3PX0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and dctp-da mismatch (tautomer) in closed conformation
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
579
structure length
557
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
molecule tags Transferase/dna
source organism Geobacillus kaustophilus
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
total genus 190
structure length 557
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px0A01
1HYVA 4M3ZA 2FBTA 4FM2A 3LP3A 3TAQA 3QE9Y 1TK5A 1TKZA 4IFVA 3KKRA 4MFFA 2ISOA 1RBTA 4DOBA 4YMOA 4RW4A 5KFAA 5CA7A 3LPTA 4MQ3A 1IH7A 4EP4A 4FLYA 1QS4A 1JXLA 5C24A 5J2KA 2HHUA 3NGZA 3DYAA 3S3OA 4ELVA 8ICNA 3KTQA 3WNGA 1S0NA 3AVNA 1J5OA 2JLEA 2RDIA 1NK5A 4XIUA 4ED1A 3C1YA 4HTUA 4CJQA 3UPQA 4CFAA 4R8UA 2VG6A 3HPOA 5D4BA 4I27A 4DF4A 5IINA 3VQ8A 2F8SA 1L5UA 4JUZA 9ICOA 3JPRA 1DOQA 4KFBA 3ZCMA 2W9MA 4CGHA 1JMSA 2F8TA 4GXKA 1KFTA 3RB4A 3AA3A 4KHNA 8ICIA 3D0PA 1BQNA 1RT2A 2ZJ8A 2DPJA 1BCMA 3AO3A 3HVTA 2QKKA 2NUBA 3G6XA 4CHZA 3V9ZA 3LP1A 3PNCA 4OPKA 4RPXA 4MEXA 5KFMA 3HK2A 5D49A 3MR2A 4NCGA 4KPYA 3LK9A 3V7JA 3DOLA 3QNOA 3JYTA 1FK9A 8ICUA 4RQ1A 4KI4A 2PXIA 1NK9A 4KLLA 4J2BA 3V1OA 3HWTA 4W5NA 3H4BA 4MFBA 1ZQIA 3GIKA 3PW2A 5E41A 4ECZA 5J0QA 2XY6A 2Z1IA 4Z6FA 3AVFA 3MGHA 5DGAA 9ICBA 2HHXA 3RMBA 5CP2A 3OYIA 3PX0A 1WSGA 1UAXA 4O5CA 2AGQA 4Q44A 4B9LA 5KT3A 4DFMA 2MUTB 4FJKA 2Q3SA 1RDBA 2NRZA 4W5QA 2KZMA 3JPOA 2W9BA 4PY5A 4DQQA 3MGIA 4J2AA 3KK3A 4LVSA 1VSJA 1T4GA 1LAVA 4KHYA 9ICJA 4YMNA 2IHNA 4CF0A 4DSJA 2DPIA 1RT1A 3PV8A 4RT2A 1KLNA 4M9LA 3OYAA 9ICFA 5CR0A 2BGWA 4CGGA 1WN7A 3KHLA 1JLCA 1ZQPA 4LZGA 1UA1A 2R8KA 4CGDA 4F92B 3AA4A 4FLWA 5J2NA 2JGUA 1ZBIA 3AVKA 4QZAA 4E19A 1RYSA 3OVNA 3T5JA 4K8XA 2BCSA 4K4HA 4DU3A 3A2FA 3MABA 3ISBA 4KLFA 1TV9A 4RUAA 2FBXA 1YT3A 3AO2A 4ZH4A 1VSDA 2HB5A 5K14A 5J2PA 4F5OA 4J9KA 4NYNA 3QEXA 4ELTA 2ZTCA 3SQ2A 4YG2A 1HYZA 4Q8FA 5D46A 4YD2A 5KFOA 4AILC 3VA0A 4NCAA 7ICGA 4CIGA 4QWBA 2C28A 4KI6A 3HPGA 1N56A 1TKTA 5KFTA 2E4LA 1KDHA 1TV6A 4HHTA 5HNKA 3AVJA 1WCLA 2VANA 3OS1A 2VWJA 4H4MA 4FJLA 4DL6A 3NF7A 2R8GA 7ICNA 3RJFA 5C5JA 3FDSA 1KVCA 5KFYA 5IIMA 4DL3A 2YNHA 4CJLA 8ICHA 1SKWA 4BXOB 3L8BA 3NH2A 4YXMA 4C8NA 3NGYA 3V6KA 4EEYA 4DSKA 1L3VA 4FCYA 1EX4A 4CHPA 4QCLA 3AU2A 2XY5A 2RN2A 3VQAA 4UB5A 8ICFA 5J0WA 5HP4A 2I9GA 4YFUA 4NLGA 4BWMA 4PGXA 2P6RA 1WAFA 3T5LA 3F73A 4OVLA 1X9MA 4RNMA 4YN4A 4QAGA 4ECRA 1B9DA 3QZ8A 4YR0A 5DBBA 4TSXA 3V9WA 1WSJA 3RH4A 3C5FA 5HRNA 3K58A 4B9SA 3SPZA 2I5JA 4K8ZA 3CG7A 9ICQA 4F91B 3M8RA 3B0XA 1VSFA 4P2HA 1KEJA 3SQ1A 2R8IA 1EXQA 3SV4A 1SKSA 3KD1E 3V7LA 4Z4CA 4DL5A 4QWDA 2BANA 3VQPA 4DSIA 1C1CA 5DB9A 5J2AA 4ED7A 5KFJA 4CK3A 2W8KA 2ALZA 3OYGA 4EBCA 4IKFA 3RR7A 4B9NA 4QZ8A 3HL8A 4DFJA 4F2RA 1QLNA 2GWSA 5IIIA 4M3XA 1S9GA 3P83D 1KVBA 3K57A 4KAZA 1RXVA 4RQ7A 3MEDA 2BCQA 4I2IA 3OHBA 4W5TA 2BCUA 4UBBA 1ZQNA 4N56A 3AVLA 1ZBLA 1VSLA 7ICPA 3VQ6A 3VQDA 3C5GA 3RJGA 1ZJMA 8ICMA 3EZ5A 4JV1A 2BPGA 3KIOA 4P4OA 4DWIA 4KLOA 1QSSA 1ASVA 1UT8A 2J6TA 3SZ2A 4O3RA 3NF9A 3PO5A 4PHDA 2HNZA 2QKBA 1WSIA 5J0XA 3GIMA 3SJJA 3GQCA 4DG1A 1TAUA 4LH5A 4B9MA 4NM2A 5HHIA 2JEFA 2YKMA 2GUIA 4I9LA 4EP5A 3MBYA 3RRGA 4ECXA 4CESA 1BVSA 4QZGA 3LPUA 4DSFA 3C23A 1VSIA 5EWGA 4KLQA 5KFPA 3T3FA 3RTVA 1RTIA 8ICYA 4EBEA 4RG8A 3GFKB 2BQ3A 4FYDA 4M9NA 1U48A 2NRVA 1Z25A 4CF8A 3RB6A 4CFCA 4RQ6A 3S9HA 1XC9A 4YR3A 3NBPA 3EPIA 4CCHA 4CJSA 4E7LA 4KLSA 4LD0A 5I3UA 5L9XA 4KMUA 4CJ5A 5KFSA 8ICRA 4BE1A 1S76D 2G8UA 5BPCA 3GV5B 1ZQMA 4KLMA 4KITB 3MDAA 2QK9A 4CIFA 4LH4A 1ZQGA 3KKSA 2WONA 2WOMA 3O3GA 5FDLA 4CJUA 1SL1A 4J2EA 4RPYA 4KB0A 4QW8A 4FJXA 1K6YA 3AVAA 4Q5VA 4M9JA 4KLGA 8ICOA 5KFFA 2LYHA 5EWFA 1QTMA 4UQGA 3GV8B 2A1JB 5HRSA 1NKBA 5HLFA 4P4MA 4F4ZA 2C2DA 1WSHA 3AVMA 1B9FA 4IFYA 4M3WA 1TK0A 3Q8PB 4DTOA 4CGJA 4Y1DA 3GDXA 4BE2A 1PZNA 2Z1JA 3MEGA 1LB2B 4N5SA 2DFFA 1T03A 4I29A 1LW2A 4CJFA 3UXOA 3LDAA 5KFQA 4O9MA 2AJQA 1Y97A 4QZEA 1LW0A 1RCHA 1TGOA 3RJIA 1Q9XA 1IG9A 1B43A 4JS4A 3WNEA 4M2YA 1NKEA 2NRTA 4FZXC 7ICMA 3I8DA 1ZYQA 4KO0A 5J2DA 5KFDA 3G6VA 4FLXA 3I0RA 4I2HA 4YNQA 4MEYA 2MAXA 3G6YA 9ICIA 5DBAA 3OYMA 3HSTB 1C0TA 4R66A 1JN3A 4Z4GA 3K2PA 3LDSA 4EBDA 2QXFA 4CEOA 3Q8RB 3T1AA 4B3OA 7ICSA 3WNHA 1BIZA 4PA1A 1BI4B 4IDKA 2BHNA 1LV5A 1G15A 2OYQA 2FPMA 1GOBA 4M0AA 4JV0A 3QERA 1UT5A 4FLZA 3ZDEA 4R63A 4GLXA 7ICRA 1RTDA 2ZTEA 3CFOA 1ZQVA 3PMNA 3M8SA 1JLBA 3QLHA 3HT3A 3TAGA 3WNFA 1XU4A 3ZT4A 3TFRA 5DB6A 2J6UA 3JPPA 3RMDA 3LANA 3HW8A 2VA3A 2FPKA 1CUKA 2HMIA 5F9NA 4F4WA 5J1EA 1JLAA 2A1SA 3SCXA 3HP6A 3ISDA 1BQMA 4CHYA 4I2EA 3L2UA 3DMJA 3KHGA 2IHMA 2YNGA 1Q8IA 1Z3EB 1A5XA 2X78A 3K59A 4CEZA 5KT2A 4YR2A 2OPQA 2PFOA 4M6WB 3TAFA 1RT3A 4I2AA 4DQPA 4CJWA 3H08A 4FM1A 1D9DA 2HHVA 4XRHA 2ZUDA 2ITGA 1ZQWA 4DMNA 4QZIA 4KN4A 2E6MA 4DFKA 3K75D 4B9TA 3S3NA 2FLLA 1MQ2A 4O3NA 1T3NA 4O5EA 4ICLA 4F4XA 1CXUA 3V9SA 1KFSA 3MFHA 4ELUA 1CZ9A 3N97B 5KFZA 2HW3A 4O44A 4C8MA 3T5HA 4I2FA 5J2JA 5JS1A 1XHXA 3HVRA 2OA8A 1BHLA 1HQEA 5KFXA 5KI6A 3H8WA 1CLQA 1U4BA 1SUQA 5KG2A 2V4RA 1BISA 3U3GA 5T7BA 4ED0A 5L1IA 3BJYA 2YNFA 2YKNA 2BE2A 1VSHA 