ZVGA 2H3VA 1YRUA 2KL8A 5EWEA 2HVZA 4P0QB 1VBYA 3GIIA 2QKQA 2QL9B 3JYTB 3S3NA 2KJWA 2MZJA 2ASLA 4DTJA 1XNQJ 4JI1K 4DL4A 4H0YB 2E44A 3SYZA 2FHOB 5AI4A 2F8KA 4FJ8A 4KB1A 5C25B 1XR7A 1MMDA 3J7AP 4ID5B 4OGEA 3OV7A 1JQGA 1Q86O 1B0VA 1IBLK 5THWA 4C4WA 1U2FA 5B8HA 4QWCA 1XMOF 3OL7A 1Z3EB 3MMJA 5AI5A 3CXCR 3G10A 4XH4A 2ZJ5A 4Q0BA 4WF9Q 1U26A 2VDHA 5C2CA 2EVZA 5ALPA 3NWRA 4B3SK 2HBQB 5KFOA 2OLWA 2ROGA 3RMDA 2B4JA 1W9HA 3R9LA 4ILJA 4YHHF 3P49B 5MLCQ 2Z2ZA 3GIKA 5FD1A 3SMPA 3HFVA 4PHTX 3VA3A 5AQXA 3CM6A 5KFGA 2MZRA 4RW6A 4AFFA 3VQ4A 2M70A 3RBXA 4U7UD 3KFUF 2XWXA 2ZNYA 3M5RA 2ZHOA 4MLEA 4Q8FA 1DLOA 2OI2A 3ZTOA 5IINA 3V6HA 3BBCA 5H9FK 3IR6B 4HUFA 4AQYF 2YMLA 5FPMA 4JI2K 1NK0A 3OPXA 1GMUA 4WFBL 1U1NA 2VFSA 5A6WA 3ET6A 4F0MA 1OPIA 2BQUA 4ZVHA 2E7WA 1I39A 1TP7A 2H48B 3AVIA 4DV6K 1JALA 3AVAA 7ICIA 5SUHA 1NK5A 4KY3A 4LFCJ 4CHYA 9ICNA 3GIJA 2RRDA 4DR5J 3IM9A 3DOMA 4DV3K 3MWTA 3EVOA 4L72B 1C1CB 3ZFVA 2W55A 3EEQA 2WVFA 4IR9A 4DBQA 2HVDA 2BJ1A 3TP2A 2VQFK 1LK5A 4FLVA 2XLKA 4DFMA 5MAOA 4ZPVR 3W9HA 2XY8A 1IV8A 1HWLA 1RCOB 1WC3A 3TZXA 2GC8A 4BGAA 1UPPA 1W7WA 4LZDA 3O6QA 1WKKA 2YH0A 2M9NA 2XHCA 3VA0A 1JLQB 4MIBA 3MAQA 5EU7A 3MEDB 4DJBA 1WN7A 2HSTA 2FPHX 2KICA 2H1YA 1YJVA 1VQ6N 1N6QB 3HSGA 3V9SA 4LJMA 4DSEA 2UU9K 4RJVA 2KT3A 4U7BA 3LP3A 2W42A 2B3TB 4USTA 4CF1A 2BJEA 2V6AA 3VC8A 3KNGA 1HLUA 4KO0A 2RQ5A 5JVHQ 1X4HA 3D5MA 4CHZA 2GJIA 1BHLA 3D0PA 3VEWA 3KDNA 4MTPA 5LSOA 3H25A 1HL6A 3RTVA 2GGPA 3GCWP 4LF7F 4EELA 2P1JA 1N5YB 2AMCB 3TX8A 4KE5A 2C3OA 5LMUF 5BPLA 5L9NA 5J2FA 4X4TA 3WC0A 4A61A 4ZVFA 1JNRB 4O23A 4PL2A 3CC7N 3H7IA 4BWMA 1X5PA 2VJ4A 3MD1A 3RR8A 4EAHD 4BJQA 2DKXA 4PHEA 1QQOA 2D69A 4FKXA 3R5GA 2E8OA 3AMZA 3EM1A 3THWA 4FJ7A 3A0IX 2UXCF 2E8AA 4EX6A 3R1XA 2P6UA 2KQ2A 3J7ZO 4KN7A 5CR0A 