3PXSD

Crystal structure of diferrous maug in complex with pre-methylamine dehydrogenase:
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 94
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3pxsD00
5EMMB 3FGBA 4J87A 3UVLA 4LG9A 5EMKB 3UVOA 4TZ4A 4E54A 4XEIC 3F3PA 2YBAA 3OKTA 4X63B 5TDHB 3GFCA 3I8EA 2P9PC 3CFSB 2IURA 4D0KA 3MZKA 4H5IA 3FM0A 3N0DA 2YNOA 4O1QD 4J0XA 2OVQB 4U7AA 4Y5RD 5FKTA 3PVUB 3RLMD 2Z2NA 4EWRA 4CZYA 5GMKn 3K26A 1Q47A 2B5LA 3IIYA 1NR0A 5AJAA 2B5NA 4GQ2P 2P9NC 1RI6A 4A2LA 4J8GA 4U1EI 2XYIA 4OWRA 4A0AB 4QQEA 1U2VC 2H9NA 4O9DA 2B5MA 2UZXB 3OTTA 5CXBB 4JT6C 5IT9g 5H17A 2O9KA 2EBSA 1L0QA 2BCJB 5HQGA 3C75H 2GNQA 5FKQA 4X60B 3EI1A 3I7LA 4JXMA 2H9MA 1PI6A 3JZGA 2PM9B 2HESX 1XHMA 1JMXB 3AL8B 5EMJB 4ZN4A 5EAMA 3JROA 4YVDA 3ULEC 4CY1A 3J80g 4E5ZA 4N14A 3DXMC 3RMZD 3I7PA 4ES0A 5HE2B 4K3ID 3DSMA 4CZXA 1YFQA 4XYHA 3GREA 4GQBB 4J77A 2H6QA 3EI3A 3JPXA 3UVNA 5C2VB 1FWXA 1U4CA 3PXSD 3DXKC 4X3EA 1JOFA 3PE7A 5FKRA 4PBZA 1MG2A 2YNPA 2XL3A 5C9ZB 2P9UC 3I2NA 5TEEA 3UVMA 5EM2A 1B9YA 2I3SA 3V7DB 4CI2A 4GM9A 2OVRB 1OLZA 3EI4B 4X61B 2P9LC 4FWWA 4JT5C 4MK0B 4GGAA 3I7KA 3I7NA 3OKYB 2PBIB 3BG1A 4CI1A 3IJ1A 2HKMA 5TF2A 2CN3A 4CY2A 2H6NA 5EMLB 4GMBA 5I5JA 4I79A 2YMUA 3SMRA 4H5JA 1PEVA 5CXCB 4GZ8A 4ZOXA 3VA6A 3ODTA 1XKSA 3KRXB 4PXWA 4IA9A 2AGZA 3SBQA 3BG0A 2H9LA 5EARA 4LG8A 3SJLD 3JRPA 3DM0A 3OL2B 3U4YA 4OZUA 3W15A 2CNXA 3SN6B 3L4MD 4QRJA 4LGNA 3V5WB 4ESGA 5IGOA 4JD2C 4PC0A 3J81g 2P9KC 4A08B 4XYIA 5AMSA 4QT8A 3SVWD 3F3GA 3UVKA 1NEXB 2G99A 4FA9D 4GGDA 2GC7A 5IJ8E 2YNNA 5FQDA 5CYKB 3L4OD 5IGQA 2PM6B 3MKQA 4CY3A 5H14A 2GC4A 3VH0A 4L3HD 3UKRC 2I3TA 2W18A 4ERQA 3PSCB 3RSEC 3AFCA 3IJCA 3OKWA 5JWZA 5GXIA 4FAVD 1TBGA 2HJBA 1ERJA 1P22A 4J82A 4BUJC 4GM8A 4A0BA 3DWLC 4A11A 2H68A 3SCYA 3V9FA 1SQJA 4O45A 4L1QD 4E54B 5I5IA 