3PX0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and dctp-da mismatch (tautomer) in closed conformation
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
579
structure length
557
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 190
structure length 557
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px0A01
4ED3A 2PI5A 3L3UA 1TK0A 5C25A 2HHUA 4NM2A 5J2JA 4YXMA 5CA7A 4MF2A 4RG8A 1ZQTA 3PMLA 1CLQA 2XGPA 2EHGA 3S3OA 1ZQIA 5HRNA 4J2AA 3AO3A 1LV5A 4YXJA 5DB6A 5DQGA 2W9AA 2FLNA 3CFOA 3L2QA 3HM9A 4CGIA 4CJSA 3OSPA 4UBCA 1RT1A 1XC9A 5KT2A 1S97A 4B8CA 3OYGA 1WCLA 2PZSA 1BL3A 4RQ3A 2OZMA 4RUCA 5KFZA 4QWBA 4M47A 3LZJA 4F5RA 5JS2A 3ZT4A 2KZMA 1IKVA 1B9DA 2NRXA 3K5LA 4CJTA 1RDCA 2W9MA 2QKKA 3RBDA 3VQ8A 2RKIA 4HUFA 4FXDA 4KAZA 1Q8IA 3LAKA 5J0QA 3FDSA 2WONA 3GV5B 5KG4A 3AVGA 4M3ZA 1U49A 4QZFA 4K8XA 4J9MA 1ZBIA 2F8SA 4NM1A 5KFHA 1SKSA 1BPXA 9ICVA 3V9UA 1WCNA 4KO0A 1ZQWA 1S5JA 1LW2A 3C2LA 3JYTA 1LW0A 4LY7A 3THVA 4RPZA 3Q8QB 4IQVA 3ZDBA 4YMMA 1SZPA 4QZGA 2YNIA 3V72A 2OZSA 5FRNA 2IS3A 3KK3A 4C8NA 2W9BA 4NY8A 4DTOA 4O55A 2ATLA 3RMBA 3GIJA 2KFNA 2HHWA 1ZBUA 8ICQA 4PGYA 1BI4A 5J0RA 5J2PA 5L9XA 2NUBA 2FBYA 1LB2B 8ICRA 3ULDA 4PHPA 1W0HA 4HUEA 4P4PA 4ECZA 1PZNA 4JV0A 5J2CA 4F4XA 2BE2A 4B9MA 5KI6A 5F9LA 4F5PA 3I0SA 1HRHA 4F5OA 4KLTA 1ZQNA 3JPNA 1ZQMA 4AILC 4PY5A 1JN3A 1XSLA 3OS0A 3Q8SB 1ZQHA 3ZDCA 2GV9A 1H38A 1DLOA 4XQ8A 1ZQOA 4DOAA 1WAJA 4OKJA 4M9JA 4I2JA 3VQQA 4FS2A 3K5MA 5DG8A 4KI6A 3IHQB 3DM2A 1HNVA 3ZT0A 4QWEA 4J9NA 4EBCA 5J0PA 2ASDA 3I8DA 3UQ2A 1U4BA 3RH6A 4DTUA 4QZBA 1FKPA 2G8VA 2HNZA 2VG5A 1F21A 2X74A 5L1KA 1J53A 1C6VA 1JKHA 1MSWD 2Z1IA 2G8IA 3HW8A 2JGUA 3MGIA 4Q5VA 1ZQAA 4HCBA 4J9SA 3KK1A 5KFXA 3M9OB 1S1WA 3H8WA 4YQWA 4M3YA 1ZBHA 4O9MA 3SPYA 1KLMA 5EWGA 4I2DA 4JRQA 1RPLA 4HVJA 4ECVA 4DL4A 2DPIA 3VQ9A 1Q9XA 4CJFA 3MDCA 1XU4A 4W5TA 3UXOA 4UBBA 3DLKA 4O0IA 4DLEA 4DU1A 5JUMA 3LWMA 2BKEA 1S6PA 4M3WA 2JZBB 3LAMA 4CIGA 3V6DA 1KCFA 3E01A 1ZQKA 4F4KA 4ED8A 3ORYA 4DQQA 4H4OA 4CFBA 3KD1E 5CJ7A 1SKWA 8ICZA 1NJXA 3IAYA 4Y1CA 4OJRA 1GOBA 3T5LA 4CEOA 4DL3A 1K1QA 7ICPA 4G3IA 4DG1A 4Z4IA 1TK5A 1BCMA 3ISBA 2W42A 1QTMA 2BGWA 3TWHA 5KFGA 3KK2A 4FJKA 3RAXA 9ICSA 3B6PA 4RW4A 4IFYA 4KHNA 4Z0UA 3VQ7A 1BPDA 3NH0A 1WSJA 3O4NA 2AGQA 3NHGA 3V6JA 3QIPA 1VSDA 2PXIA 3NF6A 4YR0A 1RDBA 2XY5A 3QIOA 5KFMA 9ICGA 2NRZA 2HHQA 2P5OA 3SCXA 5KTQA 1ZQPA 3UQ0A 1T7PA 1BPBA 1EXNA 3H08A 4LH5A 3LK9A 3TAPA 3OYIA 2KZZA 1A5VA 1N48A 1S9GA 1ZQEA 3T1AA 3DI6A 4J2EA 4CEZA 4O5EA 3N97B 3NF7A 3QEXA 3RAQA 5SWMA 3K4GA 4N41A 4FJGA 5IILA 2B4JA 9ICBA 5J2FA 4IQUA 3MFHA 4OLAA 1X2IA 5KT5A 1HYZA 2VWJA 5CR0A 4IG3A 4FJLA 1S0OA 2YNGA 1RT3A 2ASLA 3AO1A 3K75D 2OA8A 5DG9A 2YKMA 4BDYA 3V7KA 4JV1A 4KTZA 3GIKA 1IH7A 1C0MA 3V9SA 2X6NA 2LSNA 3ZD9A 2IA6A 3MBYA 1C7YA 4GC6A 2A1JB 3HX0A 1NOMA 4Q0BA 3SQ1A 1A77A 4UAWA 2V9WA 4FLWA 3WNFA 3ZT3A 3TAQA 3EY1A 3GQCA 1I3AA 2A1JA 1VSHA 1WSGA 4BE1A 3PO4A 4FZXC 8ICTA 5J0OA 3BQ0A 2V4RA 2D0CA 4UAYA 2ATQA 4IR9A 1D8LA 4Z6EA 4F8RA 3RTVA 3AV9A 4CHYA 3MXMA 5HROA 4PUOA 3SV4A 1T8EA 4PQUA 1ZQDA 3KHHA 1S1VA 3OJUA 3DRSA 2UVVA 4GVMA 1ZBFA 4NCBA 1U45A 4RNMA 1MU2A 7ICQA 3M9MB 2GUIA 5IINA 2IHMA 1X1PA 2VG7A 9ICKA 3ETLA 4GXJA 4NYFA 2ZJ5A 5KFEA 5HP1A 3AU6A 7ICEA 3HPOA 2ZQBA 3DRPA 2NRWA 4ID1A 1HYVA 2ASJA 3L2UA 3ZT1A 1JLQA 4DS4A 5D3GA 1IKYA 3PO5A 3AVNA 3UIQA 2BPGA 4YMNA 4F4WA 2VG6A 3H7IA 1LWFA 4CECA 5KG7A 4MEXA 3AVKA 4CIEA 3HVRA 3V1RA 1SL1A 3DYAA 4I2QA 5J0UA 1WSIA 4RT2A 1RXWA 1L3UA 4C8OA 2A1SA 7ICKA 3C1YA 2B6AA 5J2MA 2DFFA 4CGJA 4DOCA 4RUAA 5J0XA 2RPIA 1B92A 5KFNA 4ZHRA 2ZUDA 4IFVA 4PH5A 1BPYA 4JLHA 4IG0A 2A1RA 1HQEA 4LVSA 4DEZA 4E0DA 1Q9YA 4E7HA 5KFLA 4RQ1A 4J9LA 4OKEA 3C2MA 3C5FA 1NJYA 4DO9A 4Z4CA 4E1NA 4ED7A 3F9KA 3V4IA 1UWBA 3RB3A 4C8KA 8ICWA 2JEFA 4KLLA 4DF4A 1SKRA 1BVSA 4YVZA 4QZEA 2JZBA 4KLFA 3DLBA 3SJJA 3ZSWA 3LDSA 4TSXA 2WOMA 8ICUA 5E41A 4OKKA 1QHTA 2IOCA 3IS9A 3NTUA 1IO2A 3C6UA 4FLVA 4CFAA 4UB3A 4IQWA 4OPKA 4DU3A 3H4BA 1C1BA 3SPZA 4FZYA 1VSEA 4E7JA 3QE9Y 5EWFA 2O4GA 1IXRA 2Q0ZX 5K14A 4MFBA 3P5JA 4EEYA 4M9HA 5KG3A 1ZQLA 4I27A 3K5NA 1AROP 5CWRA 1RT4A 3SUQA 2FBXA 4UB4A 4EZ9A 1S1UA 4MFAA 3LP0A 2BQUA 5HBMA 5KGXA 3G6XA 1QSLA 2YHBA 4KLHA 3V9XA 5KFCA 3L2VA 3G6VA 3QEPA 4FJMA 2HHSA 3SNNA 2BCSA 3HVTA 1DOQA 4KN7A 4Z6FA 2XRIA 3ZSXA 2PYLA 3G10A 2JLEA 3MEDA 3MXJA 1KVCA 4QWAA 4CEBA 5DGAA 4JWNA 2EX3A 1S0MA 3V7LA 3E2EA 2DTUA 4BE2A 2YKNA 2VA8A 2HVIA 1JLGA 2D0BA 2IGIA 3S3NA 4PA1A 4MFFA 4K4HA 4W5RA 4RZRA 4Q44A 4IKFA 2KQ2A 1JL1A 1ZBLA 3HJFA 5DG7A 3KHLA 3GFKB 2IMWP 2MUTA 3PR5B 4I2BA 2ITGA 9ICWA 4CJWA 7ICLA 3M9NB 3RJKA 4P2HA 1HJPA 1J9AA 4KPYA 4CGHA 4FW1A 2C22A 2KW4A 1RDDA 3EYZA 1SL2A 3KLHA 4CEEA 4RT3A 4F2RA 7ICSA 3VQBA 4OLBA 1S10A 3NDKA 4KHSA 5J2KA 2QXFA 3HP6A 2ZUCA 4ZH4A 3DOLA 3LPTA 2B21A 4B3OA 1TVRA 2F96A 4I2AA 1ZQJA 2AU0A 2UVUA 2R8HA 1ZQCA 2ZTDA 3UXNA 4XUSA 3NF8A 3RJJA 4DSIA 3JPSA 3GILA 1BPEA 5J0WA 3OYEA 5BOMA 4RQ8A 4TUPA 3PV8A 4M0AA 4ZTFA 4YR2A 8ICGA 4HTUA 4DTSA 4PHDA 5IIOA 3ZT2A 2P1JA 4F2SA 4KITB 3TAFA 1KFTA 4YD1A 4DMNA 4KLIA 4I2EA 2C2EA 2ZJ8A 2VA2A 4DQRA 4DU4A 