3PX0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and dctp-da mismatch (tautomer) in closed conformation
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
579
structure length
557
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 190
structure length 557
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px0A01
5KFMA 3L2RA 3L2UA 1TFRA 3GILA 2PI5A 4DSJA 4UB5A 2XY6A 4R65A 4CGGA 4Z4CA 4Z4IA 4QZAA 3RJHA 1B22A 4DSIA 4MF2A 5CA7A 1XC9A 2DTUA 3RR8A 1WNSA 1JLCA 1CZBA 4Z4GA 4OKEA 2AQ0A 5HRPA 4E7HA 1S1UA 4NY8A 3T5LA 2X6NA 3NHGA 4FBTA 4HVJA 4H8KA 4FLUA 4DTNA 2P6UA 2ITGA 2PZSA 3RH5A 2F1HA 3DYAA 4I2AA 4M9HA 3K75D 4C8OA 4HYKA 4MQ3A 3QNNA 2OZSA 1RDDA 1Q9YA 3LWLA 4RT3A 5SZTA 2DPJA 2IDOA 5HRSA 2RDIA 2PFPA 2YKMA 3KLFA 2DFFA 4KLJA 2J6SA 8ICCA 5TZVA 7ICSA 3CM6A 1KLNA 3KK3A 4KTWA 2ZTCA 5D49A 1KSPA 4CJPA 2JZBA 4F5NA 2PI4A 4KO0A 4GC6A 4O3SA 2XHBA 1NK6A 4QZEA 1A5VA 3V6DA 1YTUA 4M04A 4YR3A 3V7JA 1ZQWA 4KHNA 4ECZA 5HP4A 3TAPA 3NF8A 4B8CA 3UQ0A 4RW8A 4J2EA 3MR6A 1HYVA 4DL5A 3JPRA 4J9QA 2XY7A 2AGQA 4ED2A 4UAYA 1HQEA 4E7IA 3BDPA 3C2MA 4F2RA 2V4QA 4FLZA 4XIUA 2W8LA 4CF8A 4MEXA 4C8LA 4IQWA 4GMJB 4IQTA 5KT5A 4PA1A 4EP4A 3MABA 3C95A 2QXFA 4F2SA 3N4MB 2ZUBA 4BGDA 2BPFA 8ICYA 4JWNA 5DK5A 3U6FA 5KFWA 3DI6A 4Q5VA 1NOMA 1U47A 4CECA 4EZ6A 2ATQA 4EYIB 4CERA 7ICFA 3UXOA 1DOQA 2XY8A 7ICPA 2E4LA 3C6TA 3DLKA 5KFGA 3JYTA 4KLIA 4N76A 3QZ8A 3VQ9A 3MR5A 2RN2A 2JEIA 3ZT2A 4B9NA 1ZBLA 1EX4A 3H8SA 1N48A 7ICLA 5KG2A 1KFDA 1V9PA 4DTUA 2W8KA 3K5OA 1IKYA 1ITGA 3L2VA 4FJIA 4RQ3A 1JLBA 4J9RA 5DG8A 3NE6A 1JX4A 5EWEA 8ICRA 1UT8A 5I3UA 2GWSA 9ICXA 3NTUA 5J0WA 3ZT1A 3T1AA 1K6YA 3OYIA 3MFHA 3SJJA 4FJJA 3DLEA 3GDXA 1JN3A 4CHQA 4PUOA 3ZDAA 4ZH4A 2IHNA 1BQMA 1ASVA 4ED8A 1ZJMA 4CEDA 4PPXA 4FLXA 7ICUA 5CYQA 4FJLA 5KG1A 3AVFA 3RAXA 5EOZA 2MUTA 2O4IA 3JPPA 4RQ4A 2DY4A 4DQQA 2VA2A 2C2RA 1ZQSA 2JLEA 5J2DA 2ZE2A 3PR4A 2ZD1A 1Q8IA 4QWEA 1X2IA 3KJVA 3SV3A 3PV8A 1ZQVA 4PGXA 5J0YA 2FC0A 5KFZA 2HMIA 4FM1A 1S9EA 2HB5A 4BXOB 3TAEA 1QS4A 1S97A 4B9SA 9ICGA 3AA5X 4YR0A 8ICBA 5FRMA 3ISBA 5DDMA 3ETLA 4Z4EA 2OPQA 3CFRA 2E6MA 3ORYA 5SWMA 4KLGA 1JXEA 3RWUA 3QLHA 3IAYA 1A5XA 3RMAA 4RQ1A 2OPSA 3RB3A 3IS9A 3HP9A 1WSJA 3O4QA 5KFIA 4OKJA 9ICEA 4M2YA 3NAEA 3OYNA 4ZTJA 4AHTA 4RG8A 8ICUA 3ISCA 3EPGA 3RBEA 3EPIA 1DGSA 1TV6A 1TL1A 5CR0A 3V1QA 1BL3A 2XO7A 4DS5A 3AUOA 5KFSA 4DL7A 2PYLA 2D0AA 3SUNA 4RQ8A 4BDZA 4O3QA 3MEDA 5EWGA 2QK9A 3GQCA 5F9LA 4ED3A 3H8JA 5KG6A 9ICUA 4F5RA 4HUGA 1A76A 5DMRA 5J2KA 3V1OA 3M8PA 3GIKA 4KTZA 4KLLA 4MFBA 4CEAA 3HK2A 1NOYA 2BGWA 8ICSA 2OWOA 4W5OA 1NJWA 3P1GA 1VSIA 4XQ8A 4UB2A 4F5QA 3VQDA 5DQHA 5J29A 4MFAA 2PXIA 4ICLA 1AROP 3MXIA 3RH4A 5J2GA 4E3SA 2BQ3A 1NKEA 3AVHA 3MXJA 3O4NA 4RW7A 1J54A 4F50A 2VG7A 5J2CA 3NGDA 2ALZA 1EXQA 2XCAA 1DTQA 1KRPA 2UVVA 4CCHA 4OLBA 4MEYA 3O3GA 4ECVA 3K5NA 3WNHA 1BPYA 2BQUA 4FS2A 3L8BA 4DL6A 4F5OA 4KLQA 3UXNA 8ICAA 3E01A 2P1JA 4M9JA 1BPBA 5BOMA 1G15A 1MU2A 3NBPA 4UBBA 3Q8RB 2PFNA 2JZBB 4Q43A 3ZSQA 2IS3A 4AILC 2B5JA 4AHSA 1S77D 5KFUA 2FBXA 5KFTA 1ZQQA 4RPZA 4KLEA 1JIHA 4YMMA 3TARA 1RDAA 1ZQYA 3QEVA 1RT1A 4W5RA 1S1TA 2X78A 4YCXA 3JPQA 2ASLA 3PX6A 2UVUA 4FJ5A 3AVIA 2BE2A 2GUIA 3FDSA 4F4KA 2RF2A 1XWLA 4ECSA 2HHVA 1XHZA 5DBCA 4KMUA 3RTVA 1GOBA 1S0VA 3DOKA 3WNFA 4DTPA 4KPYA 3ZSWA 9ICMA 3OYFA 1C0MA 5HMLA 1HRHA 1LW0A 1BQNA 4I9LA 2HVHA 4RQ5A 2XC9A 7ICHA 3MECA 4Y1CA 1LW2A 8ICGA 4CIFA 8ICNA 4FK4A 4RT2A 5DB7A 4RQ2A 3RJFA 2W9BB 8ICQA 4DQIA 4KLTA 4NM2A 3M9NB 4I9QA 3C5FA 4FJHA 3EW9A 1ZBHA 1RXVA 4FLWA 3Q8SB 2YNGA 2BCRA 3OVNA 4Z0UA 2NRWA 3S3MA 3HPGA 3HL8A 2F1IA 3AVBA 5KFXA 3RB6A 4F92B 4CJSA 4FJKA 3SZ2A 4JS5A 1BCOA 2ZTEA 4R8UA 5KRSA 4HHTA 3TANA 1RT7A 4CJFA 4ECQA 5C24A 3C1YA 8ICZA 3P5JA 3L2WA 4FCYA 1YT3A 4I27A 2AGOA 1XHXA 3T5JA 1VSKA 3T19A 2BKEA 4OJRA 2R8KA 4OVLA 4C8MA 2J6UA 4DTMA 4CFDA 4KN4A 4DFKA 2OA8A 3VN5A 5KFPA 4YFKA 3MR3A 1U45A 2D5RA 3V1RA 4QAGA 2ATLA 3ISNC 5KFNA 7ICOA 3AA3A 3Q8QB 3V9UA 2MAXA 3IM1A 1TAQA 1VRTA 2G8KA 1VSDA 4ECRA 3TWHA 4KITB 4J2DA 4QWCA 3KD1E 4KI6A 4LH5A 2RKIA 3NFAA 5KFEA 2AJQA 5L9XA 2BHNA 1KFTA 2A1JA 2F1JA 4I2BA 3ITHA 4YXJA 2G8WA 1I39A 1ZQDA 4OKKA 1RCHA 1S1WA 4RQ6A 1NJYA 5KT6A 3EWAA 1C1CA 5CZ2A 3AA2A 3PX0A 4KLMA 4CESA 5KFBA 3RJGA 2NRZA 4R5PA 5KFLA 3M8RA 1RDBA 4F3OA 4LZDA 3G10A 2KZ3A 7ICEA 4FLTA 1J9AA 4BE2A 3T5KA 1GOAA 3OYCA 3SYZA 4ECWA 5C5JA 2P6RA 4YD1A 5DQIA 1C0UA 2B4JA 1UOCA 2VWKA 4CEFA 1BHLA 3RMCA 4O5KA 1BI4A 2UVRA 3MAQA 3CQ8A 4NLKA 4ECYA 4FO6A 4FZYA 1SL2A 2IHMA 1ASWA 1HNIA 1RT6A 4EEYA 1D5AA 4HCCA 1RBSA 1TAUA 3M9OB 1ZQJA 1JXBA 1RBUA 4W5TA 4QCLA 1X9MA 1NOZA 1W9HA 1ZQIA 3NDKA 1ZBFA 4F8RA 4RNNA 1U49A 5HHIA 2DFEA 8ICLA 1KCFA 1WSFA 1LAWA 3EYZA 1RBRA 3QERA 1YVUA 3AVNA 3AU2A 1YTAA 3KK1A 2GBZA 5HBMA 4FZXC 4ED0A 4DS4A 4H4MA 2BCVA 1S10A 1N5YA 4F3TA 3UPQA 9ICJA 4J9PA 3PMLA 7ICJA 1HYZA 4DF8A 4O9MA 2QKBA 4PY5A 4M3ZA 4YNQA 4MFFA 3C2KA 1K1QA 3MBYA 4DQSA 4CF0A 2VG5A 3B6PA 9ICFA 3LDAA 5J2QA 4FVMA 1XI1A 2EX3A 3PMNA 4J9NA 3KLHA 1VSLA 4CGFA 1UA0A 4KAZA 3AVGA 4O55A 3HYFA 2G8UA 3H7IA 2G8FA 2ZUDA 1ZETA 1I3AA 3ZDCA 1JXLA 4J9KA 3AO1A 4F4WA 