4G9BA 2W1BA 3UWTA 4K5SA 5IM0B 1C1BA 1SC4B 4MJKA 5AHXA 4Z6CA 2DO0A 3V1OA 3UKRB 3A0HU 2DCLA 4RNNA 5B0AA 4DF8A 1ZS6A 3FSYA 3VQDA 4RQ4A 3EZWA 4RQ8A 5KFIA 4H5VA 2WSCC 2H5IB 1QVFM 2D6FC 3K2YA 4NXNF 3VZIA 3AVCA 2QSWA 3QJLA 3C21A 1Q82T 1RT2B 1WSRA 1L7NA 1XN9A 2DNKA 5FROA 4FJKA 1MMNA 2OEKA 1MW7A 2V69A 2OCEA 4BXOB 3VMFB 4Z6EA 1N33J 4MEXA 3VGKA 1X9MA 4JKFA 2YNHB 3M32B 4USIA 1LVHA 5AXMA 1NGHA 2YHAA 2Q97A 1N34K 3AA2A 2RF2B 5C10A 1EARA 2K1RA 1R8PA 5G4DA 4H4OB 1U8SA 2XS7A 2O5DA 3H8YA 1GAOA 4OJLA 1MU2B 3E01A 1FDBA 2A18A 1BCMA 1UFKA 1ZQSA 1W2IA 4U6PA 4I2AA 4DG1A 2JFKA 2P9IA 2V8PA 4XTTA 3GG1A 4JK1A 2GH1A 2KZZA 2OSQA 3SENA 3BKTA 3F2KA 2G9OA 1UA1A 1C7YA 1FX4A 4CZJA 3AY0A 3MGVA 3S3MA 5A0LA 3AHPA 2ZKUA 3LO3A 2W7AA 1J54A 1FKAF 5LJ5Y 2ZJPQ 1ASUA 3H8WA 1QAXA 1MSWD 1RT7A 1D4XA 5CHIA 3CMAN 2OELA 4QBUA 1RDWX 2HIQA 4QZHA 1VQ6S 5J0XA 4U8YA 3BZCA 1RWXB 1I94F 5CZVA 3MX5A 4K8XA 1BUPA 3IP4B 3BSCA 1R8HA 5HROA 2QSFA 1XNSA 5A0YA 2GIFA 3TJAA 4F3TA 1SCJB 4HVJA 1VQ5N 5J0WA 5L39A 4LIWA 4Y2UA 3RRGA 5HO4A 1WI8A 3HCXA 1L5UA 4CO1A 3EW9A 2HVIA 6FDRA 4DV5J 3GFKB 2OPPB 4WKRA 2ZUAA 5L1MA 4B6JA 3KHRA 2AIRB 2DGSA 4CH0S 4WP8A 4UT4A 5AJ3J 4A8FA 3LZJA 8ICJA 3EY1A 2R8GA 2RQ4A 1ZQXA 1REGX 5HVFA 3WNHA 3RFAA 1B7FA 4MKVA 4JKDA 2IIHA 4JI8F 4X66F 3BGRB 1JXBA 3JQKA 3HTVA 1QSYA 3F9KA 3WKCA 2Z0GA 3AEVA 2PN6A 3IMQJ 4YNQA 1ZM4A 5AKEA 1U6FA 1SL1A 2LQ9A 1RBTA 1AA1B 2JVOA 2KVSA 1BPXA 3QICA 4OPKA 1KKXA 2B51A 3M8PA 5J2PB 3D2NA 3KOAA 4ECUA 1F44A 1E6YA 1VDHA 2YB4A 4UQTA 4H4KC 4FPRA 2KFZA 2Q36A 1XK8A 4QJVA 2BBEA 4G1PA 3D28A 4FJNA 3KZIU 2WF8A 1NZBA 3C2MA 1S0OA 4OKEA 5BR8F 4I28A 5IC4B 4YD1A 5GAHP 4JI1F 2KJ5A 4F3MA 2J76E 3U1MA 2RDDA 2LDIA 3CD7A 3Q8RB 2YJFA 4CESA 2Y8YA 3CJ9A 4AH9A 4L3KA 3M2VB 5AKLA 4A8YA 2VG6B 3VQ6A 5L1LA 4KAIA 2WONA 