1Z00B 1U47A 1S77D 3MR6A 4B9TA 3PUFA 3QETA 2H5XA 1ZQVA 3HT3A 4FBUA 3ZCMA 4CF1A 1KFDA 2RN2A 3OYFA 3PW2A 4FJXA 1ZQBA 4O4GA 3HO1A 3MEEA 3O4QA 3QERA 3OHBA 1YTAA 3AVLA 1GOAA 4C8MA 4DTRA 1EP4A 1RCHA 1REVA 2OPPA 2I9GA 1BQMA 4QZHA 3ZSQA 4UB2A 5DMRA 3PMNA 2YNFA 2P6RA 1TKZA 5KG6A 4YR3A 4K4GA 4E19A 3G0ZA 2BHNA 3ITHA 4IRDA 4J9QA 3RB0A 4ID5A 2YV0X 4L8RB 1XHXA 4CJ4A 4J9PA 3AO4A 2PYJA 3HK2A 4FBTA 3GIIA 3T5KA 3OHAA 4W5NA 3QESA 4B9NA 4N5SA 2BGGA 2UVWA 1LAWA 2C28A 4EZ6A 3L3VA 2F1IA 3C5GA 4TQRA 4Q43A 4F93B 5IIIA 4M45A 2QKBA 4UAZA 1FXXA 3CM6A 1SUQA 1BIUA 3U3GA 5J2IA 4DTJA 9ICMA 1BCOA 4HYKA 3H4DA 4KLJA 4IQTA 4R66A 2FLPA 2XGQA 4OPJA 4EP5A 4NCGA 4GMJB 1TL3A 1WSFA 4R64A 3DLGA 2FMSA 3OGUA 4CFDA 4E7KA 9ICHA 3SV3A 1TGOA 3RWUA 3TR8A 4I28A 3LPUA 4NXZA 4NLGA 1ZQSA 2D0AA 2W8KA 7ICTA 1C0UA 4DSKA 3S9HA 3VA0A 4B9VA 3AA3A 3M8RA 1QS4A 3HYFA 2J6SA 1BI4B 3AVBA 3RJGA 4RPXA 5CZ1A 4RQ2A 4DTMA 1Z25A 3AVIA 4J9KA 1RT7A 1TKTA 5KFKA 1TV6A 4FCYA 1KLNA 1UT5A 4O3NA 3RJEA 1RNHA 1BISA 3NBPA 1BPZA 8ICYA 1JXEA 2BCVA 4KTWA 1RT5A 2DPJA 3SI6A 3SQ2A 1BQNA 5J2QA 1Z00A 3MDAA 2IDOA 9ICAA 2BPCA 4M9GA 5J2NA 5J0YA 1RTIA 8ICAA 4CJKA 4EP4A 3MXIA 4R8UA 2PY5A 4N47A 5FRMA 1T3NA 3SUOA 5KFVA 4LSNA 3DRRA 3EWAA 3ISDA 1QE1A 3EZ5A 3U6FA 4UB5A 3DLEA 3TI0A 1X9WA 4JV2A 1CZBA 1JIHA 2Z1JA 4BDZA 3H40A 4F91B 2ALZA 1W9HA 1DGSA 3O3GA 5DB9A 3PY8A 3GV7B 4F4ZA 1RTJA 5KFPA 2FMPA 5EWEA 3ZSZA 2PI4A 8ICCA 3HPGA 4O0JA 1J54A 4CCHA 3QEVA 1JXLA 1NK6A 3LDAA 1QLNA 1A76A 4OGEA 4MEYA 3HWTA 4RQ6A 4LZGA 3T5JA 3H8JA 3Q8RB 4OGCA 4CIFA 2OPQA 1B22A 2BDPA 3VQ4A 3NE6A 2W9BB 2GWSA 1DTTA 1JX4A 3PW0A 1S6QA 1JXBA 1NOYA 4KHUA 2F1JA 3SI8A 5KG5A 5J2GA 2BPFA 4I9QA 1VK0A 1NKEA 1ITGA 2IHNA 4PGQA 4B9SA 3Q8MA 1KTQA 7ICNA 4EYIB 1KFSA 5KT7A 1KSPA 9ICLA 1VSKA 2JEGA 4QZDA 2XC9A 2E6MA 1WAFA 3VQ5A 3ZDDA 1B43A 4QZCA 2F1HA 2P6UA 2FPKA 4W5QA 2C2RA 2KFZA 2DFEA 4B9LA 2XCAA 3JPQA 2XCPA 1BHLA 5DBBA 1VSJA 4DTXA 1HUOA 4QWDA 3BGRA 1HNIA 2XY6A 3ISNC 5J0SA 2XY8A 3QNOA 1JLCA 3F73A 3M8SA 5L1IA 4ELVA 4G1QA 4JK1A 8ICVA 1J5OA 2G8WA 3MFIA 3C21A 2VA3A 1MQ3A 5D49A 1L3VA 3K57A 3MECA 4DLGA 4KREA 9ICRA 2HNDA 3PX0A 2HHVA 1ZQRA 3IM1A 3RMAA 3V6HA 1EXQA 4M04A 3TABA 3MGHA 4I2FA 3JPRA 2IAJA 4JUZA 3H8SA 5HHHA 4CJLA 3RB6A 3OYKA 2ZJAA 4Q8FA 5J2DA 1CUKA 3GDXA 2UVRA 4DFPA 5BOLA 2HHTA 5DQIA 1RBSA 2G8HA 3LANA 4RQ0A 3ZDAA 3NGDA 4JRPA 2OYQA 4KTQA 1TAUA 3RMDA 3HL8A 3P1GA 4P4OA 2FC0A 4CJUA 3VQEA 4NCAA 2YHAA 4B8AB 3OYJA 3RRHA 5HRPA 2FBVA 1IKXA 9ICQA 4CJQA 3KLEA 3LWLA 3TQ1A 4DL5A 4BE0A 1UT8A 2C2DA 2WTFA 4CK1A 4FLTA 4NLZA 1N56A 8ICJA 4K4IA 3OYHA 3AO2A 2MAXA 3V9ZA 1XHZA 5CYMA 4CERA 3ZSVA 3DLRA 4E7IA 3AU2A 4EBEA 4IDKA 4ELTA 2LYHA 5KT6A 4DS5A 3QNNA 3WNHA 1YVUA 1D9FA 1XSPA 3Q8KA 4YN4A 1RZTA 5D4BA 4QOZB 3K59A 1VRTA 4JS5A 3AVJA 4QZIA 1ZYQA 5KFQA 2BANA 2Z1HA 2IC3A 4KMUA 3JPPA 4F3OA 4O3RA 3KLFA 4HHTA 4IBNA 5DQHA 1ZQFA 1RT6A 3KIOA 3D45A 1MC8A 5KFUA 2PFNA 3PX6A 3A2FA 4CF0A 5DBCA 1HMVA 3NGYA 4RW7A 4CGGA 3AA2A 1I39A 4ECTA 2Q3SA 9ICFA 1HQUA 4ED1A 3RB4A 3TAMA 4CFCA 2J6TA 4HUGA 1RDAA 4QW9A 5CZ2A 3PW5A 2FPMA 4PHAA 3AA5X 1COOA 4I7FA 4AH9A 3AUOA 4RPYA 1MQ2A 1KVBA 4CJEA 9ICXA 1ZQUA 4M2YA 1NJZA 8ICMA 4QWCA 4I2HA 1NKCA 3L2WA 4O3QA 3HSTB 3QEWA 1XSNA 1UAXA 3QINA 5DLGA 4PWDA 3EPIA 3CQ8A 3L2RA 4M3UA 3AO5A 3Q8PB 2Z1GA 4GC7A 3SUPA 1BIZA 1Z3EB 4J9RA 3QEAZ 4DFKA 4PGXA 2VWKA 2IBKA 4ECXA 1Y97A 4FJIA 1UA1A 4O5CA 1FK9A 3V6KA 4BACA 4KHQA 3RMCA 2OWOA 9ICUA 2ZTEA 3M8PA 3D0PA 1NJWA 3O3HA 4E3SA 5CY4A 8ICHA 4RNOA 4ICLA 4CJPA 1A5XA 2G8FA 3C94A 4DQSA 9ICOA 4R8UB 5DK5A 3OYNA 3AVFA 4KLUA 4HCCA 1IM4A 4Z4GA 1ZQXA 2HHXA 5KFRA 2I5JA 2J6UA 1U04A 1ZJNA 4LH4A 3Q8LA 3FFIA 4O5BA 4ED6A 2XHBA 1RBTA 4FM2A 9ICTA 3QEIA 3B6OA 2KN7A 4F92B 3AVHA 4JWMA 4KN4A 1GOCA 2KZ3A 1LWEA 1JLFA 5DB7A 4O3SA 4I9LA 1SL0A 2XY7A 3K5OA 1K1SA 5FROA 4B9UA 2BCUA 2KTQA 1XWLA 5BPCA 5C5JA 5KT3A 4UB1A 2DFHA 3SUNA 1RTHA 1TKXA 3WNEA 3T3FA 3RJIA 4CHOA 4QZAA 4NYNA 5IIKA 3AVMA 3OYLA 4RW9A 2MUTB 3TAEA 2R7YA 3OVNA 1KDHA 3OYDA 9ICCA 5T7BA 3LALA 1NK7A 1S76D 4NLKA 1JLAA 3SYZA 3PVXA 3SQ4A 4FJNA 4I29A 4I2IA 3BDPA 4M3XA 4RU9A 3U3YA 5JS1A 4I2CA 2R8IA 1XI1A 5I3UA 2BR0A 3OJSA 2RF2A 4X5VA 3LZIA 3KKRA 4KLSA 5D46A 3NGIA 3QEBZ 4KHWA 3CFPA 3NGZA 4CK2A 4Z4EA 8ICLA 4CHNA 4M41A 2HNYA 1BGXT 4GXKA 5F9NA 1WSEA 5DBAA 4FJ5A 4LZDA 3GV8B 2BCRA 1WSHA 4K8ZA 3RJFA 5KRTA 3OS2A 4YD2A 4KLDA 2XO7A 4KLGA 2ZE2A 4DL7A 4E89A 2AQ4A 3V1OA 5J29A 1QSSA 2NRTA 7ICHA 9ICIA 5KFAA 4QAGA 5HMMA 5J1EA 1S9EA 4CF9A 1VSFA 1ASWA 1DTQA 4M6WA 3NFAA 4CHZA 1X9SA 3PR4A 3DLHA 4J2DA 2RDIA 1S0NA 4PHEA 4R5PA 4NLNA 2OPSA 3VN5A 4KI4A 4FK2A 4F3TA 4FW2A 3ASMA 3LP3A 1TFRA 4BDPA 3G6YA 8ICKA 1D5AA 3V1QA 3VA3A 4KLOA 5FDLA 3OSNA 4J2BA 5DKWA 1QQCA 3KHRA 1ZQZA 5KFSA 4DSEA 4F5NA 4BWMA 3TFRA 2DY4A 2PFQA 3TFSA 4FLZA 5TZVA 3PW7A 1TK8A 4TQSA 4YNQA 5CYQA 3BQTA 3NAEA 4DF8A 3CM5A 3M8QA 4I2PA 4CGFA 3RR7A 2D5RA 3OYBA 4AHSA 3QLHA 2I1QA 2W9CB 2AQ0A 4FZZA 3UXPA 4LSLA 4YMOA 1G15A 4FK4A 3QO9A 4RQ7A 1Y88A 3TAGA 5HNKA 5KFYA 3OYMA 1TAQA 4GXIA 9ICEA 3KJVA 1XS9D 2O4IA 3ZSYA 5DGBA 4KV8A 4KLEA 4ECYA 4N56A 1CZ9A 4ED0A 2P66A 3K58A 4AHRA 