3PVWB 4IMMA 1PBYB 2IAAA 2CN2A 3F3FA 4CC9A 3MXXA 2H9PA 2IUPA 1MG3A 4A09B 3NVNA 4A7JA 4J81A 3B7FA 3EI2A 4A2MA 4J78A 3SXTD 3JZHA 2P9IC 2IWKA 2CO0C 2QXVA 4JSNC 3CFVA 4FA4D 4ZOVA 2H14A 1S4UX 2IUQA 4K3JB 4JSXC 2AGXA 4GQ1A 1MDAH 2J57G 3JAMg 5GXHA 1K32A 4J86A 3K27A 5SXMA 3MKSB 3RFHA 3C99A 2I0SA 2TRCB 3I7HA 4FB1D 2OVPB 3RN0D 3EI1B 2HYEA 4AEZA 4GM3A 4UI9R 4HDJA 1VYHC 4KFMB 1GXRA 2AH1A 4FHLA 3EG6A 4J0WA 5FLXg 4O3TB 4E5ZB 2AQ5A 4Z8LA 4ZOZA 1SQ9A 3I89A 1K8KC 2AGWA 5B4WA 2Q7QA 3RRMC 1N6DA 4A0AA 2OK6A 4GGCA 4J73A 3EI3B 2J55H 5CXBA 2P9SC 4Y7RA 3BWSA 5K19A 5THAA 1A0RB 3KRWB 5FXYA 2PM9A 2I0TA 4PSWB 5EM2B 3AL8A 3SFZA 4BL0A 4PSXB 4L9OA 2AGLA 3IIWA 2CE9A 1B9XA 2CO0A 4CY5A 5FKSA 3MMYA 3A0FA 5H1MA 4A09A 2H3XA 5EALA 4NSXA 3ZWLB 1N6EA 3EU7A 3MZLA 3PSLA 5TEFA 3SBRA 5FA5B 2XL2A 2HKRA 3E0CA 2G9AA 1QNIA 2QC5A 5HE0B 5C2WB 2OIZA 3FRXA 3SHFA 4ZOYA 3CIKB 2UZYB 3IKOA 3SWSD 2IWFA 2CE8A 4JSVC 2OK4A 3EI4A 2BBKH 4R7AB 3ORVD 2H13A 3OW8A 3OKYA 5IC7A 2MTAH 4FA5D 3C5MA 2J56H 3NVXA 3UKUC 4CI3A 4ERZA 5CXCA 3PXWD 3PXTD 2AH0A 4PNKB 2H47A 4ERYA 3I7OA 3IJ0A 1JMZB 4QL1A 3VGZA 3HFQA 4JSPC 1R5MA 2IUVA 1XIPA 3JZNA 3RFGA 3OL2A 1PGUA 5KDOB 4O3UB 3RN1D 5GSAA 3AL9A 2AGYA 1JJUB 5I5MA 2B4EA 4J84A 4FAND 3N0EA 5A2Qg 4L3GD 2HJ4A 1GOTB 4PBYA 3UR4A 3JB9L 4A08A 1GP2B 3SLED 2HXCA 5HE3B 4FA1D 2Z2PA 5K1CC 5IJ7E 3P4FA 4A0BB 2OJYA 3AH8B 4J79A 1OMWB 4A11B 5CYKA 4BH6A 1SHYB 4J8BA 2YB8B 4CI8A 5HYNB 2Z2OA 5AFU3 3SBPA 1TYQC 4G56B 5EAPA 1GG2B 2XU7A 3I8CA 2I0RA 3NVQA 4CZVA 5HE1B 3EI2B 1N6FA 4AOWA 3C9CA 3EWEA 2H6KA 3EMHA 2PM7B 4D6VA
chains in the Genus database with same CATH superfamily
