3PXLA

Type-2 cu-depleted fungus laccase from trametes hirsuta
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
499
structure length
499
Chain Sequence
b'AVGPVADLTITDAAVSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPGGADATLINGKGRAPSDSVAELSVIKVTKGKRYRFRLVSLSCNPNHTFSIDGHNLTIIEVDSVNSQPLEVDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVDLHPLVSTPVPGAPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVLLQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQAWSDLCPTYDALDPNDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
molecule tags Oxidoreductase
publication title Crystal structure of T2-depleted fungal laccase from Trametes hirsuta at low and high dose of ionization radiation.
rcsb
total genus 129
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pxlA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pxlA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pxlA03
2I7OA 3X1GA 4KO6A 3MX0B 4DPCX 2W8CA 1AACA 2XX1A 1QHQA 3BVDB 1CYWA 1NWPA 2YQBA 1J9TA 3CVCA 1OV8A 2XUWA 3ASOB 4M4RB 1J9RA 4DP1X 1WA0X 3DTUB 2WSDA 1SFHA 1JVOA 1BYOA 4E9XA 1A4AA 3HEIB 2DYSB 2TSBA 1MDAA 1JXFA 1AG6A 1IC0A 1M56B 1X9RA 3NP3A 1AR1B 4N4YB 3OM3B 4DPBX 1L9SA 4YSCA 2VW6A 1NWOA 1ID2A 1JZJA 1NDTA 2AANA 2RACA 4PAZA 3X1EA 4DP4X 3NJHA 4YVNA 2IDFA 4GP5B 2QDVA 2PP9A 4NAJA 2BWDA 5D4IA 4GP8B 4KO5A 5E9NA 1GS8A 5A7EA 1AG0A 1SHWA 3EF4A 2QT6A 5F7BA 3DIVA 2YAPA 4DP5X 1T5KA 1OOWA 1WS7A 3SBPA 2PPAA 3CZUB 3JTBA 3T6VA 2P80D 1NIAA 2DWSA 2BP0A 3JT2A 4N8UA 4A2GA 2EILB 3N2JA 3PAZA 4KOBA 4WTQA 3DKHA 2PP8A 2VM3A 8PAZA 2ZONA 3FSAA 5B7EA 1OF0A 2FT8A 1ZPUA 2UXVA 4DP0X 1BQ5A 4AKQA 3FSZA 1CUOA 1GS7A 2B3IA 6PAZA 1GY1A 5D4JA 2GC4C 2XV3A 1AZBA 5I6KA 1PNCA 2XXGA 2OJ1A 1OE2A 4GXFA 5F7AA 2BP8B 2VN3A 4E9VA 1ET5A 1ASPA 1FA4A 2IDSA 2PPDA 4DP2X 4G7SB 4E9QA 1ET7A 1BEXA 4YL4A 1JZHA 1J9QA 3PLYA 5PCYA 2FQGA 4HHGA 3EH5B 3NP4A 4AX3A 3QJTB 3H4HA 2XLLA 1PLCA 2BW5A 1PZCA 1SNRA 1HAUA 1AS7A 2VW7A 1FWXA 2FQFA 4BWUA 1PCSA 4HALA 2VM4A 1BXVA 1E30A 3SBQA 3CVDA 2AVFA 5I26A 3S3CB 4KNTA 2X88A 4YSEA 3ABGA 1ET8A 1V55B 4G7QB 1PZBA 1CC3A 3IEAA 4YSAA 2PPCA 1CURA 1OCZB 1RCYA 2XV0A 3ABLB 3TU6A 1F56A 1MZYA 4ENZA 3TBBA 2HX9A 4W1TA 2CALA 1YLBB 1NIBA 4BXVA 3KW8A 4W9ZA 5I6MA 1SF3A 3FT0A 1OCCB 3X1NA 4A2DA 3FQYA 4DP9X 2QPEB 4HHWA 2BW4A 1PY0A 3G5WA 3ZDWA 4YSUA 3FSWA 3QPKA 2NRDA 4RH4A 2EINB 1MG3C 4HIPA 3NYKA 2YAOA 4QKTA 1IUZA 3QQXA 2E86A 5TK2A 1A8ZA 5B1JA 1PLAA 3FU7A 2YAMA 1HFUA 3OQRA 1N68A 1GW0A 2YAHA 3PXLA 4G72B 4F7KA 1AZUA 2PLTA 1OCOB 3QJQB 4PCYA 2XX0A 4GYBA 4P5RA 4E9RA 2HX8A 1URIA 3D12B 1W8EA 2UX6A 3NJFA 3FYEB 3WNIA 3FQ2A 2XYBA 4E9SA 2R7EB 1OCRB 3X1FA 1E65A 2Q9OA 3QJUB 4Q8BA 2IH8A 1OE3A 1BQRA 2QPDB 1IKOP 4K9JA 3QJVB 1AZNA 3GXUB 3WKPA 1RZQA 4DP8X 2MRYA 2H47C 3NJKA 3ABMB 2BO0A 1JOIA 4M3HA 3C75A 2IDTA 2YXWA 4BDVA 1ETJA 2HX7A 3EH4B 3AG4B 4DP7X 1ADWA 1BQKA 4G71B 3U25A 3L45A 3TBCA 3FPYA 3UAAA 2B08A 5I6LA 1HAWA 2IDQA 1JVLA 1KCBA 4AKOA 3T9WA 1N70A 3AG2B 1R1CA 2ZXWB 1GYCA 4YSDA 3NJGA 3NJNA 2AZAA 5B7MA 1PF3A 2A3TA 1GSKA 2FQDA 5B1AB 3RYMA 2VMJA 5I28A 2FT7A 1PLBA 3MBWB 4CSZA 4BK5C 1NINA 2OV0A 4NERA 1KDIA 3S3BB 3X2QB 1MG2C 3NJJA 1L9QA 2CBPA 1WA1X 2BZ7A 1TKWA 4MFHA 3H56A 1WA2X 3BQVA 3IBOA 2OCCB 3WNJA 3IN0A 2DV6A 3H4FA 1PAZA 4YSTA 4AI7A 4DP6X 2Q5BA 5B1BB 3ABKB 4YSOA 2X87A 2PP7A 3IE9A 1TU2A 4BWWA 1SFDA 3V9EA 4YSRA 2WO2B 1B3IA 1JZEA 1CYXA 2WO3B 1AIZA 1TEGA 3CDZA 1M57B 3FQ1A 3TASA 3EH3B 1GR7A 5B3SB 1JXGA 4L0PB 3PAVA 3FSVA 3AY2A 3NSCA 1AAJA 3UABA 1NTDA 2HLEB 4UANA 2EIKB 2Y69B 1BYPA 1OE1A 3HB3B 4DPAX 3NJLA 4KO7A 4KOCA 1DZ0A 1V10A 1SJMA 4Q89A 5I6NA 3TA4D 1NIFA 1A4BA 2P80A 3CVBA 1ZIAA 1KBWA 2GBAA 2IWKA 4A68A 1KV7A 2TSAA 4BWTA 2Y1AA 5TK4A 1NPNA 4BXSV 6PCYA 4AZUA 1NPJA 4HCFA 2UXGA 4TXVB 4E9WA 2AZUA 1SF5A 1JXDA 2FJSA 3NSDA 4A66A 2VW4A 2DWTA 1SDDB 1EZLA 1PMYA 5I6PA 2GI0A 2I7SA 3AG1B 1W6LA 4CSPA 3SQRA 5EHFA 1UATA 3X1BA 3ZBMA 2UXFA 1M9WA 1TEFA 3KW7A 2J5WA 1IBZA 4KO9A 1I53A 2MTAA 4WKXA 2EIMB 4JHUA 4FAAB 2W88A 1JZFA 5PAZA 4FA7B 3AZUA 1ZV2A 2CCWA 1L9RA 1WS8A 2N0MA 3N55A 2XU9A 2YXVA 4A2EA 4E9YA 4NB7A 4EF3A 2DY2A 4HAKA 1NZRA 4A2HA 4A67A 2EIJB 1A4CA 1KBVA 1GY2A 2FQEA 4X4KA 3OD3A 1AS6A 3AW5A 7PAZA 3GYRA 2BZCA 4KNSA 2IWFA 2J57A 2GB2A 1E5ZA 1ZIBA 1KCWA 3ASNB 1AZRA 3FYIB 1E67A 2CUAA 1L9PA 4P5SA 1AZCA 3NJMA 2BP8A 3UGEA 1JZGA 1XMEB 5AKRA 3ERXA 2R7EA 3AG3B 4HZ1A 4QLWA 4YSQA 5D4HA 3QJRB 2UXTA 5B1JC 1FFTB 1J9SA 2FWLB 3ZIYA 2IH9A 2GC7C 2HRGA 2JKWA 2VSMB 1ILSA 3WKQA 2IDUA 1V54B 1AOZA 1L9OA 2HZHA 1NIEA 3S8GB 2CAKA 2XVBA 2XWZA 1PNDA 1BXAA 1SHXA 2BP0B 2YARA 4GP4B 4ZK8A 2XV2A 3OMAB 1L9TA 2VSKB 2BWIA 5LDUA 4JHVA 1ASQA 3T6XA 3WI9A 1XB8A 3T71A 1IBYA 3FU9A 4A2FA 1W6WA 1A3ZA 4JKNA 4HCGA 3FPXA 2ZOOA 1EHKB 3CDZB 2ZWNA 9PCYA 2FNWA 4UAHA 2PCFA 5I5MA 1J5CA 7PCYA 3S3DB 3IN2A 2YAQA 1RZPA 5AFAA 2FT6A 4E9TA 1SDDA 5AZUA 2QDWA 2IWEA 3UADA 2DYRB 1A65A 3NT0A 3T6ZA 2H5UA 4KNUA 4BDVB 3NSYA 1ASOA 3WIAA 2JXMA 1XB6A 4YSPA 2IAAC 1VLXA 3EHBB 3WG7B 3CG8A 1BXUA 1J5DA 1GS6X 4YVUA 2J56A 1RKRA 1KGYE 1NIDA 4HCIA 2AFNA 4F2FA 1WAEA 2YAFA 1DYZA 1MZZA 3PPSA 1E5YA 2FTAA 3OMNB 5ANHA 1ZDQA 2GHZA 4AKPA 3ZX1A 3OMIB 2J55A 3PAUA 2XXFA 2CJ3A 3SBRA 1PZAA 3UAEA 1ILUA 3S8FB 2PPFA 3FU8A 1QLEB 1KDJA 3V9CA 1X9UA 4G70B 1AQ8A 2JFCA 4F2EA 1KYAA 4GY4A 2PCYA 3T6WA 3FU7B 3NSFA 2LLNA 5I5JA 1AANA 1QNIA 1NICA 1XB3A 5I5IA 2GIMA 5B1KA 3PCYA 2I85A 2HXAA 2HRHA 3FS9A 3NJIA 1JERA 5B7FA 2YAEA 2BHFA 2GSMB 5IY5B 1JZIA 4YSSA 3GDCA 4G7RB 3QJSB 3UACA 1BAWA 1ZDSA 2H3XC 4UF7C 5FC9A 5I6OA 2PPEA 1AS8A 2UX7A