5IIJA 4M3XA 1A5WA 4TUQA 2HVIA 4N56A 4K4IA 3V6HA 1NJZA 1S9GA 1U9LA 2OPPA 3UXPA 1DLOA 1HYSA 4O3PA 1QLNA 2Q3SA 1TKTA 1NK5A 4DTXA 3RJKA 1CEZA 1DTTA 1VSJA 1NKCA 2M9NA 4P4PA 4CIEA 1FKOA 1NK9A 5KGWA 3PUFA 4NXZA 1CZ9A 2KFNA 1WAJA 5KG4A 1WCLA 4AHVA 8ICOA 5BOLA 2A1JB 4Q8FA 1RPLA 3OHBA 1ZQEA 2VA3A 3MEGA 2YNIA 5EWFA 4L8RB 4OLAA 4K4GA 3OJUA 5J2FA 1S6PA 4N41A 3QINA 3OYJA 1TV9A 4CJVA 4KB0A 5J0OA 1QSLA 3KK2A 3KLGA 4DO9A 3VQBA 2R8IA 4JRQA 3V7LA 4IRDA 1HNVA 1Z00B 1QTMA 1JLQA 1NKBA 4EZ9A 7ICRA 1RBTA 8ICIA 4DTRA 4ELTA 3KHGA 1IXRA 4CF2A 4RPXA 4W5NA 1A77A 1RYRA 2IAJA 2HHUA 4K8ZA 4DQPA 4M0AA 4QWBA 2F8SA 1R0AA 2R7YA 4QZ9A 4KLHA 4XRHA 3ZSOA 3NGZA 4NCAA 3ZDDA 2W9CB 2Z1GA 4IG3A 4QZCA 5KFKA 2FBYA 4IFVA 4MF8A 3ULDA 3OSPA 5HNKA 5DLFA 4E0DA 2BR0A 3OSNA 3DMJA 4RZRA 1VK0A 3VA0A 2XY5A 4FXDA 1WN7A 4DL2A 1S0OA 1ZBUA 2BPGA 1MSWD 4JRPA 4KLUA 2X6SA 3RAQA 1C6VA 3RB4A 2FLLA 4YQWA 4DSFA 3C23A 4O0JA 3QE9Y 3S3OA 2W9AA 2KFZA 1L3VA 3AA4A 2B6AA 3S3NA 4CJLA 4DFMA 1B9DA 2XRIA 4CEBA 3L3VA 7ICGA 4CK1A 4CJ3A 1BPEA 4E7LA 2HHSA 4M6WA 4RQ7A 4RU9A 4CF1A 4JK1A 4BE0A 3OYKA 3QEIA 4CE9A 4Z4FA 3G6YA 3OS0A 4O4GA 4F4XA 2R8HA 2BDPA 2YNHA 2V9WA 1ZQXA 1EETA 3LP3A 2C22A 4GC7A 2YHAA 1N56A 1C1BA 4J9SA 5HRNA 4ID5A 7ICIA 1ASUA 2AU0A 3SUOA 1ZQTA 3CM5A 4KHYA 4LZGA 4KLDA 3PW5A 4M9GA 4AHRA 4DG1A 5HP1A 1T4GA 4QWAA 1ZQUA 3GIJA 7ICMA 2C2DA 3QEBZ 4DTSA 2YKNA 9ICSA 1S5JA 4GLXA 3V81A 3RR7A 4RW4A 4I29A 1L3SA 4GVMA 3M8QA 3QEXA 2RDJA 5KFVA 1NK7A 4TURA 4JV1A 9ICKA 4IR9A 4PWDA 3Q8PB 1HUOA 2FBVA 1QSYA 3LP1A 1ZQFA 3DRRA 1TK0A 4KKOA 4UB4A 5DGBA 1MQ3A 3V9XA 4CHNA 8ICMA 4QW9A 3PR5B 3KIOA 3AVKA 3V72A 3NGIA 3JPSA 2PFOA 4F93B 2I5JA 4FJXA 1PZNA 5J0PA 5JS2A 1SL1A 5E41A 3LAMA 4M3YA 1WLJA 4BDPA 3VQEA 1Q9XA 4CJ4A 4YG2A 1VSFA 3HX0A 1RZTA 5J2MA 4R8UB 3V6KA 4AHUA 2ZQBA 1QSSA 4CF9A 2IBKA 3JSMA 2WOMA 1IO2A 5D4BA 4QZFA 4JWMA 4M45A 2FMSA 1TKDA 4QZIA 1QE1A 5CB1A 4TUPA 4TUSA 1ZJNA 3TABA 4NLNA 2WONA 1JL2A 4Q0BA 5D3GA 2BANA 3HW8A 5K14A 3L2QA 1S0MA 2IA6A 2DFHA 3THVA 2JGUA 3MDCA 5C42A 2DPIA 3P83D 3C21A 3FYHA 4B9TA 1TK8A 1K1SA 5KFFA 4F91B 4CJQA 5EU7A 3ZD8A 5KFHA 5KG0A 1IM4A 5DGAA 3QIOA 4M41A 4CJTA 2BCQA 4J9MA 4I2QA 1SKSA 4ECXA 1ZQNA 4E89A 1T3NA 5DB6A 4I2EA 4G3IA 3F9KA 2RPIA 4Z4HA 2KN7A 3RJEA 3LANA 3AVCA 2I1QA 3VQ4A 1WSEA 1C1AA 3V6JA 5J2PA 1ZQBA 9ICBA 1WSHA 3HM9A 1RT4A 4GXJA 2HNYA 1TK5A 3TR8A 1J5OA 5DBAA 3HSTB 4ECTA 2WTFA 3B6OA 4N47A 4IRKA 4MFCA 3PY8A 4RW9A 4KHWA 2VG6A 4HUFA 1ZQGA 4CEOA 2HHQA 4DLGA 4FYDA 5DLGA 1JKHA 4O5BA 1NK0A 1RBVA 4Z6EA 4FJGA 1Z00A 1WSGA 4I2HA 3WNGA 3PW2A 3IG1A 3SI8A 2XGPA 2FPLA 1COOA 1D9DA 3AVAA 3D45A 2IOCA 3PW0A 4I2CA 3TFSA 3Q8LA 4KLSA 2R8GA 3NCIA 3RMBA 1BVSA 3MFIA 3NF7A 4W5QA 1KDHA 4KFBA 3RMDA 5J2NA 3IRXA 4K8XA 1Z3EB 4M3UA 1T7PA 3V7KA 4RW6A 4PGQA 1KLMA 3TAMA 1ZQLA 4B9VA 5J2JA 5DB8A 4OGEA 2UVWA 3RRGA 4LH4A 5L1KA 2R8JA 4BWMA 3LZIA 4KRFA 3V9ZA 5KRTA 2E6LA 3HJFA 3QEWA 5KFAA 1TL3A 5HROA 4UAZA 4QOZB 1LWFA 1BPDA 1O1WA 2KTQA 3VQCA 1LWCA 4M9LA 3MEEA 4CGDA 9ICLA 1XS9D 3K2PA 1S6QA 3SUPA 3C6UA 3DRPA 5KT7A 2DFLA 3H08A 1GOCA 9ICHA 3RJJA 3OYLA 5FRNA 3OYHA 2ASDA 5HRRA 3C5GA 1W0HA 2ASJA 4RUAA 1RT2A 3ZD9A 1UWBA 3B0YA 2FLNA 3SPZA 1KTQA 1KFSA 4EP5A 1RTHA 3SPYA 4FBUA 5IILA 3DLRA 2H5XA 5HHHA 4FJ7A 4O3OA 2P5OA 3ZT0A 4E7KA 3D0PA 2Y1IA 1BPZA 4IQUA 4P4MA 4BXOA 2KZMA 4BACA 1XO1A 3K5LA 2FBTA 3PX4A 3Q8KA 3KHHA 1BPXA 1D9FA 3EY1A 4YVZA 4LD0A 2O4GA 2Z1JA 8ICHA 3N97B 4DFPA 5KI6A 3V4IA 4FJ8A 1QHTA 4ED7A 5J0XA 1QQCA 3BQTA 2B21A 4ED6A 3RB0A 1S1VA 5J2AA 1U48A 1JLEA 1N6QA 4TQSA 1MC8A 1CUKA 4PHAA 4NLGA 3RBDA 3GIMA 3UIQA 3AVLA 4PQUA 4K4HA 1CXUA 3HVRA 4FK0A 7ICKA 1ZYQA 2GV9A 4YR2A 3KTQA 3KLIA 1LWEA 3LPTA 4CJ5A 2D0BA 3LP2A 2ISOA 3VQQA 4YD2A 4FJNA 3BGRA 4C8NA 4DSEA 1KVCA 3O3HA 3TAFA 5DG9A 4DSLA 8ICEA 4FW2A 4CJEA 3OYGA 4FM2A 4I7FA 3T5HA 3SQ0A 3SQ2A 4CEQA 3JPOA 4M3TA 4ELVA 5KFCA 3VA3A 3ZDBA 4DF4A 2NUBA 3ISDA 5J0UA 4B9LA 3NH1A 3DLHA 4OGCA 3QEAZ 4NM1A 3GIIA 3DM2A 4FW1A 1KVBA 5DG7A 4I2IA 5KG3A 2OPRA 4QZ8A 3TQ1A 3MGHA 1Z26A 1UA1A 3AV9A 2QKKA 1ZQOA 3OGUA 2F96A 4I2GA 3QETA 1NK8A 1X1PA 3C94A 9ICTA 3G6XA 4EBEA 2BQRA 2W42A 1RT5A 9ICVA 4E1MA 1U4BA 4QW8A 4IDKA 3K5MA 4M3WA 4M42A 3I0RA 1IKVA 4DU3A 4KV8A 3ZT3A 4XUSA 2BCUA 2ETJA 3EZ5A 1L3TA 1KEJA 9ICNA 5JUMA 1FXXA 3E2EA 2A1RA 4CGJA 4KLOA 1CXQA 1XSPA 5J2IA 1ZQKA 4YXMA 4HTUA 3HXMA 8ICJA 7ICVA 4DOCA 3RH6A 3DLGA 4EBDA 3TAGA 3KHLA 3KKSA 4CJUA 1ZQRA 1TVAA 4KTQA 3SUQA 3OYMA 1VSHA 4TSXA 1TKZA 4O44A 4KN7A 3MR2A 3HVTA 1U04A 4RNOA 2VA8A 4EYHB 4FM0A 1RTDA 3H4BA 1D8YA 1BCMA 4HCBA 4LVSA 8ICFA 3VQPA 2XCPA 5IIIA 3C1ZA 1ZQMA 2KW4A 4LSNA 4I28A 3H8WA 2BGGA 4CHYA 2HNZA 2HNDA 4DL3A 1HUZA 4IG0A 4RUCA 3WNEA 4M3RA 3LZJA 2G8IA 2JEFA 1FK9A 2MUTB 5KFYA 1HPZA 1RTJA 2OZMA 4ELUA 2G8VA 5KG5A 1NK4A 4CK2A 3GFKB 2IGIA 1VSEA 4YMOA 4B9MA 3VQAA 3V9SA 1TGOA 4IKFA 1RYSA 5L1IA 4AH9A 5FROA 3U3YA 4DU4A 2Z1HA 4CGIA 8ICTA 4IR1A 1F21A 4NYNA 2PYJA 3KD5E 4O5CA 5CP2A 1T03A 3KHRA 4Z6DA 1EP4A 1RNHA 1ZQPA 8ICWA 1SUQA 4CK3A 3OY9A 3K57A 3VQ7A 4DLEA 4E1NA 1Z25A 5CJ7A 5KFJA 3JPNA 5HLFA 2JEGA 3BQ0A 1NJXA 4N5SA 4KHSA 5IIMA 2EHGA 4QZGA 5DB9A 