4KREA 4DTSA 4R5PA 3RJJA 3BGRA 4DSLA 2B21A 4DLEA 2UVRA 2XRIA 1XHZA 3TQ1A 4Z6EA 3SUNA 2XC9A 3RJKA 4TQRA 1CXQA 2Y1JA 4J9LA 3RAXA 1HUOA 4DL4A 4KKOA 1ZQHA 3LP0A 4RU9A 5DKWA 3EW9A 5KRSA 3IM1A 3MEEA 4FBTA 5DLFA 8ICBA 3V6JA 4FJNA 3JPTA 4M3UA 2P1JA 4P4PA 1VRTA 5KRTA 3HO1A 1L3TA 3NFAA 1RPLA 4E1MA 3TAEA 3DLHA 4F5RA 3JPQA 4DOCA 4BE0A 4GW6A 1K1SA 4RW9A 3V6DA 4OJRA 4AHSA 3V6HA 4F5PA 3PY8A 1DTQA 5I42A 3JPSA 2EHGA 2Z1GA 4ZHRA 2BDPA 1S77D 3AO5A 2XGPA 3V9XA 3QIOA 2XHBA 3ZSOA 2AQ4A 4ED3A 4CIEA 4J9NA 4O55A 3EY1A 2P51A 2VA8A 1RTHA 1TL3A 1BPBA 5KFEA 5CB1A 3AVBA 8ICJA 2DFEA 5IIKA 2IAJA 5KGXA 5HHHA 4DU4A 2ZTDA 3NF8A 2ISPA 2PFNA 3M8QA 4FO6A 4J9PA 5JS2A 2YV0X 4CJRA 3GIIA 3ZSVA 3H8SA 4HYKA 4QZFA 1JXBA 3IAYA 1NJYA 2ZJ5A 3KLEA 1WNSA 1NKCA 1XSLA 1HNIA 3HYFA 2HNDA 1XI1A 4CEEA 2Q0ZX 1TFRA 1ZQFA 1ZQXA 3DOKA 4E89A 4IG0A 2FLNA 1TKXA 3V7KA 1COOA 4B9VA 3PR5B 3NF6A 3OS0A 1S1XA 4Z4EA 4YCXA 5BOLA 1D8LA 1NJXA 2C2EA 1RDDA 1RXWA 3ZSXA 4FVMA 4TURA 1C1BA 4I2PA 4CGIA 3AV9A 4OKEA 2P5OA 1ZQBA 1ZQJA 4RQ5A 2G8VA 5DGBA 2ZUBA 2VWKA 1ZQZA 4O5KA 3ZT2A 3V72A 1ZQAA 2P66A 3PW7A 3AA5X 3C6TA 4FJHA 4HUEA 3ITHA 4AHCA 5KT7A 2F1HA 1S97A 1MQ3A 2IMWP 3SQ0A 4K4IA 2G8IA 4F5NA 1BPXA 1NK7A 2IGIA 1ZETA 3AVIA 2LSNA 4G3IA 5HRPA 2IC3A 4M47A 1ZQOA 1MC8A 4XQ8A 1TKDA 4M9HA 2NRWA 1LAWA 5F9LA 2KFNA 4I2CA 4OLAA 2BQRA 5KT6A 4KLDA 3HX0A 1HUZA 2GV9A 1ZQCA 3AVCA 1JLGA 2UVVA 5CYMA 7ICQA 2EX3A 1D8YA 4CEQA 1C6VA 5JUMA 4XA5A 3ZDAA 1N48A 1BPYA 3RR8A 3OHAA 3NDKA 2KW4A 1RDCA 2Y1IA 3PX6A 2AQ0A 5DBCA 1SL2A 5IILA 4NLZA 4E7JA 1ZQDA 1CEZA 4ECVA 2X6NA 5IIJA 1TAQA 2YHBA 3DLBA 4IR1A 9ICVA 4Q45A 4Z4FA 5EWEA 3AUOA 2B4JA 4KN7A 4KHUA 1RBSA 1EKEA 1V9PA 2H5XA 4O3QA 1BPDA 3NTUA 4FJMA 3DRSA 4FJIA 3F9KA 4AHTA 1JIHA 3Q8LA 3QO9A 5DDYA 4CK2A 3MR3A 1U45A 4M3RA 3L3UA 2E6LA 4AHVA 3OYEA 8ICPA 5KFLA 1YVUA 4BGDA 4LSNA 1BGXT 2W9BB 1LWEA 4BWJA 2BKEA 1L3SA 4Z4IA 3SV3A 1QSYA 4Z0UA 4CJEA 1JL2A 2RDJA 3L3VA 4GVMA 2JEGA 3G0ZA 3DLGA 3OYLA 3TWHA 3MECA 1K1QA 3C1ZA 4NM1A 5KG6A 4E7HA 1UOCA 1EETA 4ID1A 3VQ4A 5SZTA 4KHQA 5J2CA 1JLFA 2B5JA 5CZ2A 5FRMA 3O4QA 4ECQA 4QZ9A 1ZBFA 1RBUA 1J9AA 4OGEA 3P1GA 1IKVA 4MF2A 3ZD9A 4ID5A 4FW1A 4OKJA 4N47A 2OPPA 2HVIA 8ICQA 1B22A 1VRUA 3QESA 1S6QA 4KHSA 9ICGA 2M9NA 1SZPA 1WSFA 4QWCA 2ASLA 4JV2A 1F21A 4CF2A 1DGSA 2R7YA 7ICVA 3AO1A 1I39A 2W42A 4DTPA 3LAMA 4RQ3A 3C2MA 4OKKA 4TUPA 4E3SA 4ECTA 3KHRA 7ICKA 4FBUA 3L2WA 4GC7A 3I0SA 4RW6A 9ICAA 2I1QA 3HJFA 1NK8A 5HMLA 3OJUA 3JPNA 3AVHA 4PQUA 4NXZA 4EZ9A 1SL0A 5L1KA 3RH6A 9ICEA 1RTJA 2RF2A 4J9QA 4IQTA 2V9WA 1KCFA 3ZT1A 4YP3A 3PW0A 9ICNA 4CEBA 5J0YA 1BI4A 2O4IA 5J2QA 3CFRA 4J9RA 1XSNA 4DTJA 3L2QA 2JEIA 2F1JA 4F50A 1RYRA 7ICFA 2D5RA 1NOYA 4OLBA 4F4YA 3SI6A 1S9EA 1X1PA 3OYDA 7ICIA 4CGFA 3DLEA 1C0UA 2HVHA 3O3FA 3TABA 2PI4A 4L8RB 4FLUA 4KV8A 3AU6A 4DO9A 5D3GA 4F5QA 2ZE2A 8ICWA 1QSLA 7ICEA 1B92A 4TQSA 4ECSA 1U04A 5SWMA 3M8PA 3QEPA 4MFCA 3RB0A 1UA0A 4TUQA 4CK1A 4FLTA 3M9MB 4I2QA 2ASJA 2FMSA 4IQVA 2D0CA 4QW9A 4CF9A 4FJ9A 3TARA 3QEIA 4Z4HA 3PX4A 4C8LA 1BPEA 1HPZA 4CEDA 1N6QA 3GV7B 2BQUA 3RMAA 4FS2A 4ECWA 3MR6A 4X5VA 3UXNA 5J29A 2FBYA 2ASDA 2BPCA 3BQ0A 1CZBA 5L1JA 4DL2A 4F2SA 4OPJA 1HQUA 1VSMA 3PUFA 2ZD1A 4ZTFA 5KFNA 2JZBB 3DRRA 3MXIA 3ZSZA 5KG4A 3RB3A 2AGOA 4CJPA 1AROP 4N76A 3V4IA 1ZBUA 3ISCA 4CFBA 1ZQQA 2A1JA 2PFQA 4I2GA 1IKXA 5KFHA 2XO7A 9ICHA 2B6AA 1NK6A 3PW4A 4I2BA 4CERA 1C1AA 3ZD8A 4DQIA 2FLPA 2YNIA 2OPRA 4F93B 4RQ4A 4UB3A 1S1TA 1ASWA 5C25A 4KLUA 4I28A 4KLHA 5HMMA 4KTWA 2C2RA 4IR9A 1VSKA 4UAZA 3NH1A 4QZCA 4IQUA 3RH5A 4FZZA 3RBEA 3BQ1A 3H7IA 5J2BA 4DTMA 7ICJA 1C0MA 4IRCA 1U47A 3DLRA 4I7FA 4UAYA 3ZT3A 4FJ7A 1RILA 4F4KA 1JKHA 4UB1A 4TUSA 4PHEA 2DTUA 4J9OA 5DG7A 3IS9A 3ZSRA 2G8KA 2D0BA 2OZSA 1KRPA 3CM6A 3QINA 2PI5A 5HROA 3PO4A 2KTQA 2W9CA 4HUGA 3ETLA 3OYFA 1KTQA 3E01A 2W8LA 4OGCA 3BDPA 4I2DA 3H4DA 4JWMA 3VQCA 4CHQA 4YD1A 3CQ8A 4IRKA 3KD5E 3C2KA 1VSEA 4KLEA 2X74A 2PY5A 8ICKA 3U3YA 1IKYA 1FKPA 3OYHA 3RJHA 1NOZA 4CEFA 3MXJA 2KZZA 4FJJA 3NGDA 1I3AA 3AO4A 3HM9A 2IA6A 1R0AA 1A77A 1D5AA 4O3SA 1Y88A 1HJPA 2R8JA 5CWRA 4E1NA 1YTAA 3EPGA 4YXJA 1ZQKA 5KG5A 3K5MA 4QOZB 3H40A 5IIOA 1RDAA 9ICSA 2W9AA 8ICTA 3KK1A 3FYHA 5KG3A 3OYNA 3KJVA 3QNNA 4CJVA 4DS5A 4FJGA 4CFDA 3OY9A 4J2DA 4HCBA 4AHUA 1FKOA 5CHGA 5J2IA 3ISNC 3TI0A 3QZ7A 1LWCA 1QE1A 4RW7A 4RW8A 5DLGA 3CYMA 4AHRA 5BOMA 2XCPA 4BACA 5J0UA 2F96A 4DSEA 4E7KA 9ICWA 4PHAA 5J2EA 3C6UA 4O0JA 3OYKA 4BXOA 1NOMA 4AH9A 3ZSWA 4HCCA 5DB7A 3ZDDA 3B6OA 2G8FA 2AU0A 4CJ3A 4JWNA 3KLHA 3OS2A 4DTNA 4C8OA 4QWAA 1JX4A 3E2EA 4O0IA 2FC0A 4RNOA 4Q0BA 4J9MA 4DTRA 1NJZA 4DFPA 4B08A 1KSPA 5DG8A 3LZIA 1WCNA 3NAEA 1X2IA 2ATLA 1S1WA 3ZSQA 2R8HA 4UB2A 3PR4A 4Z6DA 3NCIA 1S0VA 7ICTA 7ICOA 2BCRA 3AVGA 3PMLA 3SUOA 8ICLA 3M9NB 3KLIA 5J2MA 1MSWD 4KTZA 1S0MA 5KT5A 3IRXA 1S9FA 1QQCA 3AA2A 2ZUCA 1BPZA 3UQ2A 2F1IA 3C94A 3CFPA 1ZQUA 4M04A 1J54A 2ZQBA 1ASUA 4QZDA 4R8UB 1GOAA 5EU7A 4B8AB 4W5OA 4BDPA 1H38A 3VQEA 4QZBA 3DI6A 4KLIA 5KFCA 3LAKA 1KLMA 4CJKA 2C22A 4O3OA 3O3HA 3Q8QB 1WAJA 1S5JA 4C8KA 5KG0A 1X9SA 1TK8A 3M9OB 3SYZA 9ICUA 4FXDA 4DS4A 1T8EA 1EXNA 4JRPA 2DFHA 3SI8A 3EWAA 