chains in the Genus database with same CATH superfamily
2I7OA 3UO8B 3CMOL 5J9PB 2JELH 4OQTA 3STBA 3MRKA 1WISA 5A1AA 2AF2A 1NLDL 4I5BA 3RIKA 5CEZL 1OB1B 3GO1H 4A63A 2PTTA 4JFED 3ASOB 5KYWB 4JKPH 4AH2A 1LK3H 5CJQH 1RH8A 4XN1A 5C0RH 2WN2A 4MXQC 1RZFL 3L3GB 2NR6A 4GQQA 5FYKL 4HGKC 4GRMA 4TNVF 3QC5X 1JXFA 1AG6A 1SLVA 1IC0A 3K2IA 4G8GA 2BNQD 4IIQB 4OFPA 3DPDA 4KKNA 3UFIA 1IEAB 5DEGA 4PRNA 4QHNA 4PP1D 1AXSA 3QUMB 4RGNC 3RURA 2DQGH 1WZAA 3GS4A 1QHOA 2RACA 3HN3A 3QEQE 4JZOA 1H6EA 4K9EH 5CILL 3T5WA 2TAAA 1PZ3A 3BJ91 4BZ1L 1TCRB 3NFPA 3BO8A 4TSBL 5DS8A 4ELMB 3MLZL 1UADC 1SHWA 2ARJB 1IJ9A 1FL6B 2HN7B 3VXOA 3BRGC 3ZE1F 2YA2A 4XXCA 2XTJD 5EOQH 1H8SA 2N1TE 5KSBA 5E8NA 1T89C 4R5XA 2X4RB 3VD3A 5T8IA 4HEME 4XBPB 4LOVA 1JCKA 3SY0B 4X5PA 4Y4HC 3VSQA 1F3JB 5H35A 1QBLL 5B7EA 2ENPA 5FM5M 5IESL 2W1NA 3RGBA 1D5MB 4NO2A 4UTBL 4D0DA 3HJEA 4U3SA 2V3DA 3FSZA 3BQUA 4GG8A 2B3IA 2MQ3A 3WFCL 2GC4C 1UXWA 3H2WA 3T0ED 1JTTA 3K6IA 4LNVA 4B9PA 2PYFB 2P5ED 4NZ8A 5K9KA 4X9IA 3U2IA 3NACH 5AWNL 4IRJC 2B2XH 1VKXA 4HSAC 4U6TA 3H9SE 1A4JB 3MRIA 4V1DE 2V33A 3CHXA 1ET7A 2VDNH 1J9QA 1PZSA 3WNNA 3CN0A 4GG8B 2E47A 3QJTB 4NZDA 4POZC 4XTRD 1RZJL 3ZDZB 4P5TA 3FCBA 2CK0L 4IIQA 5IJVA 4R97C 1IZJA 2XN2A 4H0HB 5E03A 3UTOA 4DSYA 1PZCA 35C8L 1V7NL 3O3AB 5F7HA 4AMXA 5MEND 3CMOH 5F8RC 2QTVA 3OPZL 3ARDD 2XBDA 3II3A 5I26A 4P23B 2DYPB 2RALA 1Z32X 1TJIH 2LVCA 4FX5A 4JM4H 1WZ1L 5IK3A 5EU5A 1CC3A 1I1YA 3WS6A 3C8KB 5I1LB 5DS8B 3WHXA 5JW5A 3LZPA 4HQQH 3TU6A 2W9EL 3V0WH 2WNXA 4LSSH 5I74C 2DIAA 3LPGA 4W1TA 3F58H 3WIIH 2XWBA 3CFJB 2BNQE 2CK0H 3X1NA 3BWUF 3LRMA 3PIQB 4XTRC 1ZGLP 3GDBA 2QMKA 3NIDE 3UYRL 3WFHB 4JZJA 3OKKA 2ILLA 1U8IA 1DN0B 4OB5L 3K6SA 3K72A 1JHKH 1KLGA 4UQIM 3SQOL 4WI7A 3MLZH 4FQXC 3V7MA 2W65A 2AJ3B 4Y4HB 2PTTB 3REWA 5JOFA 1X44A 4QI3A 3D87B 4FQ1L 4PRAA 2FUTA 3V0EA 1BVOA 2PLTA 3W5NA 3NG5A 5FGRA 2YD3A 1JF5A 3HPJA 4FLOA 5E8PB 2P42B 3G5ZA 3D1MC 4E9RA 4Z3FA 3BQUC 4NXKA 4N2GA 2I9LB 1TQSA 4NM8H 1FQ9C 1S9VB 2UZXA 3ARGB 1RZ7L 4R4BB 1D5IL 3S34H 4ZMOA 4GS7B 1OCRB 1E65A 1RI8A 1UH4A 4ONOA 4MJJA 5D1QB 4XNDA 2AJZB 2IPUK 1IKOP 3D18A 3UZVB 2CJTA 3WHXB 3ARUA 4R96B 4RRPM 4MMZA 4ZO8A 3HPLB 4CA4A 5EU5B 3B9DA 4Y5YC 1FVDB 1K4DB 5FKAB 2DYPA 4P5TC 3P77B 3VFNB 3SODB 2DLGA 3U0TA 4C56E 1UB6A 3N5AA 5FS5A 1ZT7A 4KRMB 4X9GA 4ZO6A 2XKSA 1F02I 2FH8A 3H7BB 1JI2A 3GSWB 5FYJU 1HYSC 4OW6A 5HYJA 2OTWA 2N4IA 2OYPA 2B59B 3PIQA 4MVBC 2Y25A 4B9FA 3L5XH 4QRPE 5B7MA 4JRFA 5FO7B 5HYJD 1FAIH 4Z0BH 3P3TA 4OZIB 4N6QA 3MRIB 2H32H 2C3VB 4OR1A 1Z5LA 5L2KD 4CSZA 4NM4L 3VD4A 4NERA 3UTQA 3B6SB 3TZVD 3VXRB 5EU6D 3VYOA 3OLDA 1CLZH 5T33H 3B9VA 3BQVA 2OW6A 4CNIA 3D85B 3O6MH 3DUSA 4NQUA 5C9JB 1NGYA 3KPPA 4JM2F 4WVRA 3BVTA 2Y7QA 5ALCH 5FUOL 1R5VB 2EKSA 2Y4SA 2YGPA 1TU2A 4WFFE 4GRWF 3K71A 1J1XL 5IMKB 5TQ0L 1B3IA 2OBGA 4MA8L 4BA0A 3M1OA 1JHKL 1GJWA 2DMKA 3SQOH 2EVJA 3NCEB 1GVIA 3EH3B 3TLRA 5AKSA 3ZMEA 2GEEA 4BZ2H 3UABA 5C9KA 3S35X 2VLMD 5FKPA 4KTYA 2DBLL 4K3EL 4P57B 1CLZL 4U6YA 5T33L 3K4ZA 3O6ML 4W4OA 4F8TA 5L6YL 1FNHA 3VWKA 5IWLA 4NM8L 1FH5H 3QDJD 3TCLB 3QUKA 4Q58C 1HQRA 1CK0L 1FCGA 1S7QB 5E5RB 1N6QH 5AVSB 3RBGA 5HHPB 2CGYA 4KPHH 3EJYC 4IMLA 2BNRB 4QF1A 1VPOH 2VLME 4JVUA 3CFEA 2J7LA 4QIRA 4PJ9B 1KTKE 3RIFF 2UXGA 4U7MA 4XAKD 5BRQA 3BEWB 4BFJA 1LO2L 1WGOA 2WUBH 1UKQA 2OMTB 3IU3B 2I7SA 5BUPA 3CC5B 4LHUA 4FYSA 3SDDA 3SQRA 4R90L 1C8PA 2QADC 5FF6B 2NX5D 1TEFA 5E8DL 2H3NB 2Y24A 3J8F7 4KK9C 3IYLW 5L2KE 5H2BA 3ES6A 3OAWA 4QHNB 1JZFA 1A7QH 1TVHA 2WXMA 1G7HA 3N1FC 3O6KH 3OF6D 4LEEA 4YO0B 1I85A 3QFDA 3ZMNA 3ZO0A 4KNQA 5GRJH 1FAIL 1YAZA 2W07B 3BRDA 1MUJA 3JYCA 4HDIA 5E51A 4XO3A 3C6EA 4W9GC 4MAYD 4KJQC 1IT9L 5T5FL 5AUMA 3T8XA 4XMPL 3PHOA 5JXEA 4QXVA 2C9AA 4PSPA 2J8UF 5CN3A 2ZYHA 3EFDL 4NPKA 1Q9WA 3HCVA 1QW8A 4JY5H 5FWRA 3FO2A 1E4KA 3FYIB 5AVYB 1E67A 1NC2A 3UZQB 5C2UB 4HSCX 3M17B 1EMTH 4V2BA 3LN9A 4FG2A 3DOSA 1XMEB 2WIIA 5FUOH 3X11B 3ERXA 3WS3A 3H6JA 5LG1A 3ECVA 1FN4B 1U4FA 4N2EA 3X12B 1FAKT 1JHTA 2ZUYA 3IT8D 3KVPA 4PJGA 4DESA 4FZEL 4MASA 4PJ7F 2EDRA 4P8QA 3Q5OA 4RNRB 3VX1A 2GC7C 2Y36H 3HOGA 2EDXA 2BIQA 4M6AA 2E7HA 4OUOA 2EO1A 5DLML 4JQIA 5D7LE 3FONA 3RY6C 3TH3T 5LUMA 5DVKA 1ORQB 2J8HA 2BVPA 3MBEC 4L3AA 4X7TB 1YSOA 5ESAA 2YARA 4HX1B 5F0JB 4AW7A 5SWZE 2PO6A 2HVKB 5EU7C 4L1LA 4JFFD 5JPMB 2YSTA 5FO8A 3NCBB 1E9PA 3BDYL 1N67A 2WQAA 3DJZA 4N86A 2QLYA 1AGCA 4HFWB 2Y1ZA 3HZKB 5BS0B 1IBGL 3BUDA 4XODA 2A9DA 2AJYL 2RFXA 5D5MB 2YN3A 1BYNA 1DJYA 4BGLA 5GS1A 1Z3GL 4ZOBA 2P8LB 2CGRL 4WHTB 4R2GD 4OLWH 4TLKA 3QEHB 1M4KA 2PCFA 3OAUL 3BE1L 2ITEA 4R7VA 4Z77A 1PKQE 5EF0A 3EFOA 2C1OB 1SOXA 3ZE2F 4PJIE 5IMLA 1TTRA 2TRYA 1AZZC 1BBJA 2R27A 3HG5A 3LS5L 2YA0A 1CLCA 3TNNA 4GT7A 4PJBA 4R90H 1FRGL 5DUML 5DO2D 5E8DH 4MCMA 3FKUS 3L7EB 4NQSA 1GMEA 2B0SL 1M42A 1ZY9A 2IAAC 1WUNT 1XSIA 5D1XE 3D52A 5IHZA 5ADOL 