3PX0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and dctp-da mismatch (tautomer) in closed conformation
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
579
structure length
557
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 190
structure length 557
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px0A01
5HP4A 3PMNA 4E7HA 4DU4A 4FBTA 2G8FA 3AA4A 2HNZA 5DDYA 1JLQA 1RT6A 4KB1A 5HHHA 4LSNA 3T1AA 5I3UA 5C5JA 4UQGA 2PZSA 1G15A 4MFBA 5IIOA 3NHGA 4FJJA 1KVBA 1WN7A 2AGQA 1H38A 3PNCA 1NJZA 3AA5X 1C1AA 3V9ZA 8ICKA 4RPYA 4FJXA 4M6WA 1T8EA 5KRTA 3NGZA 2XHBA 5KFXA 3ZT2A 4RQ7A 5CZ2A 3V6HA 1TL1A 3AO5A 4BWMA 2XY6A 3M9MB 4W5RA 1S9GA 2PFQA 2YNIA 5J2IA 2ZUCA 1LWEA 1T3NA 1QQCA 2HHSA 5KFLA 4B9UA 4ELUA 4M9JA 4PH5A 1RTJA 1ZJNA 3NTUA 7ICSA 2IC3A 4DTMA 1NJXA 1RT1A 5KFGA 4O9MA 1S0NA 2I1QA 4C8KA 7ICIA 4RNNA 1IKXA 4RQ5A 3V72A 4ED6A 2P51A 3OS0A 2X74A 4Z4FA 9ICBA 3PO5A 1UA1A 1C0TA 5J2QA 3AVLA 3QIPA 3MBYA 3G6VA 4CJSA 9ICUA 4NLKA 5SZTA 3V1RA 4B8CA 4OPKA 3PO4A 4CJVA 1XHXA 5HP1A 9ICXA 3KHGA 4O0JA 1RDBA 2IGIA 3ZT0A 3QEIA 1U49A 4KFBA 1Y88A 3KTQA 2ETJA 2IHNA 1TVRA 1NK4A 4CF2A 4LH4A 3OYMA 2BCSA 3QINA 4KN7A 3UQ2A 3VQ8A 4CFBA 3B6OA 4GXJA 2HHXA 4W5TA 4FLTA 3T5KA 1VSEA 9ICAA 5CB1A 1NJWA 3OS2A 1WSGA 3AA2A 1BHLA 1SL2A 3MR2A 2FPMA 4CJQA 4CJKA 5L1LA 4CF0A 1B9FA 3DLBA 5J2BA 2EHGA 2ALZA 4ECYA 3AVBA 4FJ7A 1HJPA 1QSYA 1XSPA 4J9MA 3OYIA 2FPLA 5KFRA 2BR0A 4CEAA 1RT7A 2G8KA 3KLHA 5KFWA 1C0UA 2YHBA 1RDCA 7ICQA 1L3VA 1RBVA 4EP5A 2PFOA 2FMPA 4QAGA 1ZQIA 1X9WA 2FLNA 4TQSA 4KI6A 4FZYA 7ICKA 4CK2A 9ICIA 2OYQA 4M3YA 5DLFA 4YNQA 4I28A 3SQ0A 3HSTB 3QNNA 3TABA 1TAUA 4QW9A 1ASUA 1I39A 4FW1A 2R8HA 2HHWA 2KFZA 1WSEA 4BDZA 3GV8B 2UVUA 4O44A 4FS1A 4O5KA 4Q8FA 2KZ3A 3WNEA 8ICTA 3C21A 4MQ3A 5DQIA 3S9HA 4CCHA 2DY4A 2JEGA 4ID1A 1CEZA 4QOZB 3UQ0A 1RBTA 4RQ6A 5EOZA 4MFFA 3RRHA 3DOLA 3V81A 3C1YA 1HNIA 3PX6A 1ZBIA 4DL4A 2B4JA 4R65A 4LSLA 1RT5A 3NH2A 2F96A 2Q3SA 1EKEA 3S3OA 4TUQA 5DDMA 3MEEA 3NDKA 4DTUA 5J0UA 1VRUA 4DQIA 4CHOA 2ZTDA 2BCQA 4JRQA 1KFSA 2YNGA 3L2RA 4UAYA 4DLGA 5KT7A 4PWDA 3QZ8A 3SPZA 3DM2A 1XS9D 4M42A 4KREA 1AROP 4I2BA 3HW8A 1KRPA 1VSIA 2P1JA 2KW4A 4DO9A 4PGQA 3VQ6A 5BOMA 3M8QA 1Y97A 4EP4A 1A77A 3DOKA 4BXOB 1EX4A 1TVAA 3NGYA 5J0XA 3SQ1A 1HMVA 1F21A 1NJYA 1N6QA 1BCMA 4YMMA 3O3FA 4L8RB 5BOLA 4F91B 1B43A 4J9OA 4KHNA 3AO3A 5CP2A 1JL1A 2R8GA 4E1MA 3G6XA 4Q43A 4ELTA 5EWEA 1K6YA 3L3UA 4CESA 4N56A 3OVNA 3RR7A 4NCBA 4J2AA 3RAQA 4I2AA 5KFJA 2R8KA 4DTOA 4YMNA 4RUCA 4KLJA 4QZDA 3OYFA 5KFTA 3MECA 2RDIA 4CF9A 4FJHA 4DQSA 4I2CA 1XHZA 4B9LA 2FPKA 1KSPA 4I29A 2DFEA 4NXZA 1B92A 1DTQA 4CGDA 4DQQA 2OWOA 4AH9A 1KVCA 1BPEA 4K4HA 1S0VA 2DPJA 3QEPA 5KG7A 4KLSA 4N47A 3T3FA 1W9HA 3V9UA 3DLKA 3ISBA 2AQ0A 4PQUA 2FLLA 1KFTA 4Z4CA 2ZUBA 3SV4A 4RQ3A 1LAWA 3TARA 3RTVA 4RPXA 8ICAA 4JV1A 3WNHA 1J9AA 4UB5A 1NK8A 4I7FA 4YR0A 4KLIA 1U45A 3ZSRA 3G6YA 5KFSA 2F1JA 5J29A 3LAMA 4ELVA 4FJKA 9ICSA 1L3UA 7ICUA 1N48A 4ID5A 2JEIA 3AVGA 3H4BA 8ICCA 3PW2A 4M0AA 2KFNA 2BQUA 4KLOA 3KHRA 5IILA 4JS5A 4FJLA 1A5XA 5DB7A 1BPYA 3C1ZA 4KAZA 3HPGA 5J2EA 4EYHB 4DFMA 2YV0X 2AJQA 2BGGA 1KTQA 1BI4B 1XI1A 2HNDA 4NCGA 1WAJA 3AVIA 3PX0A 1HJRA 3PY8A 3RRGA 3THVA 4LH5A 4PHEA 1X9MA 8ICUA 5L1KA 1KEJA 4ZTJA 4DTNA 3GIMA 4FBUA 2KZMA 4J9KA 3IHQB 2QKBA 2VWJA 1HUOA 3T5HA 4RPZA 1IO2A 4YN4A 3MAQA 4FM1A 1XC9A 3V6DA 1EXQA 2UVRA 5KFYA 4B9VA 3KIOA 2VA8A 8ICGA 4NM1A 4EYIB 4CFDA 1T03A 2OA8A 4ECUA 3NGDA 2ZE2A 2VA3A 3ZSVA 2KQ2A 4UAZA 3C5FA 1TV6A 3ZDDA 4J9QA 4C8MA 4CIEA 3TFRA 2XY5A 3PW0A 1C0MA 3MR3A 3QEXA 4FJ5A 2FLPA 3OSNA 2JEJA 2V4RA 5KFKA 4FS2A 2LSNA 3DLRA 3JPOA 3VN5A 1Z00A 4QCLA 4YFUA 1C7YA 3HPHA 4JLHA 3OJSA 3C5GA 4B08A 3MXIA 4Q5VA 1ZQLA 3AO4A 5KFDA 2A1JB 4E0DA 3V9SA 3AV9A 2OPSA 3OYJA 4IKFA 3DMJA 4R8UB 2ZTCA 2AGOA 4W5NA 4F50A 3ZSYA 4CHYA 4E1NA 4UAWA 4ECRA 2J6SA 3HK2A 4CEOA 3DLHA 5D3GA 4M9NA 2GV9A 1C1BA 2IDOA 4BACA 3RBEA 3RJIA 3V1QA 1L3SA 4AHUA 1DTTA 2ATQA 1WSJA 3IG1A 2NRZA 4RQ4A 3JPTA 4DFKA 1CZ9A 1ZETA 3CQ8A 1LWCA 5JS2A 1RXVA 1NKBA 2HHVA 7ICRA 3D45A 5DG7A 4OPJA 1Q9XA 1HUZA 1HRHA 3WNGA 2E6LA 2BKEA 3AVFA 5FROA 2C22A 3VQAA 5HROA 1QS4A 4M3ZA 2ZJ8A 4F4ZA 3ALYA 9ICMA 5DQHA 3DRRA 3JPNA 2PI4A 2E6MA 4PPXA 1S9FA 4KN4A 5KI6A 1XO1A 1NK0A 1IKVA 4EBDA 1RBUA 3K5LA 1BL3A 4PA1A 3LZIA 3RAXA 5FRMA 4I9LA 2R8JA 4HCCA 1HQEA 4ECZA 3HVTA 5C25A 3ZCMA 3PW5A 4DG1A 5KFOA 1QSSA 1BI4A 4XA5A 3OJUA 1BGXT 1NKEA 3KK3A 1Z25A 4ZTFA 3RWUA 3ULDA 3KHLA 4M9LA 3NH1A 4JS4A 4AILC 5DBCA 4CHPA 3LP0A 2ISPA 4QWCA 1YTAA 1FXXA 4KLMA 4ED7A 4RW4A 1SKRA 1D9DA 3SUPA 4ED3A 4LZDA 3VQDA 4ED1A 4DS5A 5FRNA 3MR6A 5BPCA 5DG9A 5KFUA 4KMUA 4C8OA 3HL8A 3RJGA 8ICBA 1W0HA 1YTUA 2PFNA 5J2DA 3EPGA 3KD5E 1I3AA 3GQCA 5FDLA 3TWHA 4IG3A 4PHDA 1BPBA 2RF2A 1U04A 2FMQA 3V6KA 4RW6A 4F4KA 4KB0A 4RU9A 2A1JA 1RYRA 4IFYA 4CEFA 7ICHA 2DTUA 3SNNA 2IMWP 4DU1A 2M9NA 3V4IA 4YXJA 1TAQA 5DGAA 4CEDA 4DL5A 4JWMA 2IS3A 3T5LA 3C2LA 1S1UA 2VG7A 4ED8A 8ICLA 2Z1JA 1QE1A 2BGWA 4IR1A 4J9LA 2DPIA 4E19A 5CWRA 2EX3A 3ZD9A 3EWAA 4KLDA 4CJPA 2HW3A 2FBXA 4Q8EA 3IAYA 3FFIA 4J2DA 2XCPA 4XQ8A 4ED2A 1TKXA 4DFPA 1NK7A 