3RH5A 3C2KA 1EETA 4CHPA 7ICVA 5EOZA 4DL6A 2JEIA 1C1AA 3KLIA 5EU7A 7ICIA 3AA4A 4KLMA 5KG1A 5DDMA 3L8BA 2FPLA 2VANA 4CJ3A 2FBTA 2P51A 3V81A 5HLFA 3RRGA 1EKEA 1RBVA 1JMSA 4FJ8A 3ISCA 2X78A 4QCLA 3O3FA 4KKOA 4GW6A 4Z4HA 4DSJA 4YP3A 3JPOA 4DTPA 1TKDA 1L5UA 3HXMA 3AVCA 1NK8A 1IG9A 1L3TA 2FLLA 9ICNA 4DQPA 1KVAA 3B0YA 4MQ3A 4Z4FA 5HP4A 3NF9A 1LWCA 3VQPA 4CHQA 1VSLA 4LD0A 7ICRA 4KFBA 1QSYA 2PFOA 5J2AA 1T03A 4DWIA 2Y1IA 1K6YA 3PW4A 4DTNA 2R8JA 2X6SA 4J9OA 1HUZA 4M9NA 1S0VA 4WE1A 1RXVA 3ALYA 4M9LA 1YTUA 5KFIA 3V7JA 4M3RA 4JS4A 2ISOA 1WLJA 3VQDA 1NOZA 2JEJA 8ICNA 2P5GA 4ECRA 5DDYA 3KLGA 3DMJA 1D9DA 1YT3A 8ICPA 2E6LA 2BQRA 3ZDEA 3TARA 3MR5A 2AJQA 2ETJA 4RQ4A 1S9FA 9ICJA 8ICOA 5DB8A 1NK0A 2BQ3A 4O3PA 5J0TA 4IR1A 3B0XA 1N5YA 4Z6CA 9ICPA 4RW8A 1RTDA 5KFBA 5HRSA 3LP2A 3RJHA 4UQGA 2HW3A 2V4QA 1B9FA 3OYAA 3BQ1A 3KKSA 5KFOA 7ICGA 1S1XA 4PPXA 1WNSA 4DOBA 1UA0A 3JSMA 4ECSA 8ICEA 1U48A 1RBRA 1O1WA 1CXUA 5CP2A 4W5OA 1NKBA 3VQAA 4RW6A 1ZQYA 1ASUA 5KRSA 3RH4A 1HJRA 2PFPA 5J2EA 4KHYA 4DSFA 4CESA 3CYMA 4CJVA 1ASVA 4QZ9A 3QZ8A 2B5JA 4CGDA 2W8LA 1RT2A 4F4YA 4H8KA 1ZETA 1KEJA 5IIJA 4AHUA 1CXQA 4XA5A 4FLUA 5J2HA 4YFUA 3K2PA 4CEFA 4KB1A 3T5HA 3PNCA 3PX4A 4FM1A 1ZQQA 1CEZA 4MFCA 4TURA 3HPHA 5I42A 5IIMA 7ICOA 4FLXA 4AHCA 1NK9A 3ZSOA 5CB1A 4H4MA 2ISPA 1HPZA 1L3SA 4CK3A 2QK9A 4YG2A 4R63A 5KG0A 4YFKA 8ICSA 4FJ7A 8ICXA 4M42A 5KFWA 2BCQA 3LP1A 3QZ7A 3BJYA 2HB5A 4FJ9A 4Q8EA 7ICJA 1V9PA 3EW9A 4EYHB 4CF8A 4QW8A 4FJJA 1C1CA 3MR3A 4TUQA 3UPQA 1VRUA 3ZSRA 4FK0A 3KD5E 4DL2A 1JL2A 4ECUA 3P83D 4FJHA 2ZD1A 5KT4A 4IRCA 4FYDA 4O44A 4IRKA 1XO1A 4R65A 4ECQA 5HRRA 4CEQA 3NH1A 3I0RA 4O5KA 3MEGA 4RQ5A 4FM0A 8ICFA 2GBZA 3SZ2A 4Y1DA 4EBDA 4XIUA 3V9WA 4CEAA 3RBEA 1NK5A 2R8GA 5HMLA 1Z26A 4M3TA 4CJ5A 4GLXA 2RDJA 4CJRA 4FO6A 2YNHA 5J2BA 4BXOB 1TV9A 1T05A 3RR8A 4E1MA 3HP9A 5KFFA 4XRHA 1NK4A 1RYSA 2HVHA 3C1ZA 2W9CA 1WN7A 3FYHA 1UOCA 2NRVA 1A5WA 4Q45A 4BXOA 3MAQA 1RBUA 4O3OA 7ICUA 3WNGA 1HYSA 1T4GA 4DQIA 1EX4A 2DFLA 1IKWA 3ZD8A 1KRPA 7ICFA 1N6QA 3KTQA 1C0TA 1TL1A 4KLQA 4P4MA 4F5QA 1ZJMA 3T19A 3NCIA 3C95A 4C8LA 4I2GA 2Y1JA 4BWJA 3DOKA 4FVMA 1X9MA 3OYCA 3JPTA 5KG2A 4CF2A 5CHGA 5KFJA 3GIMA 2HMIA 5L1JA 4ED2A 4AHTA 4ELUA 2FMQA 4KRFA 3VQCA 2G8KA 3IG1A 4ZTJA 1VSMA 2F8TA 2E4LA 8ICBA 4M6WB 4ECWA 2R8KA 5C42A 2G8UA 3IRXA 4KB0A 3KHGA 3AVAA 5SZTA 1D8YA 5KFDA 4AHVA 7ICMA 1U9LA 3SQ0A 4Z6DA 4TUSA 3EPGA 1ZQGA 4DFJA 4F50A 3MR2A 3N4MB 4YCXA 2M9NA 3MABA 3OY9A 5C24A 3VQ6A 8ICIA 4OVLA 4RNNA 3C23A 5HHIA 3BQ2A 3CG7A 4BGDA 4FLYA 4DFMA 4CEDA 3C6TA 3NH2A 5KFTA 2AGPA 5KGWA 4B08A 4E7LA 2ZUBA 1RILA 1LAVA 1JLEA 1JLBA 4N76A 4QZ8A 1VSIA 4CE9A 1RYRA 3TANA 2OPRA 3CFRA 4DSLA 5DLFA 2ZTCA 4FS1A 1TVAA 1SV5A 4MF8A 1S1TA 1R0AA 2AGOA 3S3MA 5L1LA 1FKOA 3OS1A
chains in the Genus database with same CATH superfamily
4ED3A 4IZ9A 4F02A 3L3UA 3TZWA 2W3RA 4K43A 5C25A 2DYAA 5K5MA 3NS7B 3KLGB 1SJQA 2YNHB 4EUVA 1DZ5A 4USTA 5CA7A 2Q66A 1DK2A 1YRTA 1F9EB 4KH1B 4IO9L 4JKDA 3S3OA 5HRNA 3QT8A 2H51B 4YXJA 3CCMN 5EX5A 4CJSA 4A8EA 3EO3A 4UBCA 5A8RA 3TUPA 2RU3A 1RCXB 1XC9A 5KT2A 4JI2K 1Q7YO 1BL3A 1KR4A 3FLCO 2QA4G 4RQ3A 3MUVP 5KFZA 2YX4A 3N28A 5JS2A 4JI4J 2YXLA 2NRXA 4WF9L 2JRSA 3RBDA 3D2EB 3S7RA 3VQ8A 2MKSA 3UR0A 4FXDA 4J8FA 1Q8IA 2VFTA 3D0IE 4YHHK 2N7YA 3TU5A 4EO8A 3RZAA 4QZFA 2FY1A 4K8XA 2J0SD 1UP1A 1O51A 3V9UA 4Z37A 1QAXA 3IBFB 1Q81T 1LW2A 3JYTA 2F4FA 4RPZA 2MHEA 4IQVA 4OJHA 4LFBF 4NLDA 1BNOA 3ETOA 3CDAA 1SZPA 2YCHA 3KHYA 3V72A 3J7AN 5FRNA 2IS3A 1F9FA 4C8NA 2RF2B 2V34A 2OEJA 4O55A 4IFYB 1LOUA 3GIJA 2Z7JA 1VRTB 1R7IA 3DGPA 4PGYA 3VPZA 3CCJS 5J0RA 5BJRA 1X42A 2GCFA 2YHYA 2LYVA 2GIQA 5H9FK 4Y2XA 4JV0A 4CD1A 2HSTA 3CSKA 2BE2A 5H1SV 4F5PA 2J7KA 3H8YA 1UZDA 2IRYA 3CJTA 3DI6B 3O1WA 4WK3A 2IIHA 3QMLA 1NO8A 3W63A 1SC6A 1XSLA 3ICXA 2GV9A 5AQHA 4DOAA 1FFSB 1WAJA 4OKJA 3SSSA 1GX6A 3A13A 3VQQA 4FS2A 2EI5A 3IHQB 3DM2A 3ZT0A 3L0QA 3HKZF 2ASDA 1NB2A 1DFDA 5IFMA 3VALA 1XIQA 1L7PA 2G8VA 3FCVA 1J5OB 2HNZA 2VG5A 5F8LA 1FERA 2ASYA 2VFVA 4Q5VA 4FYXB 1DGKN 2MQOA 3JSYA 2BRKA 2JZ5A 3KK1A 4OX9J 3ONQA 1ZBHA 1GLJO 4O9MA 4QIGA 1PJ7A 4JRQA 4JKEA 2DUYA 4DZDA 3DDIA 4HVJA 3IWLA 3MCSA 3EUB2 4ECVA 2CJ9A 5CR4A 4CO0A 4EHUA 4CJFA 3MDCA 1RM6C 1JLFB 4RQNA 5KPZA 2VHGA 2J8AA 1GTHA 2B4UA 5IV3A 2UV8G 4C0HA 2BKEA 4U6PA 5BN9A 4RWTA 4A2AA 3AN1A 1WD6A 4F4KA 2BOPA 3KD1E 1CJUB 4WCEL 3D6TB 1ICEB 3PIPL 3DXKA 2DBBA 2BDUA 2A1AA 1PSDA 2ADCA 1IN0A 2E5JA 1TK5A 2FVSA 2PE8A 4ILJA 1RAIB 1QTMA 2DR9A 5KFGA 3B6PA 4JBCA 4KHNA 3OTCA 4GKJF 4AL6A 2H1YA 5J2MB 2GO8A 3CCES 1LNQA 2GVDB 1IBCB 5L9NA 2K4HA 2F4VF 4KO0B 3QBCA 2KKVA 5CYMB 4X4VA 4AP9A 3V81B 5AM0A 9ICGA 2HI0A 4ILHA 2HHQA 1YSJA 3CDEA 5EUHA 2YB4A 3MCMA 1QQ5A 2XI3A 4USAA 2EZXA 3WQTA 3OYIA 2AD9A 1N48A 1A5VA 2GW8A 4HDGA 1YJUA 3TVKA 4J2EA 1PK1A 2BZ2A 5GAHI 3P6YC 1IVZA 4PYDA 3K4GA 3KJQB 4P73A 2VIXA 3IXQA 4P0PA 1JLBB 3MFHA 4OV1A 1HMVB 5E3CA 4AYBF 4DV3J 1WHXA 4F0HA 5CR0A 5ALUA 3K0JA 4KBOA 4FJLA 3F5AA 5AI0A 1S0OA 2NPFA 1RT3A 4OHYA 2ASLA 4ISEA 4C98A 2P2CB 4ZVPB 3GIKA 1IH7A 1C0MA 3ELHA 1KD1T 2KU7A 2RT3A 1ZA2B 4KH6A 2DKZA 2IA6A 5C7PA 2NO5A 