1NGZB 1CGSH 2AJYH 4O9HL 5HGGS 3RWIA 3KWWA 3SKNA 5KYUA 4DZBA 2AEOA 2VIRB 2Z64C 4H5SA 1OAXH 2A6JA 1JF6A 2EE6A 1Q1JH 1KSRA 1IAII 2EXYD 5L4MA 3FULA 2GCYB 1OGTA 5C08D 5AZEL 3PJSB 2DWEB 3BH8A 2QADD 3L4XA 4RMVA 2I07B 4EKJA 4F7MA 4HJGB 3QUML 1B0RA 3FTUA 3S96A 3OKYA 4NC0B 4OTXH 2X42A 5HHOE 3GSQA 4Z3GA 4W9HC 4ODVH 3CK0L 1HXMA 1W91A 4Z7UB 4JBSA 4DGWC 4ZXBB 4E41D 2C3WA 2G60L 1J18A 2YD2A 2DWDA 1ZRUA 4UOW1 4AQEA 4PHXA 5I5JA 2WXNA 3BH9A 5I15H 4X83A 1IL1B 3HNTH 3VD0A 2B5IB 4ZDHB 4JFDB 3H55A 4W9DC 2NCMA 4NO0A 1QBAA 1TF4A 1TLKA 3E2HB 4PMFA 4HJGA 5G55A 1KTCA 3BZEB 2B20A 1CDCA 1XH3B 2YZ1A 3V6BR 2YAEA 2YD1A 3RPIB 1BVKA 1S9WB 2IXQB 1ZVSB 4KQ3H 5KYYA 4G7RB 5AB9A 2H3XC 4PGDB 5KVGE 1XCTB 1U8NB 3MCG1 4W4NA 4OFVA 2UX7A 2FUQA 5FK9A 4AM0A 3RWIB 1FG2B 1FPTL 3R0NA 1NWPA 4KJQD 4NN5C 4I8DA 5IHZB 4ZW3A 3QDMA 5F1NB 5C08A 1M05B 1K8DA 5IQMA 1N59B 2ZOKB 2KS0A 5IB2B 4FKKA 3ZK0A 1D9KB 4KROD 5D2NE 3RL2B 3GHEH 1HXYB 5DUPH 5H37H 4PIBA 3QNXB 1V27A 1MRDH 3QDGA 5DJYB 3SZKC 1UWEL 1X9RA 2XSKA 4QRAA 2ZCHL 3RB7A 2XTLA 2PYED 3OM3B 1U8HB 1JGDA 4EN3B 4XCYA 1IKNC 4HUKB 4ODTH 4HFUH 4YDNA 3TV3H 3MMEB 4OZ4A 4WJKB 2IDFA 3HN5A 3GNMH 2QDVA 1SLWA 5AOKA 1GS8A 3TVMB 3DIVA 3A6BH 1RMFL 3OHXB 1IGML 2J20A 2VXSL 1DVYA 1GYUA 3JTBA 5IQNA 5TE7H 1BSIA 5AQ0A 5KBPA 5L8LB 3PJLA 1CXKA 5DUPL 3QR1A 2XQYK 5EUKB 1E27A 1HDMA 4AW4A 3QUMH 3EXJA 1U3NA 3L54A 1BFTA 6PAZA 3FTZA 1EHLH 1ANUA 2OSLB 3TBYB 5IEKB 2BSRA 3T2NL 2WZ0A 4L3ED 2EC9T 3B7TA 3IRZA 3BI9X 4P2QA 4M6NH 3PP3H 2NT0A 5DZVA 4E9VA 1RMFH 2VXSH 4I7ZC 5I8EB 2HRPL 4HWUA 3O3BA 3A67L 5TE7L 3BGAA 2A0LC 4HT1L 4ZUWB 3VFVA 1BQSA 1ZS8B 4L8SA 4BA8A 2A73B 3MV01 4JY6A 4YIQA 4L2LA 3DX0A 5D7IB 3L1EA 3FBKA 4E68A 5EO9A 3UYOD 2QSTA 3EJYD 5E70A 4JM0A 2CRIA 1ZHKB 2QPSA 3BUBA 2J12B 2XTJE 4HALA 3V52L 2HP4A 1D6EA 3QUYD 3T1FA 3B7RL 4PP1C 3A6CH 2V7NB 5AOJA 1ITBB 1TPXB 3VGAB 5BW7A 5C0FB 4J1UB 1CD1B 1P4BH 1H3TA 2XWEA 1TTCA 3FN3A 5FYJD 2YGNA 4FTDA 3O2WH 4Z7NF 1D5RA 2AV1A 2FLMA 4ZX5A 2XKUA 1GSMA 1RCYA 5GGUA 3ABLB 3LSOA 4K3HA 5D6DA 5JHDE 5LG6A 2OMTA 4FP8L 2YOAA 1MAJA 3MU3A 2IC2A 2D0HA 1RJLA 5GGRA 2R0LL 1S9XB 1S8DB 4L9DA 3KW8A 5KZCB 3QI9B 4QO1A 4XOBA 3EO0A 3HZ3A 4TUJB 1G84A 5KANG 4ODSL 1U92B 3MV7B 5L2JB 1NANI 5C0IB 2E59A 4Z7VF 5DZ9A 2NX5A 1YDPA 1MG3C 1OANA 4PJIA 4GXUM 3VB9A 4WW1B 1RK7A 3U4EB 5CCJA 1QWNA 1N5AA 3TF4A 4JJ5A 2ZP0T 5MI0C 2X44D 4DZ8A 3DRQB 3A23A 4O00A 1CG9A 2FO4B 1FI8C 1WFJA 2ZYRA 3UGUA 1L0XA 3TBWA 1XGTA 4FABL 2NY1C 1XR8A 4HJJH 4ZFZB 1D5ZA 5EZJB 5DXWA 3QJFB 4M1CD 3CD4A 1BM3H 4GMTH 4OLXL 5EC1A 5IVXE 2R0LH 3EF7A 3PAYA 1O7DC 4YQXL 1GJUA 3K8KA 2N7BA 3RBSA 5IVXB 1DQJB 2IH8A 4F8OA 1GC1H 2NNAA 3MAWA 3PNWA 1JUFA 1MEXH 1MHCB 1O7SA 2C5DC 5CU9A 3ZHDA 5DMGC 2PUQT 4HUXA 3POCA 5D1XC 3BZFB 2ED9A 1AXTL 2H0PA 4N8VA 2H26B 2WCSA 3TBWB 4X0KB 1D6VH 3H2QA 1UZ8B 2XN9A 1KG0B 5E1GA 1ID5I 1CFNA 2GFBB 4KJYB 3MBXH 4M3HA 3DTXA 2NNFA 3E1F1 2WD0A 4GUCA 2NNCA 4LNRA 5GRVL 1A9BA 4PH8A 1EAOA 3VXPA 3VXRA 3U25A 1KN2H 4TPRH 4ELDA 4XVJL 5HDQH 2EIDA 2JNZA 1PD0A 4LL1A 4WEBL 1MVFA 1QI5A 4I77L 1U8MA 5INCB 4FFWC 2X3AA 5E5UB 2K6WA 1DJHA 3OR7A 4BUGA 4J3OG 4FLRA 2VXUH 4RWYH 2WXRA 4P3WA 1ETZB 5D93B 1KNOA 4PJXE 5EUOF 3H9YA 4NX0A 2LU3A 1WC7A 3VG0L 1I9RH 3IFOB 5HPOA 2B59A 4MZ3A 3N43F 4UNIA 5DHMC 4ZO7A 2NTFB 3QPXH 5D71L 1NINA 2WNKA 2RJMA 4HS8H 2WKLA 3T65B 2IAND 2K9UA 2DB8A 3ZE0B 2R2CA 3FMGH 3A4AA 4B97A 4UT9A 5D2LE 1YPZA 4NYLA 3W56A 2IG2H 3MYJB 3MKKA 5FWQA 2OCCB 4KTGA 2Z1PA 3LZLA 3ULUH 4YE0A 1A7PH 3WV0A 2FIKB 2VDPB 4BWWA 3QO0A 4HHAB 1Z1WA 1BHGA 1D7FA 3OB0H 4R4ND 1V3JA 1DUZB 2BVOB 2VN5A 3MCLH 1I3VA 2V5MA 4AGQA 5AVRB 5HDLA 3AS2A 2Y5EA 3TASA 2N1KA 4HMDA 2HKAA 4KX7A 1MY5A 3FSVA 1UEYA 4J3OC 3G5ZB 4XNQB 4AEIH 3HAEG 2CD0A 2HLEB 3A6OA 1U8OB 2QL1A 1MWOA 2A9BA 5DURB 2X2HA 3P4NA 3PHAA 4AC2A 3WE1A 1RPKA 4OY9A 1JZ7A 4LIQE 4O02H 2OSLA 3TBYA 3WMSA 5KW9H 3FW6A 5J11B 3BMWA 4D0BA 5DRXA 5DTFA 3C2AH 3SE8H 2IWKA 2W0KA 3LN5B 4JFQA 2Y07L 4POUB 4PB9H 2W95A 7FABH 4LGPB 4Z23A 3EBIA 2AXGB 4FHBD 4UOW0 1B4LA 3WHE0 1MVUA 2DICA 4PEEA 5K93A 4LSTL 4FEMA 4E9WA 2NX5E 4LNRB 1PW3A 2X2IA 3NSDA 4HAFA 3B3IA 3AT8A 4JFEB 4OKDA 3WFZA 1SDDB 2IGFH 3IDMA 4FJ6A 4MNHA 3TCXA 1UZ8A 2XN9B 5C6TL 1OSZB 3U46A 3C8DA 1N3NB 3GJFK 5M7QA 2H6PA 1H8NA 3KW7A 5A2FA 3NAAH 3WXWL 4XP6L 3WNMA 5IB5A 1JXJA 3CFKB 4FA8A 3AFLA 2R1WA 1DBBH 2CCWA 2NYZA 4OF7A 5IB3A 1WS8A 3VFTA 3MSPA 4MD5A 5INCA 3PF2A 5EU7E 3EGXA 4A2EA 4W9CC 3DROB 4RETB 1HOCA 2P8MA 3CC1A 4X6BB 4PRIE 1ADQH 3OLGA 3QPXL 2CHDA 4RSVA 5D71H 4CVUA 5I73B 2FGWL 2WNWA 5T3XH 2KPNA 4WW2B 3N1MC 1WFNA 4DGUA 2CRYA 1IBBA 3L2MA 5F7UA 3SE3C 2OI9C 3QFJA 4H1LG 1E5ZA 3EJTA 2WPGA 3QUXA 3S5YA 4FLQA 5EZLB 3QA3B 4PTTB 3TN0A 3BHBB 2VLJD 4LGRB 3QS3A 3HZYB 1UD4A 2Z8RA 1NL0L 3HRPA 4U1KA 1MLBA 1CDHA 3B7YA 4QY8A 5DMJB 3UAFA 4R8WH 5A2LH 3QJRB 5C70A 2ZE0A 3MCLL 2IH9A 2PTUA 2VDOB 4I2XA 2VUKA 3I9IA 1ZCRA 3KNBB 3LTVA 4ZFZA 2GJ6A 3DX6B 1AD0A 2NY5L 2A9CA 3FTGA 2IDUA 3LIZA 5D7HA 1ITCA 2XVBA 3KHOA 3D2UA 5SWSA 1AQHA 4DZ8B 4UTAL 4ZK8A 4ZS6D 3AXLB 2R8SL 2AW2A 3MHZA 1YDPB 2VM9A 1FL6A 3SOTA 2F58L 2K45A 3TH2T 2DLEA 1FZKA 3DI3B 3HG1D 1IBYA 3FL7A 2CSPA 2K8QA 1FE8L 4PB9L 7FABL 4PRPB 1TITA 2OMWB 4JHAL 4JZOB 2AJUH 5BRZA 4HBCH 4M93C 5E2TL 