5KG4A 4KLTA 4M41A 2QK9A 1XSLA 2DFLA 4KLUA 4OKJA 3FDSA 2G8IA 2G8UA 2KTQA 4LD0A 1RDAA 3RB3A 1CXUA 2X6NA 4CJ5A 2PXIA 4QWDA 3CYMA 1ZQOA 3VQ7A 4CHZA 3O3HA 4KI4A 2YHAA 4CJ4A 1N56A 2XO7A 2VG6A 4HUGA 2G8VA 2G8HA 3PR5B 4R5PA 5KTQA 4CJEA 5F9NA 3LWLA 4Q45A 3OYDA 3H8SA 5CJ7A 4ECQA 2D0CA 5J2CA 3GIIA 3HXMA 4CF8A 3KKRA 3JPSA 4F4WA 9ICTA 3QO9A 5KT3A 4M3TA 4UB3A 4M2YA 3ETLA 3AUOA 4Q0BA 3ZSOA 1V9PA 3ZD8A 4CGFA 2NRWA 1KLMA 3NF8A 2HVIA 5E41A 5KGXA 3C6TA 2XRIA 1SKWA 3CM5A 2ASLA 2BCUA 4YMOA 1BISA 1VSKA 4FM0A 1ZQJA 1WSFA 2J6TA 3HM9A 2JEFA 5CA7A 4DFJA 4JV2A 1GOAA 3CFRA 4G3IA 1XU4A 1YVUA 1S6PA 4KHQA 2F1IA 4KITB 1NOZA 3ZDBA 4DSIA 4ED0A 3RH6A 4CHNA 4DOCA 3U3YA 2ATLA 4DQRA 4IBNA 4BDPA 4F8RA 1B22A 3UXOA 4OJRA 1C6VA 4YD1A 3P1GA 3M9OB 2AGPA 3NFAA 4YXMA 1X2IA 4QZFA 2IA6A 1WCLA 2WONA 4KTQA 4HCBA 5L1IA 7ICMA 2VG5A 4GVMA 3MR5A 3ZT1A 3RMAA 5T7BA 3S3NA 4ECSA 4M04A 2MAXA 4TSXA 2XY7A 5CR0A 4ICLA 5HRNA 4CJLA 3KHHA 3QEBZ 4E89A 4NYNA 3IM1A 3Q8LA 2OZSA 3EPIA 1U4BA 4M3UA 2NRXA 1ZJMA 9ICGA 3IRXA 4FLUA 3OYBA 3QIOA 1D8LA 4BWJA 8ICPA 3AVMA 7ICJA 1JLCA 4HHTA 3DLGA 3H7IA 4QZIA 3LZJA 4N5SA 4QZ8A 1GOBA 5J1EA 3KLGA 1Q9YA 8ICRA 3M9NB 9ICOA 2QXFA 1WAFA 3RMCA 2IAJA 1BQNA 3OGUA 3TAQA 4IDKA 4I9QA 4CJUA 4BDYA 4O3OA 1JN3A 2C2EA 3MFHA 1BPDA 3DLEA 2NRTA 1ZQRA 3RR8A 1ZQMA 1EP4A 1CUKA 3WNFA 4K4GA 4FK0A 5DG8A 8ICFA 4KLLA 4CIGA 1RBSA 3AU2A 1RT2A 1SV5A 4LY7A 4TUPA 1ZQPA 2Z1GA 1ZBLA 4TURA 4EEYA 2QKKA 4KHYA 1JXEA 1KCFA 4LVSA 1ZQGA 2P6UA 1ZQNA 4DMNA 5IIIA 3LWMA 4F4XA 3ITHA 4TUSA 4GW6A 3OYHA 3GIKA 2FBYA 2FC0A 1ZQCA 3F9KA 7ICEA 1T7PA 4NLZA 5J0QA 4QZ9A 5IIKA 2H5XA 1DGSA 1ZQUA 3NF6A 4M9HA 1RTDA 1EXNA 1C1CA 4CERA 5L1JA 5KT6A 2JZBB 1RT4A 1IH7A 3RH5A 4ECXA 3ZSXA 4IQVA 4QZAA 4RT3A 4B9MA 2HVHA 2RDJA 3M8PA 3AVAA 3TQ1A 5J2JA 2I9GA 1RNHA 3MEGA 4FZXC 2XC9A 1UT5A 2DFHA 1VSMA 5HMMA 4GXKA 5KG0A 3CM6A 3BQTA 4UBBA 1S97A 4M3XA 3HYFA 1Z26A 4DTSA 4AHSA 3KLFA 3G0ZA 3V1OA 4CGIA 5J0YA 3ZT3A 4Y1CA 2F8SA 5IINA 8ICEA 8ICZA 5IIMA 4RQ0A 3B0XA 3MDCA 3UXPA 5KFZA 1ZQAA 3HX0A 1KFDA 2FBTA 3QE9Y 4OVLA 1RZTA 4EZ6A 4FJGA 5J0OA 4FK2A 3ASMA 3VA0A 2AU0A 4UBCA 4CFCA 1S1WA 3VQ5A 4CK3A 4I2PA 4I2GA 1TK5A 2ZD1A 4WE1A 9ICCA 2RKIA 3KD1E 5D46A 4GLXA 4CEQA 1X1PA 3H40A 1S5JA 2ASJA 4RW9A 4DOBA 2YNHA 2BHNA 5KT4A 2BE2A 2OPRA 3TI0A 2BCVA 5DLGA 3V7KA 1QSLA 3L2QA 2R7YA 4KV8A 4RNOA 3QESA 4YD2A 7ICLA 2Q0ZX 4JWNA 2ZJAA 1O1WA 1RPLA 4TQRA 5KFQA 4MEXA 4QW8A 1HYVA 4GMJB 4P4PA 5CZ1A 2YNFA 3EZ5A 3H8JA 5DMRA 4DSFA 2W8LA 1SL1A 3K2PA 4MF2A 2IHMA 1D5AA 1WSHA 1YT3A 1UAXA 3C95A 4BXOA 1JLAA 4FJIA 4F93B 4PUOA 3O3GA 5KFEA 3LP3A 4F5QA 2W9MA 3BQ0A 3O4QA 4XIUA 3TFSA 1S76D 3GV5B 3PR4A 4YQWA 5KFAA 3B6PA 1J5OA 5DB9A 3QERA 5HNKA 3L3VA 4RZRA 3LK9A 4DTRA 1ZYQA 4HUFA 3I0RA 2HMIA 5HHIA 4FLWA 3RMBA 4KLGA 2FMSA 4DQPA 3AO1A 4P2HA 4BGDA 3QETA 5KFMA 2GWSA 3Q8KA 5C42A 2B5JA 4FZZA 3MEDA 1K1QA 2GBZA 9ICNA 3HP6A 3LDAA 5J2MA 1MU2A 9ICEA 2OZMA 3LALA 3SCXA 4K8XA 1SKSA 3KKSA 5DQGA 1WSIA 4N76A 2V4QA 4O3RA 1S1TA 4KKOA 3ISDA 3N97B 5KG2A 4CJ3A 1BQMA 4N41A 4IFVA 4H8KA 1BCOA 3L2UA 4X5VA 5TZVA 5KG1A 4Z4EA 4AHVA 4UB1A 1FKOA 4FW2A 3RH4A 1K1SA 3VQCA 4PHPA 3NBPA 3UIQA 3NF7A 2ASDA 2A1RA 9ICKA 5KG6A 2OPQA 2DFFA 4DLEA 1RILA 4CGGA 8ICQA 4LZGA 3KLEA 4W5OA 3TAPA 4QWAA 3HT3A 8ICXA 3Q8SB 2O4IA 3V7LA 2OPPA 1BPXA 3T5JA 3NGIA 4F2SA 1WCNA 3T19A 3KK2A 2KZZA 3DYAA 2IOCA 4DL6A 7ICVA 3K4GA 1Z3EB 4PY5A 1ZQXA 3SI8A 4DOAA 4QWEA 1VSDA 2BPFA 1A5WA 1U9LA 1KLNA 5EWGA 1UT8A 3IS9A 4IRKA 8ICJA 3BJYA 1TK0A 5KFBA 3RB4A 2W9AA 3MXJA 2BQRA 2FBVA 3OYEA 3ORYA 5DK5A 1JKHA 4NY8A 4EBCA 4CJWA 4O3SA 4B3OA 8ICVA 3I8DA 3AU6A 1ZQDA 3K57A 2V9WA 4P4OA 4FJMA 2PYLA 4OKEA 3P5JA 1NOMA 2J6UA 2A1SA 1TKDA 8ICNA 3I0SA 1NOYA 8ICWA 7ICFA 5F9LA 4KLHA 1DOQA 3V9XA 3L2WA 4DSJA 1ASVA 2XY8A 5JUMA 4BE2A 1T4GA 4B8AB 5IIJA 3MXMA 3RJJA 3S3MA 4UB4A 1RXWA 5JS1A 1MQ3A 3SUNA 3LDSA 4O0IA 9ICLA 3Q8MA 9ICWA 1U47A 3SI6A 4F5OA 9ICVA 1S77D 3TAGA 1S0MA 4IG0A 4F4YA 4RG8A 1QLNA 3PX4A 1ZQQA 4J2EA 1XWLA 3EW9A 3P83D 5HBMA 4YVZA 4R8UA 1MSWD 5DB8A 8ICSA 1JL2A 2UVWA 3H08A 3C23A 4AHCA 4QWBA 3SUOA 8ICMA 4FO6A 5CHGA 4I2IA 1JLGA 1N5YA 1CZBA 2P5GA 5DGBA 4M3RA 3C2MA 3E01A 4RNMA 4IRCA 1QHTA 4Z4GA 3DRSA 5J2AA 4CGHA 5KFIA 1IKWA 1TFRA 9ICFA 3VQ9A 8ICYA 2HHQA 2NRVA 2VANA 4G1QA 4C8NA 1S10A 4IQWA 3Q8PB 3Q8RB 1ZQWA 5J2NA 4KTZA 3OHBA 2E4LA 2NUBA 3EY1A 1LV5A 4E7JA 3NE6A 4J9PA 3GILA 2XGQA 1JLFA 4Z6EA 3K5MA 4FJNA 3JPPA 1HYZA 2X78A 1LW2A 3LPTA 3QZ7A 5L9XA 4ECVA 2YKNA 5KRSA 1HNVA 1ZQEA 2YKMA 2JLEA 4NLGA 3BDPA 3AVJA 1PZNA 7ICNA 4RT2A 3CFOA 4HTUA 3GFKB 4DF4A 1RYSA 1VSHA 4CGJA 1EETA 4FCYA 4DTPA 1SZPA 1ASWA 4KPYA 1TV9A 2IBKA 5J0WA 5J0PA 4O4GA 3BGRA 4B9NA 4F3TA 3OYLA 5HLFA 2C2RA 1BPZA 5CYMA 4FJ8A 3RJHA 3LPUA 3V9WA 3OS1A 5I42A 1LB2B 5SWMA 3OYGA 3JSMA 3H4DA 2Y1JA 3TR8A 4GC7A 3V6JA 3ZT4A 3VQBA 3A2FA 4J9RA 1NK9A 7ICTA 4Z6CA 5C24A 4O3NA 4YP3A 2Z1IA 2F8TA 1VSFA 2MUTB 4YCXA 4CEBA 4O5CA 1ITGA 4O3PA 3NH0A 4YG2A 3SQ4A 5HRSA 7ICOA 2B6AA 5DKWA 9ICHA 3RBDA 4QZHA 5KFVA 4F5PA 4ECTA 1JXLA 4RW7A 3QEVA 4DSKA 2HNYA 2D0AA 5J0TA 4Q44A 3C6UA 4B9TA 3RMDA 4I2JA 4FVMA 4CECA 4JRPA 3GDXA 1A76A 