4ED5A 5ETPA 1MMDA 1NOMA 5AKLA 2NYVA 3BS7A 5HVGA 3SQ1A 5G5GA 1RTHB 3VCBA 5AQJA 2V9WA 3ZT3A 5A2QO 3TAQA 2X1BA 2GWJA 4MT1A 4J37A 4FZXC 4J5OA 3BQ0A 3FCWA 5A0LA 4IR9A 1D8LA 2WHEA 4RTFD 2F7VA 3AV9A 3AL0B 3H6EA 1PAUB 2HBYB 2D69A 4BRLA 1F5BA 3L95X 3F2CA 2YH0A 4IC9A 2OSQA 3BS5B 2JH3A 3RW6A 3NMAA 4P7VA 3QLHB 1H74A 3H3NO 2C2OB 1B7FA 1MU2A 3A5OC 4USIA 3TQEA 4Y2UA 3M9MB 5IINA 2VG7A 1RWNB 4DV2F 9ICKA 3R5JB 4TKTA 2Y0SC 4K4ZA 4WIIA 3HLUA 3WDOA 3KLFB 3EICA 2F3NA 3O9SA 3KK2B 3DLKB 3HOTA 2EXUA 7ICEA 3M6WA 2HHHJ 1ZAWA 2VDHA 2NRWA 3M8ZA 3H20A 2EDUA 2YMMA 3R2DJ 1QCKA 3BDEA 4RWXA 2AYGA 1OW5A 2R7UA 2IFXA 1JLQA 5EGYA 1IKYA 4LFBJ 2ZH1A 3WXLA 3AVNA 1HIWA 4YMNA 4F4WA 4JYAF 3H7IA 3UWTA 2H4YB 3H2VE 3EGZA 1T95A 2KYZA 5E3QA 3HVRA 3NS5A 1TQLA 3N4WA 2WW4A 1NI3A 3D3CJ 4OL8A 4KHPK 1L3UA 2B6AA 1JKHB 3V2UC 4DR2K 2DFFA 4CGJA 4DOCA 1PUZA 3B82A 4RUAA 4BC5A 3ENOA 4UZCA 2EW9A 1APSA 2EKYA 2OPSB 2HWTA 1BPYA 3IN5A 3ZZPA 4UB6U 3CCMS 3KOAA 4B3MF 4M7XA 1HQEA 5KAIU 1RWPB 4JI8K 2HIYA 4CF3A 4RQ1A 2DHAA 3HVAA 3MN5A 1S12A 4XTTA 3T79A 1HARA 1NJYA 4DO9A 4ED7A 1UWBA 4C8KA 4FWRA 1SKRA 4QZEA 2JWKA 3GSDA 2N7CA 1LVHA 2WOMA 2CDRB 5CZVA 3W9HA 2GHWA 3WX8A 4UY8O 3TW0A 3RFAA 2Z2MA 4ZVTB 2V52B 2IBOA 2KJ9A 1GH8A 4CFAA 3UNYA 4DU3A 1UWAA 5AQSA 3SPZA 4FZYA 3CMAS 5EY4A 1FDAA 3QE9Y 5EWFA 2O4GA 3HFVA 1CJVB 5J8YA 1IJJA 5BREA 5KG3A 4MDAA 2ZBQA 3K5NA 5CWRA 1RT4A 1VYAA 3HHLA 3CJ7A 4UB4A 4EZ9A 1F6TA 4BC7A 2KO1A 4G9BA 1QSLA 3UDCA 5ALJA 3T1YK 3I87A 3T9ZA 4JI4K 3OT9A 3GDQA 3NVMA 3DU6A 3JAMY 2RUGA 1TFWA 4DUZJ 3CCJN 2FC8A 4PQUB 1JCGA 2ZOGA 1GTEA 3ZSXA 1UKUA 2F4VJ 1TL1B 4QWAA 2VASA 5DGAA 3BSNA 1S0MA 2KICA 2DTUA 2YKNA 1FA0A 2VA8A 2HVIA 1XQIA 3F53A 3EGVA 1H98A 5BR8K 1JJ4A 5GMKa 3S3NA 1IR2A 1U25A 2NUUG 3TSPA 1OPIA 3BGOP 1SS6A 5AK3A 4RZRA 1B64A 4IKFA 2Z2YB 2QFIA 4P71A 2KQ2A 1M1KO 2HK2A 2GAGC 1JL1A 4YDXA 5G0RA 5AQUA 5AXKA 1IUJA 2MPUA 2WSEC 5EE9A 2X3GA 5DG7A 1NXIA 1RQLA 5ETSA 1X4DA 3DNCA 5ELZA 4CJWA 2D0PA 4DUTA 4P2HA 1VQ5S 1J9AA 1FXLA 4CGHA 4FW1A 3W2VA 2Y1LB 1DT9A 1YJTA 4LR9A 1SL2A 1SI9A 1BUPA 4IJNA 1S7HA 4PXEA 4CT8A 3CO0P 4DB3A 4B3OA 2H5EA 3MTKA 5AE1A 2Z57B 2UVUA 5BR9A 2R8HA 4XUSA 4GKJJ 4FWNA 1T05B 3GILA 1BPEA 1V3SA 3OYEA 1U1RA 3W66A 3GFYA 4EMDA 4CO3A 4DTSA 4PHDA 5AKJA 2P1JA 1KQFB 4F2SA 4MK8A 4KITB 1KFTA 2XLJA 4DMNA 2CZ4A 4KLIA 2OD4A 1WUDA 1RT5B 4UUWA 4XH5A 3TKAA 3E01B 2VWBA 1U47A 3L4PA 4FL9A 3PUFA 2H5XA 4OZ3A 1ZQVA 4F26A 1G99A 2VKRA 2CPIA 4LSLB 1VI7A 3OYFA 4FJXA 2OEKA 1ZQBA 1DEJA 4Y65A 4O4GA 3HO1A 4RW6B 2YWFA 2CQBA 1RQNA 2ZH6A 2R7QA 3BQ7A 5AQIA 2W54A 1JQGA 1NMDA 3DLLL 2YY6A 3KDOA 4UB2A 2AP6A 3PMNA 1UL3A 1MWQA 1Q16B 2P6RA 4LRCA 3EEQA 2FZGB 4K0KJ 3GPAA 4K4GA 3C7NA 4KIAA 3G0ZA 2BHNA 1SC1B 2OD6A 4UAUA 3RB0A 3OVBA 3D2QA 2JH7A 2Q31A 2G0IA 2N3LA 3AO4A 2PYJA 3HK2A 1XMQJ 3SENA 4DR5J 2V4JB 1JMTA 2BGGA 2UVWA 1LAWA 2F1IA 3R6LB 3M6KA 1Y9OA 4FWMA 1FRMA 1Y0HA 1SUQA 2DHXA 1BIUA 1T9UA 3MX2A 5J2IA 1K8KB 3NOGA 1VBXA 2XB2D 1BCOA 3MM9B 1C4CA 5B7WA 4IQTA 4R66A 5DS7A 2XGQA 1Y11A 2OM6A 2WSFC 4ENOA 2DIVA 4BBYA 4GMJB 2FMSA 2DH9A 3D0HE 3LUYA 1T94A 5I3QA 2WVFA 3NLCA 9ICHA 5ALHA 1O5JA 1N5QA 2CG4A 3TR8A 4I28A 1H73A 3A8JA 2R7XA 3LPUA 1N32F 1FJCA 4NLGA 1P8GA 2LU1A 5A2QU 1FXRA 7ICTA 4X4QA 3CJBA 1UZHA 2NXNA 3VA0A 3LTOA 3G4SS 2C2ZB 2A3ZA 1X4CA 1X4GA 2B4OA 3FCHA 2J6SA 1Q95G 4RPXA 3FVYA 5KFKA 3W65A 5A76A 1UT5A 4HKQA 3RJEA 4Y2JA 2ZHBA 4K2JA 1BPZA 2V6AA 1JXEA 1ELOA 1V3ZA 4P0PB 5J2QA 5AJ3K 4GV9A 3MDAA 2QC3A 9ICAA 2BPCA 1WKKA 4M9GA 4AM6A 1RTIA 4JI6K 3Q2TC 2HQ3A 4Y28C 4LSNA 1WI6A 1QE1A 2KP7A 3U6FA 4NV0A 5F0UA 4F36A 5CZXA 1WHWA 4K59A 2ZD1B 1J5EJ 1JIHA 1Z1BA 3H40A 2E7XA 4QYZK 2GV1A 1VDVA 1X4HA 2EWHA 4NMXA 2OFGX 5E0OA 1CC7A 3QU5A 2VB6A 4F4ZA 2KD1A 1ZQ1C 2VYPA 2BBEA 4DCPB 4R5PB 1RTZA 5AXMA 5JJBA 3QEVA 3J8AA 4ANCA 3WQUA 1JXLA 2E7VA 1QLNA 2CZ9A 3T1HK 5MLCV 2FIUA 4MEYA 3HWTA 4CZHA 1B3TA 2C3UA 3Q8RB 1XMOJ 4NX9A 2QLBB 5D4LA 1F2HA 3MMCA 2ACMA 1V9OA 4FXVA 3VAKA 1D3WA 4A59A 2Q0UA 1RSCA 3FGUA 2K4IA 4RW8B 2DJWA 4DR1K 1HBMA 2OLWA 4I9QA 2ZM6J 3MX5A 1N32K 3AQOA 1ITGA 4PGQA 2EFVA 2LA6A 5GAHU 2KG1A 4B9SA 4EYIB 4IOAQ 3AQEA 9ICLA 2W2QP 2PKEA 3CP8A 1BWEA 5HMXA 3ET6B 1KOOA 3ALRA 2K7JA 2N4DA 1OVYA 1N34K 2JWNA 4ILMA 3Q7CA 2C2RA 1LXNA 4B9LA 3OVAA 1WTBA 4EK2A 1GXTA 3MM6A 2KK0A 1Y4ZB 2XYGB 4XH1A 5DBBA 1VSJA 5F8HA 1BHNA 1JCFA 2EQYA 4AL7A 1SIZA 1HNIA 1VQPN 2WW8A 3ISNC 1IBLF 5EVZA 4D3HA 1TUYA 3P96A 1JLCA 3PSPA 5L46A 2OHFA 1WEXA 5L1IA 1XR7A 2I7NA 2ZJQL 1JLAB 2G8WA 5FLXY 1N63A 2IM1A 2AX0A 1Q7LB 4LVNP 1RHQB 4HL9A 5T41A 2ZBIA 3DGPB 4DLGA 2ZITA 4A5AA 1EXQA 4M04A 5THWA 4I2FA 1R6VA 4ZLLA 4JUZA 3RU0A 3KK1B 2U2FA 4CJLA 2CH5A 3GR1A 1AT1B 3RAMA 1CUKA 3QSIA 5AM5A 1N0VC 1BXNA 1DK3A 4PL1A 3ENVA 1RBSA 2G8HA 1X4FA 4UQTA 2CH6A 3I31A 4LF2A 4FZMA 2ZH2A 3HL8A 4P4OA 4NCAA 5C2FA 2VPWB 5J1PA 2G08A 4KSEB 2ZIVA 1Q78A 3A8EA 1V4SA 4DHYA 3LGHA 3KWIA 2D41A 3KLEA 2KE7A 1IIPA 4MFBB 4BS2A 2M8HA 5ETNA 4DI6A 2QTWA 3QRQA 2HNZB 5BXIA 4BR7A 4LSZB 1NGIA 3LDNA 4WWSA 1N5WA 5JMNA 2HS3A 1XHZA 3BKFA 3IM9A 4ERDA 3PZPA 1MMLA 2H54B 3ZSVA 4E7IA 2D4WA 1C2PA 4KH0B 1N5SA 4ELTA 1KAYA 5KT6A 4BUGA 