4CF0A 3PJXA 2E5HA 4ED5A 4IKFA 2XMUA 4LD0A 4WU3A 4M3TA 2CQBA 1U2VB 2GAHC 1S57A 3KG4A 3V81A 2LU1A 2XLJA 2E9TA 4QR0A 2EZXA 2E5SA 4OMFG 2F96A 4HI2A 2JZBB 3S6JA 4B3SF 4DQ8A 2XM3A 4OQJA 3MAAA 1H73A 3PNIA 5ETTA 3BKUA 3O9TA 5KRSA 3D66A 3CCEN 3THXB 1S9EA 4IKAA 3C6TB 5LMNK 2UV8A 2UUBJ 4X64F 4F5QA 1ATNA 2ZIUB 1LWFA 4D3GA 3E8OA 3CMAS 3CB4A 2WB1D 2QL7B 4JI2F 4NCAA 3WKEA 3BBBA 1S72N 4ISEA 5KFCA 4TN2A 1T9YA 4DZDA 1WG1A 5HAOA 4OPHA 2EDUA 4LBPA 2HBZB 4KLGA 2BZ2A 2MQMA 5ALVA 2GQCA 4LR9A 4DV6F 2FY1A 3IBWA 5FPDA 1NWKA 1VIOA 1WWHA 1VQ5S 1NJIT 1ACMB 3Q24A 2KMDA 4K42A 1KOHA 1HQUB 4RQ7A 4C11B 2O8FA 1ZQLA 2B9YA 2VQFF 1TL3A 4AHUA 3CFOA 3U3GA 3ID6A 2IDOA 1MDUB 4U67L 1ZM9A 4ZIVA 2E7XA 2AZ3A 1NJYA 5KQ8A 4I2FA 1ZQIA 4TQSA 1G15A 1FFVA 2N4DA 4UARA 4AHCA 2W8KA 2RIJA 3J7YP 2BRKA 4FPAA 3ZETA 2GUPA 1X9JA 4RG8A 2QN6B 1P9YA 4JKCA 2V9WA 2M52A 1NBEB 3IAM9 2ZJ8A 2UU9F 4X65J 1QDUB 2RRBA 4LFAF 2MZTA 1Q3VA 2FVRA 2KHQA 5AFUH 2JGAA 3ICXA 1AXQA 1YJNN 1F0MA 4HI1A 3EXYA 3OLAA 7ICUA 3NVKA 1VC6A 4GNIA 4PQUA 3PJWA 3SPZA 4O5BA 4DV0J 4KYZA 4GVBB 8AT1B 2ZZMA 1DZ5A 2YX1A 3DOLB 3QLHB 3TANA 3CJ4A 3HHLD 3G8SA 1G99A 2JXJA 1D3WA 5HBMA 3SFGA 1WG8A 4CLTA 3L7OA 5FP0A 1HPZB 3FE1A 3A3PB 3CJSA 2FXUA 1HYVA 1ZC6A 1JJ2M 2DEJA 3QRRA 2NNWA 1S6QA 4M5NA 1W97L 5KPTA 3OGUA 2N7YA 3QESA 4RQ1A 3K2PA 3AVFA 2NZTA 1O51A 2XHWA 4M8LA 3D4JA 3N28A 3PKYA 3CCES 1IKVB 5IXUA 3DLBA 5HMZA 1HBUA 4I0WA 3H1QA 3LL3A 5CQGA 3X1LB 1MWMA 3KFWX 4LUBA 2VC0A 4RPZA 1TV9A 2R8JA 1AFJA 4FJ9A 4JKBA 3T5KA 2Q79A 4FZXC 2BEFA 2CDQA 1T02A 2EBEA 4L6V3 1BE4A 1S72S 4KX3A 1NGFA 1NMEB 1Q8BA 3O6WA 1Q81T 1L7MA 3HD2A 1LW0B 3PR5B 1TK8A 2K8GA 4PYAA 1HWJA 1TL4A 3N7PD 3O3LA 3IDWA 4UZBA 5CA5A 3HK2A 4BVOA 3DLKA 2W2PP 1OPZA 1MN9A 5J2MA 4ZN3A 4O3OA 1N34F 3N4MB 4F3QA 2KE7A 3CJ5A 4AXJA 