5KFWA 2PYLA 4N41A 2XCAA 3P5JA 4NLNA 3ALYA 1Z00B 4E7IA 8ICAA 4YQWA 3LWMA 2RPIA 2HHTA 9ICPA 4M45A 2P6UA 1A5WA 3RRHA 5HBMA 3HXMA 1JL1A 1HJRA 1RT7A 3CM5A 1ZQYA 4YMMA 3KLFA 4BDYA 5KFRA 1N5YA 3VQQA 3OGUA 4B9UA 1IO2A 1Q9YA 1RT5A 3OJSA 1Z26A 3C2LA 2XGQA 5J0TA 4M41A 5KGWA 1RZTA 1NK4A 3OSNA 3ZSYA 4KLJA 2JZBA 3TAPA 3U6FA 3DM2A 4LY7A 3SPYA 4UAWA 2KQ2A 1X9WA 4KB1A 3V1QA 4DLGA 1XWLA 3Q8SB 5HP1A 4ED6A 3MDCA 3O4NA 2OZMA 1Z00A 1BIUA 4RUCA 4PH5A 4HVJA 4PGQA 1RNHA 3VA3A 2XY7A 3KLGA 3ULDA 4M9GA 4BDZA 3RAQA 3OYCA 4ZTJA 1ZQRA 4EYIB 4O5BA 4G1QA 4JS5A 3UXPA 1GOCA 3K5LA 2IBKA 3ZDCA 3N4MB 3TAMA 3B0YA 5J0OA 4GMJB 3VQBA 3SNNA 2PZSA 2WTFA 3QETA 2OWOA 4O3PA 5KG7A 3H8JA 2Z1HA 2D0AA 3QIPA 4DU1A 1RT6A 3THVA 5CY4A 4R64A 3L2VA 1BL3A 4H4OA 5DG9A 4B8CA 5KG1A 3NE6A 4CJTA 3D45A 5KFKA 3LP2A 2BCVA 4JLHA 3T5KA 4FM0A 4YFKA 2J6SA 9ICMA 8ICCA 4F3TA 3NGIA 4PWDA 5DB8A 2AGPA 3SUQA 5DDMA 4CJ4A 1RT4A 5J0RA 1D9FA 4RQ2A 4FJ5A 5KTQA 1JLEA 3TANA 3DRPA 1S6PA 3PW5A 1XS9D 4NCBA 1IKWA 4DEZA 4RQ0A 2DFLA 1TL1A 1WSEA 8ICEA 4WE1A 4ECYA 1NJWA 8ICSA 8ICVA 4M3YA 2HNYA 9ICCA 4HUFA 4FK2A 5CJ7A 5CZ1A 3MFIA 3PVXA 4H8KA 1MU2A 3SQ4A 2VA2A 4PHPA 4ED2A 2DY4A 1FXXA 4PGYA 1ITGA 4FZYA 4CE9A 4DTXA 1HYSA 3KK2A 3BQ2A 1TVRA 3ORYA 1S0OA 4IG3A 5J2HA 2NRXA 3BQTA 1ZQLA 5TZVA 2FPLA 2HHSA 1HMVA 4KRFA 2PFPA 2VG7A 4I2JA 2IS3A 8ICXA 4Y1CA 4IRDA 1RBVA 3IHQB 2X6SA 2FMQA 9ICTA 2BR0A 4NYFA 4QZHA 5J0PA 4GXJA 5DQHA 1W9HA 2VG5A 4CEAA 4ECUA 3QEAZ 1W0HA 4Q8EA 3LWLA 2ATQA 4J9SA 1BCOA 3NH0A 4FJ8A 1KFDA 3KHHA 4E0DA 3MR5A 4M6WA 1XSPA 9ICKA 1DLOA 1XO1A 5J2FA 2BGGA 3C21A 3VQ9A 4XUSA 5J0SA 2KZ3A 4KTQA 1ZBHA 3HP9A 1WLJA 4MF8A 4CHNA 1S1VA 2PYJA 5DMRA 3T19A 5KFIA 2P5GA 2FMPA 8ICGA 1SV5A 1T05A 3OSPA 2ZJAA 4GC6A 4DF8A 4EZ6A 4Q43A 5KFUA 3K5NA 2A1RA 1J53A 3OYJA 3S3MA 1ZJNA 5HRRA 3UIQA 3C95A 1U49A 3RWUA 5C42A 4UB4A 2V4QA 4F8RA 2G8WA 4M42A 5EOZA 4FW2A 3QEWA 3VN5A 4O4GA 2HHWA 3V81A 1U9LA 1A5VA 5CYQA 4UBCA 4EYHB 2G8HA 5KFVA 3GILA 1A76A 7ICLA 4DL7A 1HNVA 1RBRA 3RJEA 2BPFA 4DOAA 3GIJA 1JLQA 1LWFA 3ZDBA 2KFZA 5DQGA 1SKRA 1QHTA 2IDOA 3ZT0A 3VQ7A 9ICRA 3LZJA 3QEBZ 2W9CB 3DLKA 1UWBA 3JSMA 1TVAA 5DQIA 2KN7A 4CF1A 3NHGA 5KFBA 1KVAA 4IBNA 1ZQSA 3UQ0A 1IXRA 4MFAA 3G10A 4QWEA 4FLVA 4I9QA 4Z6CA 5KT4A 1YTUA 3Q8MA 2O4GA 3VQ5A 2JEJA 4R65A 4JK1A 3ASMA 3RMCA 4K4GA 4PPXA 1O1WA 1REVA 4LZDA 1IM4A 4YVZA 1L3UA 3Q8KA 9ICXA 4DQSA 2MUTA 8ICZA 2UVWA 3MXMA 4FS1A 2RKIA 1C7YA 2YHAA 4CECA 3L2RA 3K5OA 3SUPA 7ICUA 4KLTA 4RPZA 4LSLA 3TR8A 3B6PA 4RQ8A 2UVUA 4RZRA 3MAQA 1S10A 1DTTA 3OYBA 3V9UA 1T7PA 4KHWA 2XY8A 3RBDA 4CHOA 4DTUA 1ZQTA 1ZQEA 4GXIA 2IOCA 2HHQA 2ETJA 3HPHA 4NLKA 4IQWA 1HRHA 4ED8A 1NK0A 4DQRA 5L1LA 7ICHA 1S1UA 3TFSA 4FK0A 3K4GA 4RT3A 3LALA 5FRNA 3EYZA 4NY8A 3IG1A 4JRQA 3QEVA 1VK0A 1EP4A 4PUOA 5KFGA 4W5RA 1JXEA 2FBVA 5J2GA 9ICLA 5DK5A 4RNNA 3FFIA 2OPSA 4F3OA 4FK4A 5FROA 2GBZA 3V1RA 4M3TA
chains in the Genus database with same CATH superfamily
1HYVA 2A18A 2FBTA 4CDGA 4K2JA 2VBXA 4I6MB 2OMOA 1TK5A 1JB0C 2UXBJ 1TKZA 3F2CA 4RCHA 1IXKA 2ISOA 5T7LA 1GTEA 2JSXA 4KV8B 3H6EA 1UFWA 3TADC 5D3GB 2E9RX 4FLYA 2GHVC 1QS4A 4L74A 2HSZA 5HOOA 3N5BA 4I7FB 2PFFB 1K0VA 1S0NA 2JWNA 1J5OA 1BOTO 2RDIA 3G8TA 1NK5A 2GV1A 2RP5A 4ED1A 4JI6F 4HTUA 1F9EB 3Q89A 3HPOA 4DF4A 3HHDA 2AYBA 1FNXH 5ADXA 5IINA 2E7VA 3CCVN 3G6EN 1CULA 4KAIA 9ICOA 1NDPA 1Y5IB 3ZCMA 1FXDA 4RL1A 1TR0A 5HR6A 4F02A 3O9UA 5HAOA 1D1UA 1ITPA 2XLJA 4Z7YA 2F8TA 3G9CA 3AA3A 4KHNA 1XNRK 1KONA 1URJA 2QYGA 4ETXA 3J7Z5 1VHXA 4UZBA 3AO3A 2NUBA 3TZYA 4KH1B 1YSJA 3LP1A 4IUFA 3OQ2A 3SSSA 3TUZC 3ETOA 2DJWA 1YWXA 5D49A 1XMBA 4K43A 2Y9TA 2DGVA 3KFWX 1U0HB 3KKAA 4C1NK 4WJBA 2YN4A 2P8IA 2KM8C 1N5QA 3QNOA 2Z2LA 1FK9A 4DOZA 1AZSB 2BKNA 5ETMA 3VGMA 2AZ1A 4P9SA 3A1YG 1I51B 5C2GA 3GONA 3VCBA 2VBYA 3L0QA 1Q8BA 1HNXJ 4MFBA 1ZQIA 4PCQA 3GIKA 5E41A 2VL1A 4ECZA 5J0QA 1B4FA 4Z6FA 3AVFA 5DGAA 9ICBA 4DUYJ 3D2SA 2HHXA 4DPOA 2DR7A 1UAXA 4K4VA 1XQSC 2YX8A 1V6HA 4B9LA 5KT3A 1GLCG 5AQSA 3AB2B 3IMXA 3UQSA 3M2RA 3G8QA 4W5QA 2FVSA 3D1QA 4LVNP 2IOHA 3IMQJ 4PY5A 3JYTB 1GMUA 2Q0RA 3IKMA 4ACOA 4DQQA 3MGIA 2D1CA 3MDQA 3KK3A 2KKZA 3ZNJ1 4DZDA 3Q8VA 4A8KA 4GKKK 4YMNA 2DPIA 1KLNA 4M9LA 1F3FA 2KG1A 4OJLA 2AT1B 3DU5A 2BGWA 1GXTA 3KHLA 2VPWB 1ZQPA 1UA1A 3DOMB 3QICA 2R8KA 2XNRA 4IOAQ 1S1WB 2PKEA 2RUGA 2FJBB 2JGUA 4FYVB 3AVKA 2A41A 2UUAK 3LP2B 3OVNA 2QWPA 5D4PA 4KQZA 2P9SA 1E4GT 3A2FA 2OPSB 2R2SA 3SSRA 3OD2A 3ISBA 2JNJA 2QLTA 3CWJA 3I1YA 3AO2A 4BGBA 4ZH4A 1VSDA 4KHPF 1RT1B 3FR0A 4NASA 3JS9A 2CG4A 3L95X 1DTQB 5FIIA 4AT1B 1HYZA 2ILZA 5ALUA 3W2WB 2W3SA 2HBLA 1CJUB 4Y2KA 4YD2A 5KFOA 5T7LB 4K41A 2EZXA 4ZVUB 5ALWA 5LT5A 1KXPA 4B3TK 2C28A 1HKGA 2HZVA 4C11B 3N6LA 3RGIA 1TV6A 2RDDA 4H0XB 5HNKA 3FVYA 2V7ZA 1WCLA 1H98A 3TSQA 5F8IA 4H4MA 3T1HF 2EH9A 5KOWA 2FGCA 3NF7A 2N3LA 1PK3A 4GKJK 2O66A 3FDSA 2Q6BA 2HRUA 5IIMA 2KU7A 1SVDA 2YNHA 3H8YA 2HLTA 1IBLJ 1HYSB 3O9TA 3NH2A 3FMWA 1IBMK 2ZXHA 2FF6A 2JWKA 5GIPA 4C8NA 3P5TL 5AQIA 3G4SS 3VV2B 3AD7C 1CULB 4QCLA 4ENOA 4NI2B 3VQAA 8ICFA 4NEZA 1JJ2M 1ZA1B 2XTJP 4V19J 2I9GA 2OP5A 2OPRB 1B64A 4EIAA 4C98A 3T5LA 4DV4K 4OJHA 4RNMA 4YN4A 