3PXSC

Crystal structure of diferrous maug in complex with pre-methylamine dehydrogenase:
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 29
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3pxsC00
2AGLD 2GC4B 2HJBD 2OK4D 1MAFL 2MADL 1MG3B 3ORVC 4L3HC 2OJYD 2HJ4D 2H3XB 3PXTC 4L1QC 3SJLC 4FA1C 4FA9C 2OK6D 1MG2B 1MDAL 3C75L 3RLMC 2AGZD 3PXWC 2I0RD 2AGWD 2AGYD 2J55L 3SVWC 2J57K 3SXTC 3L4MC 4L3GC 4FANC 4O1QC 4FA4C 2MTAL 4FB1C 2IURD 2I0SD 2Q7QD 2HXCD 2OIZD 2IUQD 2HKRD 4FAVC 2IUVD 2J56L 4FA5C 2AGXD 2HKMD 3L4OC 3PXSC 4K3IC 2IUPD 2BBKL 2IAAB 3RMZC 3RN0C 3RN1C 2AH1D 2AH0D 3SWSC 2GC7B 2I0TD 2H47B 3SLEC 4Y5RC 1MAEL
chains in the Genus database with same CATH superfamily
2AGLD 2GC4B 2HJBD 2OK4D 1MAFL 2MADL 1MG3B 3ORVC 4L3HC 2OJYD 2HJ4D 2H3XB 3PXTC 4L1QC 3SJLC 4FA1C 4FA9C 2OK6D 1MG2B 1MDAL 3C75L 3RLMC 2AGZD 3PXWC 2I0RD 2AGWD 2AGYD 2J55L 3SVWC 2J57K 3SXTC 3L4MC 4L3GC 4FANC 4O1QC 4FA4C 2MTAL 4FB1C 2IURD 2I0SD 2Q7QD 2HXCD 2OIZD 2IUQD 2HKRD 4FAVC 2IUVD 2J56L 4FA5C 2AGXD 2HKMD 3L4OC 3PXSC 4K3IC 2IUPD 2BBKL 2IAAB 3RMZC 3RN0C 3RN1C 2AH1D 2AH0D 3SWSC 2GC7B 2I0TD 2H47B 3SLEC 4Y5RC 1MAEL
chains in the Genus database with same CATH topology
2AGLD 2GC4B 2HJBD 2OK4D 1MAFL 2MADL 1MG3B 3ORVC 4L3HC 2OJYD 2HJ4D 2H3XB 3PXTC 4L1QC 3SJLC 4FA1C 4FA9C 2OK6D 1MG2B 1MDAL 3C75L 3RLMC 2AGZD 3PXWC 2I0RD 2AGWD 2AGYD 2J55L 3SVWC 2J57K 3SXTC 3L4MC 4L3GC 4FANC 4O1QC 4FA4C 2MTAL 4FB1C 2IURD 2I0SD 2Q7QD 2HXCD 2OIZD 2IUQD 2HKRD 4FAVC 2IUVD 2J56L 4FA5C 2AGXD 2HKMD 3L4OC 3PXSC 4K3IC 2IUPD 2BBKL 2IAAB 3RMZC 3RN0C 3RN1C 2AH1D 2AH0D 3SWSC 2GC7B 2I0TD 2H47B 3SLEC 4Y5RC 1MAEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGL D;  2GC4 B;  2HJB D;  2OK4 D;  1MAF L;  2MAD L;  1MG3 B;  3ORV C;  4L3H C;  2OJY D;  2HJ4 D;  2H3X B;  3PXT C;  4L1Q C;  3SJL C;  4FA1 C;  4FA9 C;  2OK6 D;  1MG2 B;  1MDA L;  3C75 L;  3RLM C;  2AGZ D;  3PXW C;  2I0R D;  2AGW D;  2AGY D;  2J55 L;  3SVW C;  2J57 K;  3SXT C;  3L4M C;  4L3G C;  4FAN C;  4O1Q C;  4FA4 C;  2MTA L;  4FB1 C;  2IUR D;  2I0S D;  2Q7Q D;  2HXC D;  2OIZ D;  2IUQ D;  2HKR D;  4FAV C;  2IUV D;  2J56 L;  4FA5 C;  2AGX D;  2HKM D;  3L4O C;  3PXS C;  4K3I C;  2IUP D;  2BBK L;  2IAA B;  3RMZ C;  3RN0 C;  3RN1 C;  2AH1 D;  2AH0 D;  3SWS C;  2GC7 B;  2I0T D;  2H47 B;  3SLE C;  4Y5R C;  1MAE L; 
#chains in the Genus database with same CATH topology
 2AGL D;  2GC4 B;  2HJB D;  2OK4 D;  1MAF L;  2MAD L;  1MG3 B;  3ORV C;  4L3H C;  2OJY D;  2HJ4 D;  2H3X B;  3PXT C;  4L1Q C;  3SJL C;  4FA1 C;  4FA9 C;  2OK6 D;  1MG2 B;  1MDA L;  3C75 L;  3RLM C;  2AGZ D;  3PXW C;  2I0R D;  2AGW D;  2AGY D;  2J55 L;  3SVW C;  2J57 K;  3SXT C;  3L4M C;  4L3G C;  4FAN C;  4O1Q C;  4FA4 C;  2MTA L;  4FB1 C;  2IUR D;  2I0S D;  2Q7Q D;  2HXC D;  2OIZ D;  2IUQ D;  2HKR D;  4FAV C;  2IUV D;  2J56 L;  4FA5 C;  2AGX D;  2HKM D;  3L4O C;  3PXS C;  4K3I C;  2IUP D;  2BBK L;  2IAA B;  3RMZ C;  3RN0 C;  3RN1 C;  2AH1 D;  2AH0 D;  3SWS C;  2GC7 B;  2I0T D;  2H47 B;  3SLE C;  4Y5R C;  1MAE L; 
#chains in the Genus database with same CATH homology
 2AGL D;  2GC4 B;  2HJB D;  2OK4 D;  1MAF L;  2MAD L;  1MG3 B;  3ORV C;  4L3H C;  2OJY D;  2HJ4 D;  2H3X B;  3PXT C;  4L1Q C;  3SJL C;  4FA1 C;  4FA9 C;  2OK6 D;  1MG2 B;  1MDA L;  3C75 L;  3RLM C;  2AGZ D;  3PXW C;  2I0R D;  2AGW D;  2AGY D;  2J55 L;  3SVW C;  2J57 K;  3SXT C;  3L4M C;  4L3G C;  4FAN C;  4O1Q C;  4FA4 C;  2MTA L;  4FB1 C;  2IUR D;  2I0S D;  2Q7Q D;  2HXC D;  2OIZ D;  2IUQ D;  2HKR D;  4FAV C;  2IUV D;  2J56 L;  4FA5 C;  2AGX D;  2HKM D;  3L4O C;  3PXS C;  4K3I C;  2IUP D;  2BBK L;  2IAA B;  3RMZ C;  3RN0 C;  3RN1 C;  2AH1 D;  2AH0 D;  3SWS C;  2GC7 B;  2I0T D;  2H47 B;  3SLE C;  4Y5R C;  1MAE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...