3U8XA 4KAIA 3QNNA 3ISZA 2O8BB 1YVUA 1XSPA 4ZLPA 4E8UA 3Q8KA 4ILLA 1GLBG 1RZTA 4NLUA 2QM1A 1T9TA 1TR0A 2KNJA 4FWOA 4JS5A 2ZIXA 4IEEA 2RNEA 1ILYA 3H46O 4OO1J 4KMUA 3N7RC 2C1EB 1K8AO 1RI7A 3SCJE 3A2FA 5DBCA 4QR1A 3ID8A 3HSZA 2OUGA 4CGGA 3AD7C 1K5OA 4IG3B 1KN6A 4KE5A 3IDHA 4ED1A 1J5EF 3OFGA 5ALPA 1RDAA 3AAQA 1N36F 3AA5X 1VQ6N 5J1EB 4JNEA 3AUOA 3U26A 4RPYA 5IC4B 1J2NA 2O8FB 2GNKA 4X84A 5EX3A 4JI7J 2QRRA 1KVBA 9ICXA 4Y2TA 3M8WA 4QWCA 4RL1A 1WF2A 3QINA 3BBCA 3CQ8A 2JH1A 2Z1GA 2FD2A 4XO0A 2KKZA 1Z3EB 3KUEA 3QRPA 3A8KA 3ZX2A 4WFAQ 1Y97A 4O5CA 1RLCL 1KKHA 2GUPA 3R3LA 4HHUA 4KHQA 4I56A 3UR3C 2OWOA 3VF0B 3HHLB 1NJWA 5AJ3F 2CWXA 4H4MB 1PILA 4GKJK 5KL8B 1A5XA 2PDAA 3C94A 1HNWK 3SEIA 2LKYA 3MMCB 1HW9A 4C80A 2FZKB 1MN9A 4KLUA 2UUTA 2BUNA 2QLFB 4CZIA 2O66A 4Z4GA 5D77A 2HHXA 5KFRA 1YJRA 3H0LB 1U04A 5B8HA 1WEYA 1UVIA 2XHBA 3HHLC 2XS7A 2ZKTA 5MLCQ 9ICTA 1EQ0A 3JTPA 1RWKB 5JVHQ 2XMJA 4F92B 2HDOA 3SBGA 3IR7B 4DX5A 4RX6A 1LWEA 5DB7A 3QU4A 1YBTA 4CM2A 1VCTA 3LF0A 4B9UA 3ZZZA 2KTQA 2KRBA 4E2FB 2DFHA 1RTHA 1TKXA 3MDFA 1XJWB 2O5DA 3AVMA 4RW9A 3JXUA 4KMOB 2MUTB 2R7YA 3THXB 3OVNA 5IWAF 2VG5B 2GTDA 1IR1A 3SYZA 1JLAA 3SQ4A 5F1XA 4FJNA 3R97A 4B17A 2AZ1A 2HHHF 3U3YA 1V5IB 4CNYA 1FFWB 3I32A 4C7QA 3HI0A 1SWVA 5JLFA 1XI1A 4RKUC 3A0HU 5ALXA 1B7YB 2RF2A 3AQFA 3LZIA 3AY9A 5BYSA 3KKRA 3L7UA 3IUCA 3MCAB 2HFZA 4B3RJ 2ROPA 1V4TA 5BYQA 4RR5A 2RS8A 5E7OB 1XQSC 1OO0B 4YOWA 1FT8A 3TPQA 5ADZA 1W26A 4B1UB 3THYA 1M5OC 2BCRA 3RJFA 3UFCX 3OS2A 1ATSA 4NLXA 1UWBB 2YWKA 4YD2A 3M2UA 4MLHA 4P6QA 3CC2S 4KLGA 1PAEX 1BWVA 3SCIE 1L3KA 4X2BA 4O5FA 3MM5B 1FWKA 3MUMP 3V1OA 2QWPA 7ICHA 2I2YA 4QAGA 2DRDA 1RUSA 4TXSA 3E51A 1KHVA 4CF9A 1FRKA 4IH6A 1MWMA 3QIPB 1DTQA 3DLLQ 3NFAA 4B3SJ 3DLHA 3MN6A 3DRYA 3FZBA 2QA1A 4A8FA 4PHEA 4NLNA 2DNMA 3HVWA 8ICKA 1HBUA 5B0BA 4WFAL 3LGMA 2LP4A 1CG2A 5CD4A 1HWLA 1I51B 2W01A 4GKKJ 4NYPA 1QQCA 4DSEA 2LEPA 2MLZA 4JB3A 1FRIA 3WKDA 2PFQA 3UMCA 2GZOA 2VJ5A 3LDOA 4FLZA 5TZVA 5IXUA 1Z1VA 1TK8A 4TQSA 5IWAK 3IR5B 4YNQA 2E1FA 3F5TA 1FJEB 3BQTA 4IFEA 3CM5A 4CGFA 3RR7A 3OYBA 1TL7B 4M94A 3KMQA 2W9CB 2AQ0A 1N33J 4H0YB 1X6IA 4KGVB 5LSLA 1UW9A 4WQ5A 4DPUA 1RZMA 4NB4A 4RQ7A 1OWXA 1S1XB 4RBUA 3VMFB 4CLZA 5HNKA 3CJ2A 1TAQA 1RAGB 4F0KA 3SD7A 3NKYA 4AYBD 3MPDA 5D3GB 2YX1A 4LUBA 3G2XA 4N56A 4ED0A 4QIWC 1SIJA 1EWRA 4AHRA 1HD1A 3RH5A 4BRAA 1EETA 1AXQA 2DBYA 2E7WA 4LFAF 3ISND 4H5RA 2PMZC 5KG1A 5DDMA 3A8IA 4CJ3A 3KXDA 2P51A 4DR1J 3MPVA 1UAWA 5HLFA 4YDUC 2YH1A 4LIRA 4WFZA 1TUWA 4IXCA 1EHWA 3MEDB 2EAMA 1WKJA 2JVOA 4GNIA 2N4CA 3PCOB 4KKOA 4HDHA 4Z4HA 1TKDA 2P9CA 3ETRA 3HXMA 3AVCA 3TZYA 4C23A 2YTUA 3TA2A 1IWGA 9ICNA 3B0YA 2GGPA 4Z4FA 3NF9A 3E8OA 4CHQA 3CCEN 1N5VA 2PFOA 4DV3K 3CMEN 3B4DA 1ZTTA 4JI4F 1E4FT 5ADXH 2CJQA 2QB0A 2YX7A 4NZ0A 3PW4A 1A9NB 2R8JA 2E88A 1CQNA 4YY3K 1VJQA 1XMQF 3AM9A 2CVIA 4BRHA 2L9NA 1VFJA 4M9LA 4XAKA 2KJWA 4K25A 3V7JA 3IC1A 3TJ8A 4JS4A 8ICNA 3H0RB 2VOPA 3WXMB 5DDYA 2WBRA 4OJGA 2P9UA 2AYEA 1Y3JA 2CXYA 2ES6A 1EB0A 3J7ZT 1UVLA 1TVRB 2E6LA 2BQRA 2AZ3A 1YAGA 2FHJA 3Q22A 1V97A 4IG0B 3VF2A 3FFIB 4RQ4A 1S9FA 3THPA 3I9V9 4O3PA 4BRQA 2I8EA 4CLLA 4TN2A 4LJMA 4DBQA 1N5YA 4Z6CA 9ICPA 2CPXA 4RW8A 1WI8A 1M5VC 4CWBA 5GINA 3P45B 4LFCJ 3RJHA 1A6LA 2HW3A 2K2PA 4BC2A 3JSRA 2QFJA 3OYAA 3BQ1A 5D4OA 1UVKA 1ZZFA 4DOBA 3K7RA 2KN4A 3MPYA 2DNYA 4ECSA 3MPWA 1Q4RA 1U48A 2DVIA 4NXMK 1XNQK 2W43A 5CP2A 3H1QA 4W5OA 1HI1A 2D0OA 4EELA 4USMA 4RW6A 2H3ZA 3QGGA 1PGZA 3TUIC 2RHQB 3CJSA 8ATCB 4KHYA 3N9UC 2X7IA 1Y5LB 3KD3A 3CC7S 1ASVA 5AQMA 5AQVA 2W8LA 1ZRMA 1RT2A 4F4YA 2UXDJ 1VLOA 3BS9A 1RFQA 1KEJA 5IIJA 4AHUA 4XA5A 1UEKA 1VQNS 2Q6CA 3U27A 4CEFA 2GX8A 3T5HA 4URQU 4MFCA 2DY9A 1KQSR 4TURA 3M1YA 2Y9HA 2VC0A 1YHQN 5I42A 4OPAA 2CZVC 7ICOA 1GXLA 3HD2A 4AHCA 3GB0A 1NK9A 3IV6A 4QS9A 3BN4A 1JJHA 3QU7A 2HZAA 4JI1J 1QQ7A 4WU3A 4CK3A 2QWNA 3MN9A 4IL6U 1JUDA 8ICXA 1YBUA 1CC8A 5GTIU 2E9TA 3FBCA 2LQ9A 1YK9A 2E8PA 4Q8EA 1JNZB 1UPHA 2QLXA 3EW9A 2GJFA 2M7SA 4CF8A 3N01A 2JWLA 2IJNA 1ZD3A 4QW8A 3AOCA 3MCNA 3VETA 2CFXA 1KBRA 3SJHA 4H5TA 2FVPA 3MR3A 5ALTA 1VJWA 5BYRA 1VRUA 3ZSRA 1WWHA 2GO9A 2DO4A 4ECUA 3P83D 5ALVA 4ZKAA 3VEXA 3E1YA 3Q8VA 2XMMA 1M5KC 4IRKA 1XO1A 2MSTA 3PEJA 2F3JA 4R65A 4US8A 2XSFA 2Q1LA 4ZPCA 1S5ZA 3NH1A 5HVFA 3AXKA 2WHOA 3AB2B 4FM0A 4A8KA 3PDNA 2A1BA 4Q0BB 3SZ2A 4JK7A 4KV8B 3QWPA 3KKAA 4PABA 3V9WA 4CEAA 2KHCA 2M88A 1KW4A 2H3VA 2R8GA 3VGUA 3UDLA 3GONA 2RDJA 3SQIA 4CJRA 3N7SC 5GADU 4FO6A 4TY8B 1FVSA 1JCEA 3SMVA 4KPCA 2E1AA 2ZJPL 3RR8A 2G2YA 3FYHA 3KJFB 4Q45A 1KQSM 4UUXA 4OZJA 2HHPA 1RBUA 4O3OA 3PIPQ 2A41A 1EX4A 2DFLA 5JRTA 4EU0A 3HKZC 1N6QA 5AXNA 2YTCA 4P7TA 3HBTA 3NCIA 3C95A 1S6UA 4J9UE 1VQ6S 4YOEA 1FE0A 4LF4K 3AJ2A 3DOKA 3OTBA 2K1RA 4CF2A 2PGCA 3NCRA 2YJEA 3GIMA 2HFSA 2LA4A 3DRPB 5H9FJ 1FF2A 3SMZA 3CJQA 2UXBF 4C8ZA 3PNIA 3Q8UA 4MLEA 3GJRB 2D1KA 4GFJA 1EKSA 4PG4A 3QFWA 2F40A 4CZFA 3TA1A 4KRFA 3VQCA 3OTDA 1ZTWA 3PTWA 4ZIWA 1VSMA 2F8TA 3SBTA 1UFLA 3KKAC 5LMUJ 3A12A 5C42A 4KB0A 5GMEA 1UJ5A 2HPUA 2ZBCA 1D8YA 2WF5A 2NRRA 4AHVA 5JU5A 4WU2A 2RH3A 5AFUH 1U9LA 2D9OA 3SQ0A 3M6XA 2G0AA 4TUSA 