3PXSC

Crystal structure of diferrous maug in complex with pre-methylamine dehydrogenase:
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 29
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3pxsC00
3SVWC 4FANC 2AGWD 2AGLD 4L3GC 3PXSC 2GC4B 2Q7QD 2I0SD 4O1QC 4K3IC 2MADL 2HKMD 1MG2B 2H3XB 2HXCD 4FA5C 4FA9C 4Y5RC 3RN0C 4FA1C 2AGYD 2HJ4D 2IURD 3RN1C 4L1QC 1MDAL 3L4MC 1MAEL 2AGZD 3L4OC 2AH0D 3RLMC 2HJBD 2HKRD 2J57K 4L3HC 3RMZC 3SLEC 3SJLC 4FAVC 2AH1D 2J55L 2I0TD 2MTAL 3SWSC 2OK6D 2OK4D 2GC7B 2AGXD 1MG3B 4FB1C 2IUPD 2OIZD 2H47B 2OJYD 1MAFL 2BBKL 4FA4C 3ORVC 2I0RD 3PXWC 2IAAB 2J56L 3PXTC 2IUQD 3SXTC 2IUVD 3C75L
chains in the Genus database with same CATH superfamily
3SVWC 4FANC 2AGWD 2AGLD 4L3GC 3PXSC 2GC4B 2Q7QD 2I0SD 4O1QC 4K3IC 2MADL 2HKMD 1MG2B 2H3XB 2HXCD 4FA5C 4FA9C 4Y5RC 3RN0C 4FA1C 2AGYD 2HJ4D 2IURD 3RN1C 4L1QC 1MDAL 3L4MC 1MAEL 2AGZD 3L4OC 2AH0D 3RLMC 2HJBD 2HKRD 2J57K 4L3HC 3RMZC 3SLEC 3SJLC 4FAVC 2AH1D 2J55L 2I0TD 2MTAL 3SWSC 2OK6D 2OK4D 2GC7B 2AGXD 1MG3B 4FB1C 2IUPD 2OIZD 2H47B 2OJYD 1MAFL 2BBKL 4FA4C 3ORVC 2I0RD 3PXWC 2IAAB 2J56L 3PXTC 2IUQD 3SXTC 2IUVD 3C75L
chains in the Genus database with same CATH topology
3SVWC 4FANC 2AGWD 2AGLD 4L3GC 3PXSC 2GC4B 2Q7QD 2I0SD 4O1QC 4K3IC 2MADL 2HKMD 1MG2B 2H3XB 2HXCD 4FA5C 4FA9C 4Y5RC 3RN0C 4FA1C 2AGYD 2HJ4D 2IURD 3RN1C 4L1QC 1MDAL 3L4MC 1MAEL 2AGZD 3L4OC 2AH0D 3RLMC 2HJBD 2HKRD 2J57K 4L3HC 3RMZC 3SLEC 3SJLC 4FAVC 2AH1D 2J55L 2I0TD 2MTAL 3SWSC 2OK6D 2OK4D 2GC7B 2AGXD 1MG3B 4FB1C 2IUPD 2OIZD 2H47B 2OJYD 1MAFL 2BBKL 4FA4C 3ORVC 2I0RD 3PXWC 2IAAB 2J56L 3PXTC 2IUQD 3SXTC 2IUVD 3C75L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVW C;  4FAN C;  2AGW D;  2AGL D;  4L3G C;  3PXS C;  2GC4 B;  2Q7Q D;  2I0S D;  4O1Q C;  4K3I C;  2MAD L;  2HKM D;  1MG2 B;  2H3X B;  2HXC D;  4FA5 C;  4FA9 C;  4Y5R C;  3RN0 C;  4FA1 C;  2AGY D;  2HJ4 D;  2IUR D;  3RN1 C;  4L1Q C;  1MDA L;  3L4M C;  1MAE L;  2AGZ D;  3L4O C;  2AH0 D;  3RLM C;  2HJB D;  2HKR D;  2J57 K;  4L3H C;  3RMZ C;  3SLE C;  3SJL C;  4FAV C;  2AH1 D;  2J55 L;  2I0T D;  2MTA L;  3SWS C;  2OK6 D;  2OK4 D;  2GC7 B;  2AGX D;  1MG3 B;  4FB1 C;  2IUP D;  2OIZ D;  2H47 B;  2OJY D;  1MAF L;  2BBK L;  4FA4 C;  3ORV C;  2I0R D;  3PXW C;  2IAA B;  2J56 L;  3PXT C;  2IUQ D;  3SXT C;  2IUV D;  3C75 L; 
#chains in the Genus database with same CATH topology
 3SVW C;  4FAN C;  2AGW D;  2AGL D;  4L3G C;  3PXS C;  2GC4 B;  2Q7Q D;  2I0S D;  4O1Q C;  4K3I C;  2MAD L;  2HKM D;  1MG2 B;  2H3X B;  2HXC D;  4FA5 C;  4FA9 C;  4Y5R C;  3RN0 C;  4FA1 C;  2AGY D;  2HJ4 D;  2IUR D;  3RN1 C;  4L1Q C;  1MDA L;  3L4M C;  1MAE L;  2AGZ D;  3L4O C;  2AH0 D;  3RLM C;  2HJB D;  2HKR D;  2J57 K;  4L3H C;  3RMZ C;  3SLE C;  3SJL C;  4FAV C;  2AH1 D;  2J55 L;  2I0T D;  2MTA L;  3SWS C;  2OK6 D;  2OK4 D;  2GC7 B;  2AGX D;  1MG3 B;  4FB1 C;  2IUP D;  2OIZ D;  2H47 B;  2OJY D;  1MAF L;  2BBK L;  4FA4 C;  3ORV C;  2I0R D;  3PXW C;  2IAA B;  2J56 L;  3PXT C;  2IUQ D;  3SXT C;  2IUV D;  3C75 L; 
#chains in the Genus database with same CATH homology
 3SVW C;  4FAN C;  2AGW D;  2AGL D;  4L3G C;  3PXS C;  2GC4 B;  2Q7Q D;  2I0S D;  4O1Q C;  4K3I C;  2MAD L;  2HKM D;  1MG2 B;  2H3X B;  2HXC D;  4FA5 C;  4FA9 C;  4Y5R C;  3RN0 C;  4FA1 C;  2AGY D;  2HJ4 D;  2IUR D;  3RN1 C;  4L1Q C;  1MDA L;  3L4M C;  1MAE L;  2AGZ D;  3L4O C;  2AH0 D;  3RLM C;  2HJB D;  2HKR D;  2J57 K;  4L3H C;  3RMZ C;  3SLE C;  3SJL C;  4FAV C;  2AH1 D;  2J55 L;  2I0T D;  2MTA L;  3SWS C;  2OK6 D;  2OK4 D;  2GC7 B;  2AGX D;  1MG3 B;  4FB1 C;  2IUP D;  2OIZ D;  2H47 B;  2OJY D;  1MAF L;  2BBK L;  4FA4 C;  3ORV C;  2I0R D;  3PXW C;  2IAA B;  2J56 L;  3PXT C;  2IUQ D;  3SXT C;  2IUV D;  3C75 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...