2YQ3A 3QNNA 2OTLN 3MOZA 3QU4A 2VGNA 4Y2VA 4K4IA 3SPYA 1R8BA 5J2IA 3O8WA 2A19A 3AO1A 3DM2B 3GR1A 2U2FA 4P73A 1Z25A 4DZ6A 1YT3A 2WAQD 4HVZA 2ZKTA 4DFPA 2O66A 2QB0B 1F6TA 3H98A 3SLCA 1D0EA 5I3UB 1S6UA 3DRRB 5JMNA 1V4TA 4HWIA 4DS4A 4CO4A 4ZP7A 5DMRA 4O4RA 4B9VA 4HUGA 2FD2A 5D4NA 3MM7B 2F4VK 1U0HA 1LAVA 1HYZA 4H0TB 2CZ4A 4BDPA 4GO5X 9ICFA 2ZXIA 4YQWA 1EP4B 4Z4FA 5ALUA 3ZNJ1 2JNJA 1JMTA 5HR7A 1VLOA 5KFQA 1YJNS 2HFUA 4WE1A 5J1PA 1OH5A 4CJ5A 4JI0K 2DGTA 3OYBA 2DKOB 2CPXA 3EWAA 3ZZPA 5AQSA 2U1AA 1UJ4A 2J9DA 2MKYA 1OQ3A 4KLQA 5GAEI 2WB1F 3TADC 1XU4A 2DCUB 2VFTA 1C20A 2QL5B 1RBRA 4BC4A 1ZQTA 4Z4EA 4JI6J 3UDVA 1TKTA 4M9NA 2DNOA 3UN2A 1ASWA 4ICLB 3F9MA 1A7GE 3PSPA 1TQLA 3T5HA 4RCHA 3DHWC 4TSXA 1HARA 4LF9K 3JS6A 4CJWA 3IWLA 3L4BC 3CHWA 1XMQJ 3AQFA 3RG6A 2ASJA 1LV5A 2CPHA 1GLFO 4AM6A 3CDWA 1N32F 1OUQA 4FXVA 4C0HA 2DGWA 2PMHA 4DHYA 3TAPA 5D4OA 2YWGA 1JCGA 5KFKA 4YOEA 3LW5C 4H5WA 3ETMA 1XHXA 3HPHA 2ZD1B 4QWEA 4YB5A 2CQDA 4ZTFA 2PT0A 1K8KA 3AODA 1W2BR 2UV8G 4QYRA 3HSJA 1PAUB 2W25A 1IXRA 1C0TA 3CCLN 3PYGA 4YOWA 1F1BB 4Y2SA 4CLFA 1KEJA 3WX8A 2HHHK 1RYSA 2I9GA 3OT9A 3OTDA 2HLTA 1M1GA 5I42B 3SJJA 3DGPA 5F9NA 4ECRA 4DPTA 3ZSRA 5BYRA 5ALDA 1VRQC 2KG5A 2FLLA 1RBAA 1YJRA 3FZBA 3UDEA 4BRLA 1WOPA 3ORYA 2E1YA 4MMOA 1DRGA 2DT9A 3N5BA 8ICZA 1HBOA 1MWQA 1UTAA 4ZPDA 1KHWA 4OYIA 5ELZA 2PFNA 1D9AA 2WOMA 1BPZA 2B6AA 2OTLS 1FKOB 5DB6A 1RB0A 3M6VA 4OV1A 3QXGA 4EFHA 2PMWA 3BQTA 4ZOSA 1RU1A 1K73T 3PIPL 3UIQA 3SBMA 2W4PA 2MKIA 4ILGB 4I2HA 1U49A 1KVJA 3DGVA 3IGNA 3BPSP 2MQNA 3AQPA 4Y3CA 4RW4A 5GVQA 1CQMA 1Q46A 2DJWA 2X6SA 4YY3K 1SJ1A 3O4QA 1ATRA 4H0OA 4EEYA 4ES2A 1SKSA 4X84A 1HRHA 1XR6A 2K4EA 3AO2A 1UPMB 3V9WA 3T3FA 2K06A 5BPCA 4OX6A 3UCGA 1VJWA 4EI2A 4YXMA 1VLYA 3BO4A 1TUYA 1RTZA 4KTWA 2KVIA 2YNFA 