4O5EA 5EU7A 1J53A 3ISNC 1HYSA 2W9CB 1RTHA 3G10A 5J2FA 3H8WA 5D4BA 4NLNA 3ZSQA 3RJEA 1D9FA 3Q8QB 4KRFA 1CXQA 3E2EA 1S6QA 3C94A 4O5BA 5KFPA 3JYTA 2BPGA 4K8ZA 3LANA 4CHQA 1U48A 4H4MA 3SYZA 3QLHA 1JX4A 4UB2A 3TAFA 4PGXA 2C2DA 4FXDA 4HYKA 3KLIA 4E7LA 4JUZA 4DL2A 1FKPA 1S0OA 3LAKA 4M45A 3F73A 9ICRA 4CIFA 1TL3A 2W8KA 4EZ9A 4CF1A 1B9DA 1L3TA 2KN7A 2ZTEA 3C2KA 4KO0A 4R66A 4OLBA 4NCAA 4O3QA 3K5OA 3HVRA 4NYFA 4OGCA 1T05A 4RQ2A 1LWFA 1ZQFA 2O4GA 2UVVA 2BANA 3ZDCA 3NAEA 4ZHRA 3RJFA 4QZGA 3VA3A 3B0YA 5J2PA 4KLFA 4DL7A 2W42A 3HO1A 2HHUA 9ICJA 4BE1A 1JLEA 4CJTA 3ZSZA 4Z4HA 4AHRA 4C8LA 4Z4IA 3ZSWA 1KDHA 3OYAA 4GC6A 4YR3A 2ZJ5A 4ZH4A 3VQEA 1TKZA 2ISOA 5DBBA 1S1XA 4Z6FA 4J9NA 3V7JA 3ZDAA 4FJ9A 3NCIA 1IXRA 5J2KA 1KVAA 1XSNA 5EWFA 3AVKA 3QEAZ 2ZQBA 4W5QA 4AHTA 4CJFA 3L2VA 1SL0A 1TGOA 3SUQA 3LP2A 3K58A 1ZQYA 3MGHA 2F1HA 4I2QA 2P5OA 1ZQZA 3HPOA 2Y1IA 1Z00B 4MF8A 5J2HA 4K4IA 1RBRA 4JV0A 4KHSA 1UOCA 2MUTA 1VK0A 4MFAA 4HUEA 1TKTA 3VQQA 1ZBHA 4QZEA 4KLEA 3K5NA 3ZDEA 3DRPA 4KHUA 1ZQVA 1ZQKA 3HP9A 3K59A 1R0AA 3U6FA 5KGWA 3GIJA 2ITGA 5KT2A 4F5RA 4DS4A 1QTMA 1IKYA 4R64A 4XRHA 4H4OA 4RQ1A 4PHAA 4O55A 3HJFA 1ZQBA 5J0SA 4E3SA 2W9CA 3SJJA 5J2GA 3NF9A 1L5UA 3MABA 2R8IA 4DSLA 2D0BA 3JPQA 1J54A 3SPYA 8ICHA 3PMLA 5KFCA 1LW0A 8ICIA 3OY9A 4RW8A 9ICQA 3MGIA 1S9EA 4E7IA 4B9SA 5KFNA 2HHTA 1UWBA 5J0RA 2Z1HA 4RQ8A 2JGUA 2HB5A 1ZQSA 1VRTA 1VSLA 4QZBA 2XCAA 3LP1A 1DLOA 5KG5A 4RUAA 3PW4A 4DEZA 5HRRA 4F92B 1ZQTA 4DL3A 1JIHA 5KG3A 3SZ2A 5CYQA 3FYHA 7ICGA 3RB6A 3BQ2A 4M9GA 4IQUA 1WLJA 3UXNA 2W9BB 2VA2A 1RTIA 1ZBUA 5DBAA 1BVSA 1GOCA 2PI5A 5D49A 3PW7A 4ECWA 1D8YA 3VQPA 4I2FA 1RDDA 5HMLA 1MC8A 3QEWA 1S1VA 3TANA 2P66A 4P4MA 1WNSA 3RJKA 3AVHA 2G8WA 1HPZA 1IG9A 2PY5A 3CG7A 4FLVA 4E7KA 3KJVA 2BPCA 1JLBA 4HVJA 3M8SA 4YR2A 4F5NA 1UA0A 4F3OA 2C28A 3PVXA 3PUFA 1RT3A 3CFPA 1NK5A 2AQ4A 2WOMA 2WTFA 4M47A 3EYZA 4DU3A 4I2EA 3MDAA 2LYHA 3O4NA 4DTJA 2JZBA 1CLQA 4MEYA 1Q8IA 7ICPA 1NKCA 4CEZA 3SQ2A 4CE9A 4OGEA 4Y1DA 3QNOA 2VWKA 4M6WB 3DI6A 2XGPA 3UPQA 3OHAA 4DF8A 2RPIA 1LAVA 3M8RA 4J9SA 3AA3A 3RB0A 4FLXA 3K75D 4FK4A 4M3WA 3MFIA 3D0PA 4Z0UA 1JXBA 4FLZA 3TAMA 4IR9A 3U3GA 9ICPA 4MFCA 1SUQA 1BIZA 8ICOA 2BQ3A 4NM2A 3OYNA 1MQ2A 2BDPA 4YFKA 3BQ1A 4OLAA 3TAEA 1HQUA 3AVCA 3OSPA 4KTWA 3PV8A 4CK1A 2BCRA 2P6RA 2D5RA 4J2BA 1IM4A 3JPRA 4I2DA 1RCHA 4R63A 1A5VA 4CFAA 4FLYA 3OYCA 4EBEA 5CY4A 2RN2A 2PFPA 3ISCA 4I2HA 2ZUDA 4IQTA 2PYJA 2GUIA 5KFHA 1FK9A 5HRPA 4CEEA 3N4MB 4OKKA 3KK1A 1NK6A 5K14A 2B21A 4KLQA 1X9SA 4BE0A 3L8BA 1BIUA 4PGYA 3OYKA 2W9BA 3AVNA 4JK1A 5KT5A 1VSJA 4DSEA 3AO2A 2X6SA 4FYDA 4Z6DA 4KHWA 4FM2A 4XUSA 3SV3A 4CJRA 4DWIA 4IRDA 4QZCA 4F2RA 2I5JA 4DTXA 1ZQHA 3GV7B 5DB6A 1REVA 4I27A 1ZBFA 3VQ4A 1COOA 1TK8A 5KFFA 4GXIA 1JMSA 3HWTA
chains in the Genus database with same CATH superfamily
4E7HA 3EUB2 1F0MA 2CPFA 6FDRA 1BU6O 2D3DA 3AAWB 1FWLA 1LOTB 2HNZA 1RT6A 4KB1A 4LSNA 1NGFA 3FZHA 3NCQA 1HHQA 4DMZA 5DO2A 2O5DA 4FOIA 1L3KA 4X4VA 1SGGA 1VQPS 2PZSA 1P27B 5ALVA 5ALHA 3CNHA 3W65A 2FZKB 4KGKA 3PNCA 3M6VA 4DV0J 4Y34A 3HM8A 3BM7A 2O8DA 1T8EA 3MZIA 3UD4P 1QDUB 3C19A 3T1HK 5GAGU 2XY6A 2E2QA 3ALRA 2DGQA 4WP9A 3UR3C 2O8FA 1QQCA 3MD1A 4FDFA 3HDSA 4M9JA 2GTDA 1RTJA 2VU5A 5AI6A 1NJXA 1RT1A 4QIWF 1Y3JA 2KHOA 1Y5IB 1YVFA 4NLCA 3NY0A 4CTAA 1Q7YT 2KV2A 1HNIB 2HOEA 3RSEB 5HR6A 4RUBA 3QUQA 4B3TF 3DLGB 1XN9A 3OS0A 1Y9OA 9ICBA 3PO5A 1C0TA 2LMIA 4OX6A 4USWA 1ZZNA 4OI2A 2ZIWA 1RLCL 4NWBA 3T79A 3G6VA 3HLUA 4BX9C 4GO5X 1P9YA 4CJSA 4BLGA 4DR3F 3V1RA 2QWNA 1XHXA 5BRFA 3GFXA 2Z7JA 5HP1A 9ICXA 4O0JA 5ALUA 2WW8A 4C3LA 3AN1A 3QEIA 4RQNA 1U49A 2QWLA 4KFBA 1Y88A 4PPZA 4UUXA 4Y3CA 3CCVN 2BM0A 2LDYA 3BP8A 3DOKB 4CF2A 2IRXA 3LO3A 2BCSA 3F2BA 3DRYA 4PABA 3KKFA 4CLSA 3QINA 3QU2A 2DHHA 2QLXA 5ELZA 1XC3A 4GXJA 4W5TA 3T9NA 2D0OA 3T5KA 9ICAA 4LF5F 1E4GT 1WELA 1WC0A 3PYGA 4B6JA 4ZP6A 5D0GA 4NMLA 1N62A 1YAGA 3WIVA 5J2BA 2ALZA 3R9KA 4UT4A 4YDDB 1BLUA 2F8MA 3IRWP 5EXWA 4FJ7A 3FR0A 4TY9A 1Q82T 3NL0A 2D4WA 3OYIA 5KFRA 4CEAA 4DB3A 2UUCF 1OYDA 5ALEA 1C0UA 2YHBA 1RDCA 4IO8A 7ICQA 1WTFA 3C29A 4ZJOA 1RBVA 4B9QA 3OTOK 1HLWA 2FMPA 2MPUA 1C1CB 1OH8A 1X9WA 2FLNA 1OW5A 4TQSA 3FCHA 1YUWA 2XMMA 4LF9F 4CK2A 2OYQA 4LFCJ 3OTCA 3QNNA 2F76X 1I94K 1FDBA 1WSEA 4DR1F 3MEGB 4BDZA 1SC6A 4DZ6A 2GQ2A 3SMZA 4CM0A 3JTPA 3IDHA 2W04A 3C21A 4DV4J 2W6LA 2HLTA 1YG0A 1I6JA 1RKJA 1WG1A 2YJFA 3MCAB 2DY4A 4ID1A 5ALGA 2AX0A 2IM3A 1RBOB 1RBTA 5LJWA 4LJXA 2E3TA 1YTYA 2KOBA 1Q8LA 2O8BA 2HFSA 4GNIA 2MTLA 3HKZC 3RRHA 1HNZF 1Y0HA 1HR0J 4URSA 2V63A 2B4JA 4C7YA 3MCSA 4ID5B 1CQMA 3BN7A 1CC8A 3HMJG 1BE4A 4RW9B 1Q18A 3W2VB 5J0UA 2OPRB 4DQIA 3Q23A 2ZTDA 1WUUA 3QRQA 1KFSA 2QLBB 3RGIA 2XZDB 3D67A 4LVNP 5LMUF 1B0VA 4DLGA 2HG4A 2DR9A 1FD8A 2UZAA 3AGKA 2KJ8A 2YWEA 3BO4A 4I2BA 3PFEA 1T11A 4ATNA 2C3UA 2YNFB 3Q89A 4DO9A 5GADU 1VLYA 3VQ6A 1A77A 3ONNA 2QW9A 4CM2A 2B9XA 5IT9O 1BNPA 4F0MA 3NGYA 5J0XA 4DR5F 2GW8A 4C0BA 3CCVS 3TZXA 3V6DB 2ZEJA 1BCMA 4YMMA 1U6ZA 4B3SF 1G4CA 3MF5A 3WXMB 5L9NA 1B43A 2VIXA 4BG8A 2ZE2B 2V0NA 4KHNA 1KTVA 1TUYA 1E3MA 4WQ5A 3FMWA 4A8WA 5JU5A 2CKWA 1WEYA 3L3UA 