4ECRA 1B9DA 5J8YA 4FPBA 2GX9A 3PIPQ 3V9WA 3CJ2A 3RH4A 4F3MA 4IJNA 4IXCA 1NPKA 3FFIB 5E26A 1FRHA 1RBLA 2LQ5A 1HNXF 3M8RA 3B0XA 2MQOA 2DR5A 4CTAB 4X65F 4G1IA 3SQ1A 2R8IA 3N6NA 2W2PP 1SXLA 3IM8A 3WK9A 1O0PA 3EM1A 1GLBG 2XS5A 4DL5A 2BANA 2J7WA 2VF3A 4LF6F 2W2MP 3NNCA 5J2AA 4ED7A 3ZZTA 2VD3A 4JI2J 4MYTA 2F3NA 1Q18A 5AZIA 2JFKA 4DFJA 1QLNA 4HAIA 1WF0A 3K57A 4JN4A 2FJAB 2YKMB 1RXVA 3MEDA 2ES6A 1Y10A 4ALZA 5E3RA 3SMPA 3OFGA 4I2IA 1CG2A 2NPIA 4MKVA 1UJ5A 3HHLB 3C5GA 3RJGA 1Y4ZB 3HI0A 3FMBA 8ICMA 4AXJA 2YKOA 3KIOA 4OMFG 4PQAA 1UT8A 3NF9A 2DD8S 3HHEA 4PHDA 3DGPB 1WSIA 1YIJS 3GQCA 3TJ8A 3ENVA 4BRDA 1RCOB 2WB1C 2KT2A 5HHIA 2JEFA 1LFPA 2CGKA 2ZNYA 1Q78A 4EP5A 2DGOA 3H5SA 4LF8K 4DR6J 1BVSA 4QZGA 2ZH3A 1VSIA 2KHVA 4KLQA 1AA1B 2F7TA 3T3FA 3BEXA 2KVQE 4K50A 4KHRA 3CJRA 2ZG6A 1U48A 2P6SA 2HKEA 3RB6A 2HWTA 3BGOP 3MEKA 3FZKA 2A1BA 1XC9A 4LF6J 4YR3A 3NBPA 3EPIA 1OSDA 5I3UA 5L9XA 5TKWA 2E1PA 5AE2A 4A4JA 2F9DA 1L7MA 2ALYB 5L9NA 3CC2N 2G8UA 3BGRB 4OZ2A 4KITB 1Y3KA 3MDAA 2JXJA 2JOQA 3IFRA 3QNWB 5FDLA 4P71A 1UPMB 1SL1A 1TV6B 1ZZNA 4RPYA 1IKYB 4PEOA 4H4MB 3JS6A 4DV6K 1HNWK 3FKBA 4P2MA 4JKGA 1R89A 4ZP8A 2G13A 5E3CA 4NX9A 1S49A 1QTMA 5HRSA 2E1CA 2DNGA 1WSHA 4DR1F 2BW7A 1B9FA 1M5OC 4M3WA 1OJ4A 3Q8PB 4DTOA 5J1PA 4M5KA 4Y1DA 3UE2A 5D0GA 2Y0BB 2FVQA 4BE2A 2Z1JA 3MEGA 2DFFA 2CGJA 2WBRA 3LL3A 2DCUB 3RJIA 1JLCB 1S1VB 2N4CA 1B43A 2DXDA 1UAWA 3W9JA 7ICMA 1F3VA 3TWZA 1ZYQA 4YY3K 4MKAA 4G65A 1T9UA 4NXNF 3R2CJ 4YNQA 4C9DA 1KHWA 5DBAA 4CI0B 1NDLA 2R7RA 1C0TA 3O1BA 4Y2AA 3Q8RB 3WNHA 2ACMA 4RQNA 4OX6A 4PA1A 5IT9O 1BI4B 3W2VB 3QU7A 5K14B 3BZCA 4Y2SA 2V68A 2DUYA 3IBPA 3MM7B 2E20A 5IOLA 3ZDEA 4Y2PA 5EX3A 5KL1B 7ICRA 2DB1A 4JI5K 4M1KA 4PWWA 2RRBA 4L6V3 3RYLA 4USAA 2H3ZA 2KB2A 3PMNA 1ZS6A 2GAHC 1JLBA 2FJEB 4MTPA 1TKTB 3QLHA 5CCLA 5EX5A 1XU4A 3ZT4A 3UB5A 1VHFA 3M1VA 2J6UA 3JPPA 4A8QA 3V2UC 2VA3A 3LGMA 3GJTB 2FPKA 1EHWA 2LYVA 5LL6Z 2VKRA 1RQ0A 5EE0A 5J1EA 1RAOA 3D4JA 1B0TA 3L2UA 2IJNA 2YNGA 1Q8IA 1Z3EB 3QFUA 4B3SJ 4UY8O 4WQ5C 3FCVA 4CEZA 3ILLA 4YR2A 2LM1A 4C23A 1X7VA 2CXYA 5CQGA 5LMUK 4LFAK 4DQPA 2XWXA 2R18A 3DRYA 3MX5A 4FM1A 2FC9A 2JMGA 2ACYA 2Z30B 2ITGA 4DMNA 4L73A 2OCEA 4NJ8A 4DFKA 4P52A 3K75D 1AZSA 1B99A 3S3NA 1ULRA 4Y3CA 1HLUA 2FLLA 5ALLA 4O5EA 3G82B 1C2PA 4M95A 2E8NA 3ADAC 1S59A 2BV3A 1N33F 2CPYA 4O44A 1UL3A 5D77A 3DRRB 2NXJA 2OA8A 1BHLA 4ZDNA 2I5JB 3ENHA 2V4RA 4OZ0A 4ED0A 2W6LA 3RRKA 2YNFA 4FKYA 3N4QA 2BE2A 3OFFA 1MA7A 2QMUB 4YOTA 2MYFA 4R5PA 3RJJA 3BGRA 2B21A 1UVIA 2XRIA 2JR5A 3TQ1A 4FWMA 1FJGK 1NMDA 4QYRA 4Y0WA 4PKGA 1QUPA 3CP8A 3IR6B 3FC4A 4DL4A 2HQFA 4TY9A 1TUVA 5KRSA 3IM1A 2FLOA 2ZGYA 1G7CB 2LEPA 2DWQA 4ZJLA 3M1FA 3R3LA 2JGAA 3JPTA 2W43A 4B3RF 4DV3J 4JV5J 2F65A 5KRTA 2BOPA 2O8EB 3VQSA 4M7XA 5AIBA 5AM4A 4GO7X 1P9YA 5LMUJ 3DLHA 3S7RA 4F9OA 4G1QB 4BE0A 3J81Y 3OUYB 3KMSA 4PG6A 1QZ6A 3GG1A 1HIYA 4AHSA 1HR0K 3V6HA 3PY8A 5I42A 1JNZB 2Z1GA 3QIPB 3EKUA 1ZPVA 3WXLA 3AO5A 2XHBA 5AQHA 3ZSOA 5SUHA 4NLWA 4ED3A 2ZITA 5HQMA 3C14B 4J9NA 1RTHA 1BPBA 4K0KK 2E2NA 5CB1A 1SB6A 8ICJA 1VRTB 4JBCA 4NZ7A 5KGXA 5HHHA 4KE5A 3CVKA 5D4NA 3L4IA 1UEKA 4YOVA 2N7CA 3ZSVA 3H8SA 5AFUA 1R31A 1JLEB 4DZ6A 2YWWA 3Q2SC 4IOXA 3THXB 3KLEA 3VTIA 1XSLA 1HNIA 3CCLN 4AQYK 3AJ2A 5C12A 4UT4A 4CEEA 1TFRA 4FZNA 1ZQXA 5HANA 1S12A 3DOKA 2CJ9A 4IG0A 4OJPA 1L7PA 2NSBA 4M5DB 3I5CA 4IFVB 5AJ3K 4FE3A 2IRUA 3C15B 4Z4EA 2C2EA 3GFHA 2QARA 4CWBA 3B8HA 4CBWA 1WF2A 4FVMA 1C1BA 4CGIA 2B4UA 3C65A 3WK7A 2E2QA 1ZQJA 4RQ5A 4GRSA 4KR0B 4DV4J 4WZQA 3AY0A 4JK8A 4RWWA 1ZQZA 3MAAA 1ICEB 3PRDA 2MQMA 2H5JB 4GVEA 3A0HU 1ZQAA 3SAHA 2P66A 4P75A 1XMQJ 3ITHA 4AHCA 2F77X 2WW8A 2F1HA 5F3TA 3PHEA 3UMGA 3CPWR 4TN2A 2IMWP 2YH1A 2HBZB 4LBIA 4QIGA 3O2IA 3TSUA 1X4CA 1ZETA 3AVIA 1CJKA 1N8RO 4G3IA 3EGWB 4DR5J 2ADBA 3KG1A 4OJ3A 1VQMS 4S0MA 4Z7CA 4UOFA 4TYBA 1WKLA 2E2OA 2UXBK 3QJJA 1RXOB 1MC8A 1TKDA 5J2NB 2VQFJ 4M9HA 4I64A 2ASOA 5BN8A 2ZHBA 3P3DA 4OLAA 2OSQA 3F5TA 2GV9A 3WKCA 1SQEA 3VETA 4CI6A 5CYMA 1M5HA 4DR4J 4LQ9A 2HZCA 2EX3A 1C6VA 5JUMA 1KAZA 2SXLA 3ET6A 4ZA1A 1BPYA 3M3ZA 2KN4A 3NDKA 2KW4A 1RDCA 4W4MA 3PX6A 4US9A 1SB3C 1SL2A 4E7JA 4ECVA 2IC3B 2ZH6A 4K0KJ 1KNZA 1TAQA 4X4QA 2V50A 4ANDA 4JV5K 4IR1A 4HTIA 5BREA 9ICVA 4Q45A 4P2FA 2HS3A 3OXGA 2IM1A 1YBTA 4U8VA 1HQUB 1V9PA 2EQYA 4O3QA 1BPDA 3VF4A 2OFGX 2B5JB 3DRSA 1FFGB 2CJAA 5FD1A 1U45A 2MKYA 3SQGA 3H25A 3Q8YA 1PK1A 3O44A 1UKUA 3D68A 1GK8A 4FDFA 2UXBF 4LSNA 4KFBB 4OL8A 2VOPA 1L3SA 4CJEA 1IJFB 2C3YA 5GAEU 3O8MA 2RDJA 1NGCA 3BR8A 3CPEA 3O6WA 3ZEUA 1WJ9A 3F9MA 3VEVA 2I9SA 1K1QA 1DZ5A 5H9EJ 1G3OA 1UOCA 2LQJA 2P9IA 4PAAA 5CZ2A 4FWSA 2H3EB 5HQLA 4LF4J 3DXKA 1IKVA 2DRBA 2UXCJ 3FRYA 2K4IA 3D6TB 2ILYA 1PAEX 1S6QA 9ICGA 1H7XA 1KP6A 3DEEA 2A19A 4WIIA 2KT5A 4X4SA 1HR0F 1DGSA 4CF2A 2R7YA 4X4RA 3AO1A 1I39A 3R1HA 2NZCA 3LAMA 1TZ0A 3FC9A 1VIOA 3MUTP 1J5OB 4DX6A 1R8HA 4E3SA 1Y0HA 2WF6A 4GC7A 2RRNA 3I0SA 4RW6A 4UUXA 3PSPA 1NK8A 2DNHA 1JLFB 4H4KA 4B3SK 2QJ3A 4PQUA 4NXZA 4NA3A 3C0BA 3CJAA 1KWMA 2V9WA 1K0TA 4UATA 5AQQA 5J2QA 4IEEA 2JZ5A 3CCMS 3RUBL 3H5XA 2ZH4A 3MAAB 1NZAA 2JEIA 2F1JA 2AP1A 4L75A 1NOYA 2IJRA 1CC7A 