5JS1A 5DKWA 4I2DA 2V4RA 3AVMA 4CHZA 2ISPA 4DL4A 1SKRA 3LALA 4F4YA 4ECUA 3LAKA 1HJPA 4O3NA 4CHOA 3UQ2A 4LY7A 3BQ2A 4M6WB 1LAVA 3KLEA 1B92A 4FLYA 3H40A 3RRHA 4B3OA 4ED1A 3K58A 3FFIA 4NLZA 5J2HA 4B9UA 4M9NA 4Q45A 4KI4A 2W9BA 1RXWA 4NCBA 3F73A 3GV5B 4JLHA 4BWJA 1T8EA 3OHAA 4FK2A 2PFQA 3QZ7A 2FMPA 1LV5A 5CWRA 4DOAA 3BJYA 3TFRA 4O0IA 3ZDEA 3AVJA 2J6TA 4RQ0A 5D46A 3HPOA 2OYQA 2FPMA 3T3FA 1ZQZA 3IHQB 4Q44A 4UAWA 4I2JA 3LDSA 4KREA 4QZBA 3Q8MA 3ZSVA 2C2EA 3JPTA 3ASMA 4DSKA 1EXNA 4J2AA 4WE1A 3MXMA 4PHEA 1BIZA 1SV5A 1X9WA 5KT2A 4CEZA 1HQUA 2XGQA 9ICOA 1UAXA 2HHWA 3QNOA 2W9MA 4IFYA 1S9FA 2NRVA 8ICKA 2FLPA 3AO5A 4C8KA 5KT3A 3O3FA 4R64A 3RJIA 3QO9A 3MGIA 4IBNA 3K4GA 3CYMA 8ICXA 9ICQA 4UB3A 3AU6A 2YHBA 2LYHA 4CFBA 4Z6CA 3K59A 2ZUCA 4GXIA 3LP0A 1Y97A 3KKRA 8ICVA 3CG7A 3B0XA 1VRUA 5KT4A 4IQVA 4PHDA 4AHCA 3OS1A 3HPHA 9ICWA 3DOLA 3PNCA 4J2BA 1IKXA 9ICIA 1SKWA 1SL0A 1BIUA 4Y1DA 4KHUA 1X9SA 3SI6A 4JV2A 3SV4A 5HMMA 4P4OA 1S76D 1ZBIA 5T7BA 3NF6A 1IG9A 4CFCA 3H4DA 7ICQA 1C7YA 2AQ4A 4KB1A 4JV0A 4ZTFA 3NF9A 3TI0A 3M9MB 4J9OA 4GXKA 1BISA 2LSNA 4QZHA 2JEJA 2G8HA 3ALYA 1REVA 5KGXA 3G0ZA 4F4ZA 3VQ6A 3QESA 4LSLA 1HMVA 4YP3A 1TVRA 5BPCA 3SCXA 1EKEA 2ZJAA 4JUZA 9ICPA 4X5VA 2ZJ8A 3I0SA 9ICAA 4CJKA 5J1EA 1FKPA 3PO4A 3HO1A 3I8DA 3G6VA 1IKWA 4DOBA 2YNFA 1RTIA 3PVXA 1RILA 1TKXA 3SQ1A 1BI4B 2AGPA 3NGYA 4H4OA 4P2HA 4XA5A 4UQGA 4CJRA 4NYFA 4QWDA 4GW6A 5I42A 2Q0ZX 4G1QA 5CYMA 3A2FA 4HUEA 3CFOA 4E7JA 4O5EA 5KTQA 4TQRA 5CHGA 5DQGA 4PH5A 4I2PA 3PW4A 3V9WA 4FS1A 3OYEA 4YFUA 3GV8B 1T05A 1SZPA 4CIGA 1KVAA 4EBCA 3NH0A 2Y1JA 1UT5A 4I2FA 1XSNA 5J0RA 3AO4A 2P66A 3PO5A 1D8LA 3GV7B 4OPJA 4UB1A 4B08A 4B8AB 2IMWP 1CLQA 4BDYA 5IIOA 9ICCA 1B9FA 5L1JA 1S1XA 3OYBA 5KFDA 2ZJ5A 3M8SA 4J9LA 4PHPA 5DDYA 4KHQA 3MDAA 3AO3A 5IINA 5KG7A 4QZDA 5J2EA 9ICRA 3QIPA 3ZSYA 1WCNA 4Q8EA 2KQ2A 4YMNA 2VWJA 2F8TA 7ICNA 1Y88A 4DTJA 3LWMA 3ZT4A 3LK9A 4CEEA 3CFPA 5FDLA 4DMNA 3OS2A 4JS4A 1JL1A 5L1LA 1LB2B 1IH7A 2ZTDA 5KFOA 3HWTA 5CZ1A 7ICTA 3OJSA 4FJMA 5J2BA 5KFQA 4CJWA 3OYDA 2HW3A 3ZCMA 4FZZA 4RNMA 3TAQA 4DU1A 4UBCA 1WAFA 4PGYA 4FJ9A 4R63A 3SQ4A 2NRXA 4FLVA 1JLAA 3ZSXA 4RPYA 2VANA 4YN4A 5DBBA 1HJRA 4OPKA 1H38A 2I9GA 3SNNA 2PY5A 5KFRA 3OYAA 2FPKA 3PW7A 4DWIA 4CGHA 3LPUA 3DLBA 1BGXT 4CFAA 2YV0X 3QEPA 1S0NA 1L5UA 3BQ1A 3NH2A 2A1SA 3HT3A 4E19A 1VSMA 3ZSZA 1C0TA 1JLGA 4ID1A 1RDCA 3S9HA 2KZZA 2IC3A 1XU4A 1JLFA 3VQ5A 2BCSA 1WSIA 3DRSA 3AO2A 4O3RA 1JMSA 3U3GA 5F9NA 1ZQAA 4R66A 2BPCA 5J0QA 3ZSRA 1ZQHA 4CHPA 4KLFA 1J53A 5C25A 2HHTA 2P5GA 2FMQA 3C2LA 4NCGA 4ZHRA 5J0SA 8ICPA 2NRTA 2HHXA 4Z6FA 2X74A 3VQ8A 4IRCA 3L3UA 5CY4A 1ZQCA 1B43A 5IIKA 4F5PA 4DTOA 1MQ2A 4DEZA 4DQRA 1RT3A 2W9CA 3HP6A 2D0CA 2P51A 4BE1A 5J0TA 1XSLA 2Z1IA 2C28A 4DFJA 4M47A 1L3UA
chains in the Genus database with same CATH superfamily
3R1XA 3L2RA 2DGSA 3L2UA 3IR7B 2VQEK 1VHXA 3ENHA 4NEZA 4WP3A 3VERA 1IR2A 2QFIA 1RWWB 1ACMB 1H98A 4Z4CA 5CE3A 4Z4IA 2R7SA 3RJHA 2FE9A 4DSIA 2RD5C 4KT0C 4C9DA 3KK1B 1CZBA 1HW9A 4Z4GA 3KOOA 2YXLA 3QLHB 4OKEA 4NV0A 1EX8A 3B6BA 3I82A 1D8ZA 2W7OA 4HVJA 1X40A 3RH5A 5LM7E 3FCHA 3F2BA 2BJ7A 1ZA1B 3L4IA 1V3RA 1Z1ZA 4CBXA 2PFPA 1N32F 2MKKA 1Y3JA 4KLJA 2ROGA 2J6SA 4M1KA 8ICCA 5TZVA 2QLJB 7ICSA 1Q95G 2FB0A 3CM6A 2ZBIA 3NGKA 2ZIVB 4KTWA 2ZTCA 5AQYA 1I51B 3FBFA 1R6VA 3EEQA 2JZBA 2WVDA 1ZM3A 5H1SQ 4O3SA 1PAEX 1R8CA 1NK6A 1VRQC 5IQ6A 2LMIA 3SCKE 3TKAA 3EXYA 2A1BA 4U7UK 5B08A 1YTUA 4YR3A 3MM8A 4M7XA 3HHKA 4LSZB 4ECZA 5HP4A 3TAPA 4B8CA 3UQ0A 4RW8A 3FAHA 1SVDA 5G5GA 5EX5A 2E7XA 1BQNB 3W8GA 3L7PA 2XY7A 1SIZA 1U1QA 3MX5A 1L8OA 1HQEA 1HJOA 2XTJP 4FWKA 3BDPA 3ZZPA 3UM9A 5KPZA 4E7IA 4FLZA 4CF8A 4J91A 3VAMA 2I8EA 3AMZA 4WWSA 1VMBA 4L74A 3W5YA 3W0LA 2ZWOA 1HBNA 2ZUBA 4BGDA 4DV2J 5KFWA 4Q5VA 3PRBA 1ZM2A 2HIQA 1XNSA 5JXSA 1L7NA 4B1WB 2XY8A 4BGAA 4CO2A 1DBDA 4DV4K 3HSZA 1GMVA 2DD8S 5AJ3J 3QZ8A 4JI3J 1QUVA 5FPEA 3P6YC 2JFDA 3ZT2A 2VBZA 4BR0A 3HHDA 3MZIA 1EX4A 3T6JA 5KG2A 1V9PA 3PYGA 3I56N 1OW5A 3F5EA 3M30A 1RG6A 2W41A 4FJIA 1HX1A 3TX0A 3NE6A 3HD1A 1JX4A 3AA8A 2KHOA 2EWHA 4WZMA 2C2ZB 2GWSA 3UR0A 5E2QA 4DR4J 1K6YA 3MFHA 4BGBA 3T1HJ 2W2MP 4Z2XA 2KG5A 4UOHA 3HT0A 3GDXA 4PUOA 3ZDAA 2IHNA 1IV0A 2L3MA 2P2CB 1BQMA 1ASVA 3PG9A 4K43A 1F1BB 3MECB 2DGOA 1ZJMA 4LT6A 4CEDA 7ICUA 3BKFA 4DR7F 5CYQA 3DMJB 4BC3A 2ZJRL 4I67A 1LK5A 1B7FA 3NCPA 4AQYK 2PMZD 3M2RA 4PWUA 2ZE2A 4QU7A 1Q8IA 4DR1K 4OX9J 1C0FA 2FC0A 2EFOA 3CJ1A 4URSA 2FVRA 4TU7A 1JLEB 3SQGB 3UKRA 1T9TA 1LWCB 3ICLA 2A40A 3ULEA 4UAUA 3AGKA 4LF9K 3AA5X 1YI2S 1SH3A 2E5GA 2XS2A 1RWMB 4NPOA 5FRMA 1EKSA 3A0IX 2BBEA 5B0GA 5DDMA 2APOA 3J7YI 2JLFA 3QJJA 5SWMA 4NYZA 3QLHA 5GAGP 3RMAA 4HWIA 2OPSA 3RB3A 3MCMA 4JKGA 3IR6B 3HP9A 9ICEA 4OJGA 1S6UA 4XEIA 1N5SA 8ICUA 3ISCA 4KB7A 3L4PA 1DGSA 3E01B 2OJ3A 1BL3A 1FE0A 1ZBTA 1U2VB 2PYLA 2D0AA 1U8SA 1O0PA 3E8OA 3MM6B 4WPAA 2D3UA 2NR0A 4O44B 4QIVA 5EWGA 2IVMA 4H0TB 2V7YA 4DR2J 5B5EU 3CCLS 3GQCA 5M1PA 4ED3A 2N3OA 3I9V9 3CC7N 1S59A 5DMRA 4IS7A 5J2KA 2JV3A 4FWSA 1WF0A 2PFFB 4KLLA 3SK3A 1XC3A 3GYGA 3HDSA 4X65K 4F5QA 5DQHA 4ICLA 3THYA 2VU5A 3RH4A 4ETZA 1IBLK 3AVHA 