1GOHA 3FGBA 4J87A 5EMMB 2VC2A 3UVLA 4LG9A 5EMKB 3UVOA 4TZ4A 4E54A 4RE5A 4NAAA 1O6GA 4XEIC 4IRZA 3F3PA 2XZGA 1T2XA 5FFOA 2YBAA 1VZ3A 5FFGA 3OKTA 4X63B 4AMYA 3V4PA 5TDHB 3GFCA 3I8EA 2P9PC 3CFSB 2IURA 4D0KA 3MZKA 4H5IA 3FM0A 3N0DA 2YNOA 4O1QD 4J0XA 1JV2A 2OVQB 4U7AA 4Z7NA 4WK4A 4G1EA 4Y5RD 2QR5A 3PVUB 5FKTA 3RLMD 2Z2NA 3MUNA 4CZYA 4EWRA 5GMKn 3K26A 1Q47A 2B5LA 3IIYA 1NR0A 2VDPA 5AJAA 3IUQA 2B5NA 4GQ2P 4L1MA 2P9NC 5M5TA 1RI6A 1UTCA 2VDKA 4J8GA 3ZDYA 4U1EI 4A2LA 2XYIA 5M5UA 1H2WA 4OWRA 2EIBA 4A0AB 4QQEA 1U2VC 2H9NA 4O9DA 3ZDZA 2B5MA 1UOPA 2UZXB 3OTTA 5M5RA 5CXBB 4JT6C 4BCCA 1I2MB 5IT9g 1H2YA 5H17A 3FCSA 2O9KA 2EBSA 1L0QA 3O4JA 2BCJB 5HQGA 3C75H 2GNQA 5FKQA 4X60B 3EI1A 3I7LA 4JXMA 2H9MA 1PI6A 3JZGA 2PM9B 2HESX 1XHMA 2XDWA 1JMXB 3AL8B 5EMJB 4ZN4A 5EAMA 3JROA 4YVDA 3VI3A 3ULEC 4BP9A 4CY1A 3J80g 4E5ZA 4N14A 3DXMC 3RMZD 3I7PA 4ES0A 3IVMA 5HE2B 1GOFA 4K3ID 3DSMA 4CZXA 1YFQA 4XYHA 3GREA 4GQBB 4J77A 2H6QA 3EI3A 3JPXA 3UVNA 5C2VB 5M5VA 1FWXA 1U4CA 3PXSD 3DXKC 4X3EA 4AX4A 1JOFA 3PE7A 5FKRA 4PBZA 1MG2A 2YNPA 2XL3A 5C9ZB 2JKXA 2P9UC 3I2NA 5TEEA 3UVMA 3NIFA 3DDUA 5EM2A 3T3MA 1B9YA 2I3SA 3V7DB 5E6UA 4CI2A 4GM9A 2OVRB 1OLZA 3QI0A 3EI4B 3GD1I 4X61B 3IUNA 2P9LC 4FWWA 4JT5C 4MK0B 4GGAA 3I7KA 3I7NA 2EIEA 3OKYB 2PBIB 3BG1A 3T3PA 4CI1A 3IJ1A 4AN0A 3EQ9A 4O02A 2HKMA 5TF2A 2CN3A 4CY2A 2H6NA 5EMLB 4GMBA 4WK0A 5I5JA 4I79A 2YMUA 3SMRA 4H5JA 1PEVA 5CXCB 4GZ8A 3K6SA 3K72A 4ZOXA 3VA6A 2VDMA 3ODTA 1XKSA 3KRXB 4PXWA 4IA9A 3NIDA 2AGZA 3SBQA 3BG0A 2H9LA 5EARA 4LG8A 3SJLD 3JRPA 3DM0A 3ZDXA 4BP8A 3OL2B 3U4YA 4OZUA 3W15A 2CNXA 3SN6B 3L4MD 4QRJA 4MMZA 2WQ8A 4LGNA 4WK2A 3V5WB 5C86A 4ESGA 5IGOA 1TYEA 1BPOA 4JD2C 4PC0A 3J81g 3EQ7A 2P9KC 4A08B 4XYIA 5AMSA 4QT8A 3OF7A 3SVWD 3F3GA 3UVKA 1NEXB 2G99A 4G55A 4FA9D 4GGDA 2GC7A 5IJ8E 2YNNA 3IULA 5FQDA 5CYKB 3L4OD 5IGQA 3QHYB 2PM6B 3MKQA 4CY3A 2VDLA 2GC4A 5H14A 4DNVA 3VH0A 4L3HD 3UKRC 2I3TA 2W18A 4AMZA 4ERQA 3PSCB 3RSEC 3AFCA 3IJCA 3OKWA 5JWZA 5GXIA 4NENA 3GC3B 4FAVD 1TBGA 2HJBA 3IUMA 1ERJA 1P22A 