3PXSC

Crystal structure of diferrous maug in complex with pre-methylamine dehydrogenase:
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 29
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3pxsC00
3SWSC 2AGWD 2IUVD 2MTAL 2OIZD 2MADL 3RN1C 3L4OC 4O1QC 1MDAL 4L3GC 2I0SD 2H3XB 2J55L 3PXTC 2I0RD 2I0TD 2AGXD 4FA4C 4FB1C 2HKMD 3RMZC 2IUPD 1MAEL 3SXTC 2AGLD 2HJBD 1MG3B 3PXSC 2Q7QD 4FAVC 2HXCD 3RN0C 4K3IC 2HKRD 2OK6D 3ORVC 4FA1C 2OJYD 3L4MC 2HJ4D 2AGYD 1MAFL 3SVWC 3C75L 4L3HC 1MG2B 3PXWC 4Y5RC 2OK4D 2IAAB 4FA5C 2GC4B 2AH0D 2IURD 2J56L 4FANC 2J57K 2H47B 3RLMC 3SJLC 2AGZD 2BBKL 2IUQD 4FA9C 4L1QC 2GC7B 2AH1D 3SLEC
chains in the Genus database with same CATH superfamily
3SWSC 2AGWD 2IUVD 2MTAL 2OIZD 2MADL 3RN1C 3L4OC 4O1QC 1MDAL 4L3GC 2I0SD 2H3XB 2J55L 3PXTC 2I0RD 2I0TD 2AGXD 4FA4C 4FB1C 2HKMD 3RMZC 2IUPD 1MAEL 3SXTC 2AGLD 2HJBD 1MG3B 3PXSC 2Q7QD 4FAVC 2HXCD 3RN0C 4K3IC 2HKRD 2OK6D 3ORVC 4FA1C 2OJYD 3L4MC 2HJ4D 2AGYD 1MAFL 3SVWC 3C75L 4L3HC 1MG2B 3PXWC 4Y5RC 2OK4D 2IAAB 4FA5C 2GC4B 2AH0D 2IURD 2J56L 4FANC 2J57K 2H47B 3RLMC 3SJLC 2AGZD 2BBKL 2IUQD 4FA9C 4L1QC 2GC7B 2AH1D 3SLEC
chains in the Genus database with same CATH topology
3SWSC 2AGWD 2IUVD 2MTAL 2OIZD 2MADL 3RN1C 3L4OC 4O1QC 1MDAL 4L3GC 2I0SD 2H3XB 2J55L 3PXTC 2I0RD 2I0TD 2AGXD 4FA4C 4FB1C 2HKMD 3RMZC 2IUPD 1MAEL 3SXTC 2AGLD 2HJBD 1MG3B 3PXSC 2Q7QD 4FAVC 2HXCD 3RN0C 4K3IC 2HKRD 2OK6D 3ORVC 4FA1C 2OJYD 3L4MC 2HJ4D 2AGYD 1MAFL 3SVWC 3C75L 4L3HC 1MG2B 3PXWC 4Y5RC 2OK4D 2IAAB 4FA5C 2GC4B 2AH0D 2IURD 2J56L 4FANC 2J57K 2H47B 3RLMC 3SJLC 2AGZD 2BBKL 2IUQD 4FA9C 4L1QC 2GC7B 2AH1D 3SLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWS C;  2AGW D;  2IUV D;  2MTA L;  2OIZ D;  2MAD L;  3RN1 C;  3L4O C;  4O1Q C;  1MDA L;  4L3G C;  2I0S D;  2H3X B;  2J55 L;  3PXT C;  2I0R D;  2I0T D;  2AGX D;  4FA4 C;  4FB1 C;  2HKM D;  3RMZ C;  2IUP D;  1MAE L;  3SXT C;  2AGL D;  2HJB D;  1MG3 B;  3PXS C;  2Q7Q D;  4FAV C;  2HXC D;  3RN0 C;  4K3I C;  2HKR D;  2OK6 D;  3ORV C;  4FA1 C;  2OJY D;  3L4M C;  2HJ4 D;  2AGY D;  1MAF L;  3SVW C;  3C75 L;  4L3H C;  1MG2 B;  3PXW C;  4Y5R C;  2OK4 D;  2IAA B;  4FA5 C;  2GC4 B;  2AH0 D;  2IUR D;  2J56 L;  4FAN C;  2J57 K;  2H47 B;  3RLM C;  3SJL C;  2AGZ D;  2BBK L;  2IUQ D;  4FA9 C;  4L1Q C;  2GC7 B;  2AH1 D;  3SLE C; 
#chains in the Genus database with same CATH topology
 3SWS C;  2AGW D;  2IUV D;  2MTA L;  2OIZ D;  2MAD L;  3RN1 C;  3L4O C;  4O1Q C;  1MDA L;  4L3G C;  2I0S D;  2H3X B;  2J55 L;  3PXT C;  2I0R D;  2I0T D;  2AGX D;  4FA4 C;  4FB1 C;  2HKM D;  3RMZ C;  2IUP D;  1MAE L;  3SXT C;  2AGL D;  2HJB D;  1MG3 B;  3PXS C;  2Q7Q D;  4FAV C;  2HXC D;  3RN0 C;  4K3I C;  2HKR D;  2OK6 D;  3ORV C;  4FA1 C;  2OJY D;  3L4M C;  2HJ4 D;  2AGY D;  1MAF L;  3SVW C;  3C75 L;  4L3H C;  1MG2 B;  3PXW C;  4Y5R C;  2OK4 D;  2IAA B;  4FA5 C;  2GC4 B;  2AH0 D;  2IUR D;  2J56 L;  4FAN C;  2J57 K;  2H47 B;  3RLM C;  3SJL C;  2AGZ D;  2BBK L;  2IUQ D;  4FA9 C;  4L1Q C;  2GC7 B;  2AH1 D;  3SLE C; 
#chains in the Genus database with same CATH homology
 3SWS C;  2AGW D;  2IUV D;  2MTA L;  2OIZ D;  2MAD L;  3RN1 C;  3L4O C;  4O1Q C;  1MDA L;  4L3G C;  2I0S D;  2H3X B;  2J55 L;  3PXT C;  2I0R D;  2I0T D;  2AGX D;  4FA4 C;  4FB1 C;  2HKM D;  3RMZ C;  2IUP D;  1MAE L;  3SXT C;  2AGL D;  2HJB D;  1MG3 B;  3PXS C;  2Q7Q D;  4FAV C;  2HXC D;  3RN0 C;  4K3I C;  2HKR D;  2OK6 D;  3ORV C;  4FA1 C;  2OJY D;  3L4M C;  2HJ4 D;  2AGY D;  1MAF L;  3SVW C;  3C75 L;  4L3H C;  1MG2 B;  3PXW C;  4Y5R C;  2OK4 D;  2IAA B;  4FA5 C;  2GC4 B;  2AH0 D;  2IUR D;  2J56 L;  4FAN C;  2J57 K;  2H47 B;  3RLM C;  3SJL C;  2AGZ D;  2BBK L;  2IUQ D;  4FA9 C;  4L1Q C;  2GC7 B;  2AH1 D;  3SLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...