4M94A 3O4NA 3IG5A 1RQ0A 2JRZA 3AQPA 3TU5A 3AD8C 1HNXF 4P0PB 2Q31A 3THWA 4KPCA 2ALZA 5ETPA 2XCAA 2JFKA 4OHZA 4K59A 4KRWA 3TADA 4GO5X 4JP8A 3N4PA 3O3GA 3M1VA 4J5OA 4QYZJ 1K73O 2BQUA 5EE0A 1CULA 3O4WA 2V6AA 5KPRA 4F5OA 2FLOA 3O5TB 2EQYA 4FF2A 2IRXA 1BPBA 2YNFB 1FJGF 2IM1A 4Y2SA 5AQUA 1LKYA 3NEKA 1U09A 4UBBA 3Q8RB 2ILZA 3ETRA 2HQFA 2PFNA 2FDNA 3CC2N 2Q6CA 3DGPB 5IT4A 4EIAA 5KFUA 3CCJS 4FXVA 3S7RA 1LVHA 1FERA 2GIRA 3GMGA 1HYSB 4OL8A 4YMMA 2MPUA 3FBEA 1MROB 1YK9A 1RDAA 4YOTA 2CPZA 1RT1A 1RAEB 3M8PB 1S1TA 2ASLA 3C2PA 1QQNA 4P7TA 4F4KA 2RF2A 5M1QA 1XWLA 2YX1A 2DNKA 1CJTA 4Y2VA 2Q3PA 3RTVA 2LDIA 5JVHQ 1FRXA 4DJBA 1S6OA 4KPYA 2GWJA 5B0FA 2GQCA 3O9TA 3QT5A 2HVHA 1WHYA 3RRKA 1YVNA 1RT5B 3NKYA 2KRBA 5E3PA 1XQSC 4QIFA 2GGPA 8ICNA 4FK4A 4RT2A 3DC2A 2W9BB 4KLTA 2ZBRA 2ASOA 2M0NA 3GIRA 2W43A 5AQFA 2JMGA 4OZ0A 1NMDA 1DJ0A 3H25A 5DS7A 2LQBA 4DR7J 2DGQA 1M1HA 2NRWA 3AVBA 2V94A 1VQ7S 4F92B 4LF6F 3NGSA 1RYUA 2HQ3A 3TANA 1RT7A 5GADP 2NNWA 2HRYA 1KBRA 3H5SA 4CJFA 1FFUA 2F8LA 4CM2A 5C24A 4KH4A 4U8YA 2HURA 3T5JA 5H9FK 4OJRA 2R8KA 2FPHX 4CM0A 4C8MA 5IV3A 1KQFB 1N34J 2J6UA 4B3RJ 2BOPA 4KN4A 3VC8A 4DFKA 2EZZA 4JI2K 2CDRB 3NCQA 2D6FC 4UY8O 3VN5A 2GX9A 2PFDA 2LP4A 2CRLA 5AKKA 3KNAA 2DNOA 2F4VF 2NCKL 1A9NB 4GKJF 1KHWA 2F8MA 3ISNC 4B9QA 4GIBA 4JI4K 4YOWA 1IBMK 4UTGA 3EZUA 2C2NA 4KGMA 2K8BB 2PMWA 1VRTA 1HHSA 3DOLB 1VSDA 2HDOA 4ECRA 5HJYA 4KITB 4J2DA 4H4MB 4LH5A 1QCKA 5KFEA 1SB3C 2C1EB 2BHNA 3E1YA 1GAOA 1KFTA 4DV0K 1ZQDA 1RCHA 1NJYA 5BPMA 1HNWF 5KT6A 1APSA 2HSEB 2R2SA 4KLMA 4ZITA 1T6CA 1PILA 1YDLA 4C1NI 4DR2F 3TJ9A 2NRZA 5ALLA 2RSQA 2HVZA 4RJVA 2KZ3A 4BE2A 1QZ5A 1BHNA 2EFGA 3OYCA 4ECWA 3G25A 2MQQA 4DR1F 3RU0A 4MH8A 2AEMA 3ZFVA 1BHLA 2P9CA 2ZOMA 3RMCA 2KM8C 4LF7J 2GVDA 4ECYA 3OLBA 3MTJA 2KRRA 2YJFA 5ETMA 4W5TA 4QCLA 1X9MA 1S9GB 4HHUA 1NOZA 1ZQIA 4RW9B 3J80Y 4RNNA 4LFCK 4JI2J 3L09A 3VVUA 3KHYA 4L76A 4CZFA 1Q81T 4FFDA 3BO3A 5HBMA 2D3OR 4FZXC 1F0XA 4ED0A 4KH0B 3LUYA 3LDNA 5IZHA 3GONA 4R0JA 5C2CA 2D0OA 3ULEB 2BJDA 2ROEA 3LGNA 3ZI4A 1X3NA 3PJXA 4DF8A 1S1WB 3FZKA 2QX0A 4OJ5A 4YNQA 1PJ5A 4NO7A 2HRUA 5D3GB 4BR2A 4NCGB 1X4CA 1UL3A 3LDAA 3A8IA 2X1BA 2F7VA 5J2QA 2EX3A 3SAFA 3PMNA 1SGGA 1VSLA 4G9ZA 2MSSA 3D2WA 1UA0A 2RAQA 3C15B 3LDPA 3CMAN 1SS6A 2HQIA 2G8FA 1NBWA 1VQ8N 4DL0C 1O51A 3GZFA 3FZ2A 4AXIA 1FIQA 5DZ7A 5LOQA 3BSOA 5AXLA 4F4WA 3BO4A 4CF4A 2HMIB 5CYJA 1SQEA 2LCWA 1A5WA 2DGZA 4OHXA 3NNHA 4K4IA 4DV7F 2P9SB 3DRPB 3RW7A 4MYUA 3UXPA 2O8DA 1Y5NB 4WQ4A 4O3PA 1NGBA 2DCUB 1QLNA 2Q3SA 1NGIA 1NK5A 3HOTA 3JQMA 4EX7A 1CEZA 2UU9K 2LU2A 1ATRA 1TYQA 4CIEA 1NK9A 5AQWA 2CQHA 1RHMB 3KNGA 3CWJA 2KFNA 4W92B 1WCLA 1N5YB 4X4TA 3THPA 4HKQA 4CLPA 4JKEA 1WBBA 4Q8FA 1RPLA 2Z8QA 2VA3A 1J27A 4MJKA 2ZH8A 1K8AT 3ISZA 2I7PA 5EWFA 1XNRJ 4NWIA 3AFGA 2EAPA 4NXMK 2YVSA 4N41A 1SB6A 3QINA 4ZCIA 2NRHA 3ATVA 2GGPB 3CW2C 2ZDOA 5DM6L 4JI5J 2RUSA 3HSDA 3KK2A 3BEXA 3KXDA 1M5PC 2V7ZA 1ZXIA 3E9PA 5ETOA 4F3QA 3I55N 1VGYA 1R8AA 1P9YA 4P74A 3BSAA 3HX9A 3VQBA 2R8IA 3V7LA 4GV3A 4IRDA 1TR0A 4EGLA 5HMXA 2XM3A 1C0GA 4GKJK 4LBIA 1GLFO 4EX6A 4DTRA 5A2QY 3KHGA 4OPAA 1U0HA 3NXZA 4F36A 4W5NA 1RYRA 2CH6A 1N60A 5CRXA 3GB0A 3ILOA 3MMCB 5BN9A 2I0XA 4KLHA 2C2MB 4XRHA 3CIMA 2XS5A 3TZYA 3V2UC 3FJ2A 2OMOA 2OEMA 4IG3A 2Z1GA 5KFKA 2XULA 4RWXA 4IFVA 5ETSA 3ULDA 3OSPA 5HNKA 5DLFA 2RT3A 1ZD2P 1V38A 3PSPA 4RZRA 3H5XA 1I94F 2XY5A 3U1NA 3TVYA 3M05A 4WF9Q 4M5MA 3QUCA 2JX2A 5LSRA 5EVZA 1S0OA 2P9PB 3RAQA 1C6VA 2FLLA 1H3DA 3S3OA 1GTEA 2WFBA 4MK7A 3DGVA 2J0WA 4YOUA 3J81j 4K7QA 3MXHP 3SBGA 3L3VA 4CK1A 2JH1A 3O6WA 4E7LA 3VQSA 3OHRA 2YH0A 4BVPA 1NI3A 2F40A 4N8OA 1ZTTA 4RQ7A 2CPJA 3NCRA 4CF1A 2MJNA 4JK1A 3PIPQ 5DM7L 1L7PA 3HBTA 2ZIUB 3ZLJA 2LKYA 1N32J 2VIXA 2BDPA 2V9WA 1ZQXA 1FXLA 2WC9A 3LP3A 5AKGA 4OLOA 3LM9A 4I0WA 4MAKA 1TP7A 4S0MA 5AQGA 4DX8H 3ZYYX 2E88A 4ZVFA 4QQBA 4KHYA 2AYEA 2RF2B 3PW5A 5AE3A 5HP1A 2UUAK 2OMLA 1T4GA 1CQNA 3OQ2A 2C2DA 1QJHA 4DTSA 4EO8A 2YKNA 3E66A 1YJWS 3M2UA 3V81A 3RR7A 4I29A 2ZIVA 2CZ4A 4G1IA 4MO4A 2DHHA 3W66A 5KFVA 3MWBA 4QIWC 9ICKA 3FEZA 5F8GA 3Q8PB 4P73A 2V8PA 1QSYA 2M3DA 3LP1A 1ZQFA 2ZJQL 3IKMA 4KKOA 1Z2LA 3MM5A 4C4TA 1YTYA 4CHNA 1RAIB 1B0VA 3V72A 4ZVEA 1SXLA 3TX8A 2PFOA 1WUUA 3NAHA 4LVNP 5AQZA 1XMQK 2F9DA 3LAMA 4A8WA 3NG8A 3QU2A 3M6XA 3AOCA 4ES1A 2BRKA 4BDPA 3CJQA 1SKUB 2GJ2A 3HHLB 2C3PA 4X4OA 2HBRB 3HLUA 3BV8A 1FJGJ 1GLJO 1IO2A 4V19X 1C1BB 5D4BA 2LEBA 2FMSA 3R6MA 3BYRA 2WSCC 2OEHA 1W26A 1C0UB 1JLCB 4NLNA 3OR1B 3C6HA 2BANA 5HK4A 1Q5YA 3L2QA 3PFOA 4USTA 1ZD5A 3FYHA 3CO0P 2GIQA 4PQAA 2O66A 1Q7YT 2O8BB 3BS5A 1HI1A 1JK9B 3PSTA 5KFHA 4LBHA 5AQOA 1ZOTA 3AA9A 2WUSA 2ATCB 3D0GE 2BCQA 4I2QA 2RIJA 3H6EA 2BRLA 4LF4K 3Q8YA 4E89A 4PL1A 5DB6A 3UWTA 5K8MA 2CPEA 1G2EA 3L6QA 1BWEA 2FJXA 1Q79A 3A5OC 3CD5A 3JTOA 2YQ0A 4CF3A 4OX7A 4OV1A 3J7YU 2GVDB 1DHMA 3B78A 1BQXA 1G3OA 3HSTB 4ECTA 2GQQA 2WTFA 4O4RA 3B6OA 3A13A 3G71N 1LNQA 2KK0A 2UV8A 3PY8A 3UDVA 4KHWA 4Y28C 5U47A 4HUFA 3DGPA 2KHCA 4ZS6A 3EMTA 4IC9A 2YPZA 1MMLA 1S1UB 4ZVUB 2Z2LA 1X6IA 4USIA 2DNMA 1JKHA 4O5BA 2MLYA 1CQMA 2HGMA 1WSGA 1K9MO 4KMOB 4F04B 