3GCWP 3RR7A 4NCBA 3ELHA 4JI5K 4CZLA 4J2AA 3SCKE 1C0FA 1M5PC 4WKYA 2DKXA 1EKRA 2YH1A 1YHQS 2ASMA 3ILLA 4RUCA 1MU2B 4KLJA 3R9PA 4QZDA 2QA4N 3IN5A 2IDLA 1WWUA 4I2CA 3LW5C 2GLEA 4R25A 4Z7YA 1ZRNA 4B9LA 3SSQA 1NNEA 4JV5F 4I29A 3L95X 1U26A 2F63A 2ZBCA 1FTRA 1M90T 1KVCA 3HI0A 1FKOB 2RVJA 5E3CA 2I9SA 2QN6B 3R97A 4NLVA 4U8YA 5C7PA 4HEA9 4N47A 1ZRMA 5FPMA 1GMUA 3ISBA 2P9KA 2AQ0A 4JHDB 5HL7Q 1UW9A 1O5JA 5HN0A 2ZH3A 4DUYF 4Z4CA 4RQ3A 4JKDA 3VGKA 4RPXA 2E9TA 4IQXA 1FE4A 4B1ZA 2CPXA 4I7FA 3FZKA 1W2BM 5J29A 3VZHA 1T02A 2ATCB 7ICUA 3QYPA 2NUUG 1MA7A 1SAZA 3AVGA 4X64K 1TUVA 3D0GE 4CP5A 3VENA 1CLFA 4DFDA 1M1GA 2H3QA 3MPWA 3AOCA 1FRXA 4FJLA 1HQEB 1A5XA 4C3MA 1RBLA 4AE5A 2QWOA 1NGHA 3VAHA 4NCGA 3KKAC 3PX0A 3HJVA 2MU2A 3KK3B 1X9MA 1PJ5A 4K5RA 3IP0A 3EWGA 2KZMA 1UW4A 2QKBA 1HUOA 2HQGA 3OLAA 1RWKB 1DGKN 1MN9A 3IDWA 1KQGB 5J8YC 2QB1A 5F8MA 5JRTA 1T3VA 1T44A 5KPZA 2UVRA 4JI4J 3SBGA 4ZCIA 2OA8A 1WORA 4ECUA 3NGDA 2G2OA 2OEJA 4BRIA 2VA3A 4W90B 2KXHA 2MGZA 4F72A 2QA4G 3DU6A 4J9QA 2J5AA 1RBAA 3G6EN 2FLPA 2JEJA 5A6PA 1NH8A 3LF0A 2YWHA 3JPOA 2XYGB 3VN5A 4IYQA 4TY8B 4E98A 1WOPA 2D41A 4PG5A 5IZHA 2Q1LA 1B70B 1HD0A 2QMXA 3IGVA 3W64A 5LSRA 3AV9A 5ALIA 2OPSA 4DCJB 3DMJA 5J1PA 1X31C 2ZTCA 2AGOA 4W5NA 1FX2A 4F50A 4CHYA 4E1NA 2J6SA 3HHKA 4LF7F 3HK2A 3L09A 3UN5A 4CEOA 5D3GA 2QA4S 1Q81T 1C1BA 2IDOA 3V1QA 1L3SA 1F5CA 4AHUA 3W7BA 3QFUA 2BEFA 1RZMA 2DH7A 1CZ9A 4NZ6A 1TL7A 3CQ8A 2HWHA 4LBIA 5EN1A 5B0BA 1NKBA 2HHVA 3F5TA 1DT9A 3W62A 3BBBA 3MN6A 3D45A 3MPUB 4LF2A 2GJFA 1HRHA 1MROB 3BY5A 4UZCA 1VC5A 1AXQA 2E6LA 3AVFA 2P6SA 4M3ZA 4DV5K 4F4ZA 2UV8G 5DQHA 5C0YA 2HIQA 2AYGA 2IIHA 4ZITA 5F0WA 2MY7A 1I94F 2MKSA 3OL9A 2F44A 3JPNA 5E84A 1VQOS 4ALZA 2PI4A 5AI8A 2B9YA 4KN4A 3LQVA 4QIVA 1RWOB 2KVCA 4EBDA 1RBUA 1KKXA 3BSCA 2DGUA 3N4PA 2JNJA 1BA1A 2YHWA 1F1BB 4ECZA 3FBEA 4NLSA 1T95A 2RT3A 5ALQA 3M32A 3PIPL 2HWTA 2XI9A 3RWUA 4M9LA 1S7HA 5A8KA 2G0AA 2MQOA 4AILC 4ANCA 4CHPA 2ISPA 4A8XA 5AE2A 5M1KA 4KLMA 1YBUA 4ZCLA 3CIPA 1JJ2M 4CLFA 1D9DA 4DS5A 1HL6A 1R8PA 5BPCA 2AZ1A 3RUBL 4KMUA 3IR6B 2KN4A 8ICBA 2HK2A 1YTUA 3D0HE 1YJVA 3KD5E 2ADBA 5FDLA 3RW6A 4IG3A 4FWNA 1BPBA 1P1LA 5AK4A 3CJTA 2CJKA 3V6KA 1ZH5A 1RE1B 4RW6A 3EKUA 3G6ES 4RU9A 2D0PA 2A1JA 4FWOA 3W0LA 2B6AB 4A8OA 4Q2MA 2MA1A 2VG5B 1QAJA 2HK3A 5ALOA 3FK4A 1JUDA 4DU1A 3KHYA 3I55S 3SSSA 2HGLA 2XMWA 1PSDA 4DL5A 3TACB 2YX7A 2JDJA 1S1UA 2EPIA 2ZIVB 4F67A 3U8XA 2HHPA 4ED8A 4ZJLA 1VQMN 4LF4K 1QE1A 2BGWA 2CRLA 4MK8A 4BR9A 4E19A 5CWRA 3UCGA 3ZD9A 5D15A 5RUBA 5IT4A 5L39A 3FFIA 4J2DA 4ED2A 5CD4H 3I9ZA 4JK7A 5KPRA 4WFNL 1XSLA 1K9MT 4KLUA 3OR2B 5J1EB 1TR0A 1VQ4S 2Q0UA 3N6NA 4WF9L 1J27A 3TRGA 4BRLA 1ZQOA 4LJMA 1ATRA 5E3PA 3VQ7A 2FI1A 4DUZJ 1MWMA 1VJWA 4CJ4A 5D4OA 2VG6A 4HUGA 1WACA 2K8BB 5D0RA 2G8HA 4J9UE 4R5PA 4CJEA 3N7PD 1CJVA 3LWLA 2QA1A 3KOOA 3CI5A 4ECQA 2D0CA 3TWZA 2YI1A 1KHVA 3KKRA 4P72A 4F4WA 4NYZA 4M3TA 4ZHRB 4M2YA 3P49B 2AT1B 4Q0BA 3ISND 1HIWA 1KVJA 4X62J 1YIJN 5AQVA 3U4LA 5E41A 2XRIA 3DLJA 4OJLA 3C0BA 1VDHA 4YUDA 4USKA 4X64F 2BCUA 2XSFA 3GE9A 2Z2ZA 3GFHA 1VGYA 1WSFA 2XS5A 2IYIA 1S1XB 4JV2A 3IAM9 2P9UA 3NMAA 3O1BA 5CCLA 3ZDBA 2DBYA 4DSIA 2BZ2A 5KOXA 3TSUA 5HJYA 3U3YA 3R5JB 4FO0A 1RT4B 4DQRA 2W7PA 3KZBA 3LTOA 1OH7A 2YMMA 5G4DA 1B22A 3FCWA 1FXDA 1FNOA 2CQ1A 4QYZK 2KO1A 3A13A 2EFGA 3NFAA 2GFFA 2QEXS 4QZFA 4O4RA 2IA6A 2AJFE 4LF5J 2JOQA 2GO9A 2LQBA 3DXSX 2ES6A 2ZNZA 2WBRA 2Z4PA 3RMAA 5T7BA 1MDUB 1BWEA 1HQ2A 1X9XA 1RP5A 4TSXA 2ABYA 5CR0A 4DI6A 2QB0A 4GKJF 1XR5A 2CJYB 3N4WA 4ICLA 1HPMA 3KHHA 4Y0WA 3QEBZ 4GV9A 3NMUA 4QYRA 3C15A 4JI8F 3EPIA 1RCOB 3RFAA 1RUSA 3IWXA 2YX4A 4LQ9A 4ZVTB 2JGAA 2LKZA 3QIOA 4KHMA 2NYVA 8ICPA 2ZWOA 4A2AA 7ICJA 2AYEA 9RUBA 1VQMS 3BF3A 3DLGA 4QOTA 4ZLNA 4X4QA 3LZJA 4KX3A 2KKPA 2MLZA 3MPVA 4RUHA 4QZ8A 1R6YA 3KLGA 4ILRA 1Z1VA 4YOYA 1WAFA 3RMCA 1BQNA 4KH4A 2LQ5A 2FJAB 2VFRA 4DPTA 4BDYA 3ICXA 1FHTA 3C2PA 2G09A 1VDVA 4O3OA 3R6MA 2D8CA 3F56A 4JYAF 4H5VA 1E6YB 3CCRN 3DLEA 2H5JB 5AQTA 2DKOB 4ZVFA 3C46A 4K4GA 1M1KO 5F3ZA 4FK0A 8ICFA 3R7NB 4P7TA 3MMBB 1HBMB 1RT2A 4DV5F 3R3LA 4JP8A 3I96A 5ETOA 4BBYA 1C4CA 3NCPA 2QKKA 3O2IA 3OXFA 3UPFA 1LXNA 4K43A 1NMNA 3MN7A 1KQFB 3C7NB 3KJVB 4A8SA 4QR2A 1ZQNA 2IJRA 1P90A 2C2KB 3WQTA 1YIJS 3LWMA 5LMUJ 1NGEA 3FCVA 1TL4A 3OYHA 3N4QA 2V2ZA 2B5JB 1VR6A 2FC0A 4MMOA 2LEPA 2WOMB 1Y3KA 4EX7A 4MHVA 4NLZA 3DXMA 1R89A 4M9HA 1EXNA 1NI3A 1C1CA 5AM1A 2OH2A 4CERA 4JI1J 1CJTA 4V19S 5EGYA 3ZSXA 2FDNA 2MSTA 4OYXA 5M2PA 4L6V3 2ZIUA 2ROPA 3M6GA 3VC8A 3ZI4A 3ATUA 2JVOA 3AVAA 3TQ1A 3TO8A 5J2JA 5DS7A 2I9GA 2Y1LB 3MEGA 1RNHA 4FZXC 2OEHA 1R0CB 3VGUA 4GXKA 1JQGA 1WF0A 2A41A 3HI9A 2F40A 2JXJA 5BPMA 4XPEA 2OPQB 3ETOA 4NL5A 2RQCA 3J8AA 5AXKA 1ILYA 4BREA 4G9ZA 4LF8F 3D66A 2N1RA 5IINA 4IUFA 2IVYA 4D3GA 4RQ0A 3B0XA 5KL8B 3HX0A 3PSTA 5B7WA 2ZM6J 2BV3A 2OGUA 1XNRF 4FJGA 5J0OA 3WK8A 1VQLS 1A6SA 2AU0A 3KK2B 5AQSA 3M30B 5KAFU 1VJQA 4L3NA 2EC2A 5AKEA 3EXCX 1TK5A 4WE1A 3N5BA 1DFDA 9ICCA 3PEJA 3UN2A 2RKIA 1RDWX 3KD1E 4DPYA 2XICA 3POTA 1F2HA 4NX9A 1X1PA 2K4HA 4RW9A 2E8MA 1K73T 4K0KK 3W2VA 3FEYB 1EO1A 2OPRA 1Q8BA 