4BYHA 1BX2A 3FT1A 5MENB 3RWCB 2MHAB 2JJWA 3CHOA 4PRNB 2MQCA 1QW9A 4YPGA 1GMIA 5GPRA 3FT9A 2X1XR 3MCYA 3W9EA 4G8GB 4RIRA 4ZG1A 1NCDL 3KWWB 5DYOA 1AZVA 1BQUA 2VR4A 1AR1D 4WO4D 3IGAA 3SBWA 1RUML 4QTIL 2CUIA 1D9KC 5BJTA 4J3VA 1ZV5A 3UTTA 4MZ2A 4ZYKA 4FLSA 3QIWB 2BY2A 4ZSOA 3B2XA 3US9A 4YSPA 2Z4QB 3FDWA 3WIFA 1S3RA 3HB3C 3ORJA 1G4RA 1K3IA 2F53E 3SB3A 2AXHA 2CKBB 4I85A 3GD1C 3VDAA 3ZL1A 3D69A 3MRPB 4O02B 4ZD3H 2VZ1A 2PO6D 2RB8A 1ETA1 1X5FA 3SDXF 1JPTH 3O4OC 2R69A 4FQ2H 1U91B 5J3HC 2PXYA 4M5TA 4PVMA 2X4SA 3PPSA 1OL0A 1ADQL 3FB8A 3GMQB 5TDPA 1Z9NA 4NQCA 3OMIB 2C26A 2VC2B 1JGEB 1EXHA 1PZAA 2Y06H 5IQ7L 3LPFA 5JHAA 3RUGB 4U31A 1QLEB 3KHQA 4HV8A 1D2OA 5FX3A 1A6UH 2VZUA 2YIHA 3R4DA 2G9KA 5D7LB 1ZJBA 1JWSA 3LVEA 3S98A 2LLNA 1T5XA 5CZKA 1KGWA 2CIIA 1VJSA 3GSNH 3BKYL 3KL5A 2XETA 4ZXBC 4BRJA 2X40A 4G7VL 4ZZKA 1EVTC 3U4BL 3CHQA 2IV9A 2EXYC 1R0AL 3NN8A 5EFIA 4HUMB 4A7UA 4ONFH 3F7LA 5JR1L 1TUPA 1S7XB 2WBJD 2V3EA 4WGKA 2ZOKA 1QBBA 5HYJE 2C7UB 4KGJA 3BWZA 3TT1H 4YSSA 4ZNEE 2GJPA 3EG9A 1MN4A 4CDGC 3ULVC 4AZ8A 1SVCP 4JGJA 4FKHA 1JTPA 4UTAH 4ZNEA 3B2MA 5HYEA 1T2JA 2WZAA 3V4UL 3WEOA 4DGVL 5I6XB 3NIGF 1BZOA 2EH7L 2CR6A 4J23A 4JPQA 4AVHA 4K8RH 3VWJD 3SPVB 1LEKA 1QD0A 4ZPVA 1J9TA 2Z4QA 5BS0D 1E9OB 3EHBC 4JE4B 4N85A 4EKXA 3QAQA 4M4RB 2IBZX 1DFBH 2X4PB 1BEYL 1UD3A 5FYLD 5GZNC 2PKDA 3OKEA 3SDDD 3QNXA 3CPLA 4XE0A 3SBWC 3VFRA 3FH5A 4FXKA 4ONFL 1A4AA 1D9KA 1KZQA 5E95B 2BHYA 3LDBB 2HVBA 4HKZB 3B7UX 5IOPA 3TT1L 1S3KL 1RVFL 3QEQA 3QI9D 5ITBL 1J5HA 4FXLA 4FTVE 4WUUA 1IZKA 2ENQA 3QIBC 3BZDA 3QXDB 5EU6B 1ONQB 5EWIL 2SEBA 1V5JA 3V4UH 4DGVH 2VMEA 5FF6A 1I3RB 1WWAX 3GK8L 3LKNA 3NVQA 4AK2A 2DH3A 2VDKB 4AVKA 1MCWW 4GKZA 3IJEB 3HMXH 4OAWB 4P2AA 1SXNA 4GB9A 2DLTA 3FCSB 4M6ML 1Y0LA 1WSST 2VLKB 3ME0B 4NQEB 2VRAA 4MJIE 3BPCA 3N40F 2R4RL 4N8UA 1MRFH 2NZIA 1OTSD 4YC2B 5IQ9A 4WNSA 4MJIA 4H5SB 3TVMC 4GFTB 3MNVB 2A77L 3BIKB 4P59H 5DD1L 4Q4IA 1AR2A 1F6AA 3VJ6A 2B1AL 1M3IA 5SX4H 3QQ4A 4APXB 3AT9A 1VADB 3V6FA 3LZQA 4YHYB 2Q8AH 5ITBH 1GS7A 3GS7A 4WI5A 4J3TA 4K5PA 4Y16A 5A3IC 4IOIA 2X7LA 1MLBB 3ENEA 3KVDD 2DQEL 5DK2B 4K0OA 3UAJC 1WFUA 2E7LC 3FCUB 3WLBB 2E7CA 4AE0A 3QA3A 3HZVB 1HH6A 3CDGA 2A7BA 4HJ0D 4WQOA 4OZFG 1GKOA 4TSAL 4E9QA 5C97A 3U6XA 3N91A 1WF5A 2W80C 1RUAH 3TZVA 1TO5A 3RA7L 5DMYA 1ZJAA 3NCXA 1KYOK 4X7EC 1IGCL 2AXWA 1IC5H 1MXGA 2CCLA 2X9WA 1K4CB 2B1AH 2VQTA 3H4HA 3PQYE 4GI9A 4DGIH 5IOPB 1M3JA 1UWGL 3O6LL 3MXVH 1K3ZA 1NBVH 4EI6A 5LDSA 1E3XA 5F7YC 1SNRA 4JCMA 4UUJA 5IHLB 1E9PB 2A1WL 1QFUL 1A6PA 5C0JB 5HHMB 2BY3A 1LK2B 4BFBD 4DN4L 5SX5H 4IRSD 2DQEH 3KWVA 4G59C 4N0FB 2WBJC 3PWJB 2LLGA 3TNNB 2B14A 1L9MA 4OAWA 2ZSVB 1IM9D 3IEAA 2HFGH 2OSWA 1CLVA 3D3VA 3SDXA 5CEZH 3VI3F 4LQ1A 3RFZC 2FJHB 4WTXA 3EFOB 1KIUB 3ZSTA 4MNHB 3GM0A 1LK3L 1NCHA 5DC4B 4TUUA 4FTVD 5E99H 1OARH 3QIBA 4BXVA 4GSXA 1COBA 2C7UA 3EHBD 1FCCA 1W9XA 2XWXA 3GB7A 2GQHA 2PYEB 1H5BA 3ESVF 4IJ3B 1E43A 3FT2A 1FV1B 3M17A 1KGXA 1QFUH 3FN0H 4WGVB 4ZUUA 4RH4A 3PREA 3NYKA 2H2PD 4JRLA 1MHEB 1YJDC 5BUGA 4L1SA 2FD6L 5CP7B 2MCAA 1A8ZA 1FSKB 1II4E 4F20A 1HHJB 3LH2H 2QZQA 1CF8L 4IHOB 1UCBH 5CP3H 2VL5A 3O45B 1AZUA 4U4BA 4F37F 3T8MA 1I8KA 4OJCA 4ZFGL 1HN1A 4TOYH 3UZVA 1CF1A 1OSYA 2ADIB 5D1QE 2LHAA 3RUGA 1FZMB 1KFGA 4Y16C 5CN1A 3SGJA 3HG1E 3QCTL 2FSDA 3OXRA 4FFYA 3RB5A 3V6OC 3DPBA 4GBXB 4IKIA 3MA7B 4E36A 2ZOTA 1TVHB 2EDJA 1F6FB 3LRSB 1WZLA 4EE2A 4HUWB 4FQIL 5HI5D 4FNTA 4AJYV 3LN4B 4ADGA 1XF5B 5MI0B 1A3LL 1X5AA 4G9DA 3WKPA 5BZDA 2BC4B 4HGWA 4NLHA 4M02A 2H47C 5AG9A 1YEEL 2FZ3A 3L4YA 1F4HA 4MLIA 3S4SA 2XA8H 3OBAA 3QORC 2ZXEB 4WNJA 2L3BA 2Y7NA 3GO1L 4TSAH 3BEWA 3AG4B 1T1YA 5CR1A 3QIWA 4JRYA 3D48R 2JH2A 3K72B 4Q0XH 3TBCA 4AYSA 2N0KA 4DT2A 3SYPA 5HHQB 1QR4A 1IC5L 1KCBA 4S10A 3X13A 3AG2B 1HE8A 4XCNB 2Z91B 1LM8V 2D7QA 2DEWX 3WGUB 1SMAA 3PV6A 1IQWL 3RWCA 2R2BA 3GJEA 3Q43A 2DL9A 3EYFB 3S36L 4NOFA 3FFDB 3RYMA 4PRPA 2H3NA 4PJDB 2JI2A 5A2KH 2HKFH 3OR7B 4XMKH 3ZKMC 2CKBA 3IJHB 4PJBF 2KLSA 4NQVA 4PG2C 1RIHL 1S5IH 4UZGA 2OP4L 1U2CA 1BJ1H 2VDRL 2CM6A 2ZUVA 4ZSOB 2JJVA 1WV7T 5AAWC 2UVEA 4PJ9A 4Y2LA 1RV6X 3IKCB 4XMLL 4MDJB 3ULUC 3QCVL 3LXBA 3L1OL 3GKZA 5E56A 1KCVH 3KPSA 2VCOA 2AXFB 1NCIA 5AVWB 4CVZB 4Y9FA 3PQYA 4QCIA 4K8RC 1IQWH 4NNYA 4Y19A 5LGYA 4UT7H 4LRIC 1A0QL 1EEYA 1KJVB 5I18L 4MB4A 1FJ1A 2F8VA 2JJSC 2X4OA 5F7MC 3C08H 1M2VA 4WK0B 1QACA 2XCMC 2ZOLB 3UBGA 4NI6A 4KDTC 4TNFA 5J4MA 1NLDH 2TRHA 3SGJC 5T3ZD 4MD0B 4WF7A 4HYTB 3MYZA 3FTWA 4JKPL 4TOYL 2Y69B 2XACC 4N2MA 4ZUVB 4OZIA 4HWBL 1AE6H 2OSXA 1L0PA 2FRGP 5SX4I 5FGBC 4BZYA 4M48L 1U8KA 5TE6H 3U2SA 3QCTH 4N3UA 5E6IB 3TA4D 1SVBA 3A21A 5BQDA 1I1FB 3N1QC 4FQXB 1UOWA 3RI5K 1XF4A 1M71B 1P5UB 4UT7L 3RIAK 1E8YA 4DETA 5L2JA 3JTSB 3PJNA 5IHHA 1ZT7B 3BN9C 4MD5B 3D85A 1RJYA 1KY6A 4QO1B 4IGBD 4YR6B 4GXVL 2AZUA 4NO5B 2R1WB 3JVGC 2YZ8A 4GH7B 2VW4A 5IW1B 5I16A 4U1SB 1HILB 3KPSD 4EN3C 2IOMA 5I6PA 4IGBA 5TTRA 3ZTDC 4DOHE 3FB6A 3SPIA 3QFJB 4HQQL 4BRVA 1AXIB 1H9DA 5KJ4A 3DSFL 2VE6B 1F1GA 4JFEA 3ZUNC 1AXSB 4YLQT 5CUSH 3RWDA 2W88A 1RSFA 4PSRA 1HEHC 1DQMH 1ZV2A 3JTTB 4UTBH 4G6MH 1BAGA 3VD7A 4HKBB 4PJEF 3ZVVA 2XU9A 4FKEA 3LZNA 3SPJA 3D4ZA 1K2DB 4KKLC 2YGOA 1BFSA 2J8OA 1BZ7B 1OXYA 3QHTC 