2UXDJ 1X1PA 4FPIA 3OYDA 4J5OA 3ZTPA 4CGFA 3DLEA 4QQBA 4BC4A 1IUJA 2DH9A 4WKRA 2X1GA 4P2XA 2HVHA 4I6WA 5G5HA 3CD5A 5HR7A 4OX9K 4DO9A 2GNKA 2ZE2A 1QSLA 2CFXA 1LNQA 3ULEA 2QL5B 1NCLA 1XC3A 1CQNA 2VFVA 4WQ5A 5AJ3F 3VVTA 2OTLN 5K4LA 1U2FA 1IJJA 4IQXA 3QEPA 2AZ3A 3R5JB 5CZXA 3ENAA 3RB0A 3MUVP 4TUQA 2DF4B 2WB1D 4AF1A 2EFPA 2ASJA 2ZDOA 4YHHJ 4JKFA 1RTIB 4I67A 3H7HB 4FJ9A 2FHMA 1QUVA 1TELA 1KDNA 4CEDA 3KLHB 1XN9A 3MPUB 4DU8A 2QB1A 4X5VA 2FDNA 3KK3B 3A8IA 2B0GA 3R7BB 5J29A 4NO7A 2ASDA 2BPCA 3BS9A 4CIOA 4US8A 3CCZA 5K8OA 5L1JA 4F2SA 4OPJA 2QLWA 1HQUA 3CCQS 2ZD1A 4ZTFA 3MXIA 5KG4A 3RB3A 1SCJB 2DXEA 2FUG9 2W2NP 4ZN3A 4JI7J 3LUYA 2PFQA 5ALRA 2MU2A 2E8AA 4LF1A 2XO7A 1LXJA 2MKJA 3X1LB 1VQON 1V4SA 2WAQD 2E1YA 3NWGA 1UVNA 3M6XA 2Z4PA 1IBLK 3QFWA 3ZD8A 4DQIA 1U26A 1X4HA 2QZ8A 1OSCA 4RQ4A 4BC9A 4BJQA 1UZHA 3KJQB 1M6YA 2M7SA 4H5TA 4DI6A 2BA9A 3LTOA 4KTWA 2NZ4A 2QSFA 4QIFA 4DV5K 3D2WA 1ZTTA 4IQUA 3RH5A 3RBEA 3BQ1A 1XNRJ 4DTMA 4IRCA 3V81B 4I7FA 1PJ7A 2HZAA 3CJBA 2AX0A 3R6GB 3UVJA 3C6AA 4F4KA 1NU0A 1JKHA 4TUSA 1JLGB 3R27A 2DTUA 5E2QA 4V19S 4OJ6A 3GSDA 4K25A 2PI5A 1QTNB 2NLWA 1SXEA 1S1TB 2HGMA 3WKEA 3OL6A 1JI7A 4LT6A 4WQ4C 4DR7K 2W8LA 4OGCA 3ENBA 4PL7A 5GIOA 4I2DA 3VAJA 1YI2S 2X3DA 1AFIA 4C80A 1XTZA 3KD5E 3BM7A 2J0XA 2RHFA 4PQUB 3C2KA 1VSEA 2X74A 2H5IB 3I8BA 3J7YP 1ACMB 5LJVA 4FXVA 1FKPA 2M8DB 4MK8A 1K8AT 2RHKA 3JQKA 3RJHA 5CYJA 4WFNL 4CEFA 3MXJA 4FJJA 4ZCIA 3HM9A 1VJWA 2F8EX 5BPMA 2KXNB 2HOEA 1LKYA 2R8JA 5CWRA 1X3NA 4EAHD 4E1NA 3EPGA 4YXJA 2JC1A 3C6UB 1SPBP 4LRFA 2RE1A 4WFXA 2AJ0A 2OPQB 1KTVA 4IG3B 3CNQP 1EQYA 4XTTA 3LOUA 3D3BJ 1FHTA 2VPZB 5B0EA 4DPWA 3I9ZA 5A76A 4UB6U 3VGSA 2XBPA 5C2FA 5IV4A 3ETMA 3R1LA 3QFPA 4K42A 3D2EB 1LWCA 1S1UB 4O8UA 3CYMA 2J5AA 5BOMA 4NLVA 1R0AB 4DSEA 3DXSX 2YQ1A 2IRYA 9ICWA 1ECWA 4CO4A 4PUOB 3OYKA 4BXOA 3HILA 3CO0P 2M4MA 2M70A 5IXUA 4IDKB 3ZDDA 2G8FA 2AU0A 3CRXA 3M32B 3CF5L 4OLOA 3KLHA 3OS2A 3ZX0A 2LXIA 4DTNA 4OYBA 3E2EA 4O0IA 1R3NA 3KOOA 3VQTA 4Q0BA 3N5FA 4A46A 1D8ZA 4DTRA 1NJZA 1KSPA 5F41A 5DG8A 4A62A 4LRAA 4FF1A 3M5RA 3VPZA 1X2IA 1K9MT 1S1WA 4OHXA 2R8HA 3N7SC 7ICOA 1JCGA 3TUPA 1TYQA 4D3GA 3KJFB 3OA9A 4DV6J 2JL9A 8ICLA 5GINA 1T9YA 3NCQA 5J2MA 1MSWD 3D67A 3MMJA 1WOPA 3IRXA 1S99A 4CBUA 3QFHA 4I1TA 2XM3A 1BPZA 1LW2B 4BG9A 2E66A 2J76E 3UQ2A 1RTZA 5FLXU 5IQQA 2B4VA 1ZC6A 4B1WB 1U2VB 1HNXK 1N33J 3KVGA 1V3RA 1DGKN 2O8CB 1RWXB 2RH3A 3CIMA 3VZHA 3OW2M 2FJ6A 4A48A 4QZBA 1W2BR 5KFCA 3LAKA 2C22A 4O3OA 2YY6A 2ROPA 1WAJA 4JI7F 5KG0A 1X9SA 2Q1NA 4EO6A 1J97A 9ICUA 4JI8K 1R0CB 1KL9A 4FZMA 1U7LA 4DR2F 4WQ4A 4JKGB 5AQFA 1B0XA 3BN4A 4N41A 5AQXA 3VF2A 2XCAA 1FEZA 3P5JA 4FP9A 4E7IA 2J9DA 4NB4A 1VGYA 2BKPA 1RWMB 2XIDA 1N5XA 2CPXA 1J2VA 2Y0SD 2RPIA 4IZ9A 1VQSA 3RRHA 3UR3C 1RT7A 3SBMA 3OTOJ 3QWUA 5GAGP 2HRTA 1O03A 3SQOP 1N5YA 1BQXA 2FSKA 1RT5A 1GX6A 1WF1A 3CW2C 1HX1A 3C2LA 4URGA 1F44A 2XGQA 2VFUA 4M41A 5KGWA 4X4OA 3ZSYA 2HOQA 5A2QU 4J9UE 3TAPA 3U6FA 3SPYA 3GFXA 1Q79A 4UQTA 2JFDA 3LVWA 2OKQA 1XWLA 5HP1A 2VFTA 2GUPA 1O51A 4NLYA 4DL0C 2CQ4A 4PYDA 4EU0A 4PGQA 3SAGA 4DV2F 3VA3A 3WC2A 3ULDA 2BJ1A 4BDZA 3RAQA 2XMUA 1ZQRA 4EYIB 1J2NA 2AMCB 4JS5A 3UXPA 2HF3A 4BR9A 1QH9A 4KHPK 3N4MB 3TAMA 3B0YA 4B02A 3SCIE 1HHQA 2YKPA 4OYMA 2PZSA 1PO6A 1K9MO 2OWOA 4O3PA 1EARA 3H8JA 2CH5A 3MM7A 4EWTA 2Z1HA 1X5TA 1T0TV 4WP3A 4YORA 3H5YA 1QQOA 3AFGA 4DU1A 2V63A 3CPWM 2KNJA 3MD3A 3QT6A 1DGJA 1LWCB 3AJDA 2BVZA 2MEWA 4BQZA 4CM2A 4RNHA 2DEJA 2KRRA 2KD1A 3I9V9 1BL3A 5LOQA 4ZPCA 5KG1A 3F2KA 4CJTA 3AQPA 4ZVTB 3W9IA 4IL6U 1NNEA 2RQ4A 2BCVA 2KIVA 1DBDA 3D66A 8AT1B 5J1EB 2ZM6K 1C4AA 4DV1J 4PWDA 3NGIA 4QNLA 2VJ5A 3K2YA 2WCXA 4B9QA 4JP8A 4CJ4A 2V34A 4RQ2A 4USJC 1Z4OA 5KTQA 1HW9A 3TANA 3DRPA 2PAVA 3PW5A 4MHVA 1KQKA 4NCBA 1RAIB 2DFLA 4HVZA 4WE1A 3OT9A 5LXYA 1VBXA 1QJHA 2ASYA 5IT9Y 1Q3UA 2FHKA 1JROA 1QAXA 1GH8A 1BWEA 2J8SA 3ULEB 1YJNS 1B7YB 4DV2J 2ZBCA 1JRPA 1Q16B 1T95A 3PFOA 4IH6A 1MU2A 3SQ4A 2ZJPQ 1YJ9N 1QQ6A 3QGIA 4CO1A 1UCNA 4KBOA 3GE1A 3NY0A 2AJ4A 3BQ2A 3RFAA 4Q2LA 5F8LA 2JLFA 2FVRA 3O3LA 3ZLJA 1DLOB 1FFWB 2JVRA 2RQCA 2FPLA 5ADZA 1Q86O 1SI9A 1NAQA 2E5LJ 3K1ZA 4M5HA 2X6SA 2FMQA 1S5ZA 4LFBK 2OHDA 5AI8A 1B7FA 2F4VJ 4OI2A 2XZTB 3EGNA 2FVPA 3FGUA 3TVZA 2QW9A 3DMJB 3B4DA 1WKKA 4ZP7A 3IDHA 3ULHA 3CD6N 1A0OB 2ATQA 4BC3A 4OQJA 4BRMA 3QUQA 1BCOA 1VISA 5AXMA 3CJ3A 3TADA 1H0HB 2QX0A 9ICKA 2HHHJ 1XO1A 3CD7A 2DNPA 3C21A 3PEJA 2D3UA 1APSA 1LWXA 3FZ2A 4K0KF 2NZTA 4DCJB 4CHNA 1S1VA 2PYJA 3T19A 4TYAA 5AQOA 2FMPA 3NUQA 3HMJG 4DF8A 2RS8A 1C1CB 2LM4A 3GJRB 4USKA 2BZFA 5DZ6A 3OYJA 3S3MA 5FPMA 5C42A 4F8RA 4OZ5A 5EOZA 2HYIB 2PEBA 4RQMA 3EUB2 3QEWA 4AUKA 2ZIVA 2KIWA 3QJLA 1YITN 3W2VA 3V81A 2MQLA 1FO1A 3MGJA 3R3TA 4P6QA 2V0NA 3KFUF 1RBRA 3U4LA 1HNVA 3MTKA 3RJEA 5IWAF 2BPFA 5DQGA 3UFCX 2GVZB 2IYIA 3ZT0A 3QEBZ 2QLJB 1UWBA 2H3VA 3JSMA 2FC8A 1E6YB 1TVAA 2Z57B 5GADP 2UV8A 4OHVA 3HKWA 1WDTA 4IBNA 1BE4A 3WEEB 3HHKA 4MFAA 1OXJA 2C3OA 2VYPA 1H1VA 1HWLA 2Q97A 3CDWA 3CSKA 4Z6CA 2DHXA 2AEMA 1HIWA 5AKGA 2VUGA 2PN6A 1IBKK 1CZAN 3VQ5A 2JEJA 4R65A 4K4GA 1JLQB 4C97A 1YRTA 2JVOA 3R2DJ 1IM4A 2V4JB 5CR4A 4PWDB 