2EFOA 1QAIA 2LQJA 4BS2A 2R7YA 3L2QA 3FZMA 2Q0ZX 1HA1A 2OP5A 3W60A 4LF4F 2YNFA 1NJIT 2GQQA 3TJ9A 1WKLA 2ZJRQ 4MF2A 3K2PA 5ETVA 4ANDA 1YT3A 1UAXA 2W2NP 5AZIB 2HKEA 5KFEA 5BYQA 4F5QA 3BQ0A 1YJNN 2I5JB 2QZ8A 3CCRS 4OZ3A 2W11A 2FDRA 1N34J 3PR4A 2F2AB 1WUAA 1WC6A 1M5HA 1J5OA 3QERA 5HNKA 4RZRA 1ZYQA 4HUFA 3PHEA 4AM6A 3I0RA 4NXNK 3J80U 2G07A 3RMBA 3K2YA 3WK5A 2HVDA 1Q86O 4KHPK 1SIWB 3QIDA 4DQPA 2DUYA 5AK3A 2KG1A 3Q8KA 4JI0J 4FZZA 1K1QA 9ICNA 3VV2B 3HP6A 2F5GA 2QM1A 1MU2A 3HSDA 2MHEA 2OZMA 4K8XA 3SCXA 3QQCD 4N76A 4O3RA 5AQMA 2H3EB 4DX6A 4F25A 1AYEA 5FPDA 5KG2A 1BQMA 4N41A 3Q0AA 4H8KA 2JHDA 5F8IA 4AYBD 1MMDA 4F36A 5E3AA 1JLGB 4CO2A 1TFYA 1FKOA 1IWAA 3E01B 2K1RA 4P0QA 1IR1A 1RAHB 4QZVB 1YDLA 2W2OP 3NBPA 2ASDA 1OS5A 4A47A 9ICKA 3GJSB 1LWEB 2E8NA 2VZ9A 4JBCA 2DFFA 4KC5A 3JQKA 5A2QO 4JI3F 3IRUA 8ICQA 1LNQA 3KLEA 3NASA 5KL1B 2QWRA 3HT3A 8ICXA 3N5FA 2YTCA 3D4JA 2P6TA 4G1QB 1XBWA 2ZUGA 3BGUA 3Q8SB 1HWJA 3IBPA 3GYGA 3NGIA 2G06A 4YY3F 1OPIA 3DYAA 2YXLA 4DV7K 3T6JA 1U1QA 1OO0B 4CO1A 2P9PB 5AQUA 3WX8A 5ETQA 3QIPB 5B66U 2BE7D 2BPFA 1U9LA 1JLFB 1KLNA 3HFKA 3UMCA 5AQHA 3ZZTA 2RUGA 1K0VA 2V8HA 4I6MB 1TK0A 5C12A 3ENAA 3RB4A 2W9AA 1JCFA 3AAPA 1R8HA 1HNVB 4NY8A 4EBCA 3CIMA 3MM9A 2NYIA 3I8DA 3K57A 3R1HA 3FVYA 2G5HB 2FY1A 4OKEA 1TVRB 3CO0P 3P5JA 2JWKA 1NOMA 2A3ZA 1SXDA 2B4OA 2BRLA 2DNRA 2NO5A 3V4MA 4DSJA 1ASVA 4A8MP 5CYMB 3SBMA 2YKOA 4H5WA 3MXMA 2NLXA 3S3MA 1BHNA 3DDIA 4CLPA 3Q7CA 1MWQA 3TEGA 5CAAA 3CC4N 1HARA 1DBDA 4ZN1A 2HURA 3KDNA 1AW0A 1VHXA 9ICWA 3ET6B 2PSZA 2QO3A 2E5IA 2K89A 4F5OA 5M1NA 2DNLA 1RT7B 1SV0A 1S77D 3MCPA 5BYRA 4BGAA 2ZBPA 4F4YA 2DL0A 2CJBA 3EW9A 3P83D 5GTIU 2AH5A 5F3TA 5DB8A 8ICSA 4NRUA 2I6WA 2HWIA 2UVWA 3TTCA 4KRWA 4HHJA 4LRCA 1GTEA 3C6UB 3X1LB 1VQ5N 1KC8O 1VFJA 1N5YA 1Q46A 1VMBA 2P5GA 3HOTA 3G8TA 2R7WA 4Z2XA 4BR5A 1RWWB 4RNMA 1UPMB 3LPEA 1FNXH 1IBMJ 5HSPA 2LLZA 2E1FA 3SMVA 2UXBK 3GSDA 3DRSA 1CSJA 5J2AA 5BPLA 4X65K 2EC0A 5KFIA 1UVKA 2G2ZA 1IKWA 3JYTB 4UW9A 3M2UB 5ETMA 3VAGA 2HSTA 2C2OB 3E9PA 4H5NA 1J6ZA 1WSRA 2CAJA 1FF2A 4ES2A 5LSOA 4C8NA 4ZLLA 1X3NA 5ITHA 2MXYA 1RU1A 2WK4A 1FKPB 3Q8PB 1UWAA 5J2NA 2CGKA 5M1QA 2BE9B 2JRZA 2VOPA 1DQ8A 2E2OA 1NSQA 1URRA 2IHR1 1T9WA 3OFHA 3NE6A 4DJBA 3L3FX 2DGVA 3HZ6A 3O4WA 2XGQA 1XMOJ 1BOTO 1VRUB 4Z6EA 3VR1A 4FJNA 1YVNA 2YNGB 3M7DA 3OXLA 2Y8WA 3LPTA 5BXIA 4QJFB 4L75A 2WHEA 5J2PB 1ZQEA 4LRFA 2JLEA 4WFZA 2H51B 4X4NA 4U67L 1VSHA 1HBOB 3LVVA 2DK2A 4NB4A 1SZPA 2ZC3A 2F4VF 5CQGA 2IBKA 3NVZA 4BRCA 4B9NA 4FOEA 1OSCA 1R43A 4BG9A 2C2RA 5GAHI 4BVPA 2ZNYA 2ZHOA 3LPUA 4Y65A 3OS1A 5I42A 1FERA 2N7YA 4OX9K 4WTYA 3H4DA 3CCES 5HJXA 4CYUB 4UATA 3VQBA 3ZTQA 1IJFB 1M0SA 1K8KB 4I2QB 3K9JA 4BROA 3IGNA 2Z1IA 4PZNA 2UXCF 3K1ZA 3CCSN 2Q31A 4YCXA 3HHLA 3ED5A 1ITGA 2P9SB 4US9A 2M2BA 7ICOA 2B6AA 5IWAF 3D3CJ 2QARA 1RCXB 3WDOA 1CJKB 4PG6A 2HVZA 4F5PA 1JXLA 4FXVA 3KZIU 2D69A 2ESEA 2HNYA 5J0TA 1UKUA 1HEKA 2CUYA 1IBLK 3RMDA 3AQPA 3FEZA 4ANEA 4KHPF 3SENA 4TLQA 5EU7A 4XH5A 2GS8A 4ED4A 3CJBA 1P7DA 4G1IA 2VBWA 3H8WA 2CNLB 3OQ2A 2CGLA 4FYVB 1VQ5S 4JK9A 3ZSQA 3EJMA 4RW8B 1HLUA 3Q8QB 4A4JA 1S6QA 3C94A 4O5BA 3SEIA 3H98A 4K8ZA 3BBFA 3NS1A 3JB9k 2Y8YA 1U48A 4H4MA 2AKWB 1D8ZA 4O8UA 3D2QA 2C2DA 3OR2A 3U02A 3GTYX 4GRSA 4JUZA 3NVMA 9ICRA 4CIFA 1H3DA 4ZVSB 4CF1A 2W54A 4AYBF 1B9DA 4BC3A 4UY85 4YDXA 3C2KA 1JCEA 2AF6A 1GLJO 4ILHA 3L4IA 3UMGA 1RTIB 4PQAA 4TYAA 4HTIA 3HVRA 1NH7A 4TKTA 2C42A 4DV3J 2CXYA 3EGNA 2BANA 1AUSL 4OO1J 4X2BA 3ZDCA 2IRYA 4ZHRA 3RJFA 2B0GA 3GU0A 2DNPA 2NRRA 3QT5A 1RQNA 4P74A 4DL7A 3MCOA 3HO1A 3GU3A 4FF4A 3UDLA 3G96A 2HHUA 3BN4A 4DV7F 2QJ3A 1SXEA 4M94A 4FPBA 3ZSZA 4Z4HA 3CHWA 2G4BA 1DK2A 2G08A 2E8OA 4GC6A 1J5EF 2DIUA 3WXKA 2D9OA 1TKZA 5IQ6A 1S1XA 4J9NA 1T03B 1RT3B 1IXRA 2QSFA 5A0YB 1KVAA 2Z8QA 2VKZG 3OFGA 1XSNA 5G0RB 4FN5A 3W63A 1B4FA 4ID8A 5BRDA 5AQZA 1SL0A 4JYAJ 1BWFO 2F9JA 1EQMA 5DDOC 3CCTA 1Z00B 4MF8A 5J2HA 2ROGA 4JV0A 1UOCA 2ZF5O 4LRDA 4MFAA 3DI6B 1JWWA 2V67A 4QZEA 3GG4A 3ZDEA 2VC0A 1VK8A 1HBNA 2V50A 1CULB 3HHDA 3KJFB 1TUWA 2PEBA 1TUGB 2M70A 4DS4A 2VFUA 2UXDK 4H4OA 4F4AA 3MK6A 2R2SA 3HJFA 1NUEA 3IG1B 3GYXB 2W9CA 4F3QA 1HUXA 3NF9A 1L5UA 2EWHA 3CMQA 3QGIA 1HQUB 2YBVA 2DNQA 2XG8A 3KWIA 3TR5A 4E7IA 4B9SA 4OYAA 2XQCA 1YRTA 1SJ4P 5D78A 3BGOP 4MKBA 4ZA1A 3PYEA 4IH6A 4RQ8A 4X66F 2VPYB 2LYAA 4ZS6A 4NO7A 3P5TL 2BUPA 4DV2K 4PJ0U 3VESA 1KWMA 5KG5A 4JD2B 3JAMU 4NZ0A 3UE5A 4DEZA 1G2EA 1JIHA 3HTVA 3CDAA 2AEJA 4LFAJ 2H4WB 2UXBF 3RB6A 1WLJA 2VFSA 3R5CA 4LF8J 1HJOA 2UP1A 2DNOA 1FT8A 3K7RA 5HK4A 1BVSA 2EZYA 1WC4A 1FX4A 1YWXA 3HSZA 1M1HA 5D49A 2XWXA 3MMBA 3H1QA 1HBMA 1XNRJ 1MC8A 3QEWA 3H8YA 4P4MA 5F8NA 3LP0B 4PL1A 2OSQA 4MYUA 1RSCA 3C7NA 3KJVA 5AZJB 3QATA 4TNOA 1BQXA 2DQNB 4J03A 5CCMA 4F3OA 1RJJA 3KDOA 5B0EA 5ADXH 1NK5A 2AQ4A 2WOMA 4P9SA 2ZOFA 3LDOA 1U1KA 4OFZA 2VL1A 3QMQA 1NGBA 3D6JA 1A7GE 1Y11A 2LYHA 2B7BB 3B8HA 2RQKA 3QNMA 3D2NA 2D74B 1KOHA 2LCWA 1N2XA 3UB5A 4M63A 2HSEB 2KHDA 4BGBA 3QNOA 4E8UA 3DLLL 1YJ7A 5GAHU 5AHXA 2PD1A 3UPQA 3AHPA 2WFBA 3LGMA 4FLXA 1RI7A 1GLEG 4M3WA 5ALMA 3I33A 2V68A 4M5MA 3CJKB 2YNIB 2E5LK 4FLZA 