4WWNA 1TCMA 2VN6A 4QHLA 4H8WL 2VL4A 3AW5A 2VDRH 4ZS7H 2ZUQB 2BZCA 3W39A 1T03H 3D39E 1DJZA 3FTYA 2AK4D 1C5BL 4G9FA 1YY9D 2BHUA 4OQTL 1GL4B 5F7DB 2Y7SA 4MMXB 5L88L 2CHWA 4J3OD 4LPTA 4XMLH 3GSOA 3DXAA 3T3ME 3DSFH 3IAGC 4LRIA 3PGDA 4YFDB 3NJMA 2BP8A 5KSAD 5CUSL 4H25A 3GT6A 1JZGA 2HT4C 2CKBL 1IIKA 2FGZA 1PYWB 3AS0A 4JY4A 5CZVL 4HS6B 2YQ3A 4HZ1A 4BQCA 1BD2D 3C60A 4JL1A 5LBGA 4XWOD 1NEZA 2IAMA 1KTDB 3C08L 4Z7QB 2Q8BH 2WJ7A 4DN3L 5E8PA 1QLEH 5HJ3A 3WKML 4WI2A 4JQVA 2WBKA 1EX0A 4BHUI 4NC1E 5EN3A 1CE1H 1HXKA 2HPOA 4AJVA 3ALXA 4QRPA 5A3ID 2YK1H 2JCCB 5C86A 5KBLA 1DQDH 2CO6B 2D2CC 2BWIA 4OGYL 1E5UI 3DGGB 5IFJB 3QQ9D 4BZ1A 4R7DA 5AEAA 1USZA 4F8NA 1EGJL 2D3NA 5KS9E 1T80A 4KRPD 1M9SA 4IRZL 1KIPA 3JYBA 2EVFA 1KNOB 1U58A 2EXWD 1UA3A 3GSUA 1SJVA 4FLHA 3WJJA 4MA3A 4YXKH 3SN6N 3VQLA 4BQ6A 3VWJC 2VERA 2D7PA 1UWXK 3L3JA 3GSNA 3RVXD 2IH1A 1LO2H 3FZUC 3L4UA 4Z7WA 4JPIA 4B5EA 3NT0A 2CLRB 2P5EE 1A9BB 5I16B 4IBWA 1GOFA 1PD1A 3UDWC 4KJPC 3V6OE 4ZRGA 5DMKB 1EFXB 3BQUB 2SODB 3F12A 5FCUH 1OTTC 3C09C 5HYIA 4N9OB 1J5DA 3T8VA 1VZIA 2EDTA 3NIFE 1HIMH 4G6AD 1KPVB 3TC9A 4OVVA 5SV4A 4MCZB 4DVRH 1NIDA 2FHCA 3FOLA 1TO4A 1XH0A 4QRPD 1Z9LA 4LLWA 4GQRA 1KF9B 4Y4FB 5TQ0H 1XBRA 4KK5D 4OM1L 1BPVA 1I82A 4Y5XA 5DFVC 1F8TL 2ATPB 2NUTA 4EIGB 1IAMA 3QXAB 3FUEA 3U1QA 4NO0B 3BO8B 3K81A 1KDJA 1RZGA 1WBYA 4G6FD 4KH2A 4NC2B 1AQ8A 1ROWA 3C60C 2EDNA 4NJAH 4O2EA 1NCGA 1E4JA 3TBTB 3BAXA 4GKSA 4G6KH 1A66A 1EH9A 1Z0MA 2WLLA 5CZVH 1FH5L 4IU2A 4D0DB 2O5YL 3MUGA 5B1KA 3VFWA 3IS1X 4I4WA 3BD3A 4G9FD 2BCMA 1XGRA 5KG9B 2HRHA 4KPHL 4XXDB 3PHQB 4Y16D 2Z92B 3WMQA 1OGTB 5G4OA 3FB7B 2WP3O 3WKMH 1ZHLB 4RFNB 2GSMB 3GMOA 4WFGE 1MCJA 4JCLA 1B0GB 1HNYA 2HN7A 3BW9B 3L6FA 5HI5C 4QRTB 4WEUD 4NQVB 4TLSA 5BQ7B 2GVYA 5JMRA 1DCEA 3MX0B 2QVKA 1DQDL 1WFOA 2AV1B 3BVDB 3F00A 3ML8A 1N0XL 4V1DD 4ZS6C 1OY3B 4HLZH 1E0OB 5FDYA 2V7NA 2P26A 1N5AB 2Y72A 4N0CC 2AAAA 1F4XL 2VMDA 4PJAB 5DZPA 3MRFB 5D1ZI 1Z3GH 3FH7A 4R7NB 3K1DA 3UG4A 4ES8A 4OLWL 1OWRM 2JKNA 3F7RA 1Z66A 4J8RA 4A37A 4WO4B 1AR1B 4N22A 3CFNA 3MRLA 3QVAA 4QOKB 3EBAA 4NRZA 1S9XA 4HWNA 5CINL 5J57B 2H1PL 43CAB 5EEYA 1NMAH 4P9HC 1TQCC 4ZUWA 3NJHA 1AR1C 4WO4C 4OD3H 4LP5A 5AVQB 1D7CA 2QQLH 2DBLH 4K3EH 2CR0A 1AGFB 5BO0D 3ZT7A 3OTTA 3AAZA 1F4YH 2CLZA 1R24B 1ZT4A 4NKOA 4PWFA 2J2ZB 3WD5L 3NFSL 3QW9A 4AGOA 3BIBX 2DQDL 1C5DA 1WLHA 3CZUB 3OZLA 4P4KD 1NDGA 2CDGB 4W70A 1RZKH 2NY1D 2J73A 3CX5K 1IGYB 3AT0A 3HNVL 3PDDA 4U2YA 5EF2A 5EOTB 2UWEE 4APQB 1QG3A 3GHPA 1MFVA 3H0TB 3HC2A 4KK6C 3VA2C 5A6IA 3RWGA 2VXTL 4NKMB 4AQ8A 4LLYA 5J3HD 3N43B 4JFUA 3MJ7A 1INQA 1S5HA 1R3KB 1UJ3C 2J8UE 4P2RD 5CINH 2Q6WB 5GGQH 1QSFA 2BFVL 4WY7L 1Z7JA 2IVFC 3QAZB 3IXTB 4WV1C 4X8GA 1X7SA 4BK8A 1LO4H 2Q3ZA 3W2DH 3KPQB 3S4SG 1MDTA 1YMHB 3QEQD 2AQNA 2DRUA 4LFHG 3ZKNC 2DS4A 4XN8A 4CC4A 1A7QL 5HHOD 4WLCA 3D05A 4HLZG 3DX7B 4CW1B 4G2AA 3DARA 1MCSA 2E9JA 3HNVH 3PGFH 4OZFH 3H9HB 4WI6A 3R19A 4HHGA 2G75A 1HL5A 5KBMA 5IBLC 4YAQB 5TDOA 1T5WA 3KCPA 2FJHA 3V5DA 2DD8H 1DQKA 1EIBA 4XMPH 1JPSH 2KT6A 2P8PB 4O51A 5HPMB 4L37A 4PRPD 4UBDD 4BFIB 2YKLH 4R2GB 1Z3RA 1LO5A 4HPYH 4JY5L 4KUZH 3MRCB 2APTA 1FVEA 3ZDYE 3EIFA 2VUYA 3FRPA 5E2JA 1CE6B 2ZAGA 1P0SE 1ET8A 4Y4FC 4YZFE 4G7QB 4A6YA 4UMSA 1U8LB 5F7EH 3IFPA 4PN6A 4UDTA 2B1OA 5IMOA 4FRWA 1SXCA 3JWNG 2MPAL 3FQNA 1HK6A 4XBMA 2OX5B 5ALBH 3GI8L 2JTYA 2M1KA 4JO5A 3QIWD 3PGFL 4ZODA 4ANVA 2G3MA 5IVNA 5FUCC 3APCA 3EOTH 3IDXL 1Q1JL 4E5XG 3OMZA 3V4PB 4UTBA 1RFDH 3EJJX 1U2HA 4WO4A 4PJIF 2OFQA 4KI5D 2QFPA 2GSIA 1DSYA 3QZLA 5D4QA 5LNDA 1OLLA 2Y5QA 3U6RB 4NNXB 1CICA 3KXFB 2P44B 4PV9B 4LU5H 1HINH 1Q9OB 3HRZB 5JYLA 1XXFC 2E8YA 5HY9A 1IGJA 3VCLA 4F1SA 3CK0H 5B1JA 4IBZA 3LZFH 1OW0A 2DWDB 2JSFA 1VGKA 1Q94B 4LPXA 3RPBA 3SDAA 3OQRA 2DQDH 4S11A 1IGTB 4U6VL 1OCOB 3RTQB 3GXFA 4GYBA 3T77A 3IU4H 3ILQD 1ZPLA 2WTOA 3CZFA 2F8XC 2VISA 2FX7L 4GMSL 2G9HB 4CAGA 1S7VB 4JRXA 4Q8BA 1RIVH 3RDTA 1SYVA 4XGZB 1BQRA 4MJ5B 4OCRH 4WY7H 5F3HA 3FOMA 5L8JB 5L8KB 4K9JA 3UTTD 2VWEC 4M7LT 2Y7QB 4YNYB 1LO4L 1HKLL 3RTQA 5CR8A 5AB2A 3QDGE 3CCHB 3HBPA 1U8LA 1M7DB 3HMWL 3O2VH 3BLKA 4P99A 3C75A 3W0WA 4AQEB 1SY6L 4PS7A 1X5ZA 3ZYZA 2HB0A 2XNAA 1NM4A 4JB9H 4DP7X 1ADWA 3UJTH 4L4VD 1Z2KA 1E9QA 1FFNB 1HAWA 5GRUL 3D25B 3QFJD 4BFIA 4HT1H 4AKOA 1JPFB 3QWNA 2F5BH 3E3QE 3KCPB 4A7QA 2JMRA 3F7YA 3NJGA 1T6VN 1NSNH 3SSGA 3VNZA 4LLWB 4Z7IA 4KZEH 5TF1L 4DFIA 4RBPK 1TMQA 4HW6A 2DQTH 3D0LA 4MYPA 3QDME 4ZTOL 1Q38A 4Q6IC 1RUKH 3BIAX 1JNLH 2IADA 2X41A 1DVTA 2OV0A 2ZSWB 3P11L 1JV2B 3QIUB 1B4TA 2UUDK 5F88B 2VDRB 5CBAA 5K9JH 1KY7A 3HNTL 1U8QB 3DTDA 4YXHH 2VJ0A 1J8SA 3FQWB 1QFWM 3BD5A 4N2LA 1VGEH 5ERWB 1WA2X 3HVNA 1NH6A 4MBRA 1NCAH 4GRLA 1QHPA 3WNJA 3IDXH 1EERB 4NEHB 1JZ2A 2KH2B 3U4AA 4WDIB 1G7PB 2DM7A 3B2VL 4YS4A 1ZGLB 1BD2E 3ZKND 3KPRB 4NQED 4KVPA 4AYMC 3EW3B 3GJFH 1BD2B 2ITDB 1T5XB 5LBSL 4XWGH 3SDAC 4M7ZC 4URKA 2YKKA 1JZEA 4PP2B 3NCWA 3UC0H 3WXVL 2VR9A 3L3OC 2AEPL 3QRBA 1MCLA 1U8QA 2PTVA 4V2CB 1A9EA 1JPGB 3CH8A 1JV2A 1P1ZB 3LQZB 3QIUA 4M6NL 2E0PA 3RZCD 2EQDA 4NRYB 3SGEH 1KGIA 1NGXA 2A4EA 2WCGA 1UKTA 2HRPH 1KEML 1KTJA 2LLLA 3LKPB 4JO2H 3A67H 4PRAB 3KM1A 4EZJA 4TVPE 1J87A 4H88L 2ENYA 1DE4B 2EE0A 3MRLB 4KK9D 4Z7QE 1BM3L 