4CZMA 3PNIA 2HURA 2NS1B 4A2BA 4DFDA 2I2YA 2MUTA 3MXMA 3QGGA 3LGNA 1C1BB 3WKBA 3SUPA 4ES2A 3S6JA 4LSLA 3AMZA 1ZBSA 2GVDA 1RP5A 4RZRA 3OLAA 3MAQA 4CD1A 1S10A 1PC4A 2GA7A 1HBMB 2HMXA 1T7PA 4KHWA 3RBDA 2ZC3A 3CJCA 4DTUA 1ZQEA 4GXIA 2D6FC 4NL9C 4L3NA 5GTIU 2IOCA 3W1YC 1IR2A 3GTYX 1MW7A 4DQRA 1RU1A 1S1UA 3CC7S 1N36K 4F67A 3OW2R 3TFSA 4BREA 1NM2A 2ZWPA 2YNFB 3VENA 5LJWA 5AI6A 1EP4A 2CNLB 3OXLA 4PUOA 5KFGA 5AIAA 2FBVA 9ICLA 4RNNA 3TA2A 4XO0A 3PIOL 4RNFA 4M3TA 3UN3A 4QU6A 1KC8T 1U1LA 2IVOA 4KPCA 4LJMA 3QE9Y 1U1RA 1T02A 5ALXA 1X4FA 3PYDA 4MFFA 1FI4A 2ATCB 3BZKA 4LBHA 4ZPAA 2AA4A 1Q53A 4K4XA 4BC5A 5KFAA 2C2ZB 1RWNB 5A8RB 1WWVA 1QVGM 4EP4A 2K7KA 5H9EK 1CLFA 5J2KA 1RABB 4DV3F 1VQKS 2HHUA 3TQEA 3DYAA 5A8KA 2DHAA 4DN0A 1WB9A 4ELVA 3HFKA 8ICNA 2YHYA 4CO2A 2FZKB 2YX1A 2DO0A 4Y6IA 2RQMA 1R8CA 3MDFA 4OJ5A 3Q7BA 3KZXA 1KQFB 2AD9A 3UPQA 3M4XA 3VEYA 3GCWP 4C7YA 4I27A 3LYSA 3VQ8A 3UW1A 1YJRA 1MA9B 3OR1B 1U2VA 4KFBA 1MN9A 2QWNA 3LM2A 4CGHA 3AH6A 1LCUA 1KFTA 5B8HA 2V8DA 2W6KA 8ICIA 1OYDA 3EE9A 1BQNA 2GQCA 3O9QA 1VQPS 4C4TA 3P5BP 3SSQA 1S22A 3J80O 3HVTA 2AW0A 3ONQA 4H0TB 1NHVA 3IG8A 2G0AA 1S9EB 2DNMA 2NRHA 1OVYA 1Z6RA 5J8YC 1M90T 2EC0A 3MR2A 1XUPO 1IKXB 3EWGA 1OS5A 3F5AA 1NSPA 3O1WA 3AXMA 2PEHA 4CZGA 5CZVA 4RQ1A 4UW2A 4ZPWR 2PXIA 1NK9A 2YNIB 4KLLA 5IT4A 3E0FA 3T1YF 3OFEA 3TJAA 2CPRA 4FWNA 3C15A 1RT5B 4UY8T 4U95A 5ITHA 3OVAA 1GNKA 4HI1A 2LLZA 2EANA 4XDCA 2XY6A 2Z1IA 4CP5A 1NEEA 2CUYA 2KJWA 5F0UA 3U9ZA 3OYIA 3DNCA 1WSGA 3PRBA 2V4JA 2V8VA 2FF3B 4RW8B 4ED5A 1LQ9A 4DFMA 2MUTB 1OYEA 2Q3SA 1RDBA 5LJ3Y 4JI4J 2KZMA 1ZPWX 1JCEA 3L5KA 4YDUC 1BC6A 3AAQA 5HJYA 4J2AA 1T05B 4LVSA 1YJUA 3H3NO 1HJOA 4M5JA 2IHNA 4CF0A 4DSJA 2UUTA 3OYAA 9ICFA 4CRJA 3MECB 4DB3A 2D9OA 4A61A 1PYTA 1WN7A 3W7BA 3NG8A 1R43A 5J2NA 4QBUA 4WYWA 4OI6A 1ZBIA 4E19A 1RYSA 2OPPB 4K8XA 3HKZF 4DPXA 2IM3A 1JNRB 3HOSA 4KLFA 2V94A 3WC0A 3BSAA 1YT3A 3QUTA 1AB8A 4KRWA 5E3PA 2Z2ZA 3AD8C 4V19X 2ZTCA 4YG2A 1HPMA 4C0BA 4ILGB 3TTFA 3DRPB 4MYUA 4AILC 1S3XA 2F40A 4NCAA 4QWBA 4WE1B 3PKMA 2C1EB 4HHTA 3AVJA 4LF9K 3MM6B 3OS1A 4FYYB 1Z1BA 2GAGC 4DL6A 2DVIA 5B0CA 2DBBA 7ICNA 3RJFA 1JLAB 5C5JA 5KFYA 4U67Q 3CDAA 4A47A 3I5AA 3I5BA 4GFJA 2R7UA 3LQVA 4YXMA 1RT3B 2K4PA 2IRXA 3MR7A 3V6KA 4Y65A 2RLTA 4FF3A 3IWLA 1EX4A 4CHPA 4UB5A 2I6XA 1TKXB 3O6QA 2E1MC 1NNLA 4YFUA 4NLGA 2P9IB 2P6RA 3VHQA 2CH6A 3IWNC 2MA1A 1U1OA 4QAGA 2M0NA 4LFAJ 1IG8A 3DXKB 4YR0A 5BR8K 4FO0A 2CQBA 2P5VA 1WSJA 1U1PA 3JXUA 4URQU 3IWXA 3C5FA 1K44A 3A8YA 3K58A 1BHNA 3M8WA 3KLIB 2A0FB 3CG7A 1VSFA 1WG8A 2K2PA 5BRDA 1RWPB 2EXUA 3SV4A 3KD1E 1U2CA 1KW4A 4PZNA 4OD0A 2EFGA 4ZPTR 3I0SB 1FKOB 2EDUA 2R7SA 1IBKJ 5DB9A 2KI2A 3K8WA 5KFJA 4CK3A 2W8KA 2ALZA 4CM0A 4DXLA 4DR2K 3HBTA 3R8EA 1ZAWA 4DG1B 3UCUP 2ITMA 4LF9J 5L39A 4IDHA 2VOOA 2ZJQQ 1KVBA 3VR1A 4CYUA 2IIRA 3OHBA 4W5TA 2YWKA 4H4OB 3ZXWA 3EL2A 4N56A 3ILJA 1BUXA 1ZBLA 2E2PA 3F44A 3DLEB 4H0YB 3L7PA 3M6GA 1ZJMA 4OHYA 3EZ5A 1PG5B 3A5OC 4JV1A 1QSSA 2N4DA 2PMZD 2J6TA 3SZ2A 2HNZA 1B3TA 2HBRB 2A3VA 5J0XA 2XSJA 5K9FA 3IV6A 3W8PA 3CMAS 3CE8A 1XNSA 4NM2A 4Q7AA 3G86A 2YKMA 2GUIA 4ZLNA 4I9LA 3EE8A 2K1RB 3TPQA 3RRGA 5F8MA 2MQPA 2RIJA 2JRSA 3LPUA 2DHHA 4ES1A 1RTIA 3FZBA 4BR2A 4LF5K 3GFKB 2BQ3A 2A42A 4FYDA 2R2RA 4H5WA 4M9NA 3NVVA 1CJTB 3LPEA 1Z25A 4CFCA 3S9HA 3KOAA 3LW5C 4DUZK 4F0KA 1AFJA 4KLSA 5CHIA 4B1YB 3BGFA 5KFSA 1MLAA 4MKBA 4LSLB 5BPCA 1RHQB 3GV5B 4RLEA 5AM2A 2DR9A 5GAHI 2GVDB 1ZQGA 2WONA 3O3GA 3CCUS 1Y5LB 1YF5L 3A0BU 1FTRA 3UD5A 1ZD3A 1G4CA 4J2EA 3CDUA 2GC8A 3U7JA 4QW8A 1LFWA 4B3SF 3PKYA 1DY3A 3KWMA 4M9JA 2Q4TA 2QWQA 1RJJA 1NGGA 4NXMK 3SEIA 2BABA 3PJ9A 2ODGA 1M90O 1BY9A 1NKBA 5HLFA 3A8JA 4P4MA 4F4ZA 2J4RA 4AQYJ 2APOA 3AVMA 4IFYA 1V5IB 4KGZB 2OD6A 4MMOA 2DPNA 5I3UB 3KZBA 3SK3A 5GMKa 3GDXA 7AT1B 2MKKA 4Y34A 4ZPDA 3W63A 2DHGA 1T03A 1WTBA 2KV2A 1LW2A 1U1NA 5ADXH 3UXOA 4O9MA 2AJQA 2BOAA 4QZEA 1IG9A 1QDUB 4JS4A 4U96A 4Y2JA 3WNEA 4M2YA 4H4KC 4OJGA 4CLPA 1IV8A 3LVVA 1OIAA 1UWAA 3G6VA 2BUPA 3CXCM 3I0RA 4I2HA 1VLYA 3UVJB 1HD1A 4IKAA 2Q3PA 9ICIA 4PABA 3HSTB 3CJ4A 1O6XA 4R66A 3HHLD 4Z4GA 3K2PA 4EBDA 3ZTRA 3AA8A 3T1AA 4B3OA 7ICSA 3UDCA 4BR7A 4NOHA 5HK4A 3M8QB 3MTJA 5A8KB 3VEXA 4B3TJ 4ZCMA 1IM6A 2H4YB 3VOVA 2PMZC 1UT5A 2XMTA 5CABA 2QB0A 1N34K 4FVCA 4LRBA 3QUCA 4JI0F 2EAMA 1X66A 3S6EA 2ZTEA 2I0XA 9ATCB 3HT3A 5B0FA 4PXCA 1RT7B 2XS7A 4Y2IA 2GIFA 2RT3A 2E88A 2HMIA 5F9NA 1UP1A 1QCKA 4F4WA 1BQMA 4BROA 3E3XA 4ICLB 4I2EA 1QM9A 2CJKA 3ISZA 1HQ2A 3K59A 2A1AA 2OEMA 3GR0A 4QOTA 1UEUA 2OPQA 5A6PA 2VICA 4PXBA 4I2AA 5IM0B 2HNZB 1YHQS 4NRUA 3G8SA 3IUCA 4ZVOB 1JXVA 3N9UC 4DV5J 4QZIA 3QT7A 2E6MA 5L1MA 5KAKA 2EG1A 4WYBA 2WVBA 5EE1A 3FEZA 1HBNA 2AYEA 2J0QD 3Q83A 4MFBB 4O3NA 2IBOA 1CXUA 1WC0A 2EZZA 3MFHA 2QL9B 5ETTA 3SFGA 4OO1J 2ROEA 2D9PA 3UMBA 1KVJA 3T5HA 2CQGA 1XHXA 1R8PA 3HVRA 1HQEA 4JKDA 2DK2A 2VKQA 5KFXA 5KI6A 3P6YC 1CJTA 1U4BA 1BISA 2XSFA 2EFVA 2PMHA 5T7BA 5L1IA 3BJYA 4RBTA 4B1ZA 3N01A 2E29A 2QEXN 3QMQA 1VK8A 2R7OA 3GSIA 4DSLA 1XHZA 1OH5A 1RWKB 3AEVA 1F2HA 5TISU 3HM8A 3RJKA 3PXGa 2QL7B 4LFCJ 2CQPA 3P8BB 1CXQA 4GVBA 3CC7N 1RHMB 2GJIA 5M1PA 3RAXA 