3BZCA 4ILMA 3V4IB 4IR9A 1WB9A 4OX9F 2NO4A 5LMNK 1FCAA 1VBYA 4MFCA 1QQOA 1RKIA 4KPCA 4LR9A 5BR8F 2VG7B 4NM2A 3OYNA 4YFKA 3A5OC 1F5SA 4NV0A 3OSPA 5GAEP 2WFAA 2BCRA 4XPCA 3CDEA 3EZOA 3H3NO 3NWGA 3AT1B 3M30A 1TFWA 1IM4A 4EX6A 1IQTA 1PGZA 2QA2A 4R63A 4CF3A 4B1VA 4CFAA 4CLZA 1TKXB 1FXRA 2MZ1A 4WYWA 5B09A 2PFPA 2ZUDA 5JJBA 3VETA 1RXOB 1SKUB 3EE8A 1FK9A 4QIFA 4TXSA 5AM4A 5HRPA 3RU0A 5ALNA 3Q86A 3KK1A 4OKKA 3MI7X 5K14A 4M8LA 2DY9A 3VWSA 4KLQA 3KXDA 1RWNB 3ETMA 2R7VA 1FVSA 4JMUA 2W9BA 1UFLA 4MK7A 4QS8A 4JK1A 1VSJA 4DSEA 1RLDA 3AO2A 3J81j 5AZIA 5A2QY 4BR2A 5A8WB 4KHWA 4OJ1A 3ZXWA 3PFOA 4UB8U 2PN6A 4CJRA 4IRDA 2I5JA 4PL2A 2IVPA 1ZZFA 4DTXA 4YY3J 4H0VB 1IJEB 5DB6A 1REVA 5T7LB 1H72C 4I27A 1ZBFA 4WQ5C 2HRTA 4JKEA 4LR8A 4NLBA 5KFFA 3BEXA 1JMSA 5HMXA 3MM6B 2K4EA 4RR5A 5DETA 4FBTA 3C28A 4RU2A 2JWLA 4OPAA 2B8PA 3GDQA 2AEFA 2DNKA 2VQEK 4DR2F 5HHHA 3MMAA 2I7NA 2R7SA 2DR6A 4UQGA 2G0CA 1MN8A 5LT5A 3GL1A 1G15A 2JMGA 5IIOA 4ETXA 2VD3A 2GVDB 1IWGA 3WT0A 1FI4A 2ZHBA 2FY8A 1WN7A 5F1XA 4CNYA 2VPXB 3CJ3A 1NGCA 3AA5X 1ZPVA 1NZPA 3QT7A 2CGJA 8ICKA 1H74A 4M6WA 2XHBA 5KFXA 3BKFA 3ZT2A 3EXYA 2I1RA 3CQYA 4O44B 4BWMA 2WONB 4DR6K 1S9GA 3QRPA 3L0QA 3TYTA 4ENOA 5H1SV 4BCAA 4UOFA 4DV6F 4C0HA 2ZUCA 1LWEA 2R42A 1HKAA 4LF1A 3DOMB 4B9UA 4ELUA 4A46A 7ICSA 1TELA 1CJUB 1UFKA 1R59O 3LYSA 1U7LA 2I1QA 3DNCA 3CCQS 4C8KA 1DGJA 2FSKA 1RM6C 4RNNA 2FJWA 4RQ5A 3QGPA 4IOBA 3V72A 1O13A 3QWUA 4MLHA 3VAIA 1UAWA 2X74A 3MPDA 3QIPA 2QE5A 1Y64A 2UXDF 4NMXA 2IJFA 4B3RJ 9ICUA 4NLKA 3KFWX 5SZTA 4JKCA 3ID6A 4OPKA 4CJVA 3ZC4A 1KBUA 3M5RA 5FLXY 3KHGA 3QSYB 4GKKK 1L8OA 2VBZA 3BSAA 2DGXA 1TVRA 1NK4A 2P35A 4JB8B 3OYMA 3VQ8A 3CE8A 3A8YA 2O6KA 3AGRA 5CB1A 3AL0B 4DV2F 3KMQA 2E66A 1WSGA 4BC7A 4ZIVA 3AA2A 2QYCA 1FRLA 4F02A 3TEHB 3MR2A 4DR7F 4CF0A 3DLBA 1LOUA 3GFYA 1WHVA 1VIXA 3ET6A 2POKA 2E5GA 2JLFA 3ZZYA 4LF6K 4NYOA 2BR0A 4U9RA 3FE1A 3JSBA 1RT7A 2G8KA 4OJHA 2KH9A 5KFWA 3RG6A 3G4SN 1ZQIA 1RTDB 4URQU 3IWNC 2XMTA 7ICKA 3O8MA 2RH3A 4M3YA 3ZZOA 3SQ0A 5L38A 2IFXA 1KKHA 3MGJA 5ALJA 4QW9A 1DTQB 1NDLA 3F44A 2R8HA 1ASUA 1I39A 2K7KA 1UEUA 4NI2B 2KFZA 4AUKA 4HT7A 2I6XA 4CVNE 2UVUA 4YHHK 4ZPDA 4LFBK 2D3ZA 3HKWA 4O5KA 2VHGA 5H1SQ 2V7ZA 2KICA 5EE3A 5G5HA 4NEZA 2LKYA 2RS8A 2FD2A 2K06A 4JAXA 3WIUA 1KAXA 4QOZB 3UQ0A 2GIRA 2LFVA 5AJ3J 3PXGa 2AXTU 4HH0A 2NPFA 3DOLA 3C1YA 3FQKA 5JICA 3D0IE 2P9IA 1Q8KA 1ZBIA 2ZZNA 4HDHA 4I68A 1G7CB 1CS4A 1D1UA 2ZD1B 3MM7A 5AKIA 4C8ZA 3ENBA 3NH2A 1QY7A 2IMOA 2GZOA 2YVSA 2DO4A 3S3OA 1SQEA 4CF4A 5DDMA 4Y2UA 2YNHB 3MEEA 2CFXA 1VRUA 2BE2B 2FXUA 1B0XA 3NRWA 2YNGA 2Q36A 5KT7A 5C2FA 3DM2A 1LKYB 2WVBA 3HW8A 2P1JA 5DDRC 3QJJA 2HCFA 1IG6A 3CCUN 2XLIA 4OYPA 4BXOB 1HBOA 1S79A 4ZKAA 1TVAA 4K2XA 4ZPVR 3SQ1A 1YF5L 1NJYA 4B3MJ 1H0HB 3JSYA 3DXKA 3O3FA 5BOLA 3BH6B 4DCPB 3KWGA 4J9OA 1D3WA 2VH7A 2E1ZA 3DV9A 1UL3A 4F0KA 1V38A 2KFYA 5CP2A 1TV6B 2R8GA 4JOUA 4CLUA 4TYBA 1HW8A 3AQFA 4E1MA 4UTGA 5EWEA 4CESA 2ZH6A 2YX8A 4EU0A 3W2WB 3OA9A 3FM9A 4I2AA 5ETTA 1LFWA 5KFJA 1VC6A 4I1TA 3JTOA 3ZZZA 3MEDB 4YMNA 3KMSA 1PJ6A 2BXJA 4K8RA 3G2XA 3MM8B 4IFEA 1JALA 3UKRB 2DXEA 4DR4F 1GEHA 1B92A 4CGDA 3QXGA 2KP7A 1J5EJ 3PRDA 4DQQA 3AODA 2VQEF 1S0VA 4K2JA 3BS9A 4MTPA 1KOOA 4CZCA 5KG7A 4J90A 4KLSA 2FGCA 1L7OA 4AT1B 1F9FA 2OMLA 3T3FA 2FJVA 1LWCB 2WSCC 3C16A 1I5OB 2E8PA 3VZIA 1S5ZA 2RE2A 3SV4A 1NMDA 3I31A 3RTVA 8ICAA 5B0CA 4C4TA 2VBXA 2FZCB 1BMQB 3PIOQ 5B0DA 5HROB 2WB4A 5E5NA 2EXUA 1OYEA 2OPPB 2NREA 4BRDA 5KFSA 3ILIA 3QT6A 1H7WA 4FJKA 3G71N 3LH2S 1RHQB 3NVWA 1XMQK 3H4BA 5M1FA 8ICCA 1GLBG 3PW2A 2WB1D 2KFNA 4Y2XA 1IKVB 1WWVA 4KLOA 1RWVB 5HQMA 3M1YA 4WFAQ 4JS5A 4EFHA 3IS9B 5DB7A 1BPYA 3HVTB 1SQFA 4KAZA 1F3VA 2MLXA 4DFMA 4GIBA 3TX8A 1S72S 2OEKA 2FVPA 4CI0B 1BI4B 4DV4K 1XI1A 4H5TA 4MO5A 3M1FA 1S5LU 3FC9A 4Z7CA 3Q7BA 2CPHA 4PHEA 1KEJA 1JJHA 1U0HA 1TMMA 1Y4ZB 4DU7A 2RHKA 3T5HA 3BR9A 4X66J 3G86A 2ZIXA 1N8RT 3MAQA 3TTDA 1HR0K 1EXQA 1XR7A 3CCUS 2VA8A 8ICGA 1T03A 5IT0A 3ZSVA 1KEKA 3J81Y 5HQ8A 2KQ2A 2VQFK 1VCTA 2NSBA 3C5FA 3HHEA 2VFTA 4WYBA 2XY5A 3PW0A 4JI6F 3QEXA 2N4DA 4IH5A 3O80A 2KVSA 2IJNA 1VHIA 4DPWA 1Z00A 4QCLA 4YFUA 1C7YA 4BR0A 3OJSA 2RF2B 1KDNA 4Q5VA 3ILJA 1NLVA 1ZQLA 3HZGA 3NAHA 1F5AA 2KNJA 5HBMB 3ICLA 1Q3UA 3ZSYA 4UAWA 4ECRA 2FHKA 4KH6A 1WG5A 2EAMA 1WG4A 3R7BB 3W3SA 3DLHA 4M9NA 4N8OA 2ZH8A 3PJWA 3RJIA 1DTTA 2ATQA 3IG1A 3CSKA 2QWMA 2M8DB 1UVNA 4RQ4A 3BO3A 1SV4A 3OL8A 1RISA 3U1MA 3VAMA 1XNQF 1JRPA 1RXVA 3IR5B 3DU5A 7ICRA 1N36J 1XUPO 2R7RA 4OPJA 3NMRA 2LMRA 2OCEA 2OEMA 2V69A 1D9AA 4QS7A 9ICMA 2CYYA 1VISA 3DGPB 3EO3A 2P9CA 3D5MA 3O9RA 2H5IB 4AP9A 4W92B 2VPZB 5KAKA 4LFBF 3H2VE 2C2NA 4PPXA 4BR7A 2RAQA 3OPKA 4Y2CA 1NK0A 3OTOJ 1BL3A 3A0IX 4PA1A 2Y0SC 4EK2A 5C25A 1RWXB 1IJJA 3WKCA 4DG1A 4H0OA 5KFOA 1U8WA 4H54A 1QSSA 3CT9A 5D4PA 4NL9A 4XA5A 3OJUA 5HL7L 4ZTFA 3ULDA 4OV1A 3NH1A 4JS4A 4JK8A 2ZITA 3A8IA 4UOHA 4QWCA 4W4MA 3LP0A 4J9VA 2MLYA 3FSIA 4DV0F 4DV1J 1EETB 5AZJA 1OQ6A 4ED7A 4RW4A 1SKRA 2GAHC 4WFBQ 2BRKA 3OUYB 3P4IA 3SUPA 2KT3A 3CULA 4B1YB 4WU2A 5IOLA 5FRNA 1EX8A 2IY5B 2XYPB 5DG9A 1S6PB 4C8OA 2WF9A 3NNHA 2PA8D 4KSEB 