3EPGA 2VBYA 3CJ8A 3TX0A 1HWJA 4B3RK 1P9YA 3CCTA 3VQ6A 4OVLA 1NGDA 3FZKA 4I6WA 3SAHA 3QPIA 2EZZA 2FHOB 3DXBA 4X64K 5HHIA 5EX0A 4OLPA 4LRFA 2XZDB 2UUCF 3H0MB 4JI0K 4RPFA 3M2VB 5KFTA 1GEHA 3ZZTA 2G2OA 3CXCR 2ZUBA 4ZVUB 2YQ1A 3WK5A 1JLBA 4M5KA 3WXJA 3MM6B 3EGWB 3A0BU 1MWYA 2OEHA 3ETMA 4FNHA 1FTRA 4MJKA 1NGJA 3VGLA 5HN0A 5K8NA 1SV5A 5IT0A 1R0AA 2DH8A 4WFNQ 3MMAA 1FKOA 3OS1A 3D2NA 2F9JA 2X1AA 3IS9B 1TK0A 3PJWA 2HHUA 4NM2A 1RKJA 1NUEA 2GJIA 3U7JA 1SV5B 4KGMA 3DOMB 4HT7A 3QT7A 2KVCA 4RG8A 1ZQTA 3EDQB 1S72N 1N2XA 2XGPA 2BW2A 4LF4F 2WF9A 3VGMA 5DQGA 2FLNA 3CFOA 3HM9A 3L2QA 4CGIA 1S48A 3BO3A 3OSPA 5M1FA 1QY7A 3IG5A 1FRLA 1RT1A 2LEBA 4RBVA 3BSAA 3TRGA 4K0KK 2KT2A 5C2DA 3H90A 4M47A 3LZJA 4ZPBA 1B9DA 1FI4A 3ZC4A 4JV5F 3IRUA 1E3MA 4CJTA 4F3MA 1RDCA 3GZFA 2W9MA 5JICA 4OI0A 1AQ6A 2KEYA 1PCAA 1W2IA 1TL7A 4RW7B 4FDFA 4YY3F 1PC5A 3LAKA 2D3O1 3FDSA 1YRUA 3OBWA 3GV5B 2C3MA 4M3ZA 2P8IA 2ZVIA 5CAAA 2DTJA 5K8MA 2A3JA 2B56A 4A8XA 3M30A 4J9MA 1VBZA 5AXLA 3R5GA 4NM1A 2A18A 3VAHA 5KFHA 1BPXA 3GWCA 2AEJA 3BYRA 3TVYA 9ICVA 3HX9A 1N0UA 4BR4A 2IPOB 2KT5A 3NOCA 3UMGA 2CXEA 3GIRA 3U9DA 3ZDBA 2EK1A 1BWFO 3NS1A 3CNQP 2YNIA 1VOMA 4FZVA 2PO4A 1I94F 4FNIA 2NSBA 3TO8A 2V2VA 4RO0A 1SCJB 4DTOA 4NZ6A 3ZTOA 3VWSA 4I2QB 4DPWA 2QA4S 1Q53A 1T9YA 3Q23A 1D8BA 1C0FA 1ZAVA 2NUBA 1LB2B 3ULDA 1VQ9S 4HUEA 2QARB 4P4PA 4ECZA 1U0HB 4FOIA 3D2SA 3J80Y 2VU5A 3N4PA 3H2UB 2XYPB 2R7VA 3ZNUA 1PK3A 5ALWA 1HKBA 1PO6A 4KLTA 1ZQNA 3E66A 4CI6A 5AJ3J 3DEEA 2VL1A 2V50A 2RD5C 4G6VB 3NVVA 2HRUA 3OLBA 3VVTA 4BJQA 3QT6A 4WFYA 3P5TL 4NMLA 5AKKA 1HNVA 5J0PA 4BGBA 3UQ2A 3RH6A 3GYGA 1XNRJ 2E5GA 1CLFA 2BJ7A 4TLRA 5F8MA 2HSEB 5L1KA 1J53A 4HTJA 1MSWD 2BJ3A 5C15A 2M5YA 2G8IA 4RUBA 2E5SA 2K3KA 2JGUA 3MGIA 1ZQAA 3PHEA 2AHOB 3LH2S 3O8WA 1LKZA 4YDDB 1KLMA 4PKHA 4H0TB 4I2DA 1U02A 5CCMA 1RPLA 2A3VA 4K4VA 1N6QB 5CYJA 3CI5A 3O9QA 4B1YB 4WP9A 2IDEA 3O3LA 2DPIA 2CNOB 1TP7A 3CJ3A 1XU4A 3FKBA 3HHKA 4UBBA 2NSCA 3DLKA 4USJC 3KG0A 3DXMA 2XQCA 1RWVB 5GVQA 4M3WA 2JZBB 3LAMA 2FY8A 1TFYA 1P7DA 3V6DA 1ZQKA 2DRAA 4IO1A 1HNXF 4CFBA 5AQTA 4LVOP 8ICZA 4CNZA 2ZH3A 4OJRA 4JI8J 1IKXB 1GOBA 2YBVA 3C29A 2B9XA 3MWBA 3US5A 2JLFA 3AB4B 4O4GB 5AQOA 2BGWA 1GO3F 2ZOMA 3KK2A 3RAXA 4GY2B 4P10A 4J90A 9ICSA 4RW4A 2HFOA 5AK4A 3HOSA 3RG6A 3VGSA 3M32A 5A8KB 1WSJA 4MMOA 3CO9A 2RILA 3NP5A 3M7DA 1VRQC 4Y2KA 4W92B 3O4NA 3NHGA 4F72A 3V6JA 1FNXH 1LW2B 1HX1A 3QIPA 2PXIA 2X3DA 2M70A 2J0QD 3UN5A 3C7NB 1YITS 3QIOA 3PHTA 2JGAA 1NSKL 4ID8A 1B70B 4ES3A 3SCXA 1BPBA 1EXNA 3H08A 3LK9A 5CABA 2KZZA 2BA9A 2H3FA 1EARA 2AH5A 5DM6Q 3HJVA 3NF7A 3RAQA 4DZ6A 4FJGA 3CJCA 2H3EB 5HMWA 2YKMB 1NLVA 4OLOA 2EG1A 4U67L 1HQUB 1X2IA 3C46A 5KT5A 3HCXA 2ZE2B 4IG3A 2QYCA 1VISA 4P2SA 2O8CA 3QX7A 1X9JA 2HWHA 1N61A 3V7KA 1LK7A 2LSNA 5B5EU 1FKPB 1FDDA 1NDCA 4GC6A 3HX0A 3JB9k 3R5BA 4Q0BA 4DOZA 2NZ4A 1A77A 2UXCJ 1MA9B 4FLWA 4ZP6A 3WNFA 3EY1A 3P8BB 4AXIA 3FSYA 1VSHA 3ENWA 1WSGA 2XBPA 4F71A 3PO4A 3T9NA 2V4RA 2D0CA 4KT0C 5D8HB 5LMNF 4NLWA 3RTVA 1REGX 3A4TA 4FSVA 1I3OB 4I69A 4PUOA 4U67Q 3S1TA 3SV4A 4PQUA 1ZQDA 3RSEB 4FFDA 1OKJA 3DRSA 1RP5A 4QJVA 4GVMA 1RLDA 1Q82O 1L7OA 1NGEA 4ZLJA 1EAYC 4H0OA 7ICQA 2CGLA 1WC4A 4BQZA 4GVEA 2RHSB 4ZVEA 1M5PC 4YUDA 2P6SA 2CJAA 5FPDA 4NWIA 2KG5A 2JVRA 2ZJ5A 4BY9C 4CLKA 1CULA 2HKEA 4QU6A 3CJRA 3CPEA 1NZPA 3FZFA 4ID1A 1YJ9S 1HYVA 2BYCA 3F0NA 3TX8A 3L2UA 5IM0A 3ZT1A 2ZZTA 3HI9A 1YJNS 5D3GA 1CJUA 2VUGA 2W6KA 4NL9A 4DR7F 1ZPVA 2M9KA 4BVOA 2IHR1 2B4VA 4DR6F 4MEXA 4CDGA 3SCLE 4JD2B 4CIEA 2NZCA 3OLAA 2LECA 1WSIA 2LMRA 1RDFA 4WBFA 4C8OA 4XDCA 5A0YA 3FRZA 3HSJA 2IMOA 2LXFA 5T7LA 2Q97A 2VD3A 3PJ9A 3NVWA 3MAAA 2RPIA 5KFNA 2FYXA 4JLHA 4JI0J 3R5CA 2R7TA 4DEZA 1QDUB 3RW7A 4E7HA 5KFLA 4J9LA 3QYPA 5DJBA 4C0BA 2FQQB 2G2ZA 8ICWA 1XBWA 2CQGA 3MMJA 4YVZA 2DXFA 2JZBA 2BZFA 1WORA 2G06A 1VAZA 4KLFA 3DLBA 3MMAB 3K89A 3SJJA 3LDSA 8ICUA 5LSOA 4L76A 1QHTA 4OD0A 5AK6A 1XMQK 4KGKA 5ALKA 3UCGA 3IS9A 1IO2A 4DN0A 3PLAA 1RAFB 4L73A 2YB1A 5D0HA 3H4BA 1C1BA 4A62A 4BC4A 3D6RA 1IXRA 3P5JA 5AT1B 1ZXOA 3CD7A 1ZQLA 1RDRA 2ZNYA 3BF4A 1AROP 2KT3A 3SUQA 4LF9F 2OFHX 1S5LU 1N5YB 4DUYJ 1S1UA 3O6WA 3LP0A 5HBMA 3G6XA 1SJ1A 4WYLA 2UUAK 2F8HA 2XNQA 5DO2A 5I42B 1FNMA 4WFBQ 5AI8A 4I6YA 4CP5A 3QEPA 4FJMA 2HHSA 1SXDA 4I2PB 2BCSA 1IWAA 1DOQA 2WBMA 2A6MA 4KN7A 2R4FA 5HK4A 2X1GA 4Z6FA 4OYIA 5CA5A 1H6KX 4BRCA 2XZTB 3OFFA 2JLEA 1NBEB 2KRRA 4P52A 1KVCA 3UQSA 2VJUA 1W7WA 2OTLS 4JWNA 2LQJA 2YHWA 2P9PA 1PKUA 5JVGL 1JLGA 3BP8A 4ANDA 4N7TA 2NXCA 4MFFA 4K4HA 4YB1P 2V63A 4OHZA 4W5RA 3AARA 4HLBA 2UXCF 3I56S 3KFWX 4O23A 1ZBLA 3BPDA 2FHJD 2CGJA 4I2BA 3A5LC 2JXJA 2CPHA 1HJPA 4KPYA 3CJ4A 4QIFA 4M1KA 1RAJA 3AJ1A 3EX7B 3I5BA 1J5EK 4CEEA 4RT3A 4F2RA 4OLBA 3L3FX 1S10A 4Y2PA 5J2KA 4ZDNA 4OFZA 2QXFA 3WBZA 4WCEQ 4ZH4A 3DOLA 3G8QA 2F96A 1ZQJA 1DARA 2PMWA 2BJDA 3UXNA 3NF8A 1U0HA 3D54A 2MY8A 1PC4A 3J7YP 3GJQB 5CRXA 2MZRA 3T1HJ 3WKAA 1QTNB 4RQ8A 2VZ9A 3ZZYA 1WWUA 2J0XA 3PV8A 4YR2A 4P0QB 3NGSA 3UD3P 4CO5A 2MJUA 3TAFA 2FLOA 1MG7A 2Z30B 1ATRA 1VHFA 4WYWA 1YHQS 4B9TA 4CTAA 5BPNA 3QETA 3BGUA 2Q43A 1CI4A 2ZXHA 2GMJA 3O8MA 