3MN6A 3BF1A 2EFPA 1IBKK 3MEGB 1H1VA 1TAMA 2P9PA 1HR0K 3M30A 2OPSA 4H03B 4WPAA 4LF5F 2RILA 3TJ9A 4OI3A 2RE2A 3JSBA 1BPEA 4UAWA 1JRPA 2CFXA 3P39A 5ITHA 3HRGA 3Q7CA 1OSCA 4DL3A 4FYVB 2BPGA 3W2WA 2CQ3A 2XSJB 5HANA 3PEHA 4OLOA 5KG3A 4CP5A 5J0SA 2B0CA 4DL2A 4ZJQA 5DDPC 5KFTA 3PRDA 2I2YA 4Y0FA 4PKDB 1ZZNA 9ICLA 5F0WA 3OYAA 2E3TA 4CE9A 3LUYA 2NO4A 3DXKB 1SC1B 1P9QC 2LKZA 4CZEA 4Y2IA 2JV3A 1JJHA 1LFPA 1UEVA 1HYSB 4LFBK 4NOHA 3TWZA 3G6YA 1HNWK 4H0PA 3HSTB 4JMUA 3K5MA 4CGHA 1URRA 3CCVN 1RT6A 1Q1KA 1RT5A 4GXJA 3SV3A 3LA0A 3ZD8A 4PHPA 4QAGA 4QW9A 2WAQF 1WOQA 1Q9XA 3KWMA 1RXWA 4PPDA 3FK4A 4DR2J 4FSVA 2JWKA 3H40A 1IIPA 3W2VA 3C95A 3SSRA 3CCLS 5ETQA 3SCIE 4QJFB 3WUHA 4IG3B 4FS2A 2YTCA 1WUDA 2P9NA 3SK3A 1J2NA 4FJHA 2V8VA 1TFRA 2EZYA 1PGZA 5C24A 2RS2A 3IBFB 1U47A 4DV2K 1T4GA 1HWIA 1WDTA 2D41A 4DPXA 3MM9A 1REVB 3PW5A 4Y65A 4UUWA 5IILA 4BGBA 3TEHB 1KCFA 4G9ZA 1DJ0A 1ZQ1C 1TK5A 3KLHA 1HKGA 4G3IA 3HPOA 1OVQA 4DMZA 2O8CB 4TY8A 1FFSB 1S59A 1RGIA 3HHNB 3MECB 1FRJA 2MGZB 3DXMB 2QZ8A 1NO8A 1J2MA 5DZ6A 1ZBUA 4JI4J 2V52B 4JV0A 5KL8B 1RUSA 2RRAA 2X6NA 4RT3A 2ZITA 2MY7A 4XEIA 4XAKA 2K8AA 4CH7A 4AHSA 2O8BB 5AKYA 4CF8A 2I7NA 3PIOL 3RMAA 5C5JA 3LGHA 5F3ZA 2WHOA 2FPKA 3VERA 5J8YC 4YMNA 1HNXK 1Y5LB 5J2EA 2K8BB 3TAMB 1NGIA 2WFBA 4FJIA 2YX8A 4FLWA 3NCIA 1UQVA 2KT5A 5AK5A 2HHQA 5EE9A 1IR1A 1HNZJ 1KP6A 1XWLA 4KRFA 4DR4K 4PL1A 2WB1C 2PFOA 3T1AA 4DV7J 1KAXA 3PYEA 3IG1A 2NREA 4OJRA 2KVQE 2KU7A 1M90O 2AGQA 2QJ3A 5HQMA 1ZQKA 2C2KB 2ZE2B 2O01C 4DU7A 2NUHA 1IWGA 3PO4A 1SV5B 4WYBA 4I6MB 4ZIWA 2M8DB 3EVWA 1FNMA 4KPYA 3R7BB 3IUCA 4K4ZA 1BC6A 2QC3A 1FRMA 1S5ZA 2OJ3A 4B1YB 3QYYA 2A1JA 2YNIA 2GO7A 3BN7A 1ZD2P 1HW8A 4KX5A 4OJ6A 2POKA 5AQMA 3L2UA 4FYYB 2LP4A 2VQEF 2E1RA 2NYIA 3KJQB 4FNHA 3K1RB 3ZSOA 4NXMJ 4CGJA 