1IV8A 4OLXH 2WB1A 5AUMB 3T8XB 5HHXH 4K8RD 1OQOA 1UWEH 1DSFL 3EGDA 3KPSE 5KAQF 4AGPA 4MDIB 1WWBX 2ADGA 3AREC 8FABA 4EI0A 4PREB 4CJ0A 2BS8A 2WXQA 5GSVB 2OYLA 2A38A 1NEZB 1KGCD 4CC0A 4AJWA 1SF5A 1JXDA 5IFAH 2Z4TA 4LF3A 1AXTH 3HC3H 5H2BB 1RZKC 4XPGL 1NGQH 1EZVY 1A14L 1MJJA 1SY6H 4KRNA 3S5LB 1OWWA 5FA4B 2GI0A 3TS8A 2CK2A 3D39B 4IIQC 5K1JA 2DDQH 3FO2B 3M88A 4H20H 3DJTA 2UXFA 5F8QC 2CNYA 3C8KA 1CTNA 2Y5TA 4IOFC 4YPGB 2VABB 3LNGA 1TTGA 2V2TA 4QHLB 5KBKA 3R8QA 3K4AA 5JIDA 5FYKU 1J8HA 1QUNB 4GQZA 3F04A 1AFVL 3MV8E 3TP4A 1BOYA 4Z8FL 1DEDA 4LBEB 5CS7A 2WQXA 5F9JB 2JKIS 4P3DA 4U6HA 3WDHA 4ZMAT 4AG4L 2QHLA 4NT6A 4NQXB 1QATA 3W11D 2AERT 3S5LG 1RUKL 5FA3A 2O6PA 1GY2A 5ICUA 3U0PA 5AENA 4ZX6A 3X14B 1RZIA 3QDAA 2E76C 1VZHA 3LEXA 4KNSA 2ISDA 1UZGA 3WY2A 3DC0A 5IT2L 4AM0Q 3TA3C 5I8KH 4PB0H 3OVUB 4OBRA 4QRUB 1DR9A 1ZLEA 3KXFA 3NZHL 2W0PA 4RISL 1SJXA 4JZJC 3OJ2C 4TMPA 5IF0B 3DNKA 2F7IA 3KXFE 4JDVA 1XAUA 4LCWB 4L2YA 4K5OA 4MXVE 3G04A 4JFTA 1ZWIB 4QLWA 1Y6NR 5D4HA 4H2AA 1Q0XH 4Z8FH 3C9NB 3MO1B 4OJFH 9CGTA 2QGDA 5AYTA 1NDMA 4MHHG 3T0BA 3UC0L 1P53A 4MCZA 4NKIL 5CM1A 1R5VA 2EKSB 3LAFA 5HHPA 1R75A 3U1SL 3TJPA 1T1ZA 3IFPB 3RG1C 2FR4A 5GGRY 5I23A 3UPRB 2Y2YA 3QWOB 1DQVA 1OGAB 2AQTA 2HZHA 4LCCC 2VR5A 4Z3TA 1OSEA 4WW2A 5AD0A 4NSKB 3QP3A 2BCKB 1Y6MR 4JPIB 1LO0L 4X7FC 3QQ3A 2AK1H 4LVNC 2Y6TE 4XNBA 3UTQB 5BUAA 1HSAA 2EAEA 1E8WA 3T6XA 2CZNA 1XCWA 2X1PA 3T71A 3VFTB 2JK5B 4UZUA 3CH1A 3B9KB 3IGUA 2Y7LA 3C2AL 1VHPA 4JDZB 4KKAD 1KJVA 1PY9A 5E2UL 3DX7A 4CW1A 1TU2B 3O0RL 4R0LA 2DM4A 2DTSA 2F19L 2N7AA 3GJFB 3T3PE 3KG5A 4GNKB 2NXYB 2GITB 1A14H 2Z0UA 3TBSA 2FT6A 1W80A 2P3YA 2C9RA 3IKCA 1XIWD 3BT2L 3Q1EA 4M93B 3B3IB 4ZMTA 3UEQA 2DKSA 1UVQA 3U7WL 3QXTA 4PJCA 1EJ6A 2EC8A 2R0KL 3LZOA 1ASOA 3B6SA 2JXMA 4HS3B 1KGUA 3UO1H 3I3DA 1NKGA 4U1JA 5BOZG 1MCCA 4HD5A 2YBRA 3WXWH 1VCBC 4YQXH 3B9KC 4DCQB 2APVA 4F3FB 2J56A 3D4YA 1U0QA 3RFZB 1BF8A 2D7OA 3OWEA 3VMNA 2K0RA 4IKLA 2KYIA 3EYFA 1DTUA 1FGVL 3WDIA 5ADPH 5ENWA 1YC7A 1KUMA 2ROXA 4XCCH 4YDVA 2UWEB 4Y1AE 3UBFA 2VH5H 1LNUA 1WBZA 4DK3A 1S7SA 3BAIA 4GW1A 1I8LA 1ETB1 3HLAA 4P46B 2WWOA 3NZ8B 1DVFA 5CLWA 1DBKH 1LWHA 3H9SD 5ISZA 4PGCA 2JFCA 3NPSC 4NFBA 2J5LC 1QVOA 3MUJA 4JMNA 4XVJH 5J6HA 5JOFB 3EYVB 1UZ6F 2I26N 5KW9L 4HHAA 2J88H 2MOQA 4P5KA 4OBSA 3QUXD 2EUZA 1C5CH 4HF5L 1LP9F 1DN0A 3E7JA 4MXWH 4C83A 4CVWA 3K6SB 1K6QH 1T0NB 3MGTB 4F5CE 3W5MA 4LCCA 1K2DA 1ZHNB 3NJIA 4QNPE 4WW2C 4HUWA 3RGVD 3P02A 5EA0L 4M8UA 3AQYA 3VFGH 2I9TA 4RDQF 3DX9A 1JZIA 4PJEB 1RJZB 3RJQB 2EYTA 3GRBA 1OP5K 1BAWA 3T0EE 1DBKL 3PGDB 4PJ6A 4KUCD 2IGFL 1LQSR 1M6OB 4WZ9A 5I30H 4DCQA 1R3IL 4HPHA 2W8CA 2R2EB 3BVNA 1G9ML 3P4MB 4PWHA 1XGQB 5E8OB 1G87A 4X6CB 3CVCA 4U1JB 3W39B 3BW9A 3L6FB 5F9WC 3ULUL 2E8ZA 4JO1H 4XRCB 2E74C 5B3JF 4R0LC 4MZRA 4KXZI 4B9ZA 3U9UA 3QJZA 4ZMZA 4HF5H 2HUEA 4MXWL 4RMWA 3P1VA 1NFDE 2FDBP 3CBRA 1A9VA 2J4WH 3FUKA 2FL5A 4RAUA 5E2UH 1XGRB 3GBLA 4KDVA 2YJLA 43C9A 3CVHL 3FU0A 4KI5E 4MAYC 3V4PH 1L0YA 4RGMB 1P4LA 3SYOA 4N4YB 3KZ8A 3P9LA 1V3KA 4DPBX 3QIBB 4E2OA 5KVMC 2Q1EA 3MNDA 4PAZA 4UM9B 2JKJA 2ED8A 1LP9A 4OH2A 4QRSA 1E5BA 4J3XA 3GXDA 2ZX8A 2YJQA 4K2UL 1P7HL 3UO1L 1CIUA 3CUPA 4PPTA 4N2CA 1E5AA 3MUY1 5F7FA 1DJSA 3OG4B 4X5XB 4AVJA 3N44F 4F7PB 3SO3B 5I1IH 5I8OH 3MRJB 4LZKA 4Z3JA 1G5GA 2FIRT 3SDCA 1KIRA 2C4XA 4HUUA 4XHJD 3OR6A 1ZOXA 1YN6A 3MVSA 4M4PA 4L1BA 3FOLB 2LTQB 5T3XD 4XCCL 2WWKO 3J7HA 2JKRM 3N1PC 3TWCL 4BUHA 3PQYB 1JPTL 4HIXH 4NO2B 3V4PL 4OCNC 2YUXA 3GBNH 1XZWA 3PDOA 2R83A 4L3CB 2FT8A 2HJFB 5H35B 1F41A 1TQCB 1AO7A 3L5HA 1CG9B 3MJ8B 4U2ZA 4V11A 1GY1A 3BLBA 2MPVA 5D4JA 1AZBA 1L7IH 5I6KA 1OPGH 4QHKI 3L4TA 3U9WA 4M61B 1HOEA 4JREC 4MZIA 1MW3A 1XV8A 3TO4A 2J88L 1QPXA 3P0YL 3ARWA 1RPQA 3EO0B 1E8ZA 4GIOA 3TTSA 4Y4KA 3HI1A 3PP3K 5IIEB 1DBML 4N2IA 3H9SA 5ISZD 1U58B 1LEGB 3NP4A 4AIEA 4R4FH 1MI5E 4KQ4L 2PO6C 3QBTB 3UX9B 2MCPH 4XPBH 1NCDH 1A22B 4KRPB 3DVFA 3X13B 4ECNA 1JNHA 3LXCA 4YDLC 4UM8B 4MJIB 2VLKE 1JAEA 3LQAL 1MCIA 2NY2B 5KSUB 1B2WL 1J0YA 4KNTA 2MTPA 4EN2A 3FCSA 5GGTH 4EZMA 3ABGA 3DJ9A 5C3IA 3PGCB 3V6ZA 3P0YH 1EANA 2WQRA 1BWWA 4U0RB 2XV0A 3L5WB 3M8OH 2C9XA 1CT8B 1CQKA 5B3NA 5T1LB 5HVGB 2EDKA 5CD3A 4YBQD 4L4VA 5BRZE 1XSJA 4KQ4H 1OF2A 3BUQA 1LL1A 4XPBL 2MCPL 2LU5A 2AITA 1RVFH 2ADIA 5FHAL 2KMWA 1KCRL 3WEXB 1FBIL 3TPUA 1OSPH 4K2UH 4TTGA 1FNGB 2PNDA 2ZUXA 1G5AA 2ZF9A 3ATDA 5BXFA 5J12B 1MCOH 5FLVA 1MW0A 4H1LH 5LCVL 3GUTB 4H44C 2F53D 3M8OL 1BZ7A 5FW6A 2NY1B 2NXZB 4M6MH 2V4LA 1FE8H 2XT1B 3KYAA 2VAAA 5AL8A 4JPKH 2YEZB 3OX8B 1IGFL 5KJRH 4OD1L 2BRRL 1W8EA 1M1SA 2BSDA 3ZTNH 1J48A 4DPRA 3TFKD 5IFHL 3OXRB 2CLVA 1B88A 1H0DB 3KDMB 4HWZA 2YWYA 5ID1B 4BE6A 4P9HH 4F91B 1CICD 1MCOL 4NQDB 3EUDA 4P2CG 5C0BE 3IGFA 4DOHB 4N0FA 25C8H 2PW2B 4FQLH 4N6RB 4OUUB 1CR9L 1LLAA 1FZJA 1MHEA 3AB0C 4OCSH 1RJYB 3UAAA 4AUUA 1AY1H 1S7WB 3VSUA 5I6LA 3L13A 1KLUA 1IGFH 1YYCA 4NIYE 2C4FT 4M62L 1FL5A 1T2QH 3NH7L 2LU7A 3ZTCC 3GMQA 5JXED 1K4CA 1U8PA 3Q5TA 3ZSSA 5GZOD 3VRLF 2BVEA 2R69L 4JFHE 5C09D 3WEMA 4DKTA 3O9WA 4MMYB 5FB8B 5G5DB 3NA4A 5CCKL 2BMKB 3OKLB 4EQ2A 4FFYH 4YHPA 2X1OA 3OC8A 1U3HB 1P7QD 4JFYB 5I1GH 2HA1A 3ARPA 3O2DA 2BZDA 5DQJA 4HWBA 4QYOB 4JLRB 2NDFA 2WBXA 