4J82A 4BUJC 4GM8A 4A0BA 3DWLC 4A11A 2H68A 1U8CA 3SCYA 3K71A 3V9FA 2HU8A 1SQJA 4O45A 4L1QD 4G1MA 4E54B 5I5IA 3PVWB 1E8MA 4IMMA 1PBYB 2EIDA 2IAAA 2VDRA 1QFMA 2CN2A 3F3FA 4UM8A 4CC9A 3MXXA 2H9PA 1GOGA 2IUPA 1MG3A 2VDQA 4A09B 4BCDA 3NVNA 3NIGA 4A7JA 4J81A 3B7FA 3EI2A 4A2MA 3IURA 4J78A 3SXTD 3JZHA 2XE4A 1H2XA 2P9IC 2IWKA 2CO0C 2QXVA 4JSNC 4MMXA 3CFVA 3ZE1A 4FA4D 4ZOVA 2H14A 1S4UX 2IUQA 4K3JB 5E6RA 2VZ3A 4JSXC 2AGXA 4GQ1A 1MDAH 2J57G 1E8NA 1H2ZA 3JAMg 3FCUA 1JTDB 1C9LA 5GXHA 1K32A 4J86A 3K27A 4NC4A 5SXMA 1VE7A 3MKSB 3RFHA 3C99A 2I0SA 2TRCB 3I7HA 4D9SA 4FB1D 2OVPB 3IUJA 3RN0D 4RE6A 3EI1B 2HYEA 4AEZA 4GM3A 4UI9R 4HDJA 1VYHC 4KFMB 1GXRA 2AH1A 4FHLA 3EG6A 1UOOA 4J0WA 5FLXg 4O3TB 4E5ZB 2AQ5A 4Z8LA 4ZOZA 1SQ9A 3I89A 1K8KC 2AGWA 5B4WA 2Q7QA 3RRMC 1N6DA 4A0AA 2OK6A 4GGCA 4J73A 3MUOA 1M1XA 3EI3B 5C92A 2J55H 4JHPC 5CXBA 2P9SC 4Y7RA 3BWSA 5K19A 5THAA 1YR2A 1A0RB 3KRWB 5FXYA 1L5GA 2PM9A 2I0TA 4PSWB 5EM2B 3AL8A 3SFZA 4UM9A 4BL0A 4PSXB 2VDNA 4L9OA 2AGLA 3IIWA 2CE9A 1B9XA 2CO0A 5E6SA 3EQ8A 4CY5A 5FKSA 3MMYA 1UOQA 3A0FA 5H1MA 3O4GA 4A09A 2H3XA 5EALA 4NSXA 3ZWLB 1N6EA 3EU7A 3MZLA 3PSLA 5TEFA 3SBRA 2BKLA 5FA5B 2VDOA 2XL2A 2HKRA 3E0CA 2G9AA 1QNIA 2QC5A 5HE0B 5C2WB 2OIZA 3FRXA 1QFSA 3SHFA 4ZOYA 3CIKB 2UZYB 3IKOA 3SWSD 4JHNA 2IWFA 4DNUA 2CE8A 4JSVC 2OK4A 5M5SA 3EI4A 5HDBA 2BBKH 4R7AB 3ORVD 3MVDK 2H13A 3OW8A 4BCBA 3O4IA 3OKYA 5IC7A 2MTAH 4FA5D 1C9IA 4Z7OA 3O4HA 3C5MA 4WJKA 2J56H 3NVXA 3UKUC 4CI3A 4ERZA 5CXCA 3PXWD 3PXTD 2AH0A 4PNKB 3ZE0A 2H47A 4NBMA 4ERYA 2VZ1A 3I7OA 3IJ0A 3V4VA 1JMZB 4QL1A 4MMYA 3VGZA 3HFQA 4JSPC 1R5MA 2IUVA 1XIPA 3JZNA 3RFGA 3OL2A 1PGUA 5KDOB 3IJEA 4O3UB 3RN1D 5GSAA 3AL9A 1O6FA 2AGYA 1JJUB 5I5MA 2B4EA 2EICA 4J84A 4FAND 1A12A 3N0EA 5A2Qg 4L3GD 2HJ4A 1GOTB 4PBYA 3UR4A 3JB9L 4A08A 1GP2B 3SLED 2HXCA 3ZE2A 4O2WA 