4KIAA 3PNIA 4KE5A 2FPLA 3AVAA 2IOCA 4FWMA 1EQMA 1N34K 1Z4UA 3QICA 3NCIA 1NGGA 4LBPA 3MFIA 2ZJRQ 4JKGB 5LJVA 2V5HG 5J2NA 1LOTB 1N62A 2R7OA 3IRXA 1TYQB 1ECWA 3EKSA 1OS5A 1NGFA 2KB2A 2FF3B 4RW6A 3EUB2 1ZQLA 4B9VA 2I5HA 3FGVA 4OGEA 2E5LK 2UVWA 2VF3A 4OX6A 2MQMA 2F5GA 3FC4A 1Z05A 3O9SA 4Y0WA 1S5ZA 3EE9A 4MTPA 1F5AA 3IMQJ 1NEEA 1YUWA 1NXIA 3ETOA 5LMUK 2VUGA 1G99A 4CZKA 2J0QD 4PAAA 1TL3A 3V81B 5HROA 3M6KA 4OZ2A 3VQCA 2AJ4A 1LWCA 2LQ8A 3MEEA 1S6QA 2A6OA 2A1AA 1F3FA 1B70B 1WG4A 5AZIA 3DRPA 2DFLA 3H08A 5F41A 1JJ2M 4TYAA 2PEHA 2ASDA 1YXQA 5DDOC 2CKWA 4Q0BB 4NRUA 3THYB 1T9UA 5EE9A 3WK9A 3SPZA 3VEZA 1ICEB 2QA4G 1KTQA 3IV6A 4EP5A 3D6FB 1FKOB 2DHGA 2XMMA 4NA2A 4FBUA 3R27A 1HQ2A 5BPNA 2H5XA 2EEYA 4E7KA 1UVJA 2OANA 2QTDA 2Y1IA 3FRYA 4URQU 1GXLA 4BXOA 1UTAA 3O9QA 2LYBA 1XO1A 2FBTA 2XMUA 3PX4A 1MLAA 3U02A 3KHHA 1U1PA 3EY1A 4JI8F 2K06A 4ZK7M 3N97B 4DFPA 1IKYB 3N9UC 4FJ8A 1QHTA 3D2QA 4ED7A 4NMXA 2MKYA 1RDUA 3T9ZA 2B21A 1BDGA 5J2AA 4OYMA 2DBYA 1U0SA 4C0ZA 2EBEA 1FO4A 4NLGA 5J2PB 1X31C 1PUZA 4IOAL 3UIQA 2JWLA 3I0SB 4FK0A 2Z2ZA 2GV9A 4NLQA 1LWEA 4BRIA 2BVZA 3MC1A 3LPTA 2K89A 3NAIA 2UXCF 1PYOB 1PK1A 5KOXA 5EX0A 4I6MB 2UU9F 1MWZA 1QM9A 1KVCA 5DETA 3O3HA 5J8YC 1D8BA 5DG9A 4BRDA 3TAFA 3OYGA 5LJ3Y 3A0BU 1Y00A 1RDFA 3DFEA 3T5HA 1DURA 3SQ2A 5HMZA 2QLTA 4M3TA 3ZDBA 2ZWHA 3UFCX 3ISDA 3U1MA 2MA1A 2R7UA 5F8LA 2OFHX 3NH1A 2KVCA 2YKAA 3DEEA 2KVSA 1KVBA 2W2PP 1J2MA 1VC5A 2EWSA 5DG7A 5KG3A 2OPRA 4DV1K 3BGFA 3MGHA 3PSFA 3POTA 2BANB 3BBCA 1HPZB 2BJ3A 3R3TA 1TL5A 2F8EX 2C3YA 1P27B 5D4OA 1NK8A 2GCFA 3FKBA 1T9XA 2VG7B 3OTOK 2BQRA 1RWPB 1WC6A 3UDLA 5L46A 3K5MA 2B9XA 4DU3A 4KV8A 2ETJA 1L3TA 3ZTRA 5JUMA 4C4SA 5KNIA 3E2EA 2A1RA 4CGJA 3EM1A 5BPLA 2R9LA 3OTQA 2MGZA 5BR8K 4P0QA 3HXMA 2AJ1A 1KWMA 4KGZB 5CQGA 5B0EA 3KHLA 2GTDA 2MY8A 3NBPB 1LFWA 3MUVP 4KTQA 3SUQA 3CCSS 2YCHA 4Y2JA 1TKZA 4RUBA 4RNOA 1SV4A 3GDQA 4FM0A 3H4BA 2CZ9A 4RCHA 1BCMA 4HCBA 2M2BA 2UXCJ 4K41A 5IIIA 4RTFD 1ZQMA 5IM0A 2KMDA 4HR2A 3QPIA 1VHFA 2POKA 3F56A 2BGGA 2HNZA 3CJ3A 4DUYJ 4NLXA 2E5LF 4RUCA 1YJ9S 3H3OB 1X4DA 2GAGC 2AV5A 4ZPBA 3IUCA 1FK9A 3CD6S 5KFYA 4NZ6A 4LF4F 2WF6A 2HK3A 4KC5A 3OTDA 5B09A 3O08A 3TP2A 1FXRA 4CK2A 5CXTA 2QL9B 1OWXA 1I94J 3MWPA 1JI7A 3TQEA 4IKFA 1RYSA 3IBPA 5G0RA 3FK4A 3Q2TC 5FROA 3U3YA 4WKRA 8ICTA 3W61A 2E8AA 1ZTWA 3KD5E 1M90T 4NYNA 5ETLA 4DR4F 4BRFA 1EP4A 3EGVA 3SENA 5L8RC 3P39A 2ROPA 3VQ7A 3JPNA 1VQPS 3N01A 3BQ0A 4UAVA 5B0DA 3GJTB 1Z1VA 2VFUA 5DB9A 3CB4A 2BKPA 1LEOA 3K2YA 2B9YA 3AVMA 2ISPA 1SKRA 4HH1A 2YTCA 2NZCA 4DX7A 4JK7A 1JLAB 2G1HA 4LY7A 3MAAB 4MMOA 4RWWA 2PT0A 1I6JA 4K2JA 4M6WB 3KLEA 1B92A 3C66A 3CJKA 5K20B 4ED1A 4ZLPA 2GVZA 2OKQA 1HIWA 2ZZTA 2BE9B 3WXIA 3FFIA 2RDDA 4NLZA 5J2HA 3MEKA 3UNYA 4B9UA 4M9NA 1SXDA 2DWQA 1T8EA 3O1WA 1V3SA 2CNNB 4UF4A 2CQBA 4Y2IA 4DOAA 1GFWB 4A8FA 5AQHA 2AA4A 1WOPA 4O0IA 3RW6A 3ZDEA 3AVJA 2J6TA 3HPOA 3VVTA 4UAWA 4KREA 2MRLA 4IQXA 3K9KA 3Q8MA 1M5SA 2HHPA 2DHAA 1TVRB 4DSKA 2RHSB 2HNYB 3ILIA 5J1EB 5GVQA 1RAJA 3P38A 3DDIA 3CPWR 2XGQA 9ICOA 1UAXA 1NDPA 4PL7A 5ALJA 2W9MA 2AIRB 2XSJA 1S9FA 2FLPA 3AARA 3AO5A 4JI7J 1V3ZA 4PG7A 1JUDA 3I4HX 1YJUA 1RKJA 9ICQA 3ENWA 1AW0A 2YHBA 3QB0A 4H4KC 1WOQA 4KGKA 3J7A1 2EFVA 2ZUCA 1N63A 3LP0A 1FCAA 4EEKA 4UATA 3W9JA 4RL1A 3B0XA 1VRUA 1WI8A 5E3RA 4AHCA 1S6PB 1WSRA 2P9KA 9ICWA 3S6JA 4ZP7A 1RTJB 1SKWA 1SL0A 3FCVA 1BIUA 4Y1DA 1X9SA 1LKZA 4JV2A 3SV4A 1R0CB 1JCGA 1U6FA 4JV5J 3FFKB 3M32B 1WDDA 4OZNA 2QV6A 2GELA 1J97A 3WZ0A 4KB1A 1SJQA 1NZPA 4JV0A 2WRMA 4J9OA 1BISA 2WAQD 3CJ2A 1B4FA 3ALYA 2RVJA 3KLFB 1OIAA 1S1VB 2CUYA 2D9OA 5IWAJ 1VS3A 2HOIA 4CZCA 2GJIA 3QU5A 1KAXA 4LREA 3A8JA 4JAXA 9ICPA 4X5VA 3I0SA 9ICAA 2BH1A 5GAHP 3G6VA 2C3OA 1DY3A 1HQUB 5GTIU 4M5GA 4NXNJ 1RTIA 1RILA 5K9FA 3IDWA 2E9ZA 3U7JA 2V63A 2ZEJA 2V4JB 4BRQA 4YDUC 1R7IA 3AEVA 2OPSB 5DM6Q 1PAUB 5I42A 4G1QA 5AJ3F 2KFYA 3ZZZA 3K9JA 2V2ZA 4HUEA 5M2UA 2KG0A 3NASA 1P8ZA 1OMSA 5DQGA 4I2PA 4LF5J 1N5VA 3GZ7A 5HVFA 5A8RB 3OYEA 3CMES 4YMEA 4I2FA 1XSNA 5J0RA 3LGMA 1M0SA 3FM9A 3MHYA 5M1NA 3AO4A 4WZQA 3GV7B 3FCWA 4OPJA 2LI6A 4A8KA 4BDYA 2XYHB 1JQGA 3HF5A 2ZJ5A 2CJXB 2H51B 4WBFA 3AO3A 3MPVA 3CRXA 1RWVB 3QYYA 9ICRA 1WCNA 3TZWA 2KQ2A 4YMNA 2ZH9A 3GFYA 1OJ4A 1Y88A 6AT1B 3ZT4A 2AX1A 4UQTA 4F67A 1IBKK 3VOVA 1K0VA 4DMNA 3TW0A 3DI6B 3T1HK 1N0VC 4LFBF 3IM9A 4TVAB 3WQUA 4BG8A 1LB2B 2ZTDA 1IH7A 5KFOA 1S12A 2F3JA 4X66J 5CZ1A 3PHTA 2QFJA 1VQMS 2XHCA 1W2IA 1OUQA 2FY8A 3MPWA 5KFQA 3OYDA 3OXLA 3IWLA 1CULB 1PVRA 2VG6B 1WAFA 2ZC4A 4FZNA 4RLEA 3P5TL 2HNDB 1WWUA 1NMEB 4FLVA 1JLAA 2O8FB 5AT1B 3VHQA 3ZSXA 4DR5K 4RPYA 3BM7A 1JRPA 2I9GA 3L4BC 3SQGA 1J5EK 2FPKA 1UJ6A 3DLBA 1IQTA 1AFIA 1RHJB 2XQCA 2AP6A 4U9RA 2YV0X 1RAHB 3BR9A 2YWHA 4QJFB 1M1GA 4MKYA 2DHXA 2RE1A 2VC1A 2A1SA 2HS4A 4E98A 2WONB 1VSMA 3O44A 1FI4A 3ZSZA 3UKRB 1C0TA 2ESEA 1JJHA 3O1LA 3QT8A 4PXDA 2KZZA 3S9HA 2IC3A 1S7IA 2V68A 1XU4A 1JLFA 1Y9OA 2J7KA 1VQKN 1X4FA 1WSIA 2HQDA 3VR1A 3M2RB 4OJOA 5F9NA 4AL7A 4LQ9A 4NJ8A 5F3ZA 2CGLA 3SMZA 1FNMA 4KLFA 1NM2A 3ZEUA 3CCMS 2IJRA 2OTJS 2CQIA 3CCVS 4NCGA 1S6QB 4FKYA 8ICPA 1UAWA 4B02A 5GAEI 