3K1KC 5CF3A 1FFPA 1JMZA 3U4BH 1FP5A 3MLWL 5B1CA 1R0AH 5E4EC 4M62H 3DVNA 2QQKH 4Z78B 5E99L 2X4UA 4YZWA 3VD9A 3T09A 4ZDHA 1HTYA 4I48A 3IE9A 3EGSA 3KXFD 4E5XA 3WGVB 4XWOC 3DX2A 3RVWC 3ZRCC 1OSPL 2AI0L 4PUBH 3KGSA 4L23A 5CHNA 2R9HD 3EYOA 1N8ZA 1CXEA 1M53A 2YMXL 4G42B 1RD6A 4JLRA 5EU3A 3GSQB 2NSMA 4DKEH 4HJTA 3UYPB 4U3CA 1EXUA 1B0RB 2FD6H 1TNMA 3MBWA 1UJ3B 1UM6L 2EDOA 1BW8A 1NTDA 4YFLF 2G5BB 3U79A 1BYPA 1RUPL 4PJDA 2G4EA 3MNZA 5IJDC 5L0QB 4YDJA 4NUJB 1BVZA 1GCYA 2XIDA 2BRRH 4W6XB 3NRFA 4PJDE 4XO9A 2BP5M 5GGVH 5I1EL 5J11C 4P4KA 3VI3B 4KXAA 3KLAA 4D3CH 1DL7H 4HKZA 4DZBB 1P2CB 2ORBH 1G6RB 3O6LH 4YDIL 1B4RA 3VFRB 1AGEB 4NNXA 3ETSA 3O6FC 4HBQA 5JW4R 1B9ZA 1AO7E 1OAKH 1X5XA 4NP9A 4UYPA 3SQBB 4XNYL 4J3OF 4NCDA 12E8H 4NQEA 4DKEL 2EDHA 1QWHA 5FFGA 4FQCH 4ZJ9A 3L17A 1AOHA 3ZLQC 1EZLA 5I2IA 4GUPB 1T4KB 2FB4L 3WIHH 1CIDA 4HH9A 3FQNB 2P49B 3P3SA 2R4RH 3ARFB 2J5WA 5EBWB 1CFSA 1RAMA 3H9ZA 3GMRB 4RZCA 4AL8L 3ESPA 2C9VA 4B0MM 2A77H 4P59L 3QDMD 4PCKA 5DD1H 1DL7L 1E2ZA 3IDNA 3O9WC 2FHBA 3V0JA 2N0MA 2JKSA 2YXMA 1W0WB 3KM2A 1MI5A 2WLIA 5FR3A 1Q0YH 2L7JA 3CSYB 4XNUH 4I87A 2GK0A 2XV6B 3HTLX 5EN2B 1FZJB 2V37A 2OJZL 5JDJA 3QIUD 1TENA 3RZCA 3CFKA 4KKAC 2BVPB 1AS6A 2VNCA 3GTVA 3IDIA 5CJ5A 5D93C 3NBNA 4ZBJA 1JNJA 4EDXB 2DMBA 4RFNC 4NO0D 1RK0B 3LNDA 3K0YA 1KJ2H 1CN4A 4R3SA 4TULL 2HUHA 3G6DH 3TONA 3ZE2B 4ERSH 2CUAA 4PYGA 4ZXBD 4RX4D 3HC0B 3ARBD 1SVZA 1A7NH 2X9XA 5HI3D 5D7SL 3G3LA 1CS6A 3B34A 2VDMH 3CFIC 3GB7B 4N2FA 1P7KA 4LDCA 4F92B 1PDKB 4KVNH 1A1MA 4P48A 4HIQA 4LESA 2FYVA 4EBQH 4JW3A 3D69B 1YUHB 2YLHA 5ESQA 5DQ9A 5B39G 4BH8A 3WIFB 4APQA 2CIIB 4HZAA 5D1QD 4TSBH 3LHPH 2XA8L 3OZ9L 4GPVA 4GP4B 3ETBF 4Z6AT 4AK1A 4ZYKB 3UTTB 4EO5A 4CSTA 1EAQA 4HJUA 5H4ZA 3MLRH 1R6VA 5EEWA 2W07A 3AAZB 1IFGA 4UUJB 4AQ1C 4YDZA 1CVRA 3DX4A 4M48H 3NZSA 5TE6L 4IKJA 4GW4A 1UUNA 2K3HA 1OHQA 1E42A 2K78A 2ZOOA 3V5KB 5CCGE 4WI3A 4TL4A 9PCYA 1QSEE 2ZUUA 5IREA 3FN0L 4QOKA 5C6WH 1DJXA 3HI1B 1CT8A 2DYPD 4KK8D 5D96C 5FV1L 2DBJA 5BO1L 1ND0B 1KWKA 5DRZB 5JOPD 2AEQH 3P2BA 1ZSHA 2YOCA 3QEUB 3LH9A 5K39B 2APXA 4J6IA 3LHPL 3WTSA 3TEXA 1M7IA 2BVQA 5AB0A 2V9UA 5FGCB 4NWTL 2RQ8A 3FFCB 3CFTA 2I32A 3L4CA 2ZUTA 1T7YA 4JRXD 1P84K 3S3JA 1ES0A 3LQMA 1PZ5B 3NGBB 3FTGB 3CG8A 2XZCH 1BXUA 2ZKYA 2EE3A 2DQUL 5FYKH 4R7XA 2A4ZA 3UJJL 5BQ7A 4G6ML 1IBDA 4I1RA 2YAFA 1E5YA 4NS0A 5DRNB 1CJYA 2FWUA 1ZT1B 5ANHA 1NOFA 1URLA 2A0LD 2GHZA 2IH3A 4TUKL 3HZYA 4WSKA 2XQYG 4ZO9A 3IJEA 1BQHA 2ENJA 3EDJA 1EJOL 4GAAA 3NQIA 4ONGL 1WZ1H 4YHIB 4TULH 1CGVA 1X9UA 5CAYB 4LHUG 1JK9A 3I75A 1JIBA 4FA6A 3WN5C 2B4CC 4F2EA 5HHOA 1GZHA 2F7OA 3T6WA 4BK4A 1A7NL 1BZ9B 5FXCH 3V0WL 5E23A 3Q2VA 2DQUH 1MIMH 1C16A 5IESH 2I85A 1BP3B 4Q52A 3DXAD 4ODXA 4XMZA 5E00B 3VQ2C 5I1JL 1JUFB 3PNWB 1XXDC 3FTXA 1DQLL 4Y5XB 1FFPB 4C47A 4AT6A 2Q8BL 3RJOA 1QR1A 1G0DA 2GJ6E 1T83C 3Q01A 3GRWL 1PU0A 3PL6D 1PSKL 3GIVA 1CFVH 3GZOA 2APWA 2XY2A 1Z5LB 4TUOA 2H0FA 5AWNH 3MLRL 1U95B 3ZE1E 1I3GL 1FYTE 2KZBA 4Q9CA 3S37H 4HIIB 4URTB 5F9OH 1ZGLM 4ZUSA 1T22B 3QCVH 3SPGA 2YQ2A 5KSBE 4P5TD 4DEPB 3L9EA 1QTSA 1M6UA 1H3UA 2CLRA 5E4OA 2W0LA 1MJ8H 4GO9A 4OCWL 5E8EA 3S34L 3RGHA 5IGXL 1D5IH 3JV0A 1JVOA 1XAKA 1KB9K 4PY7B 3HBZA 1FH2A 4XC3H 4BFNA 1TVBA 4MJ2A 2AJSH 2TSBA 3HE6C 1MDAA 1MFAH 1NANH 5EUOA 1M56B 3FF7A 2PW2A 1FFOA 2F74A 4L9LB 4IRSC 3SCMA 2VW6A 5DQDH 5IQOA 5HP5A 5JHDB 1ID2A 4H8WH 5JDSA 2NR6D 1G7IB 5LQBL 3OXSA 1U8OA 1M6OA 2EICA 3HE6B 4HWBH 4OQTH 2QPUA 3L7FA 3N85L 4MHHI 4LSSL 2VXQA 4H1LB 1MNUL 5HGAB 5ABZA 4V1DA 1JZDC 3RUGE 2YRZA 2DKMA 3UJJH 1JL8A 1UWYA 3ULVE 2AK4B 1D6EB 1SOQA 1S9VA 3ARGA 3BDXA 1MVUB 4NFCA 5E6IC 1HH9B 3N2JA 4LASL 1Z5YD 1HWHB 3QO0B 3QUHA 1B2YA 5D7IE 5KSAB 5E1QA 3HW7A 4MD4B 5AW1B 4FQQB 1S46A 2FHFA 2WMPA 1MWAL 1TJMA 3IMTA 3Q6FA 1FIGL 3MNMA 3IRPX 1SJEA 1CUOA 3TBVA 3TX4A 3DO7B 3CQQA 4L8SB 1W8OA 1IM3D 1RXLA 2HJKA 3WYRA 3HHSA 2YK1L 1OB0A 4PJCB 4PGCB 1PNCA 2YWZA 3OC5A 3K6FA 5BJTB 2YRLA 1R3JA 1MPAL 1OP5H 1UWXH 3ARQA 5I24A 1HEZA 2WWNA 2IO5A 4OGYH 1CD0A 4LLDB 4AMKH 3PWLA 1SQMA 4PGEA 1A1OB 4KJWC 3KLQA 5J6GB 1P69B 4L4VB 4GG6B 1T83A 2VR3A 4NJ9H 5GGSY 2HFEA 2G0KA 2HSIA 2V9RA 5EUOB 2CCVA 2BDNH 3UP6A 5JA8B 3L5WA 2ODIA 5D72L 3ZZSA 1TVBB 5FECB 3QZPA 3DGCR 2VW7A 5J6SA 1KGJA 2D0GA 4PRDB 3D9AL 4JN2B 1ML0A 2J72A 2D9QB 1FO0A 2A83A 4PJFE 1E6JH 2W94A 4B3EA 3CVDA 2NYYC 3WNPA 4XNXH 5IV2B 4N5UA 1T22A 1KTRL 4H1LA 2J1XA 5HGAA 1T21B 1JNHB 4OZGE 4AMKL 1P84J 4J27A 4O58L 3STLA 2ICWB 3WFDL 1W72B 4LOEA 3HE6A 3MODL 1MJ8L 3IAQA 4OCWH 5GRZA 3EDKA 1HIML 5DD0H 1G7MA 1I1AD 5JHDA 5A7BA 1EFXD 1EUTA 1MELA 1S7UB 1E4XL 4NOBA 1NFKA 4PJHF 5GS0D 2D8KA 1AP2B 3O8XC 1CXLA 1A4JA 4HHWA 3VMOA 5FW8A 5DQDL 1F8TH 3QPKA 4NM4H 4WU5A 3ARGC 2E4TA 4X50A 4OD3L 3IFLH 1HFUA 1KJ2A 1ODUA 2PXYC 1J8HE 1F4YL 3CX2A 3KPTA 1IKFL 1A7RL 3HUJE 3QJQB 1YNTA 4P5RA 1TQUA 3GMLA 1TR7A 4LASH 1Z0NA 4DEWA 1F97A 3FNKA 4M9PA 5C0IA 4OFKA 4U7SA 3KWUA 1FGNL 2X4RA 3ZPDA 1F58H 1YY8B 5DJXA 3ZE0F 3BVWA 1T7XA 1FIGH 2VDPL 5JLZB 5L7XL 4K3DL 2JB6A 2V2TB 1OE3A 3LRHA 4JFDE 3I74A 3BJLA 1I4FB 3LSOB 4CVZA 2DN7A 4Q97A 1D7BA 4E42A 3IFLL 3MLTA 1T21A 2BSED 1ZLSH 3QNYB 1ZSDB 1JDAA 2XN9E 1DJWA 1N0XH 1BZEA 2YXWA 3U6XS 3L3IB 5HHOB 3ALWA 1KLFA 