3RJGA 1GT8A 1NM1A 4WU3A 1W0HA 5J2DA 4WCEQ 1FKAF 2KSOB 4QR0A 1F9EB 3J7YP 2QLJB 2DBBA 5D4LA 5A8RA 5D6GA 2QTWA 2HBLA 1DEJA 2MHNA 4PHDA 1ZBTA 1FDDA 2V2QA 2FMQA 2NXUA 3CMAN 4XO0A 1Z6RA 2ZXIA 4IFYA 4FP9A 4Y2QA 4JB3A 3ZZPA 4C8YA 2M0NA 4Q2LA 3CJKA 2IMWP 4RW7B 3V4IA 3THXB 5DGAA 2IYGA 4NA1A 2IS3A 3O6WA 4DR2J 2OTJN 2VG7A 2FHJD 3BV8A 2M3DA 2Q4TA 2Z1JA 2DPIA 2GGPB 2EI5A 1HI0P 2Q1NA 3GBTA 4LRAA 3IAYA 2XCPA 2ZKTA 4XQ8A 1TKXA 5JLHA 1FJGJ 1XJWB 4KLTA 4K4SA 3FDSA 2G8IA 1RDAA 1F44A 4U7CA 3RB3A 4CJ5A 4NLWA 2IAJB 2OHDA 2ZH2A 1PIEA 2NPIA 4CHZA 3IV6A 4IDKB 4DV6J 2WSEC 4FSVA 4GO7X 2OI2A 2G8VA 1RHUB 2X1GA 3IXQA 2J4RA 2ZFHA 3V2UC 4C23A 3H8SA 2WAQD 3GIIA 2DVIA 3EZWA 2V8VA 2EBGA 4CF8A 5ADZA 3DXBA 3QO9A 4C11B 3KOAA 2KU7A 3SCLE 2VONA 2ZOGA 3ZD8A 2A6OA 3NG8A 1QQ5A 4LFCF 5KGXA 3MM6A 2AX1A 1BISA 3D54A 1VSKA 4NXMK 4FM0A 1ZTWA 2J6TA 1RDRA 4OQJA 2F9WA 4DFJA 3CFRA 3UW1A 4G3IA 2WB1F 4KHQA 2F1IA 5GTHU 3MOJB 2HEKA 1P8GA 1XQIA 4DV4F 3RH6A 2ATLA 2VJ5A 5AQJA 4ED5A 4BDPA 4NLUA 1C6VA 1HIYA 1Y00A 3M8PB 3M9OB 1RACB 2WF5A 5AI5A 2ZDOA 4YXMA 2HAFA 3VF0B 1HR0F 2NZTA 4U8VA 2WONA 5L1IA 1RG6A 4XAKA 2HBJA 1R0AB 3KLFB 1WOQA 3S3NA 4DR7J 3CJ2A 3H42A 3A8JA 3DOMA 1CI4A 4CO4A 2H65B 4FWPA 2YMPA 3ENWA 4WK3A 1TE2A 2PMZD 1VQ9S 3IM1A 3Q8LA 1VQ7N 2OZSA 3NVYA 5A6WA 3AXKA 3BKUA 1LW0B 9ICGA 3IRXA 1B99A 2OTJS 4FLUA 3VF6A 1S9EB 3EGWB 3AVMA 3FZ2A 4DHVA 1KD1O 1TYQB 2M52A 4EHTA 2HS4A 3H7IA 3CPWM 4N5SA 3GJQB 2QKQA 1VRTB 4RWXA 1GOBA 2L9NA 8ICRA 2QXFA 4RPFA 4CGZA 1D8BA 2OTLN 2B4PA 2HFZA 1GMWD 3M6XA 5KAIU 3OGUA 4C1NI 4NLXA 1T9TA 2JX2A 2ZC4A 3I5CA 5K4LA 4CLLA 4G65A 1JN3A 3MFHA 1D09B 3RR8A 1EP4A 2Z2MA 5AFUA 4AQYJ 3DLLQ 4HL9A 1FESA 1SV5A 4LY7A 1VAZA 2Z1GA 1ZBLA 4EEYA 3ZTRA 3BSNA 4BC2A 1CPZA 3KZXA 3AJDA 3I1YA 1ZC6A 3D1OA 1KCFA 4LVSA 1ZQGA 3C14B 2KG5A 3FC4A 1U09A 3O8WA 4X4UA 1SV0C 4HACA 2HOFA 5FPNA 2MYFA 2ZWHA 2DY1A 5K9FA 3N7SC 1ZQCA 3F9KA 1DQ9A 7ICEA 1T7PA 1M5SA 5IIKA 1HNXJ 2XTJP 1M90O 3NF6A 3G82A 1RTDA 4LBPA 4QR1A 1NSKL 2CDQA 1GNKA 1OUQA 2QWQA 1S1TB 4JI7J 1SIJA 2KHCA 2GUPA 1VIOA 3IMXA 5CEHA 3FMBA 2RDJA 1UVLA 4WZMA 2I0XA 4NI2A 4ZPWR 2UV8A 4IS7A 1VC0A 4B3TK 1VSMA 4X62K 5HMMA 5KG0A 3CM6A 3BQTA 4M3XA 2C3OA 1X4EA 2W7AA 4KGXB 4AHSA 4DHYA 4F9OA 1S7IA 3RBZA 2E1CA 5J0YA 3NP5A 3ZT3A 3CCMN 5J1NA 4DN9A 3ZEUB 4DR3K 3CP8A 3QE9Y 5IV4A 2HS3A 3DEEA 3K5PA 3AJ1A 1GXUA 3ASMA 3VA0A 3CD7A 5M2RA 4CK3A 3N7RC 4I2PA 5I3PA 2ZD1A 1NDPA 2GMJA 4WFXA 4DR4J 4ZPTR 4GLXA 2LU1A 1T6CA 1ITPA 2YNHA 2MKYA 4KB7A 2GNKA 2BE2A 4LF5K 4P75A 1QSLA 4JI4F 4FL9A 4KV8A 3SAFA 3Q8YA 3QESA 2H3FA 3R27A 1O1WA 1RPLA 1SVDA 4C80A 2DNHA 4B3OB 4P4PA 2FJBB 2KKVA 1P6TA 2YX6A 1ZM9A 2E7VA 1D5AA 3C95A 4BXOA 1ATNA 1JLAA 2UUCK 1PVPA 1BXNA 3MUMP 3SSRA 3O4QA 1VK3A 2YKPA 4M5DA 3MDQA 2CQGA 4HHHA 2HF3A 5KFAA 5DB9A 1H73A 1LXJA 3R5AA 3LK9A 3FNNA 4CQ1A 2C2MB 2FSNA 1NEEA 5C15A 2HMIA 5HHIA 2G1DA 2B4UA 3K17A 4DR1K 3HHLC 2RRBA 4P2HA 1Z4NA 3W2WA 3QETA 5HATA 2HBKA 1SC4B 5AI4A 5C42A 3ZX2A 1Q81O 2HFNA 3MEDA 2X51A 4IEIA 3CQXA 2WAQF 4WKRA 4MFBB 3H8MA 4DCOB 3O9UA 3QUBA 5J2MA 2EAPA 3LALA 2K8CB 5DQGA 4Y2MA 5D0HA 1WSIA 3MM8A 1TZ0A 1FTCA 4R0JA 3UKRA 1VBXA 4IFVA 3L2UA 4X5VA 1HNZK 5TZVA 3L3CA 4UB1A 4G6VB 2R2TA 1TL1B 3VHQA 3CCLS 4CNQA 4ETZA 2ZVIA 3SIPB 4PHPA 2HMPA 3OFEA 3E66A 2A1RA 1RILA 3GR1A 4IKAA 2WVFA 2QT7A 4CO0A 1PYTA 5LMUK 5A2QU 3TAPA 4I64A 1RHRB 1SH3A 4L3KA 1RAFB 5EX3A 2Q79A 3OBWA 1S99A 2O4IA 2OPPA 3CCMS 1BPXA 5HOOA 2HAIA 3IFEA 2KZZA 2ILYA 3A1YG 1ZQ1C 2XO6A 7ICVA 2ODGA 5AQPA 3A3OB 3BH7B 3IUCA 4PY5A 2H1YA 1VSDA 3WBZA 2RUSA 5F3XB 1WWHA 3IS9A 8ICJA 5AQLA 2RS2A 1OIAA 2K3IA 2V8GA 5KFBA 2CQDA 1LW2B 4QYZJ 3OYEA 3ORYA 3Q83A 1XNQJ 5D77A 1JKHA 3ENVA 3TA1A 4CBXA 4CJWA 1X42A 1OH6A 2ZG6A 3KK7A 3AU6A 2ZKUA 3P4UB 2QRRA 4P4OA 3O9SA 3NRZA 4FJMA 4X4OA 1WG8A 2PYLA 1GQEA 2ZDPA 4UARA 4AXJA 2J6UA 3S8SA 3GJTB 7ICFA 4KLHA 2HRYA 1T4GA 4EO6A 9ATCB 5EE1A 3X3UA 4JV5K 5EHHA 3O9TA 3CWJA 3JSMB 2RE1A 3SUNA 3GOIA 3PJXA 4NLTA 1JJ4A 5C24B 1WOSA 3G87A 3BKTA 3PDNA 4CWBA 3IR7B 4USJC 3KLHB 4PG8A 2O66A 4BC5A 3PCOB 1QLNA 3PX4A 3NGRA 1W2BR 5HBMA 3CMES 4DUYK 1U2VA 2ZJRL 2QL7B 3DCAA 1SS6A 1NGGA 5H9FJ 2PBDA 3C23A 4NYPA 4AHCA 8ICMA 2NCKL 1HHTP 4FO6A 2NV3A 4IOAL 1N34K 4DPXA 4M3RA 3C2MA 1HYSB 1EHWA 3SQGB 5FLXU 4IRCA 4DUZF 2QIFA 1K9MO 3OVBA 4Z4GA 3ETRA 1D4XA 4USVA 4H4KA 2YWGA 3LVWA 1KC8T 9ICFA 1SJQA 2KK0A 4M5JA 4FPRA 1LEOA 1GX6A 4JI0K 4I6WA 3QLHB 2NRVA 2VANA 3V81B 1LCUA 2DCLA 1RDFA 7FDRA 1S10A 2K7JA 3Q8RB 4X62F 1TL3B 1Q3VA 3OHBA 2AEMA 1RT5B 2E44A 3S6EA 3EY1A 3BF4A 4YDUC 4E7JA 3A3PB 3R6LB 4KO0B 1GLDG 5AI9A 5DDQC 1HBUB 1QUVA 3BDEA 2MKJA 1YJ9S 2KYXA 3BSOA 3FFKB 3K5MA 4CH7A 2JFKA 1T05B 1HYZA 1ZD4A 4PWDB 5L9XA 4ECVA 2YKNA 2DNGA 4RTFD 4QPTA 3IP4B 4F3MA 1QD1A 3BS5B 1PZNA 2GQCA 3BBCA 1E4FT 2J0QD 4RT2A 4HTUA 3GFKB 4J8FA 1EETA 1K47A 1ASWA 3TUIC 1L7NA 3RZAA 1TV9A 3PACA 5IS2A 4LUBA 5AT1B 1N6QB 1FEHA 2GC8A 4O4GA 5HLFA 3OYLA 1BPZA 3UI3A 3BZQA 3D6MB 3RJHA 3TADA 3WEEB 5DZ7A 7AT1B 4K4WA 2OUGA 4LF7K 4UB6U 3MMCA 3OYGA 3HKZD 5BN8A 2Z57B 4B17A 4M63C 1YHQN 2KSOA 3A2FA 1NK9A 3MGVA 2AW0A 2R2UA 4D3HA 4FPAA 3I5AA 1Q16B 2F8TA 