1HUOA 2LU1A 4GKJF 3DOMA 2P9GA 2YJFA 2WF8A 2DTJA 4IH7A 2GIQA 1DRZA 3UN2A 4EEKA 1PCAA 3ZTSA 2HAFA 4CZJA 2W25A 4PZOA 2P1JA 4P4PA 1N2XA 1L3TA 2DISA 4E1MA 3TAEA 2NXCA 1CJVB 3K89A 4F5RA 1X9JA 3JPQA 2Z56B 3KD3A 3IP0A 2UXCF 1K1SA 3POTA 2VODA 4OJRA 5AQVA 2CQ2A 2ZIXA 4F5PA 1DTQA 1MN7A 1FRIA 4Q2MA 2VJUA 4ZHRA 2UU9K 2BDPA 1RSCA 1DK3A 1RWUA 4BY9C 3WT0A 1ZM4A 4CIEA 3CCSS 4O55A 3EY1A 4Y2YA 4NLRA 2FZCB 4ZJQA 4FOEA 2DFEA 1URRA 2EWHA 2O8EA 1QHAA 3I31A 2V51B 4B3OB 1OUQA 3M8QA 1M1KT 4YOWA 3THPA 5HL7Q 4J9PA 4DUYK 2E1RA 3J80Y 1VQ6S 5L8RC 1KD1O 1OMSA 1FDDA 2E1FA 3HKZC 2CJXB 1ZOTA 1P6TA 1N5YB 4P74A 4HHHA 2BKOA 4E2FB 5BR8J 4K59A 4EK2A 1EQMA 3CF5Q 1YVFA 2Q6CA 4Y2QA 3EXCX 2FLNA 4H5NA 5F8JA 1TKXA 1X5PA 4DN9A 2X3GA 3GMGA 3V7KA 1TKZB 3HHNB 1QE1B 1H74A 3LH2S 3NF6A 2BM1A 5T41A 4YCXA 1D8LA 2LU2A 1RDDA 1RXWA 1OH7A 3E1YA 2COLA 3EDQB 3AV9A 4YOUA 1J2MA 2E3TA 2B3TB 2G8VA 1HBOA 1DHMA 5DGBA 5IM0A 2B0CA 3R7SB 2VWKA 3MC1A 3DN9A 5DM7Q 1HNIB 4LF6K 2V5HG 3ZT2A 5DZ7A 1KQGB 3MOZA 1F5SA 2W55A 2D1KA 2UU9J 4FJHA 2QV6A 3C16A 5KT7A 2O6KA 3T41A 1DRGA 2H9ZA 1WOOA 2OO4A 3D1OA 2GQQA 4K4IA 3SQ0A 4F5NA 4ZVFA 1NK7A 4K4UA 3JSMB 3FBFA 1X9XA 5M1FA 3G2XA 2LSNA 2ESEA 2L9DA 2HQGA 3WEEA 2QARB 4Z2XA 7FD1A 3MEDB 3FSXA 4M47A 4B1XB 1ZQOA 5C2DA 3O1LA 3K9KA 1QQ7A 5F9LA 2QRRA 2BQRA 4KLDA 3HX0A 1EAYC 1WHWA 4LJXA 1MWZA 2MHEA 1D8YA 1N48A 1KR4A 2HS4A 5JMVA 4DV7F 5DDPC 2PIIA 5DBCA 1KBUA 5IILA 3EVMA 4PKIA 3IDWA 4PHTX 1Q3VA 3THYA 4DR6K 3QXGA 4CT9A 1Q4RA 1PVQA 3H2UB 2MY7A 2DQNB 4M5NA 5IIJA 3CJKA 1WDDA 2WFAA 2YHBA 3K0JA 3M6KA 3BO4A 4DPTA 2DY1A 5ALYA 2EKYA 2B4JA 4KN7A 1F5AA 4QR2A 4LFBF 4KHUA 1EKEA 4DUYF 1OW5A 1OKJA 2H5XA 5HVGA 2AJ2A 3OL8A 2BYCA 1NDCA 2GMHA 2L41A 4BGAA 2DGUA 3VAHA 1JIHA 3Q8LA 4B3TF 3QO9A 4CK2A 4M3RA 1KC8O 1WWHA 1HWIA 2E6LA 2WTUA 3OYEA 3F0NA 4FN5A 4M8LA 2FDRA 4OX9F 2V52B 4BWJA 4PXDA 4M94A 2Z8QA 4MDAA 5AQRA 4J90A 1EB0A 3HZEA 3G0ZA 3TR5A 2XHWA 4Y2VA 3TWHA 3EXYA 3LA0A 3ENOA 4HH0A 2RU3A 1N34F 3VQ4A 4NL5A 4WFYA 2B5JA 3TUIC 2AHOB 3O4QA 1GLDG 4ECQA 3DLLL 1RAAB 1FJGJ 1J9AA 3QGPA 4OGEA 1NHKL 1YBAA 1EKSA 2EFNA 4N47A 2YKNB 1ZBTA 1B22A 8ICQA 2YXLA 3QESA 4X62F 2Q1LA 3KJNB 4AQYF 2IIHA 5KPRA 4EENA 1WSFA 2UYTA 5AICA 3HFZB 4QWCA 2ASLA 4JV2A 7ICVA 4USHA 2FSNA 2W42A 2DNZA 4RQ3A 1JCFA 3CMEN 3C2MA 3C19A 4NZ0A 4TUPA 4OYZA 2BH1A 3B6BA 4GO5X 2OTLS 3LP0B 7ICKA 4FBUA 3U8XA 4R79A 2I1QA 5CH7B 4IO9L 2F2AB 3THWA 1XJWB 3E9OA 1X8DA 5AXKA 4JI2F 2JJ4D 5CD4H 5AKZA 1SL0A 1BD6A 4HT7A 1RTJA 2WBMA 3ZT1A 4YP3A 4B1UB 5J0YA 1S6QB 3JTNA 4A8XA 1BI4A 3AAPA 1BQNB 3JAMY 2XYGB 4J9RA 4JKBA 4X66F 2XZDB 1RCXB 4K2XA 1S9EA 3G6ES 3LPYA 5D4LA 2YQ3A 1FRKA 1UMJA 1SIZA 1GEHA 3QWPA 2KVCA 3D6FB 2FHOB 3O3FA 2HFUA 3TABA 1WBBA 4BR0A 4L8RB 4QS8A 5JVGQ 2KHCA 3M30B 2UXDK 8ICWA 2C2MB 2GQ2A 3UR0A 5SWMA 3M8PA 3H20A 1AW0A 1WC3A 2POKA 4A5AA 1BA1A 5GADU 4FLTA 1BQMB 4J7CA 3M9MB 4I2QA 4ZCKA 4DR3J 1O13A 2FMSA 2FD2A 4FNIA 2KOBA 3U9DA 3QEIA 5BYQA 4X2BA 1AQ6A 4CH0S 2BQUA 1ED1A 2J7UA 3PSFA 5ALSA 2WFBA 4FS2A 1LXNA 5AI0A 3MR6A 1RG6A 2KK0A 5AKIA 2BANB 2DNLA 3EMTA 1RADB 2FBYA 1FRXA 2XHCA 4Y00A 4JI1F 3W64A 3BQ0A 3PUFA 5KFNA 3DRRA 3ZSZA 1NZPA 2M0GB 2AGOA 2KJ8A 1FD2A 3ISCA 4KHPJ 1KBRA 4BRNA 1RQLA 1ZQQA 1H2UX 2A1JA 2B6AA 1G1XA 1NK6A 3PW4A 1WBDA 4ZPVR 4I2BA 3Q0AA 3I56S 4C1NI 1HNWF 1C1AA 4WK1A 4R5PB 1TFYA 3W0LA 2CAJA 4P0PB 2FIUA 3Q23A 4UB3A 2E1ZA 1ASWA 1A7GE 4LFAF 4KLUA 4I28A 1V9OA 2VQEK 4ZP9A 4LC9B 2NXUA 3FZLA 1OPZA 4BR4A 3T6JA 1VQ9N 1T3QA 3J7ZO 4B6JA 1VSKA 4UAZA 1P1LA 5JU5A 4QYZK 4QZCA 4XDDA 3ZC4A 3UKRB 7ICJA 3GIRA 1C0MA 3DLRA 1KLMB 2EFQA 3QQCD 1JWWA 1FNOA 3EICA 3ZT3A 4CT8A 1RILA 1E6VB 5CEHA 4QIWC 5JVHL 4PHEA 2MLXA 3IS9A 1D0EA 3CM6A 2U2FA 5HROA 3SIPB 2KTQA 4HUGA 1YAGA 1S7IA 5A2QY 2R42A 4KHMA 4ZLJA 3NXZA 5BR8F 3VQCA 4JWMA 4G1PA 2PDAA 1FXLA 3J7ZT 1NB2A 3N4WA 2EC2A 3KBBA 1RWWB 1P8ZA 3CQ8A 1A0PA 2CQCA 3T1HK 2CVEA 3SQIA 3THWB 2E9TA 4XH4A 4BVOA 3HOTA 1Q5YA 2B8PA 1FERA 2FJDB 5FJ4A 1UVMA 8ICKA 4YB6A 5AK6A 1IKYA 2DGWA 3OYHA 4F71A 1REVB 3ONNA 2MQ8A 3DM2B 1J5EF 1S5LU 2K4HA 2V7YA 4BR5A 3WXMB 1D5AA 4O3SA 1Y88A 2B9XA 3CDEA 1MROA 1NPRA 2UUCJ 4WTOB 3NRBA 4C8ZA 2KMDA 2EWSA 2CQ3A 4JYAJ 2UU9F 2W9AA 1WTFA 5K5MA 3U02A 4BRPA 2BJDA 3A8EA 3BN7A 4BUGA 4WCEL 3QNNA 2UXCK 2L48A 4IG0B 2ZM6J 4CFDA 1YJTA 4A2AA 4HCBA 4AHUA 1FKOA 3NGSA 5CHGA 2HFOA 4X64F 5J2IA 3ISNC 5ALTA 3QZ7A 1QE1A 4RW8A 3ZNUA 5DLGA 1SC4B 2F96A 1NLVA 3IBFB 4C0ZA 1DFDA 4DR6F 3C6UA 1RA7A 2GO9A 2IVNA 4O0JA 1IR1A 3BS7A 1KKXA 1KQQA 3ZSWA 4WXOA 3B6OA 4LIWA 1VBZA 1NSQA 5EGYA 2QKQA 3BO3A 2M9KA 4ZMMA 4IOCQ 2FC0A 4YHHK 4RNOA 3EZWA 5ALIA 3BS5B 4JKAA 4IWVA 3LZIA 1WCNA 3NAEA 2ATLA 1CJKB 1I6JA 4J9VA 3N7PD 1N32K 4UB2A 2MJNA 3NNHA 2D3OR 3CGIA 1L8LA 3AVGA 1RAJA 1RGIA 5LL6d 3W61A 2BMBA 4X65J 5JXSA 3LDNA 3WKDA 2ZHAA 5ALOA 3BSNA 5KT5A 2NPFA 4UOGA 1S9FA 3AA2A 2ZUCA 5ALKA 5CYMB 2C2NA 3HHLC 3WXKA 1UW4A 2F1IA 4P0PA 2G07A 4FPAA 3AN1A 3T69A 4M04A 2J0SD 1J54A 2ZQBA 1G6BA 1EQ0A 4MK7A 4R8UB 3C28A 2V9KA 4EHTA 4NLDA 1NO8A 2QC3A 5E84A 3GE9A 1LK5A 3TJ9A 2P9KA 4KLIA 1KLMA 2KFYA 4CJKA 4U8YA 5AZJA 4RX6A 4AYBD 2DEIA 2OSRA 2WZ1A 3G82A 2HBQB 1TK8A 5ETPA 1T94A 