3C12A 1I1CA 4Y5VB 3OGCB 2ZKXA 3F05A 3L45A 4HETA 2C34A 2V5RA 4L5FE 4NT6B 2J43A 2NX5B 3IFNL 4B9IA 1VPOL 5AKTA 4P23C 4X5LA 3SE4A 2ATKB 4P2OD 4JFPB 4I0PD 5J0BA 2ARWA 4BV1A 1LWJA 1K72A 3DURB 4TLTA 3VRIA 2NY5C 4G3YH 3V5KA 2G3ZA 5I0YA 5I0VA 4OD2B 4G8EA 5BZXA 1XX9C 1PLBA 2IF7A 3SIKA 1R3LB 3MGOB 3BDYH 1WA1X 5K9OB 5I66A 3GEFA 5EBMB 4NCC2 1TETL 2UZYB 4PP2A 2VR7A 3SD2A 3VSTA 1M7IB 2OM5A 2H41A 5HHVL 2GTWA 4YLCA 2XWDA 1E90A 1BZDA 4LQFH 1SDYA 3QYCA 4QRQA 4YSTA 3FJTA 3JV6B 1BFOB 2RQEA 1I7UA 2YD7A 2QADB 2E4FA 1SXBA 3BE1H 4WDIA 4PJ5B 2OTPA 3LN4A 4YIQB 4WNQA 4XH2A 3IF1A 4LAJH 3VXTA 4JO4H 1AYOA 5GGQL 3LS5H 2AK4A 1XCXA 2OMVA 4LU5L 3TIDA 1IM3A 3FQ1A 4UQ3B 4JKMA 5CBAB 2AK4E 4J6RL 3EJQA 5B3SB 3PAVA 3W2DL 4NPYA 4OQ1A 1CDYA 1FIEA 3U48A 3LZFL 1A9EB 1JPGA 2XJLA 4KGLA 4TF4A 1TETH 1JP5A 2MQGA 1BVNP 4EDXA 5JMOC 4KV5E 1BJMA 4JG1L 4N8VG 3L4WA 4OCYH 3U1PA 1F58L 3ARGD 4Y1AA 4YC2C 5CP7A 1HJBC 2GBAA 1VZGA 3UXFA 2F08A 4CN6A 2Y3NA 3NGBC 1HXYA 3QG7L 4BXSV 3QUZD 3NCYP 5GGSB 3CVHB 1O7DE 1FFNA 1RIVL 3MNWA 4HCRH 3Q8CA 4GRLB 4RGNB 3UGXA 4S1DC 3FT2B 3CXHK 5DUJA 4M8QA 4TQHA 5D7JB 3NIGE 3GPEA 3IDNB 5CEZE 3IMUA 3ULUE 1KJ3H 1KB3A 3X11A 1OQXA 3O4LB 4CKVX 4KVCL 1QNZL 5C0AD 4JEGB 4XOEA 1U95A 3U4KA 1UT1A 1JNNL 1DVXA 1FLRL 1OTTD 1CBVH 2MPAH 3LDBC 4OZHF 3IFNH 4JG1H 4KO9A 1ZLDA 1GYWA 3LKOB 3EUUA 3MRQB 4PW3A 4AT6B 1S9WA 5D9SB 1XR9A 3EH1A 3ISYA 2NY3B 3KLKA 1L9RA 3BKJH 3FQTA 3Q2WA 4HOZA 3BZEA 3GINA 2DQHL 2OSYA 2Y9RT 1X5LA 4HCRL 1NSNL 3RVXC 1WK0A 4XAWH 5L2KB 1HHIA 5HYFA 5A2IH 4NHUB 2VC2H 7PAZA 3GYRA 4F9LA 3EYUH 2X38A 5BPPA 3P11H 5K9JL 1FFRA 2FEEL 4HH9B 4KH9A 4UT6H 5HHVH 4RDQG 4AIXA 2J1YA 5C6PB 4PLJD 1BM7A 1AKJB 1EUUA 2W92A 1EBPA 4Y19D 3I6SA 3BN9D 3BAKA 3RDTB 1IIIA 3PJSA 5EMYA 2FO8A 1ZVSA 2WXKA 1JHLL 3JWDH 3MV7E 3BKJL 3TESA 4AYDC 3HS8A 4JFDD 2F18A 5GGRB 3HG4A 1JPSL 2ZNWA 2VDOL 1MW2A 3CFEB 5DFVD 4IEFA 4KI1A 1J5IA 4OCRL 1BDYA 4HPYL 2C3HA 4ETQA 3UBXA 3RGVB 5EU4B 4TV3A 2V2XB 3I6KA 3NQKA 5E0FA 3W9DA 2VC2L 3NCFB 5DZAA 2H4EA 3MV8D 1DHKA 2G60H 4GQPH 2CAKA 4ODWB 5T1DL 2C1PA 4KHTH 3T2OA 4KZDL 3HMWH 3O2VL 1SHXA 4MNQB 2X0UA 4ACTA 3GHBL 3NJVA 2QSCH 2C7FA 3QQNA 4MQXD 4OCYL 4PRBA 1VA9A 3QDJB 3V79C 4PWEA 4XPAL 5FGCE 1X5YA 3QEUA 5K39A 5HPMA 2OR7A 3SE6A 4F24A 4A2FA 1RFDL 2F5BL 2VZTA 1E4WL 2JLLA 4M7KH 1N8ZB 2BNRD 2VDOH 3B1UA 5C8JA 2NY6D 1NEZG 1OKEA 4KXBA 2VABA 4UAHA 3ZY7A 5FDWA 4KZEL 5TF1H 1ZLWH 1EFQA 1RHHA 2G2RA 3QIWC 5KYXB 4GW4B 4XN9A 4QUOA 2R59A 3E9TA 1ECYA 1NBZA 3HNSH 2DQTL 3GXIA 3KD4A 4ZTOH 1JPEA 2GIXA 3UTSB 3WLWC 1JFHA 4KZDH 3VXRE 5JIQA 2HVKA 3ILDA 4ONHA 2QKSA 4YUEL 2F54D 5GZOC 2RHEA 5KVDE 4KNUA 3W0WE 4BDVB 4GAJL 1CTMA 4YHKH 3OKOA 3BP4B 3UTTE 4XCFL 3VNYA 4AJ0A 3TL5A 3MNWB 1VLXA 2ITCB 3FONB 4PG9B 1HDMB 1YEFH 3K6OA 4XMUA 4GXUN 5FCSH 4MSWA 4X42A 3D8MA 4CJ1A 1RKRA 5DEFB 5EUKA 4U0RC 5CSZA 3OKMB 1FORH 4PG2A 5ANMB 5L0QC 2OMUB 4PJGB 5I0XA 4KXCA 1C5DB 4AG4H 4G43B 4HFUL 3TV3L 3WS3B 4XXCC 2RFXB 5D5MA 5D7KD 3K8LA 3V52H 1F86A 2DW5A 2Q2EB 4JKLA 2IGTA 3R0MA 4LSRH 3RP1A 1P1ZA 3WNOA 1M7XA 3F7KA 2GJ6D 2K6ZA 4R97B 5GSRB 1PJWA 1QTPA 5GGTA 1KEMH 3ZE2E 5ESAB 4L3EB 4PB0L 2VGLM 5GRUH 1K4DA 3MOBH 3IJSB 4KMQA 4L18A 3REVB 1YG9A 3JWDL 2D3LA 1EZUA 4MMZB 1FNGA 2NY4D 5A2JH 3C2SA 1VSCA 1J1OL 2VKXA 2DJ4A 5HDRA 1MCEA 1Q0XL 2O6DA 4Q7DA 4JREB 2FX9L 5IBTH 2UZYA 3HR5A 3T0VA 5D2NB 3U7YL 3OPUA 2VLLB 2VXQH 3T2NH 3EAKA 3QZMA 4OCXL 3S3PA 3U1SH 1JNLL 3HC3L 1YEJL 3DJSA 3IWUA 1PPIA 1XGUB 2VDQB 2W60A 5DRWB 1I9IH 3E6HA 5I6OA 4UIMB 3MRPA 3X1GA 3FXIC 5KUKA 1R9FA 1N0LA 1WBXB 2IPKB 2IQ9L 4NZRL 4X80L 4N25A 5AZ2L 3LH8A 4LLUB 43CAA 3MC0A 5KYYB 2Y7OA 2BSEA 2VZOA 1PEZA 1A5FH 1PL3A 4FI6A 1GCFA 3KEHA 4ZPTA 5IBLD 2JF1A 1SFHA 2WM0A 5H37G 3NRQA 2K70A 5F72S 1SMDA 1Q0EA 2ICEC 4E9XA 5C7XL 4YE4H 4JFWA 2YD0A 4M00A 3WS6C 5CFHA 3WXVH 1MEXL 4PBDA 3AXHA 2YLKA 3HNSL 5DVOA 4GSUA 1IL1A 4LL4A 2D4FA 2WLLB 1N10A 3L3IA 2YPVH 5ES4B 1RU9L 3WCYA 2Z65C 2I5YL 3TEZA 3FQUA 3QWQB 1TTUA 1NDTA 1G0XA 5IEHB 1CGWA 1FHNA 3LNIA 3OQ3B 3FB5A 5LWYL 3MREA 5ECJE 3WDJA 4JO2L 4PGBA 4MAYB 4Z7VA 3KPOA 4Z7UE 2R0KH 3FUNA 1ZLWK 4F7MB 5DD6A 2IFFH 3US0A 2HVJB 1G7LA 3DJRA 4JPVL 4KOBA 5HGHA 1NOAA 2VXUL 3QPQD 2FEEI 1KPVA 5ADPL 3MLYH 4I4WB 2VO8A 1G6RL 3NMEA 2C9QA 1X7QA 1VFAB 2WQUA 4WU7A 2FECL 4IU2B 1NGYB 1RU9H 3KPPB 4I2XB 3TCLA 5JTWA 3D09A 3CFCH 2HAZA 3ARZA 4DHLA 1YN6B 4FGMA 4M5YH 5DURD 3H9SB 3Q2CA 4O5LH 3ROOB 4MNQE 3GTNA 1LDPL 1UXSB 1ZLUH 3ZDXE 1OE2A 4H20L 3CXFA 4QXUH 3VG9B 2CA3A 3MOBL 4GXFA 1VKXB 2AK1L 4JFYA 1CICB 5DMIH 2ATPA 2NUTB 3EOYG 1N7MH 2GJZA 5FB8A 2GSIB 1J1OH 4F2MA 2ERJB 2DZEA 2BXZA 2W81C 1WRFA 1XGPB 2YSSB 3LIZH 2F5AH 4JPVH 1UXWB 2D4DA 4NP4H 5KVFE 4X98B 4M7LH 5LGJA 1SZNA 4NN5B 1OLZA 2CJUH 5I1DA 2DQ6A 3U7YH 3MLYL 4CVXB 3PFQA 2OX5A 1IE5A 1NBYB 3O3DA 5C0ND 2F19H 4XZUA 1P7QA 1SJHA 1YEJH 3QGVA 4G11A 4NPJA 2AQ2A 1RQ5A 4M5YL 5F3BA 2L4OA 3N04A 4NXSA 2RCSH 3FO0H 4LEOA 5I8CB 4YX2H 3GLDA 4ALAC 2Q7AA 5IVZA 1WD8A 5C08E 1YN7A 2A9NL 4FYQA 1ZEAH 2O72A 2CR3A 5C3LD 4GI6A 1WCBA 2W9LA 2F2HA 2H6PB 1J9CT 2O5XL 1ACXA 1SLXA 3CUPB 4WEBH 3T4AC 5ILTL 5LLIC 2DM2A 2WGNB 3FH8A 1UB5A 4I0PC 4NQDE 4J4PA 4MB3A 3AS3A 3D18B 4JG0H 4M7LL 4RNRA 3DUUB 4KKRA 2OPCA 2FEDD 4Y9CA 4XZ4A 1HWWA 1SF3A