1A7GE 3TUJC 3ZLJA 1HHSA 1KFDA 1NDLA 4C97A 4HTIA 5AIBA 4RBTA 3P39A 4E1JA 4DTRA 3AVLA 3DMJB 2VJVA 4C8MA 1GOAA 1EP4A 1REVA 2OPPA 1TKZB 2CNNB 2I9GA 1BQMA 4X4RA 1U1MA 4IOCL 3WEEA 3UVJA 3ZSQA 5F8JA 5ALZA 4HWIA 2F44A 4OX8A 3CPWM 1EP4B 2V0NA 1BE4A 1TKZA 3QGIA 4DN9A 4YR3A 4C2MA 4E19A 4IRDA 2W2PP 4ID5A 4WQ4C 1F1BB 2YV0X 4L8RB 1NPPA 1Q86O 1VQ9N 1XHXA 1QZ5A 3T6JA 3CQXA 4CJ4A 3ZFVA 4A61A 4J9PA 3TP2A 3T5KA 1CZAN 4DJBA 4B9NA 4N5SA 4EZ6A 4K4TA 1RHRB 3T41A 4DU8A 4M45A 2QKBA 3DOKB 4UAZA 3CM6A 4QS7A 4KKOB 2V8HA 2QG9B 4NI2B 4FN5A 5DM7Q 9ICMA 2DGSA 1DLOB 4BX9C 2KDOA 4I6AA 2DISA 2KVSA 1C20A 4NCGA 2DNKA 1TL3A 5LMNK 4R64A 3OGUA 4NL5A 4DCJB 4E7KA 3QB0A 3CE8A 2WAQD 2F77X 2ESEA 3RWUA 4OZ0A 5EXWA 4NXZA 3MURP 2PMZF 1ZQSA 3E9PA 2OXOA 1C0UA 4Z2XA 4DSKA 1P9QC 5AHXA 2C3YA 3ZXWA 4ILGB 2K8AA 3DOMA 3IWNC 1BI4B 4M5IA 2KH9A 1KP6A 1TELA 3OL7A 3MD1A 2ZZMA 3WKEA 3AVIA 3J7YI 3CCWA 1CSJA 2W4CA 2JFKA 5AQWA 4O0NA 2IVNA 3D6HB 1RNHA 1VR6A 1HW8A 3C6TB 3NBPA 5JVHL 8ICYA 2BCVA 4KTWA 2DPJA 3M6GA 1UVNA 1BQNA 1J2VA 1ZD4A 2IDOA 2E9RX 3FEZA 1DRGA 4CRJA 3DCAA 2MZQA 5J2NA 3NL0A 1Z6RA 1NU4A 3ILOA 4CZKA 3JSBA 4R8UA 5FRMA 5KAFU 4LFCK 4HAIA 1RXOB 3EZ5A 4UB5A 2KSOA 3P5BP 4PL8A 3IR6B 1X9WA 1KONA 4PG6A 2ZXIA 1LWEB 4BDZA 4YB6A 2ALZA 1W9HA 5ALNA 4ZK7M 4DMZA 1R31A 4JV5J 3L6QA 4WKRA 3GL1A 1LQ9A 3GV7B 4ZVQB 1U1LA 2WMMA 3LP0B 3VEYA 3DV9A 5EWEA 3HPGA 1Q3VA 4CCHA 2V7ZA 4OGEA 2XS5A 4AD6A 4LZGA 3T5JA 3H8JA 4IUFA 1RISA 4OGCA 5KOWA 2OPQA 3ED5A 4RNHA 1HWIA 2GWSA 2DNZA 3RSEA 5B0EA 1S6QA 1NOYA 3PYEA 2W7OA 2QLJB 2V8PA 1SXEA 1VQON 3SI8A 1WC3A 1JLGB 2HCFA 5ADXA 1UVMA 1WTFA 3FK4A 3GG4A 1NKEA 1RQ0A 1EQYA 3ULEA 4CLFA 1G6BA 2B7CB 2ITMA 3Q8MA 2YKNB 1R8PA 3FAHA 5KQ8A 5KT7A 1KSPA 3G8SA 4OJ6A 2GAHC 1VSKA 2XC9A 1UMJA 1DURA 4OIXA 4C3MA 5CEHA 3ZDDA 3OXFA 3GJSB 2FPKA 2Y1RI 2KFZA 1X9XA 4WK1A 2ATCB 2R7WA 2XCAA 3JPQA 2IOFK 2O8EB 2VQEK 1HUOA 5FD1A 2XY6A 4O44B 4JKGA 2XY8A 2YQEA 3H7HB 2CPFA 3VHQA 3VESA 3FM9A 4ELVA 3ICLA 4G1QA 4JK1A 1VJ5A 1BD6A 8ICVA 4JHDA 5LY3A 3I6PA 2OCEA 2YWGA 1AA1B 2CQ3A 2VA3A 2AJ2A 3CC2N 2HS0A 5D49A 4TVAB 5ALMA 3SMSA 1FRXA 3A1YG 3PX0A 5ETLA 2DGVA 3C6HA 4XK8C 3ZYYX 2COLA 2VBZA 4JK8A 1YVNA 1SQKA 3TABA 3MGHA 2MKYA 2CQIA 2DCUB 3JPRA 2IAJA 5HQ8A 3TVZA 3RB6A 4FYYB 4NJ8A 4OX9F 3OYKA 2ZJAA 3LP1B 3DRXA 4ZPDA 2IVYA 1VQLN 3C15B 2UVRA 2HF3A 1VHXA 4E98A 3TZZA 4ZPTR 4KTQA 3P1GA 4CJUA 2GMHA 1RHKB 3ID6A 4O8KA 1U6FA 4B8AB 3OYJA 3RRHA 2IVFB 5HRPA 4MK9A 2FBVA 3CJKB 1GLCG 9ICQA 4CJQA 3JXOA 4PYAA 4LF4J 4X4TA 3HRGA 4DL5A 4KHPF 4AFFA 3U1NA 3SDEB 1FD8A 3VENA 2C2DA 1CJTA 3H25A 4FLTA 4JI5J 5RUBA 3D1OA 2Z4PA 2YY3A 1QM9A 2DR7A 2MKHA 3AO2A 3V9ZA 4CERA 2AJFE 3M32B 5A8KA 1VQNN 2A6AA 3WK8A 5HI7A 1D9FA 3CCVS 4K4YA 1M1HA 4YN4A 5D4BA 1JXVA 4QOZB 4Y2CA 5D0GA 4K41A 4QZIA 3LL3A 1JALA 3W0LA 2QSFA 1A0PA 4O3RA 3PXGa 5B0FA 5AK5A 1SGGA 4DDFA 2AIRB 3KIOA 3H42A 3H59A 1VQMS 3THTA 3NGYA 2HVEA 2VGMA 4RW7A 3AA2A 4K2XA 3VTHA 4J7CA 4WQ5C 4ECTA 1T0TV 1WC6A 3PM9A 1HNIB 4F9OA 1HQUA 2HK3A 2J6TA 3WZ0A 4U9RA 4QIWF 3RUBL 4QW9A 2XVTA 3PW5A 2DKXA 2AKWB 1COOA 4K8RA 4R0EA 4AH9A 2K8BB 1MQ2A 1A6SA 3LDLA 4YDUA 4CJEA 3ZI4A 1ZQUA 1I94J 3C6UB 4JAXA 1NKCA 3W2WA 2P9KA 1KKXA 4O3QA 4G1IA 1XSNA 5FIIA 1UAXA 3GG1A 2LCWA 3R9LA 4MYTA 2MQNA 3L2RA 2Q1NA 3SUPA 4GC7A 3OTOK 1RJJA 1SVDA 2V51B 3QEAZ 4U8VA 4PGXA 2HWIA 4CO4A 3Q24A 2IYIA 3AOBA 1K0TA 2FXUA 4JI1F 3W2WB 2VKZG 2P9KB 3G86A 4CH1A 4LF7F 5FDLB 1OY8A 3AODA 1JLCB 4BACA 3DOLB 3KZBA 2LPEA 2YPYA 2EPIA 1RT7B 3M8PA 4Z7CA 4RNOA 2DWQA 3H1VX 4X4PA 3TACB 1E4GT 4UTGA 2H65B 1W2BM 1FO1A 2MXYA 5AQPA 4CBUA 4R8UB 4L3NA 2EFQA 1R6YA 4C6AA 2IOFA 3GCXP 3HSCA 4IQXA 4P0QA 2QA2A 2BJ9A 1QAYA 4LH4A 3Q8LA 1IKVB 3OHRA 4O5BA 4ED6A 1O03A 2FI1A 1RBTA 1JJ2R 5HQLA 3ULEB 4B3TK 3G87A 1ZM9A 1SQEA 5FLXU 3BREA 2KN7A 3ULHA 1WSVA 1GOCA 2KZ3A 1B0TA 1JLFA 4FWKA 4B1XB 1OY6A 1QH9A 5HP1B 4A8QA 3M8QB 2V69A 1NSAA 5IZHA 2LBOA 3SUNA 2H3QA 3DXSX 3QSYB 4KHRA 3RJIA 4CT9A 2ZHAA 3C14A 4CHOA 2P9EA 2H3IA 1HEKA 4NLQA 1REVB 1B0VA 3OYDA 4Y2AA 9ICCA 2H5IB 3FBEA 3LALA 2VBXA 3A5MC 2B51A 2ZIUA 3IG1B 2OGUA 4JI7F 3HHNB 4FF1A 2GVDA 4I2IA 5KPRA 3BDPA 4M3XA 4RU9A 1X5PA 2J0WA 3GE9A 5JS1A 4I2CA 1PYOB 2BR0A 3OJSA 2OP5A 3O44A 3QXGA 1CVJA 2XMWA 4F4AA 4P9SA 1KVJA 2PN6A 4KJIA 2G0CA 2M52A 2PAVA 1N52B 3X3UA 7AT1B 1X5OA 4BG8A 2N1RA 4GXKA 2V94A 4YORA 4DKWA 4CI0B 3MF5A 3DXMB 1CULB 4CZMA 4FJ5A 4PQAA 1YI2S 3DU5A 4YN3B 2E3TA 2EFGA 1B4SA 3GFXA 4K8ZA 2XI2A 2YWHA 1P90A 5KRTA 3KWMA 2D7SA 5IQQA 2J4RA 3BSCA 4OYZA 3HTVA 1N60A 3MI7X 4CLPA 2AQ4A 3QAUA 5J29A 1QSSA 2NRTA 9ICIA 4I4BA 1J27A 5HMMA 5KPTA 5LL6d 2DR8A 4YS2A 4EGLA 4F0MA 4ZOHC 4RNFA 1X9SA 4OQJA 4UAVA 2DB1A 4URSA 2RDIA 1S0NA 2JX2A 4FK2A 1GLEG 4F3TA 1OY9A 4FW2A 4ZVFA 3MAAB 1XNRK 4DV4K 3MGJA 1SZHA 4BDPA 1NG9A 3D68A 1D5AA 3VA3A 2KMDA 3KZIU 2EG2A 2UXDK 2M8DB 1L7MA 4C4SA 4ICAA 4J91A 4J2BA 3GYNA 5CHCB 1ZAXA 4DR7K 1ZQZA 5KFSA 5DDPC 4F5NA 4BWMA 3TFRA 3MCPA 3MR7A 3TFSA 3UN2A 2HEKA 1RG6A 4PJ0U 2Y9TA 3BKUA 3FRYA 1VLBA 1BMQB 3WIUA 3NAEA 4DF8A 2GMLA 3G71N 1L7NA 1MN8A 2D5RA 5BR8F 3NWGA 1TMMA 3QLHA 4ZVRB 2I1QA 2WVCA 3OUYB 2XM3A 4JI1K 4FZZA 