2E5HA 1VQLS 1JUDA 2E8MA 1S72N 3ED5A 1N63A 3MCPA 1Z00B 2FYXA 3VESA 5GAEP 3F41A 4YQWA 3LWMA 3WDOA 3GDQA 2CQDA 4M45A 2P6UA 1A5WA 3KLGB 2XMKA 5HBMA 3HXMA 1MG7A 3TEHB 1ZQYA 1SH2A 3QBXA 4BDYA 2QMXA 3OGUA 4B9UA 1PILA 3IFEA 1N60A 3O8WA 1EJ7L 2HBYB 1Q7LB 2W40A 3M1YA 2ZVSA 4X66K 2CNNB 4PJ0U 3AGRA 5JLHA 5IWAJ 2JZBA 1VDVA 2W54A 2EW9A 3DM2A 1WC1A 4ZP6A 2B4OA 3MM5B 2KVSA 3V1QA 3Q8SB 4DJBA 1H72C 4ZVSB 4ED6A 1UPPA 5F8GA 3G25A 5LXRA 2G06A 3O4NA 2CZ4A 4RBUA 3D6RA 4PH5A 4ISGA 4DV0F 3AOBA 1Z4UA 1Q86T 1RNHA 4UY85 3I4PA 2XY7A 3EGVA 4M9GA 3PLAA 3MAHA 4JI4F 1V3SA 1NMNA 4CO0A 2W24A 3OYCA 2FB0A 4G1QA 1Z05A 2JH7A 4GMJB 3QETA 3NVKA 3PYEA 3QIPA 2XLIA 1W25A 1U8SA 3THVA 3UO0A 3O80A 4H5VA 4KH6A 1FEHA 4R64A 1RAFB 3AJ1A 1KQSR 4N7TA 4H4OA 3NE6A 2Q31A 3MN6A 2R7QA 1K73O 3D45A 1N34J 2E5IA 4C0HA 4JLHA 1VC5A 4FM0A 1X5OA 4NMLA 4GMKA 4YFKA 3C8YA 2J6SA 5BXIA 9ICMA 8ICCA 4WWSA 4RBVA 1XK8A 2KT3A 4IC9A 1Z1ZA 5J0RA 1HLWA 5AHXA 2CNKB 4PR6A 1XEZA 2R2UA 1JLEA 4A57A 5BN9A 2XWYA 1IKWA 4DUZF 3CJ0A 4DEZA 1WSEA 3MMAB 8ICEA 4I56A 3MM9B 1NJWA 4JI3K 4CGZA 8ICSA 3CD6S 1Q8KA 3JTPA 3DWLA 4CH7A 2HNYA 1R59O 4X4VA 9ICCA 4YN3B 5BRFA 5BYSA 2FPHX 5A8WA 2R7VA 4NPOA 3VEWA 3MFIA 2H54B 3PEHA 2FY1A 3E8OA 3KKAC 4OYOA 2VA2A 3EKSA 2UUWA 3R9KA 1FXXA 4PGYA 5HN0A 5BR9A 4FZYA 3R9PA 4CNZA 3IGNA 1BUPA 1TVRA 4KGXB 1R8BA 1RKJA 2PFUA 2NRXA 1ROFA 1ZQLA 1X6JA 4PZVA 4OI4A 2VG7A 4I2JA 1JJ2R 4Y1CA 3ITHB 1RBVA 9ICTA 2HK3A 3J81O 1NGJA 2XEXA 1H2VZ 5J0PA 3M6VA 4GXJA 5AQPA 3K8VA 2VG5A 2AWZA 1SC3B 3QEAZ 4RW4B 4Q8EA 2ZD1B 4L3KA 3HKZD 2W2QP 4JI6J 4J9SA 4JEPA 1RKIA 1VQNN 3NH0A 1KFDA 2GO8A 4E0DA 3JXOA 4M6WA 3PJXA 3B4MA 1F9FA 1DLOA 1U24A 2GFFA 3NAIA 4CLFA 5AI5A 5J2FA 2X7IA 2BGGA 5D8HB 2ZXIA 5AKYA 3VQ9A 3KG4A 2ZJRL 2KZ3A 4KTQA 5HBMB 1WLJA 4MF8A 1RK8A 4KX3A 3MPVA 3ET6B 5GADI 3WK6A 2ZIWA 2ZJAA 5AI4A 4EZ6A 2LA6A 4Q43A 3K5NA 1O8BA 5ALVA 2XQCA 1J53A 1WEXA 1YDLA 2IOFK 1SV4A 1Q81O 2KKVA 2DH7A 1CC8A 1U49A 3RWUA 3CJQA 3C7NA 1KN6A 4UB4A 1MWKA 2YB1A 4LVOP 2OTJN 4Y2UA 5GMEA 3N4PA 1A5VA 3CCEN 1DQ9A 3NS6A 2L3MA 1BNOA 4EYHB 3GILA 4ZIVA 5B7WA 4DOAA 3GIJA 1NU4A 4OV6A 4U7UD 2KFZA 1SKRA 3TVYA 1QHTA 2FE9A 1B0PA 3VQ7A 2AJ1A 1K5OA 4ZITA 5DQIA 3PSTA 1M0SA 4WXWA 3E9LA 2A2DA 2CQ1A 2IDLA 1ZQSA 2QLBB 2XI2A 1C0UB 1HBUB 1XNQF 2F1FA 5LSOA 1GAOA 3G10A 3NMRA 4FLVA 2ROGA 3ETRA 1TP7A 2E5LK 5C10A 5KT4A 5IT0A 2RE2A 3H42A 2PMZF 1WC5A 5M1QA 1XMOF 4JK1A 3ASMA 4K4TA 1U1KA 1REVA 2HWIA 3SCKE 3DCAA 4GV3A 3M6UA 3D0GE 1IIPA 1L3UA 9ICXA 1IKVB 2RS2A 2UVWA 4FS1A 3CCLS 2XNQA 2YHAA 2YNHB 3L2RA 5ALFA 4HHJA 7ICUA 3QRPA 4RPZA 1WUUA 5F2RA 2J9CA 3B6PA 4NXNK 4ZIWA 2HCFA 3UM9A 3HTVA 1F2GA 3MMAA 1X6IA 1DTTA 1CVJA 3OL7A 3W5YA 1IQTA 1RQNA 2ZHOA 4NLKA 4JI6K 3UDVA 2KKHA 1NWKA 3UNGC 3K4GA 4FZLA 2CZVC 1Y7PA 4NY8A 1VQ4S 4JRQA 3GPAA 2ZZMA 3H59A 3CJ7A 3RSEA 4W5RA 5CD4A 3FFIA 4E8UA 3V4IB 3RJMB 5FROA 3M2UB 3BGLA 4DR1K 1YRXA 4FM2A 1LW0B 4C2MA 2UP1A 2GLEA 2L08A 5A0YB 1EETB 4DCPB 4DOBA 4ZCLA 4K7QA 2VG5B 3IP4B 2GOLA 4RW4A 5CA7A 3LPTA 1XR6A 4URSA 4DR3K 1EO1A 2EG2A 5C24A 1W2BM 2I7PA 4CZEA 2BRKA 3NGZA 1IWGA 3R5BA 5B08A 4Y0FA 4WU2A 1VHIA 3BF3A 3A5MC 4DCHA 1RBOB 1VR6A 2ZIXB 3WNGA 1MMDA 2VFSA 4ZHRB 4XH1A 2JLEA 1VQ9S 2HQ3A 1KKHA 1N4LA 4HKQA 2G5HB 4LBPA 5K8PA 4CFAA 2NSCA 4DV5F 1FFUA 2P9NA 4NXMF 4Z37A 4JUZA 2V8GA 3JPRA 3TSPA 4AL6A 2D0OA 1JMSA 3RB4A 1CS4B 2GW8A 4HEA9 2VIHA 4EX7A 3D0PA 4YY3J 1X4BA 2QKKA 3QU5A 4J8FA 3V9ZA 1XQIA 5CHCB 1C4CA 4HHUA 4IS7A 5DS7A 2VJ4A 3TVKA 5GAHU 4OPKA 4QZVB 4MEXA 2K60A 1FNMA 5K8MA 1FIQA 3KYLA 4H0VB 3LK9A 3V7JA 3OR1A 3NBPB 4O4RA 3DOLA 4FVUA 1HBUA 2QT7A 2AXTU 3BP8A 2C2OB 2RRAA 3H1QA 5D4OA 4E98A 4AD6A 2H3FA 2MZSA 1NNDA 2KG0A 3GYNA 2G1HA 4LF7J 5FDLB 4MIAA 5HJXA 3VF6A 3MGHA 2CQHA 3CCRN 1HBOB 2AGQA 4Q44A 3SDEA 2CNOB 2MZ1A 2RVJA 2NRZA 1FE4A 2W9BA 1U2RA 3AY9A 3NOGA 3J81j 2CJBA 3SCLE 3KDOA 2X1BA 2UUBF 1RHRB 1T4GA 1NSAA 3L7OA 4KHYA 9ICJA 4GKKF 4EMDA 5B0DA 4WFZA 3PV8A 4NZ6A 2LMIA 1YJ7A 3F2DA 3CERA 2ZIUB 4JI2K 1JK9B 5ALNA 1JLCA 4PL8A 3MI7X 2JHEA 3W8GA 2VQEF 4AM6A 2B9WA 1BMQB 1YTYA 4CGDA 4LF8J 4FLWA 3M30A 3CCMN 2FSJA 3WIUA 4DHYA 2J0WA 2LKYA 3MCMA 3HSJA 3T5JA 1WEZA 1GXUA 3H46O 2BCSA 4K4HA 4DU3A 1L7OA 4BRCA 4LF7K 5AQTA 5D0EA 1IQZA 4RUAA 5AK3A 2FBXA 4TU7A 3V6DB 4I0WA 4PG5A 5K14A 2DITA 2HFNA 5J2PA 1LKYB 2MGZA 5ETOA 4B3MF 1QQMA 4J9KA 2LYBA 3BBFA 3QEXA 4ELTA 3WQPA 3SQ2A 5AKXA 4HDGA 2EAPA 1KVKA 4WU3A 3CJKB 4A5BA 3AARA 2HDOA 2VH7A 1N5WA 3MCSA 1I3OB 3CC2S 4CIGA 1H2TZ 5U47A 3HPGA 1TKTA 3QLHB 1UW9A 2E4LA 1KDHA 3X3UA 2HNYB 3KWGA 5A8WB 3CB4A 1TL5A 3IRWP 4NYZA 1VQ8N 1KVCA 3BH6B 4DL3A 4CJLA 2EBEA 3GFYA 8ICHA 3FSIA 4BXOB 1BLUA 1X60A 2WC9A 3L8BA 2F5GA 1TVRB 3QAEA 1TE2A 2XMWA 3CCVS 3HRDD 4EEYA 1YVNA 4AL7A 4DSKA 2OYYA 2KHDA 2UUAF 3AU2A 2YWHA 1SAZA 5J0WA 3JQMA 2UXDF 5EDWA 3O4WA 3CCQN 4BWMA 3PM9A 3S01A 4LF7F 1ZD2P 4PGXA 2B6GA 2XYHB 1WAFA 1X9MA 2H5EA 3MM8A 1OY6A 3QZ8A 4J37A 4C3MA 2YHWA 5DBBA 4TSXA 3IG1B 5AT1B 3P4IA 1VQOS 1TYQB 1PUZA 2HBJA 4B9SA 2NYIA 4OLPA 2JC0A 3R6MA 2I5JA 4K8ZA 9ICQA 4LFCK 2J7KA 1E6VA 5ETVA 4F26A 1RLDA 4WTYA 1KEJA 3UWTA 2O67A 2NR0A 3FJ2A 1NGDA 2CZ9A 3PSIA 4QIWD 1SKSA 1B0VA 3V7LA