5IIKA 4F5PA 3TA0A 2Z2MA 3I8BA 1YJWN 1OXJA 2OELA 2W9CA 3HP6A 1T9WA 3P3DA 4C6AA 3N6MA 5J0TA 1XSLA 2Z1IA 4OV6A 3H2LA 1L3UA 2O1PA 1N61A 1X66A 1RAFB 2JC1A 1N5TA 1U1OA 2WVEA 4DV1F 3DRXA 3N6LA 2DXFA 4K4ZA 3CPEA 4R65A 3F0NA 4QZAA 1B22A 1XC9A 2HSTA 4WFAQ 3RR8A 1WNSA 1JLCA 5D0HA 2HVDA 3J8AA 3H5UA 4P52A 3M8QB 1YRUA 1BUXA 2FIUA 4XH1A 2E7WA 1A6LA 3K8WA 3H5YA 3OLAA 1RAGB 4NXMF 1SBRA 4H8KA 4DTNA 2ITGA 4HHJA 4NRTA 1H7WA 2IRUA 3DYAA 4I2AA 4HDHA 3J80U 1O13A 4DR1J 5BN8A 3QNNA 2OZSA 1Q9YA 1N8RT 4OX9K 2DPJA 3HULA 5D4NA 1ZXOA 1HBMA 4P10A 3KLFA 4PWWA 5IQQA 1U7LA 3W5ZA 3NVMA 2UUCK 2M9KA 2BM1A 3KK3A 1YJNN 5A0YA 3E51A 3EVMA 1PG5B 1JLBB 1SXEA 5HMYA 4IQMA 4OYPA 4F5NA 4GC6A 4BQZA 1X60A 4CQ1A 2GO7A 2ZJPQ 2WSFC 2F2AB 3V6DA 3GOIA 2E66A 4ZPDA 1J6ZA 3QU9A 3Q7CA 2XLIA 4W90B 2W01A 1GX5A 2ZH3A 4J2EA 4DL5A 5ALNA 2RS2A 4JKBA 2XI2A 2FZGB 4O8KA 3F5AA 2AGQA 4BRKA 4ED2A 1KQSM 2QL5B 2IVPA 4CLSA 3IG1B 2V4QA 4XIUA 3P96A 4MEXA 2QA2A 3ZETA 4PA1A 4EP4A 3MABA 4USVA 3C95A 1FESA 3UE5A 1YGYA 4BR9A 4F2SA 1XEZA 4I1TA 4NLPA 2BPFA 3GU0A 1P6TA 4JWNA 2YX7A 5DK5A 2DVIA 4USMA 1U47A 4CECA 4EZ6A 2CJAA 4CYUB 4DOZA 3ZZRA 1QY7A 3OL6A 4CERA 7ICFA 4ZIVA 5MAOA 4NLCA 4CZLA 1DOQA 4KV8B 2FJ6A 1BG3A 4BS2A 3DLKA 5AK6A 3P45B 4KLIA 1RADB 4N76A 2VONA 3MR5A 3AAWB 4UW2A 5LL6d 3MN6A 4B9NA 4TLRA 2FD2A 3K5OA 2QMXA 1ITGA 4RQ3A 4OI1A 1KR4A 2I2YA 4J9RA 1XMBA 5DG8A 4J90A 3VGMA 2KXNB 3F53A 4GY2B 8ICRA 4LQ3A 4C7ZA 4C11B 1WEYA 1N36K 3DU6A 2E44A 3NTUA 2QYGA 3ZT1A 3BF4A 2H3QA 3R6GB 1KAZA 1TL7B 3DLEA 4CHQA 1JN3A 3IM8A 3GYNA 3W2WA 1RCOB 4ZH4A 1R6YA 5EN1A 4ED8A 3OTBA 4A48A 3K7RA 2Q4TA 1FDBA 4IKAA 3AVFA 5CZVA 2MUTA 1NH7A 3HSJA 2CPIA 4AFFA 1IBMJ 3T41A 1FVSA 2VA2A 2C2RA 3O9RA 1HQEB 2NV3A 2RHQB 1DLOB 3MK6A 3SLCA 1ZQVA 1TUVA 3SFGA 4X4NA 1M1KO 5J0YA 1NPRA 1YI2N 3NRBA 3I6PA 1NGAA 1S9EA 2NXEA 4C8YA 3TAEA 3QFPA 3GG1A 4CO5A 2XNQA 4X84A 1FEEA 4BRLA 2ZUAA 1NG9A 8ICBA 1Q5VA 2FI1A 3Q89A 4TY9A 3BGLA 5AFUA 3N0VA 1PBUA 1RISA 2VYPA 2WF9A 3RWUA 4IOBA 4H4KA 1FTRA 3WK6A 4PPZA 1NRKA 1FX2A 2WFAA 3ONNA 2IM2A 3IS9A 2NXNA 2LXFA 1I94K 2WVFA 5KFIA 2G07A 3NAEA 1RDRA 3OYNA 4ZTJA 4RG8A 1RUSA 3EPGA 3EPIA 1YLXA 1TL1A 3HD2A 5BXIA 2XO7A 2ADBA 1KD1O 1WI6A 5KFSA 2PMHA 3P8BB 1GLBG 1BO5O 2CJBA 3MMAB 5AQLA 2QO3A 3CJCA 1JWWA 1MROA 2MZ1A 4NB4A 5KG6A 2HFVA 4F5RA 4HUGA 5DDQC 3CE8A 3M8PA 1M5KC 2H4WB 2N4DA 1RU1A 1X42A 3GIKA 2KXFA 1DGJA 4MFBA 3HI9A 3HK2A 2QWPA 5A8WA 1Q81O 3JSBA 4ZKAA 4WE1B 1RDWX 4XQ8A 3MI7X 3BPDA 5ALSA 3MXIA 1RM6C 1VQPN 3U26A 3M30B 2I6WA 2MQNA 2VG7A 2F44A 5J2CA 3NGDA 2MKIA 4B1XB 4LFAF 1KRPA 1D3WA 3LPYA 4CCHA 3VEVA 4KYZA 1ELOA 5C25B 1S57A 3I56S 3J7AP 2N82B 4ECVA 3K5NA 4A2AA 3NRZA 2Y9UA 5AQNA 1BPYA 3GFXA 4FS2A 1RTHB 1A0PA 2CPFA 3KFWX 3L8BA 3HVTB 2H3EB 3AD9C 5DDPC 1SJ3P 3MURP 3AB2B 1G15A 5HLFB 1C20A 3MMBA 1MU2A 1MMDA 3N5BA 1S49A 3C6TB 1HWUA 2IS3A 3PHEA 2V9KA 3L7OA 2KSOA 3QSIA 4AILC 4C8ZA 4AHSA 4CBUA 1R89A 3MDFA 1IQZA 2FBXA 5H9EK 5KFTA 2YHWA 4F72A 3R9PA 5GAGU 3W8PA 2QE5A 4NA1A 1XUPO 5AQRA 3TARA 2WBMA 3ZX0A 2JJ4D 1ZQYA 4P9SA 3QEVA 1X0PA 4I56A 2HOQA 5ELZA 3JPQA 1K73T 4ECSA 5HP1B 2R4FA 1OH6A 1XR7A 4DV6F 3WK8A 4PQUB 3K1RB 2HBQB 1SPBP 3BN4A 1C0MA 4ISEA 2QWRA 1CS4B 4I9LA 3RBZA 3HVAA 3PIPL 2A41A 5B66U 2EZXA 2KV2A 4Y1CA 4JI5K 4BC2A 8ICGA 3SAGA 1YRXA 2Q1LA 3FE1A 5A2QO 4PG5A 4DQIA 1GLLO 3M9NB 1DTTB 1F2GA 3HKZF 3CJ0A 2W7AA 4FJHA 4P2SA 1RXVA 2ZVIA 2GAHC 3Q8SB 5HVGA 1OY8A 4CDGA 3SCIE 3IG8A 4DMZA 4OQJA 2F1FA 2K8AA 3E58A 4PKGA 3UO0A 1KQKA 3CD0A 3JYTB 4JS5A 4NI2A 3HZGA 2PAVA 2QG9B 2J7WA 8ICZA 2E9TA 3L2WA 5ALGA 4BROA 4FZLA 2BKEA 5IXUA 2HCFA 3IDHA 4OVLA 4NWBA 2NSCA 4DTMA 5BR8F 2HS3A 1UEVA 2D5RA 2CQ2A 5IT9O 4PZOA 2O3DA 1RU2A 3V1RA 2AWZA 4QAGA 3MOZA 3D2FA 1RA7A 1VQ5N 1ZH5A 2WK4A 1IJJA 3MN7A 3O1BA 3UN2A 4P71A 1NHVA 3Q8QB 3SXLA 3V9UA 3IM1A 3M6GA 2V8DA 3QQCD 1XNRF 3TWHA 3H0LB 4ATNA 4QWCA 2YQ1A 3KD1E 4Q7AA 2KEYA 5L9XA 1NHKL 1SV0A 2BEFA 2A1JA 2F1JA 4I2BA 3FZLA 3KKAA 4JKFA 4F25A 1HFEL 4OKKA 3NGUA 1BWVA 2QMWA 4RQ6A 2M88A 1XN9A 3EWAA 5LMUF 5CZ2A 6FDRA 3PX0A 3V6DB 4LF5F 4C2MA 4CW7B 3AL0B 5KFBA 3I31A 5KFLA 3PXGa 4LZDA 4R0EA 2CADA 2L5YA 1VLOA 3SYZA 1SJRA 1WHWA 4ANDA 4FNHA 5DQIA 2ZFHA 2QWLA 4CEFA 1O08A 2MB0B 1WC4A 1WEXA 4Y2XA 1BI4A 3ET6B 4CH1A 4MT1A 4X62K 1JCFA 4FZYA 1DZ5A 4PKHA 1Q4RA 1RT6A 2OO4A 1T03B 4HCCA 1TAUA 2NSBA 1JXBA 4DV2F 2KDOA 4US8A 5A8KA 1ZBFA 2W40A 1MN8A 1U49A 4YS2A 2A2DA 1KCFA 1NSKL 1E6YA 2AD9A 1N6QB 2RRAA 1XMQJ 3I76A 3ZO7A 1YTAA 3IXQA 4OCZA 4CLUA 1ITPA 3G8TA 3JAMU 1Q3VA 1DXSA 1N5YA 1U1NA 3ITHB 7ICJA 3M8WA 3NS6A 4PY5A 4PUOB 1VCTA 4ILMA 3C2KA 4B17A 3VAFA 1HWJA 3DCAA 3CF5L 1VQSA 4CNQA 3S6EA 3IRUA 1T02A 5ALYA 4YDDB 2DR6A 1XI1A 4J9NA 3PEHA 5BYSA 1BMQB 5I3QA 4O55A 4CWBA 3HYFA 3ILJA 4ANEA 2A3VA 2QARA 3ZDCA 1JXLA 2VKRA 4J9KA 2J9DE 3DXMB 4A8SA 4X4SA 4M3XA 3CP8A 1FKAF 2G0CA 2HVIA 2H4YB 3V6HA 1NJZA 2CXEA 2MJUA 4YUDA 3GWCA 1DLOA 3MWTA 2G0IA 1HI0P 1ZOLA 3OFFA 4JYAJ 3KKFA 2W4DA 4IWVA 4QS7A 4IFYB 1NZAA 3RSEB 2BE2B 2DIVA 1VSJA 1WDTA 1CJVB 2NPFA 4BRNA 1RAAB 4D3HA 5KGWA 2FHMA 2Q2RA 3O3LA 1KN6A 4GV9A 2DUYA 5BOLA 4CIOA 3ID6A 3OL8A 2F4VK 3OXGA 4NL5A 2V2QA 