2NRHA 1VSFA 3M2VB 2MUTB 1QTNB 2YKQA 2ZJQQ 4O5CA 4O3PA 1X5PA 2XLJA 2XBPA 4MAKA 4YG2A 4K0KJ 1DARA 4F71A 3W1YC 3RBDA 4QZHA 5KFVA 4UAUA 1RA6A 4JI2J 4RW7A 1W2IA 4O23A 4N77A 2VOOA 3THXA 4DSKA 2D0AA 2P9GA 4B9TA 1FDNA 4NLYA 1HFEL 4CECA 3AB4B 3GDXA 3L4QA 2IOFK 2NS1B 4O5EA 5AKJA 5JVGL 4OI3A 3A5MC 4IC9A 2PKEA 1AZSA 1D9FA 4PQUB 1CXQA 5IM0B 2O3DA 1UWBB 3LANA 1JJ2R 4NXNJ 3CJ4A 2RQ4A 4HYKA 3MN9A 1UCNA 4DL2A 3CGIA 4M45A 2Q2RA 4JKGB 1V3SA 3QWPA 4WJ3B 5THWA 2KN7A 1V9OA 3AY9A 3NVKA 4HAIA 5AQWA 4I6AA 2K8GA 4RQ2A 1LWFA 1IBMK 3HT0A 2N3OA 3SDEB 5T41A 4PKIA 3B0YA 1U1OA 2W42A 2CRXA 5AE1A 3EN9A 3VGVA 1G99A 4JI1F 9ICJA 1GX5A 2VBYA 4C1NK 4M5HA 2CXEA 1E6VB 2CQIA 4AHRA 1JLBB 5JMVA 2ZGYA 5B5EU 1U25A 3VQEA 4ZH4A 4PYDA 3VPZA 4CE6A 3AMZA 4OHWA 1S57A 3V7JA 1C4AA 5BN9A 4ZK7M 1KP6A 3IBCB 5D4NA 2VC1A 4H0XB 5EWFA 5DRKA 3AVKA 1XMOK 3L2VA 3SUQA 3LP2A 4C7QA 1H2UX 3I56S 4FWRA 4HI2A 2QFIA 2K4PA 4K4IA 1RBRA 2LYBA 3BF1A 1ZBHA 3VQQA 2ZM6F 3JS9A 3NOGA 4HHUA 4KHUA 2BZFA 2GH1A 3HP9A 3K59A 1X4CA 1R0AA 1VQYA 3ONQA 5KGWA 1MW7A 3TAMB 5KT2A 4F5RA 2HVEA 1IKYA 4XRHA 1FFUA 1RADB 3U9ZA 4O55A 1KQSR 2NR0A 4E3SA 4C4WA 4CZFA 5J2GA 2ACMA 1JROA 2R8IA 1B4SA 3FGUA 1UHUA 8ICHA 3PMLA 5KFCA 2RU9A 2VKRA 1LW0A 2J7KA 1M5OC 4PKGA 1WYGA 1C20A 3VEWA 4P0PB 4JKAA 1S9EA 5KFNA 3G25A 4CBWA 3TJAA 1TYQA 3DAWA 3D6FB 1AA1B 1F9HA 2GCFA 4HKQA 2I8EA 2FYXA 4FVCA 1VQON 1K8AT 3R5DA 1WJ9A 1VRTA 3SAHA 2GIFA 4J37A 4EMDA 4QZBA 3LP1A 2XVTA 1UTAA 1DLOA 3SQOP 3Q8VA 3AARA 2J8AA 1N34F 2A0FB 3P45B 3RBXA 3J81U 3PW4A 2JWNA 4ES3A 2GMHA 5CABA 1ESVA 5KG3A 5CYQA 3VEVA 3BQ2A 4M9GA 4IQUA 1NB7A 3VERA 5HR7A 4FE3A 3TVKA 1U02A 4YMEA 3P5BP 3N0VA 3P96A 4JI0F 3PW7A 3VQPA 2XULA 2Q66A 4I2FA 5B0FA 3NNCA 1S1VA 2J8SA 3LGNA 3MWTA 1PK1B 2YH0A 1WNSA 1Z2LA 1V4SA 2F8LA 1HPZA 4A5BA 3U9DA 3VQTA 2A1AA 4O0NA 2CQHA 1QZ6A 3P3DA 1IV0A 3M8WA 4HVJA 2J0WA 1AQ6A 2Z2YB 1RT6B 4LSNB 1KQKA 3PVXA 1HNWF 3UQSA 3CFPA 2D3O1 1QJHA 4DOZA 3JSRA 3UO0A 5IFMA 1PILA 3EYZA 4DU3A 3MDAA 2VCPA 3CJ7A 3FBFA 4GKJK 2DPNA 2P9EA 4MEYA 2JRSA 2HPUA 4CZKA 2H48B 4CE9A 4DV3K 2W40A 3DFEA 1IXKA 4JI8K 3UM9A 1RYUA 4PL8A 4ZVUB 2XGPA 2PAVA 3I55N 1LAVA 4J9SA 3RB0A 1ULRA 2YB1A 4MK9A 3DDNA 4NPOA 2N4CA 3A5NC 2O8FB 2HBYB 1QZ5A 3U3GA 1B0TA 5A0LA 1YJWS 2HZVA 9ICPA 1RTJB 4W98A 1RT1B 3HKZF 2F3JA 2NXEA 5E7OB 2BDPA 1PYSB 2Q97A 4CTAB 4OLAA 2AJ0A 3O44A 1YZ7A 4FXWA 4JYAK 3TZWA 5DJBA 4OJ5A 3JPRA 2W7OA 1VQ4N 3IM9A 1RCHA 2UUAJ 5GAGP 3OYCA 3F53A 3PNIA 2ZIWB 4I2HA 2BVZA 2BJ3A 2PYJA 3JQMA 1CZAN 2KDOA 1VRQC 4OIXA 4USTA 3VF4A 4CEEA 5AM0A 5LL6Z 3W5YA 2VJUA 1N32F 5HP1B 2B21A 4RBTA 3H6EA 4KFBB 1VBKA 4FNHA 3AVNA 1F2GA 1NBEB 5KT5A 3C6HA 3VEZA 4QJVA 1W7AA 1OWXA 2BJDA 4R0EA 4LIRA 1UMJA 2F8EX 1IBLJ 2VYPA 4DWIA 2BKPA 3HD2A 5IC4B 2J9DA 3GV7B 3VQ4A 3TX0A 4GXIA 4U6PA 5HP4A 4M5KA 2G8FA 3LDNA 3AA4A 3NUQA 2BBEA 3O5BA 5DDYA 1Q95G 2DHGA 3SR6A 5I3UA 5ALXA 3JXOA 4PXDA 3F9MA 2KVIA 4IOCQ 3K0SA 1IBMF 4MFBA 4LFAK 4EWTA 2A42A 4KY3A 4LF8K 1KVBA 2VDIA 4PR6A 2QEXN 1NJZA 3VEXA 3V5RA 4BJQA 1C1AA 2O8CA 1FRKA 3V9ZA 2VDHA 4ILJA 4FJXA 5KRTA 3NGZA 1XNRK 1F0XA 1I1GA 3AFGA 5CZ2A 2Z2LA 1N88A 1TL1A 4DN0A 3AO5A 2E29A 5HI7A 4W5RA 2CADA 4IJAA 5J2IA 3Q2SC 2HHSA 4ZVHA 1IVZA 5KFLA 2IM2A 1XMOF 2ITMA 2PGCA 4MT1A 2M88A 2IC3A 2V52B 3QUTA 4KQZA 5A76A 5DDPC 4USAA 1VQ6S 1YJTA 2LEAA 5T14A 2O8BB 1S0NA 3NNAA 2A3JA 2IM1A 1IKXA 2O8EB 4MN4C 3PHTA 1JCGA 2F9TA 3IM8A 2B9WA 1R8CA 4OJ3A 3BR8A 2P51A 1NZAA 3R3TA 2A2CA 5J2QA 2A6MA 4C0ZA 5GVQA 3O1LA 4B8CA 4M1KA 2R7UA 2CPRA 3PO4A 3R8EA 1ZM4A 1U2CA 3OV7A 1RDBA 3JS6A 3NKYA 3ZT0A 4FYWB 1Q4RA 1KQSM 1X4HA 1L7MA 3MXHP 1HHSA 2E88A 4WYLA 1U0SA 3VQSA 2LXUA 3WUHA 5JXSA 4F26A 2EQYA 4IH7A 4K4TA 1V3RA 1WHYA 2YMQA 1BHLA 4OI6A 2FPMA 2ZJPQ 2W41A 3L7PA 4DX5A 3QBWA 3A4TA 1RK8A 3AVBA 1X66A 1HJPA 1QSYA 1EB0A 2FPLA 1RAOA 4KE5A 3OTEA 5L46A 3KLHA 4BRGA 2Q6CA 2B0CA 4PG7A 4A2BA 5GADP 1WKJA 3M7VA 3H5SA 1L3VA 4EP5A 2L5YA 1NAQA 4UUWA 2PFOA 4QAGA 4JI3K 2ZVSA 2O67A 1Q5VA 3WK7A 9ICIA 5DLFA 3PKMA 4YNQA 3BYPA 2BW7A 2QTDA 4U7BA 3TABA 1TAUA 4XEIA 2LQ9A 3CETA 4CDGA 2HHWA 4C98A 3UDEA 2UUBJ 1TQLA 4ZN3A 4YY3K 3VCDA 4CJ7A 4FS1A 3CJ8A 8ICTA 1GXTA 5DQIA 3S9HA 4RQMA 3E51A 1QQ6A 1VBZA 4CCHA 2ERRA 4HVZA 2JEGA 2P8IA 1VQLN 1CEZA 3T1YJ 4DDFA 4X4RA 5AQQA 3CC7N 3EVOA 4DV3F 3WC0A 5EOZA 4MFFA 1B7YB 4IO9Q 3V81A 4HR2A 1HNIA 4UASA 3RSEA 5HVGA 3PX6A 5IC6B 2V8DA 3O08A 3E9LA 1RT5A 1K5OA 1T94A 1EKEA 3CXCM 4FF1A 4TUQA 2DTJA 4NL9C 3C3LA 4RBVA 3ZNUA 4JRQA 3L2RA 4UAYA 4PWDA 4UOCA 3N6LA 4NOHA 1RHKB 4M42A 3G8QA 3H5YA 1AFIA 1VSIA 2IDEA 2J7WA 4ITSA 1Y97A 3ULEB 3DOKA 1GMVA 2I38A 4UF4A 2E5LJ 1SCJB 4USIA 1EX4A 2A19A 1F21A 1KS2A 3N9UC 1IIPA 5AM3A 1N6QA 3UWTA 2BX6A 1N5SA 1IR2A 3QB0A 2NXJA 4BQLA 1H6KX 3CJ0A 3GZFA 3AO3A 3UE2A 2MGZB 4ZVQB 1JL1A 2JFDA 3SFUA 1FEEA 3G6XA 4Q43A 4ELTA 1VQKS 2DISA 2D6FC 1PAEX 3CVKA 1FEZA 2MQMA 2QFJA 2MRLA 3EUNA 3NS5A 1QVFM 2JC0A 4EAHD 3GP9A 3H7HB 3M8ZA 2DRAA 3OYFA 5E79U 2OPSB 4OLPA 2DR7A 4CF9A 2P2CB 4DQSA 1RAAB 3DMJB 1PC5A 4FJHA 3BGFA 1ZD5A 2YTUA 3CW2C 3CERA 3M4XA 4OX7A 2WVDA 3PYDA 4A8YA 3S01A 3M6UA 3CPEA 5D3GB 4TU9A 2QL9B 4O8KA 2OWOA 4LR7A 4K4HA