5AZIA 4J7CA 1TUGB 2IHMA 4MFBB 4CGIA 4KLEA 1VQ4S 2IM1A 2NCKL 2Z30B 3I9ZA 4WFYA 1RHRB 5LXRA 3KLFA 1JLEA 2UUCJ 5KT5A 4US8A 2KW4A 3WK9A 4CNZA 3ZT2A 4NLRA 3AD9C 2I8EA 2X51A 4Z37A 1V38A 3C6AA 4O3NA 4PG5A 1WKJA 4V19X 4OPJA 2GWKA 2WSEC 3ITHB 1RWMB 4DR3K 4I2DA 4ZHRB 4BRNA 1ZD5A 4Y2KA 1PYOB 5ALMA 2Y1JA 1LW2B 6FD1A 3PW4A 2QFIA 2GS8A 1MROB 3NF7A 4J91A 2WVCA 3HHLC 2QO3A 4DUYJ 3BGUA 1X9SA 3RW7A 2ZM6K 3O1LA 4F50A 3HKWA 3W8PA 2PXIA 2A10A 3NF6A 1WC6A 3JYTA 1XNRK 2G4BA 3CCQN 9ICQA 4M5HA 3ZCMA 1AYEA 2IMWP 4ID5A 1JROA 2YKMA 2DHGA 2LXIA 3C7NA 3RBEA 4ZH4A 2ZC3A 4M7XA 1L8LA 4AM7A 4N76A 3I0RB 8ICVA 2W6LA 1UFWA 1H2TZ 1PCAA 1PVRA 3TAGA 4ECVA 3I1YA 4LVSA 1RI7A 2JEIA 1JX4A 1J5EK 5AQYA 2N4CA 3CULA 1WJ9A 1GLBG 3EUB2 4WJBA 4BRAA 3HMJG 4XPEA 4MFFA 3EKUA 4FZZA 4NO7A 4LRCA 1V9OA 1SXDA 1GX5A 4DOAA 2D0PA 2FJBB 1NLVA 5CD4A 3HDSA 1VMBA 2QA4S 9ICRA 3F0NA 1FVSA 2VFUA 5CYMA 4ZVSB 5AKKA 4FL9A 3MPVA 2GV9A 2HLUA 4AL5A 4DX8H 1UZHA 2IOHA 2R2UA 5IIOA 2JEFA 2HOQA 3V4MA 4JD2B 4CJ4A 2P9LB 4OGCA 2B4OA 4QYZK 1ZBSA 2XZTB 1VQPN 4OYAA 2G13A 2QXLA 3EN9A 3R5DA 5H9EK 1JL1A 2FMSA 2HFVA 3JTOA 4WQ5C 3H1VX 3JPQA 4IOCL 2C2DA 5ADXA 1RWPB 2R2SA 4DR1K 2E1FA 3AARA 1BQNB 1GEHA 2QMXA 4OZ1A 5AQVA 3D6HB 1IBKF 5DB9A 2HQ3A 4CEZA 3HHEA 1A5VA 3WXMB 3CF5L 4U95A 3ZI4A 4MYUA 3D1HA 2EKNA 4R63A 1HR0F 3LOUA 3OTOJ 1C1CA 5B0FA 1K9MO 2DQNB 1CZBA 5F8LA 3NASA 4OHZA 4LF8K 3JSYA 8ICIA 4DU4A 2JH3A 2FC8A 3N79A 5E3PA 2WSFC 1U24A 4BWJA 5JUMA 2DH8A 2XO7A 2H54B 3KHYA 2FY8A 2HNZB 1L3KA 3IR7B 1JLQA 4WK1A 1S7HA 2V2KA 3MK6A 2BDUA 3OR1A 1N56A 4LFBF 4M7YA 1H6KX 1YG0A 3DLJA 4OI0A 3MR2A 4GKJF 2G08A 3HRDD 1EETA 1UT5A 1RXVA 1YKWA 4YP3A 4PCQA 5HMWA 5D0RA 3J80O 4ZCMA 4DV4K 3B8HA 4LSNB 1ED1A 1IKXA 3KLEB 3TX0A 4AL7A 4KKOB 5GAGP 2W40A 5IWAK 1YGYA 3G6XA 8ICBA 3CCQS 