4USHA 2QZ8A 5JLHA 3QRQA 2M4MA 4OLAA 1GLEG 3OJUA 4RNFA 5J2FA 2ZNYA 1W25A 3CDBA 2O8BA 4JI0J 2I38A 2YY3A 1ESVA 1TV9A 1NGHA 2DY1A 3SDEB 2B7CB 4DV3K 2WBRA 2H3GX 4J7CA 1S8OA 2JXJA 1YITN 4KB0A 3FSIA 5IT9Y 2X3DA 2GC8A 1U2RA 1KOHA 3RUBL 1MA9B 3LP2B 4PABA 2JWKA 2KT3A 1QTMA 1RT2B 1N36J 3UI3A 3GCWP 4EZ9A 7ICRA 8ICIA 1UP1A 2CQDA 2FHOB 2B4OA 2VFSA 1GLAG 2FZKB 3PZPA 4M0AA 2R7YA 2YNGB 3THXA 4QZ9A 2COLA 4R25A 1G4CA 3ZSOA 4H03B 2RHFA 3ZDDA 1KQSR 2DKOB 2AW0A 4MF8A 4E0DA 2BR0A 3DMJA 1MDUB 2AKWB 2VD3A 4BR7A 4U7BA 4LUBA 4DPUA 2FC9A 4DL2A 4I68A 1MSWD 3BO2A 1ZS6A 4KLUA 4QZVB 4YQWA 4Y2KA 3C23A 3JSYA 7AT1B 2BW2A 2D74B 4Y6IA 2D8CA 2CPXA 2D1CA 1UEUA 5I4MA 1GQEA 3Q23A 1TQLA 3IGVA 2XRIA 1HHQA 7ICGA 1S22A 4CJ3A 2QXLA 5B8HA 4F0MA 1PGZA 2HHSA 1NJIT 3VENA 1C4CA 5TISU 1DQ8A 5JVGL 5ALEA 4Z4FA 3IMXA 1XIQA 4F4XA 4BR5A 2R8HA 1HNVB 4BRGA 3JXUA 2QMUB 4IUFA 2AEJA 2C22A 2WB1F 4GC7A 4EFAC 4I4BA 2YHAA 1C1BA 5HRNA 4IJAA 7ICIA 1U24A 5FLXU 1IJEB 2E1YA 4LZGA 1N36F 3OTOJ 5D78A 1X3MA 1UPMB 3PEJA 1ZQUA 1U2VA 1SC4B 2YJEA 9ICSA 4GLXA 1L3SA 1E6VB 1Q86T 4GVMA 5J1PA 1R3NA 1NK7A 1ZZFA 4BRCA 4OHYA 2OXOA 2DT9A 3M1FA 1DRZA 4WFAL 3R7SB 3P4IA 5HAOA 4FKXA 3BYPA 4BY9C 1VQNS 8ICMA 1DQ9A 3PR5B 3KIOA 2OEKA 3NGIA 3JPSA 1QQ6A 3WKEA 4B6JA 4OX8A 5JS2A 3BSNA 1V4TA 4DUYF 2U2FA 1HBUA 1W7WA 4HEA9 1IG6A 2HZAA 3TRGA 4I6MA 1NPKA 1SC6A 5FLXO 4LJXA 2HZVA 3QUTA 1T6DA 1QHAA 4HDGA 5E0OA 4CJ4A 2QLWA 2BW7A 4YG2A 1VSFA 5F8NA 4NI2B 3V6KA 2ZQBA 4RPFA 1LWFB 4CF9A 4KX5A 2IBKA 3WT0A 5F0UA 1QUPA 1T3QA 3JSMA 4MO5A 5F8IA 3MM7A 3WHIA 4QZFA 1WC5A 3AY9A 4Z94A 3KK3B 4L3QA 5AK3A 3SEOA 4M45A 1VISA 3CJ7A 1TKDA 2KJVA 3FNNA 1QE1A 2VBWA 4KY3A 4CLFA 2X1AA 4ZVTB 3HW8A 4ERDA 3TJ8A 1S0MA 3THVA 1HLUA 3EVWA 2JGUA 3MDCA 1QQMA 4LJMA 2DPIA 2OUGA 3P83D 3WXKA 3C21A 4B9TA 3EKUA 1K1SA 2YNIB 1L7OA 2HGLA 2K8GA 4MDBA 5KFFA 1SI9A 1M1KT 5EU7A 3ZD8A 3C7NB 1YBUA 2BJ1A 1W2BR 1R43A 1XO0A 2OH2A 2A6AA 5KG0A 5DGAA 3EX7B 4M41A 1RWKB 5AQXA 4CBWA 2UXBF 2VQEJ 1N5WA 2XMJA 3HFZB 3B4DA 2HQGA 2Y1LB 4ZN1A 1SKSA 3J7ZT 1ZQNA 3IAM9 4IH6A 4I2EA 1VQOS 3JQKA 3F9KA 4BBYA 2RPIA 4Z4HA 5FPDA 2FQQB 3ID8A 1JLQB 3AVCA 1PK3A 2HFSA 2VZ9A 3KG4A 4USAA 1JALA 3VZHA 1C1AA 1SC3B 1FWLA 1WSHA 4GXJA 3G6EN 2E8NA 3TR8A 4NLDA 1J5OA 2HLUA 5AI0A 4DR4K 1EZZB 2HBZB 2VODA 5LMNJ 3TVZA 2PGCA 2NRRA 4QPTA 1I5OB 3QFHA 4N47A 3QDKA 4RW9A 3N28A 4A5BA 4LF1A 5IOLA 3D2NA 2VG6A 1NDKA 2Y0SD 1X4BA 4FO0A 1ZQGA 3THTA 4AQYF 2CH5A 4DLGA 4FYDA 3IP4B 1RT6B 4K4YA 1Z00A 4Z7YA 3WNGA 2JR5A 4M7YA 1VIOA 3PW2A 4C3LA 2LM4A 3SI8A 2LU1A 4DR3F 1D9DA 2EVZA 2EG2A 2Q79A 5ALIA 3PW0A 4I2CA 5ALWA 3TFSA 3RMBA 3I28A 4ACOA 1OSCA 2ES6A 3NF7A 4WQ4C 3IS9B 3RMDA 2IVNA 2IBOA 4K8XA 3M32A 1IKXB 1Y11A 4YHHK 1XR5A 3R8EA 3A3PB 4PGQA 1KLMA 4YHHJ 3PRVA 5J2JA 4RR5A 1QAYA 2ZIXB 2LA6A 3VQTA 4F3MA 3KZXA 4LH4A 2R8JA 2RQCA 2WMMA 3VTIA 3ZTQA 3LZIA 3WXLA 4Y2TA 5KRTA 2P6SA 4NX9A 2E6LA 2GVZB 2B51A 4QOZB 1O1WA 3DLJA 3DOMA 4E8UA 9ICLA 3SUPA 2QJ3A 2DH9A 1T9VA 1GOCA 2QARB 3RJJA 7FDRA 2P8IA 3OYHA 2H65B 3C5GA 4FF1A 3MTKA 1W0HA 1RT2A 3ZD9A 1KL9A 1UWBA 3UMCA 5LT5A 3R97A 2HBYB 2HHHJ 1UVNA 1KVIA 4G1QB 1X6JA 4LF7F 5IILA 2CDQA 1UFLA 3DRRB 2K4IA 2RLTA 2KG1A 3IFEA 1FHTA 2OM6A 3BGUA 2D0PA 1U6BA 3JAMO 4X4RA 3TVKA 2G2OA 3R5DA 4IQUA 4P4MA 1UVKA 1YITS 3K5LA 1H2TZ 4QIGA 3QNMA 4LR7A 1BPXA 2PEBA 3VALA 4LD0A 1FWPA 2G1DA 2O4GA 2Z1JA 1SH0A 1EJ7L 1HEKA 2L9NA 2RILA 1PC5A 4C3MA 1IBLJ 1PCAA 3D2EB 1Y64A 2VPWB 2G5HB 3KLEB 1PJ7A 2E5HA 2B4PA 3I5AA 1CUKA 4PHAA 4DX6A 3RBDA 4DV7J 2KD1A 5HBMB 4DR6K 2IIHA 3AXMA 4LR8A 2UUTA 1J5EF 2N7CA 1T3VA 5ALDA 4YEAA 2DNHA 4CJ5A 5BYRA 2X51A 2MYFA 4ZJOA 3KLGB 4NXNF 2FUG9 2F9TA 3LP2A 2D0BA 3AN1A 8RUCA 4OYIA 4CNZA 2FVSA 3IAS9 4FN5A 1JJ2R 4FJNA 3KJFB 5HOOA 3EGWB 5AR0A 8ICEA 2HK2A 2EKNA 1V5VA 2QC3A 4K0KF 3SQ0A 1H73A 4KR0B 1Q18A 2QSFA 3VA3A 2J76E 2FZCB 3WKCA 2NUBA 1B64A 4ZPCA 3SJHA 1C4AA 2JL9A 5HR6A 4B9LA 2MSTA 2CQGA 3QEAZ 4YY3F 2WF7A 3KJNB 4NM1A 4CD3A 1MWQA 1WTBA 5IS2A 2DHSA 1AT1B 1RK8A 3FZBA 2GUPA 2WF8A 1Z26A 2V8GA 3GLJA 1VJQA 1ZQOA 3CMQA 2CVIA 3CCVN 2XMKA 2ZHOA 1X1PA 1TMJA 9ICTA 2VASA 4EBEA 3Q24A 2QW9A 3U9DA 3HKZC 4E1MA 5I9EB 4QW8A 4IDKA 2E20A 3I0RA 4X66K 3H0MB 1YJ7A 3MMVA 1FXXA 1SV0C 1XSPA 1JLFB 4P0PA 1DTQB 2UUBK 4HTUA 5FDLB 8ICJA 7ICVA 3A4TA 4BJQA 3DLGA 3C0BA 4IZ9A 1CRXA 4Q2MA 4EBDA 2AHOB 3OVBA 1VJ5A 4EUVA 2VL1A 4Y2MA 3ULHA 1Z4OA 1T11A 5M2RA 4FWNA 4KN7A 2JHEA 3T1YJ 1NSAA 4EYHB 2HWTA 1RTDA 2N3LA 4GVBA 3J7YP 5ALRA 3BKTA 1X5TA 1Z2ZA 1VQ4N 3VQPA 2X1FA 4ZCLA 2KW4A 2DCLA 4CO3A 4LSNA 2OHDA 2KN4A 1GNKA 2AJ2A 4CLLA 3DM2B 2ZC3A 2VDIA 1IBLF 3CNHA 3WNEA 4M3RA 3LZJA 2G8IA 1IJFB 2ZZMA 2DO0A 4JI1F 2MUTB 1R8BA 4ICLB 1X5SA 3WIUA 2OZMA 1JNZB 2ZDPA 3UKUB 2Y9TA 2DITA 2G8VA 3LDOA 5KG5A 1NK4A 4MN4C 2LBOA 4TKTA 2IGIA 1VSEA 4B9MA 3VQAA 4ZVSB 1TGOA 1S99A 4ZVGA 3BDEA 4K4WA 1SQKA 1GMWD 5L1IA 4AH9A 2LQ5A 4IYQA 3I1YA 5AJ3K 4V1Ak 4IR1A 2PYJA 1WWVA 5CP2A 3KHRA 4Z6DA 2P9LB 1CJKB 5J1NA 5GADI 4JI1K 4XH4A 4UW9A 4E1NA 1Z25A 1JJ4A 5CJ7A 2R7QA 2JEGA 4N5SA 4NZ7A 2YKQA 5IIMA 4JHDA 1KHVA 2DNQA 1KC8O 5JS1A 5DKWA 3IWNC 3WDOA 1BQMB 2QB0A 4I2DA 2V4RA 1RCXB 4LRBA 