2J5AA 4LSLA 1G15A 3MHYA 2HSZA 1OUQA 3QO9A 2EZYA 4JV5K 4NLYA 1AFJA 1Y88A 2Q2RA 3TAGA 5KFYA 2RVJA 3DM2B 3CMAN 4X62F 5TISU 1YUWA 3KJVA 2FGOA 2O4IA 2B6GA 2OJ3A 2K4PA 4EO6A 1F5SA 3O2IA 2RE2A 4ECYA 1Q18A 1XK8A 2CJKA 4X66K 1CZ9A 3M6VA 3K58A 2M3DA 5G4DA 1HFEL 4CHPA 3B8AX 2P6TA 1RT2B 3NRZA 1YI2N 3D9BA 4I64A 2IM0A 4JP8A 2FPLA 1Z05A 2KL8A 2VANA 2BABA 2XG8A 4LF6J 3D2FB 3BR8A 2J7WA 2LLZA 3EXCX 3KUHA 4FJ8A 4OI6A 5K9FA 1HNZJ 8AT1B 2ADBA 4PZOA 4K50A 2X78A 4QCLA 1BA0A 1SUQB 3O3FA 3AXMA 2QA4N 3SCKE 4ACOA 2HBKA 4HTLA 1L5UA 1OYDA 4RU2A 4GIBA 3GBTA 3MZIA 3WK7A 2J8SA 4CF5A 2FLLA 3JAMO 1HQEB 2CAJA 4LREA 1QHAA 4FXWA 1LWCA 4USHA 2MB0B 7ICRA 1H2VZ 1QSYA 4EFAC 4JI2J 1Z4OA 1OIAA 2YJFA 5J2AA 3B78A 5ALFA 2L9DA 3QIDA 1OH5A 3THYB 2Y1IA 4DTNA 3KG4A 4UASA 2DNNA 1HUZA 4M9NA 1FJGJ 1J97A 1Q82T 5K20B 4FOEA 1S1TB 2BKNA 4ZJOA 1YTUA 5KFIA 2GQQA 1ED1A 1FJ7A 3EDRB 2ZC3A 1WLJA 3QU9A 3R6MA 2P5GA 3CD6S 4DR3F 4ECRA 4HH0A 4H5VA 4JI0F 3J80U 2B7BB 3G8TA 4TNOA 2RQCA 1H7XA 2OTJN 2OTLN 2HNDB 1YT3A 4CGZA 1GXUA 4NPOA 3WIVA 5C25B 4V19S 2AV5A 2G1DA 3MR5A 1IR0A 9ICJA 1U2VB 4ATNA 2WAQF 5J2QB 1NK0A 2BQ3A 5J0TA 1ACMB 4M5MA 3RBZA 4UT4A 3IMQJ 5KFBA 4M5JA 5DETA 3I56N 3LP2A 2MU2A 2XHWA 1QAJA 1QZ6A 5J8YC 1N8RT 2V4QA 2GC8A 1EJ7L 5M1OA 3DRSB 5KFOA 3DLEB 1S1XA 4RCHA 1HNXK 1UA0A 1JROA 3BPSP 5E84A 2MHNA 3JSMA 1YX2A 1X0FA 2RS2A 5HOOA 3UCZP 1S6PB 3VQAA 2ZH7A 3QFUA 3RH4A 1Z19A 1HJRA 2MJNA 1RWUA 3PJXA 4CJVA 2QL5B 1KWMA 2L3MA 4CGDA 3QATA 4WF9Q 1LKYA 4OZ5A 2YI1A 2QIFA 2IA0A 1ZETA 1SB3C 4NRTA 4PWDB 3KG1A 2KV2A 5J2HA 2EFNA 3PNCA 3FZMA 1EIYB 4AQYK 1MLAA 2QX0A 3CD0A 1WWVA 5I4MA 1O13A 5FPEA 3OBIA 5ALLA 3TSUA 5CB1A 2CVEA 2ZH4A 2O6KA 2ISPA 2L5YA 1ZM3A 3IM8A 2PFFB 4R63A 4M5NA 3KNAA 3NXZA 4FJ7A 5I3PA 4QIVA 4OZLA 4IOAL 2BCQA 1MU2B 1N34F 4F67A 1Q1KA 4DV6J 3G6EN 4FJ9A 4DCOB 3EMTA 4FJJA 1GT8A 5FLXO 4DQ8A 2UU9K 1RAEB 1C1CA 2M0GB 1F0MA 4UF4A 1I94K 3UPQA 1W2BR 2XS2A 2WF8A 2JJ4D 3C16B 3DLJA 4FJHA 1FKAF 2P9LA 2EBGA 1S8OA 2Z2ZA 4ZN3A 2RHFA 5IC6B 3OTOJ 4HR2A 3GMGA 2CN1A 2D3UA 5EOYA 5ETQA 3O5BA 4YOUA 2HMPA 2V67A 1V85A 3N6NA 3I0RA 4Y3CA 1Y5NB 2QJ3A 4RQ5A 4U96A 5KOXA 1HL6A 2Q79A 4C4RA 2ZJRL 3R9KA 2PT0A 5LOQA 4WZQA 3LPYA 5HMLA 3UKRA 4V19J 4GLXA 3BBBA 3T1YF 4Y2MA 4DX8H 1N5TA 5J2BA 3K17A 4UY85 2GELA 4E1MA 3HP9A 4XRHA 1VC0A 3D2FA 1RYSA 2HVHA 3C1ZA 1HYSB 3ZTSA 3L7OA 2ZWHA 4EENA 1QQ6A 1PIEA 1HBMB 1UOCA 4MTPA 4QJFB 4BXOA 2XEXA 2LM1A 7FD1A 2HNYB 1HYSA 1T4GA 1K47A 4B3MJ 3ZD8A 1RHJB 7ICFA 2UXBJ 4CIOA 2W2MP 4KLQA 5CCLA 2K8CB 1ZJMA 1KQQA 4H4KA 4BWJA 1WBBA 4FVMA 3F2KA 2J9CA 5KG2A 4KH5A 1VGYA 5KFJA 4KFBB 4X4SA 4CH0S 4ZJLA 3OA9A 1NHKL 1VBYA 2HMIA 2EWSA 3D67A 5B09A 5L1JA 3TJAA 2K60A 4H54A 4MN4C 2RUSA 2WFAA 4AHTA 4ELUA 1FCAA 3D66A 3L4IA 1WC1A 3IG1A 1M90O 4ZTJA 4MKBA 2E9ZA 3K0SA 2OPQB 4A8WA 2E4LA 1X4BA 2ZJPQ 1F0XA 4JI8F 2HLTA 3IRXA 2HBMA 3KHGA 1IBMK 4DFJA 3W62A 4F50A 4H0VB 1TTHB 2IRUA 2WVEA 3HZGA 3IRXB 4DV5F 2VPXB 5GAHP 3S8SA 8ICIA 2E44A 3CG7A 3OVSA 4X64F 3DWLA 2L9WA 4DFMA 3NH2A 2EANA 2AGPA 2Y0SD 2MGZA 5ALQA 2PD1A 4Q2MA 2O8EA 1LAVA 1M0SA 4KBIA 4N76A 3WHIA 1K9MO 2F76X 3L7PA 4OYAA 3H2LA 3VAMA 2UV8A 4CE9A 1FIQA 5IQ6A 2OPRA 3CFRA 5ALGA 1JLEB 2A19A 4FS1A 2E1YA 4QR0A 2AGOA 2VICA 5G0RB 5L1LA 2VOOA 2EEYA 3TADC 4ZCKA 2PI5A 2HQIA 1OH6A 1LFWA 5J2JA 2ZGYA 2AF6A 2V8GA 1NJIT 4OPHA 4DV1J 2LQBA 4MF2A 2LKZA 1CLQA 1CJTB 4J2AA 1ZQIA 2DNPA 3GOIA 1SC4B 4AXJA 5DB6A 5HAOA 1EKRA 4DR7J 2O1PA 3I76A 3VAFA 4LFBK 2WC9A 3NAIA 3EZWA 3GYXB 3K5PA 4B8CA 3FZ2A 3CJ0A 1Q46A 4RUCA 4QWBA 2CJXB 3M6ZA 2ZDPA 5AE3A 4F5RA 3ZT4A 3FE1A 2I38A 2MQ8A 4DR3J 2CYYA 1WJ9A 2FVRA 2RKIA 4HUFA 1KQKA 3CCSS 5J0QA 1N36K 4NA1A 2WONA 5KG4A 1UPPA 4J9VA 1IKWB 4CDIA 2KSOB 4OI1A 1TKXB 2ZZNA 4LF8K 1ZBIA 4Y2YA 4PZVA 5H9EJ 2B0CA 1Q86T 2A42A 4H03B 1S5JA 5AQGA 2KJVA 2W2NP 1RU2A 5L8RC 1SJFA 4LY7A 4NWBA 3THVA 3EZOA 4YMMA 3MUTP 3P4IA 4DX6A 4QZGA 2OZSA 2RAQA 4BC9A 1HWUA 2E5HA 2W9BA 3BO2A 3J80O 1UEVA 2ATLA 2IDLA 2HHWA 5AQYA 3VCDA 1NNEA 8ICQA 2IVOA 1I1GA 3I28A 2DHHA 1BI4A 1U1PA 2UXCK 2W11A 5L9XA 1QD1A 2W40A 4CO1A 3L4BC 3U9ZA 4PHPA 1W0HA 1J6ZA 5LL6Z 1SJRA 2DITA 5J2CA 4LMZA 2HG4A 5AM4A 4F4XA 2MSNA 4B9MA 5KI6A 5F9LA 4EX7A 4F5OA 5AQFA 2P9PB 1E6YB 3JPNA 2E2QA 2I0XA 5B0AA 1HKAA 3T1YJ 1KC8O 5E3PA 1O8BA 3ZDCA 3DRRB 2YHXA 3ZTRA 5AZJA 5EE0A 2G0JA 1XMOF 1VC6A 4I2JA 2YKAA 2GH1A 4KI6A 4MDBA 1IG8A 1GNKA 1TL4A 4DUZF 1U4BA 2WCXA 4DTUA 4QZBA 1FKPA 3J7ZO 4G1QB 1UJ4A 2BVZA 1W25A 3OR2B 2X74A 3VF6A 4JN4A 2VQFF 1JKHA 2Z1IA 3NAHA 3CT9A 1AB8A 3VVUA 4HCBA 4PL2A 3MK6A 1QAIA 1Y00A 1Z4NA 3HSGA 2G5IB 5KFXA 3PFEA 4N77A 2BTFA 1S1WA 3H8WA 1OS5A 2GVZB 5IT4A 2H48B 5EWGA 2IAJB 3OPKA 2CA9A 2NS1B 2FTRA 3NVYA 4UZBA 1S1WB 1Q9XA 1HNXJ 3NRBA 4JKCA 3UXOA 1F60B 1WG5A 2XO6A 5JUMA 3EKUA 4L75A 1ESVA 1S6PA 4HACA 2DXDA 3P3DA 2POKA 3CC4N 4ZS6A 3ORYA 4H4OA 4DR4K 4UOFA 1SKWA 3W60A 3GCWP 2YWWA 1VQ8N 1BOTO 1K1QA 1K8KA 4LC9B 1NEEA 1NM1A 2W42A 4IYQA 4KGZB 1N54B 4FJKA 3V5RA 3QRRA 2DQNB 2VIHA 3DXKB 4MHVA 2VQEJ 2QWLA 4Z0UA 1BPDA 3NH0A 3CD6N 4B3TF 1RT4B 5ALOA 1HI0P 4C7YA 1U2FA 2NZTA 1MDUB 1VSDA 2BMBA 1RDBA 1OVQA 1XC3A 4K4SA 5KFMA 4DV2K 1UJ6A