1NKEA 3OYNA 3ATVA 5HQLA 3MOJB 4YG2A 3C15B 1P6TA 2XYHB 4R66A 3SBGA 3CJQA 2ZOMA 5J0YA 3TUIC 5GAHI 4E7JA 1FJGK 4OHVA 2IJFA 3I5BA 1ILYA 4QZEA 4AT1B 1ZJMA 3KTQA 5T7BA 3H0MB 4ZVOB 9ICWA 1T7PA 3FBCA 4IFVA 2XMJA 4XK8C 2YKNA 4E89A 4KB0A 1GTEA 4IQWA 1FRKA 4K41A 3UQSA 4O3RA 4N56A 2OO4A 3CSKA 3HHKA 1T3NA 2IA0A 4B3RJ 3OVBA 4RTFD 3UQ0A 5IM0A 3TZYA 2ZUGA 4LRFA 4P6QA 4JBCA 2HOIA 2B5JB 3LM9A 3W5ZA 1RAAB 5AI9A 2IBKA 4DCOB 1EKEA 2P9KB 3UKRA 4O3MA 1OMSA 3ZZ0A 3VEVA 4MKBA 2HS4A 4UOCA 3LDLA 4F4KA 2G5IB 2SXLA 3C6UA 4CFBA 8ICAA 2W6KA 3OXGA 4LVNP 4CTAB 3QBWA 1VSKA 3J80U 1VSMA 3UFCX 1RQ0A 5L46A 2LA4A 1KWMA 1RT2A 1LAWA 1MWKA 3A5LC 3PIPQ 2GEMA 2DR6A 1SQKA 1VQPS 3IFRA 1M5KC 2NUBA 1FD8A 3TU5A 1DBDA 3ZX3A 4NLZA 2HGLA 3ZZZA 2YNHA 1R0CB 1CLFA 2R18A 2RF2A 4FVCA 1RAEB 1JUDA 5IT9Y 4H4OA 4UTGA 4DQIA 4Y28C 4IRDA 3BSAA 1MU2A 2FJAB 3PW0A 2JLFA 4ELUA 4LZGA 3HXMA 4FN5A 4DTRA 1VQLN 4MFAA 4J9LA 2XMAA 3MMAB 4DR4F 3BO3A 4BDYA 4K59A 5DM7L 3UNGC 2A0FB 3D1OA 3EUNA 2BQRA 2ZJRL 3G9CA 3SFUA 3DI6B 4PG4A 2ZIVA 4PGQA 1YUWA 1ESVA 3PV8A 4U9RA 1NLKL 4RR5A 2HBKA 1VRUB 2H51B 1KQSM 3U9ZA 4CF5A 4USWA 3M6KA 4WFAQ 2IHR1 3WK7A 5FJ4A 4CLPA 3W61A 4CJQA 2IHNA 3TRGA 1Q86T 4PJ0U 2GVZB 3J7YI 3LAMA 2CPIA 4ZDNA 4KLLA 4MT1A 4P7VA 5LJVA 4B3TK 1B7YB 2C3UA 1Y64A 1RHKB 4GIBA 3TAEA 1VQNN 4ER8A 4DOCA 2RHFA 2QXFA 1WG5A 1XC3A 3OTBA 3FGVA 3GP9A 2RP5A 1F60B 5DQHA 2OPPA 4KI6A 1L7PA 1T6CA 3AQOA 3C2KA 3LDNA 3AB4B 1X0PA 1DQAA 4XRHA 3W66A 2P5GA 4QPXA 1JLFA 2BW7A 2KYXA 1YSJA 9ICUA 2XY6A 3LK9A 4FNIA 3C19A 2KG0A 3K89A 1NGJA 4Q0BB 4MF2A 3ENOA 2O4GA 1I3AA 4CD3A 4JOUA 3UW1A 3QU9A 3WK6A 3MGIA 4DUZK 2DNPA 4DR3F 3W7BA 4X4OA 5EHHA 2VKZG 1A76A 3IS9A 5BR9A 4QWDA 4WFNQ 2FMQA 4QOTA 1N33K 1U0SA 4QZDA 4RW6B 1LXJA 2JC0A 1AFIA 4M5KA 3FM9A 4F2SA 4GVMA 1M5OC 3IV6A