5EE3A 1S72S 5EE1A 1RT1B 4ECUA 3LAKA 5D0GA 1WWHA 4NYOA 3T79A 5CYQB 3UQ2A 1LAVA 2B9EA 1ULRA 3H40A 1KOOA 4FPBA 1LXNA 3K58A 3PKYA 1XNQF 2RB7A 3KLHB 1ZA2B 4KI4A 1RXWA 3ELHA 4BC5A 3OHAA 3TNVA 3ZTSA 3GJRB 3GBTA 2LQJA 3PSIA 1LV5A 5CWRA 4DR7K 9RUBA 1XBWA 5JTIA 4MDAA 5TKWA 2FPMA 3T3FA 5K8PA 2DNZA 3KK7A 4QZBA 3FGUA 5A6WA 3JPTA 1EXNA 3UD4P 4WE1A 1B0PA 3L3CA 1SV5A 1RLCL 1N0UA 1J5OB 4B1ZA 5KT2A 3VF0B 1RP5A 2M52A 3MF5A 3BGRB 3T6BA 4DU8A 2X7IA 3G4SS 2HHWA 3W7BA 5D15A 2G2ZA 4ZJLA 1WC3A 5KT3A 2OFGX 4G6VB 4YY3K 2OTLS 1IG8A 4JK9A 8ICXA 1VBXA 2ZKTA 4O8UA 3AU6A 1S4EA 4NE9C 4Z6CA 1H74A 3U27A 3A3OB 2MU2A 5JRTA 4OZ5A 1FF2A 2Z30B 3MEDB 4BCAA 5KT4A 4IQVA 4PHDA 1URRA 3MCOA 4JI6F 1FK9B 2NXCA 4J2BA 2Z7JA 3FRZA 1IKXA 3QMQA 3SI6A 3ZTPA 3QUQA 1P1TA 5DJBA 5HMMA 3HJVA 1Q7LB 1RHUB 5K8OA 3QSYB 1Q46A 1A7GE 1IG9A 7ICQA 2LECA 3OT9A 1FJCA 1N33J 1MA7A 3I5CA 3R7NB 4NLSA 4ZTFA 3NF9A 4GXKA 2VBXA 4QZHA 4MKAA 3KZIU 2R7RA 3EGNA 2V50A 1HKGA 4DKWA 5KGXA 2KM8B 4ZOHC 2LLZA 3QESA 1HMVA 1DGKN 1U0HB 2EZYA 3BBFA 3KMSA 4U8VA 1S9EB 5BPCA 4J03A 4DCHA 4JUZA 3F2KA 3M6VA 2ZJ8A 5J1EA 3I8DA 4X64J 1IKWA 1HNIB 4DOBA 3CCQS 4B3RK 4ISGA 2YNFA 1IWAA 4ISFA 3PVXA 4CDIA 2MZJA 3SQ1A 2K1RA 1H72C 2B5JB 2JC0A 4H4OA 2B56A 4QR2A 3TPQA 2B6AB 4NYFA 4QWDA 2Q0ZX 2YBVA 3H42A 1WSVA 5CYMA 2ASPA 2IVOA 3MCSA 3D6HB 3X1LB 2A3ZA 3D66A 1JNRB 4O5EA 2ACYA 4K4VA 4TQRA 3UQSA 5CHGA 1RHRB 3CMAS 1RT3B 1UW9A 3MMJA 1SZ2A 2UXCK 3MPUB 4CIGA 2BJ8A 4LSNB 1KVAA 1NAQA 4JBCA 4JHDB 3D4JA 2Y1JA 1OH7A 2KIWA 4DXLA 4DX5A 4QPXA 2NO5A 3D6MB 3WX8A 5HQ8A 2GV1A 4DPWA 2EFPA 1NSPA 5F8JA 2CG8A 3CXCM 5LJWA 5HQLA 1S1XA 1QVGR 5G5HA 3EE3A 4I6WA 5KFDA 4B3MF 3M8SA 4J9LA 1OYDA 4F0KA 4FPAA 1XERA 3BP8A 2Q36A 3NVVA 3M2VB 1RBOB 4Q8EA 1MG7A 5ADXA 2VWJA 1MNEA 3ZETB 5ETVA 2F8TA 3OD2A 1S48A 4EELA 4LF7K 5ALZA 2KJ9A 4EWTA 3CFPA 4ZPVR 1WUAA 1K9MT 3KWIA 1JL1A 3VEWA 1I1GA 2GEMA 1ZAXA 7ICTA 4OJ3A 4MK8A 3UCGA 4X62F 4A46A 3J81O 3R5BA 3ZCMA 1Y7PA 2KI2A 4AE5A 1SIWB 2F63A 1XNRK 4FJ9A 4MIWA 5AM2A 3LVVA 2N7YA 3I55S 3F41A 3CCUN 4DV0F 1RHKB 5E5NA 3T9NA 4A8OA 4YN4A 5DBBA 2M70A 1H38A 2MLZA 1F9EB 5KFRA 5ETTA 3CIPA 3OYAA 2VQFF 3LPUA 1WG1A 5F2RA 4MLEA 4CFAA 2Z56B 3VAGA 4F71A 2VJ5A 1L5UA 1IIPA 3M6ZA 4C0HA 2PIIA 2B9WA 4E19A 1WKLA 2V67A 2UXBJ 5F0XA 3UCZP 4DUYK 2XIDA 3ZZ0A 1JLGA 3QIPB 2F9WA 4C4RA 3DWLA 4ID1A 2J4RA 1RDCA 2IMOA 1ATNA 1CJKA 3VAKA 1ROFA 3AOBA 4JI4F 2LKZA 2DR7A 1RJJA 4ZVHA 2UXDF 2VB6A 3U3GA 1ZQAA 5IC4B 3WKBA 3AM9A 1KBUA 1ZQHA 4QIWD 2J0SD 4NLWA 3DAWA 3C6AA 2DISA 2HHTA 1FD8A 2FMQA 2QA4N 5ALXA 5ETNA 4DR6J 5H9EJ 2HHXA 1P8GA 4WXOA 5K8NA 2X74A 5CY4A 1B43A 4FYXB 2VJ4A 1V9OA 2Y8WA 4DTOA 4DEZA 2AZ1A 1ZM9A 2IDEA 2D0CA 2P51A 1OO0B 4M47A 5KFCA 3BF3A 2L9DA 4DCPB 2GH1A 4X4QA 4DR3J 1TFRA 3GILA 5EY4A 2PI5A 3G6ES 2XY6A 3ENAA 1BUPA 4CGGA 2JVOA 2ZVSA 3NMAA 4MF2A 5CA7A 1DRGA 1RGVA 5CH7B 3PACA 2OD4A 2QYCA 4RW4B 3TUPA 4L73A 1YIJN 1ZRNA 5HRPA 3CCRN 4MHVA 3NHGA 4BX9C 3QNWB 5TKYA 4FBTA 5EGYA 3MM6A 4OZ3A 3MUTP 1SH2A 4MLHA 2PZSA 2VDHA 2F1HA 5GINA 3R2DJ 1O6XA 3K75D 3L0QA 4C8OA 4HYKA 4AD6A 1RA6A 4A4JA 1TU0B 4RT3A 4DFDA 3UPFA 1IN0A 2IDOA 2JH3A 5HRSA 2H48B 1LQ9A 2QRRA 2YNHB 4IL6U 3WXJA 2W04A 4UB6U 2LHTA 4OYXA 1X7VA 3R6LB 1Z6RA 3S8SA 5AQQA 3F2DA 5D49A 3NS5A 1KQGB 1D1UA 1V85A 3AQEA 2XHBA 3IRXB 4QZEA 2DGUA 1GXUA 4UZBA 4YB7A 4A8QA 3HZEA 1TKXB 3GJQB 4IH7A 2AYMA 2FHJA 1B0XA 4KHNA 1RAOA 3NF8A 4CZGA 4K4XA 2QLFB 4AYBD 4IOAQ 1AZSA 1Q82T 1TL7A 3MR6A 1HYVA 1R8PA 3M6WA 3JPRA 2E1AA 2W54A 4DUZF 4ZN3A 4J9QA 4KAIA 3D6RA 4UAYA 1RQLA 3SBMA 4B1VA 1URNA 3FUYA 2EH9A 3CHWA 2WCXA 1BD6A 4GMJB 3M7VA 1JKHB 4RKUC 2IOFK 1CVJA 3WK7A 4LRAA 8ICYA 1U1MA 2VFVA 2E7VA 2E2PA 1FJGK 4F7VA 2FC8A 1RFQA 4AP9A 3BH7B 2AYBA 1WF2A 1NOMA 3SSQA 3D3CJ 1E6YB 1F9HA 2EXUA 3GSDA 3UXOA 4AT1B 4G65A 4Y2UA 2E4LA 1RTZA 4A47A 3C6TA 3GCXP 1S1XB 4TNOA 4UOFA 1XNQK 2RN2A 3E9OA 2JEIA 5A0LA 2A3JA 1XNQJ 2HF4A 3H8SA 2IPOB 1N48A 7ICLA 2J9EA 2KHDA 2B8PA 2QA1A 4DTUA 3KD3A 5HROB 3L2VA 4OI6A 3TUJC 2ZIXA 1WD6A 2OD6A 4CTAB 2H3ZA 3A3NB 2H1YA 2XMAA 1UT8A 2PN6A 3W64A 1Q8BA 1U1KA 1WB9A 1VDHA 3NGTA 9ICXA 5J0WA 2QSWA 4NMLA 5GAHU 4HTJA 3JXOA 3T1AA 3OYIA 4AL5A 5LMNK 2EC0A 4FJJA 1FRHA 1CS4A 4R79A 2EANA 3O5BA 1PYSB 1YJRA 3QXGA 5LXRA 2IOHA 4IG0B 2MXYA 3RZAA 2X1GA 4FJLA 5KG1A 2BOAA 3RAXA 5EOZA 1RGIA 2R7VA 3DU5A 2WB4A 3MCNA 5AM1A 4J8FA 5IT0A 1ZQSA 4MIBA 1COKA 4ES2A 3OBIA 3PR4A 4QWEA 1X2IA 1GLDG 3WKAA 3F5TA 3SV3A 1DFDA 2O6KA 2GIFA 4JNEA 4PGXA 1HLWA 2G13A 3CF5Q 5T14A 3CIZA 5KFZA 3LQVA 2VGMA 1IV8A 4BXOB 1HKBA 1S97A 3NOCA 2UUCJ 4B9SA 4YR0A 2XWYA 1U6ZA 3ISBA 3AAQA 2W4CA 3A12A 1VHIA 3CFRA 4KLGA 4DUTA 1GTHA 3IAYA 4K0KK 1A5XA 1YG0A 4DN9A 1V5IB 1IM6A 3K0SA 2DNRA 1VQ6N 1XJWB 1TUYA 4JYAF 3I4PA 4M2YA 4GO7X 2P9GA 5E84A 1UEKA 3D2FB 4JI6J 5CR0A 4DS5A 4E1JA 4DL7A 3M2UB 3SUNA 1V6HA 4N7TA 4O3QA 1WHVA 4OX9F 4EHTA 2V34A 2RRNA 1WNEA 5A8KB 2QLXA 1BE4A 2WW4A 5F9LA 2KKZA 9ICUA 5EX3A 4HL9A 4GKKJ 1X9XA 3HM8A 3V1OA 3R5CA 2YKMB 2ZH6A 4L3NA 4AL6A 4FSVA 3D6TB 3WX4A 5BYQA 4CEAA 4LF9F 2OLWA 2IAJB 2I5JB 8ICSA 1FEHA 3P1GA 2B3TB 4FYVB 1VSIA 1NNLA 5E79U 2JOQA 2VH7A 1AROP 3BH6B 5IWAF 3NNCA