5HE3B 4FA1D 2Z2PA 5K1CC 5IJ7E 3P4FA 3VI4A 3KCIA 4Z7QA 4A0BB 2OJYA 3AH8B 1VZ2A 4J79A 1OMWB 4A11B 2QZPA 5CYKA 4BH6A 1E5TA 1K3IA 1SHYB 2YB8B 4J8BA 5M61A 4CI8A 5HYNB 2Z2OA 5AFU3 3SBPA 1TYQC 4G56B 5EAPA 1VE6A 1GG2B 2XU7A 4DNWA 4AN1A 3I8CA 2I0RA 3NVQA 4QAMA 4CZVA 2HU5A 5HE1B 3EI2B 1N6FA 2HU7A 4AOWA 3C9CA 3EWEA 2H6KA 3EMHA 2PM7B 4D6VA
chains in the Genus database with same CATH topology
5EMMB 3FGBA 4J87A 3UVLA 4LG9A 5EMKB 3UVOA 4TZ4A 4E54A 4XEIC 3F3PA 2YBAA 3OKTA 4X63B 5TDHB 3GFCA 3I8EA 2P9PC 3CFSB 2IURA 4D0KA 3MZKA 4H5IA 3FM0A 3N0DA 2YNOA 4O1QD 4J0XA 2OVQB 4U7AA 4Y5RD 5FKTA 3PVUB 3RLMD 2Z2NA 4EWRA 4CZYA 5GMKn 3K26A 1Q47A 2B5LA 3IIYA 1NR0A 5AJAA 2B5NA 4GQ2P 2P9NC 1RI6A 4A2LA 4J8GA 4U1EI 2XYIA 4OWRA 4A0AB 4QQEA 1U2VC 2H9NA 4O9DA 2B5MA 2UZXB 3OTTA 5CXBB 4JT6C 5IT9g 5H17A 2O9KA 2EBSA 1L0QA 2BCJB 5HQGA 3C75H 2GNQA 5FKQA 4X60B 3EI1A 3I7LA 4JXMA 2H9MA 1PI6A 3JZGA 2PM9B 2HESX 1XHMA 1JMXB 3AL8B 5EMJB 4ZN4A 5EAMA 3JROA 4YVDA 3ULEC 4CY1A 3J80g 4E5ZA 4N14A 3DXMC 3RMZD 3I7PA 4ES0A 5HE2B 4K3ID 3DSMA 4CZXA 1YFQA 4XYHA 3GREA 4GQBB 4J77A 2H6QA 3EI3A 3JPXA 3UVNA 5C2VB 1FWXA 1U4CA 3PXSD 3DXKC 4X3EA 1JOFA 3PE7A 5FKRA 4PBZA 1MG2A 2YNPA 2XL3A 5C9ZB 2P9UC 3I2NA 5TEEA 3UVMA 5EM2A 1B9YA 2I3SA 3V7DB 4CI2A 4GM9A 2OVRB 1OLZA 3EI4B 4X61B 2P9LC 4FWWA 4JT5C 4MK0B 4GGAA 3I7KA 3I7NA 3OKYB 2PBIB 3BG1A 4CI1A 3IJ1A 2HKMA 5TF2A 2CN3A 4CY2A 2H6NA 5EMLB 4GMBA 5I5JA 4I79A 2YMUA 3SMRA 4H5JA 1PEVA 5CXCB 4GZ8A 4ZOXA 3VA6A 3ODTA 1XKSA 3KRXB 4PXWA 4IA9A 2AGZA 3SBQA 3BG0A 2H9LA 5EARA 4LG8A 3SJLD 3JRPA 3DM0A 3OL2B 3U4YA 4OZUA 3W15A 2CNXA 3SN6B 3L4MD 4QRJA 4LGNA 3V5WB 4ESGA 5IGOA 4JD2C 4PC0A 3J81g 2P9KC 4A08B 4XYIA 5AMSA 4QT8A 3SVWD 3F3GA 3UVKA 1NEXB 2G99A 4FA9D 4GGDA 2GC7A 5IJ8E 2YNNA 5FQDA 5CYKB 3L4OD 5IGQA 2PM6B 3MKQA 4CY3A 5H14A 2GC4A 3VH0A 4L3HD 3UKRC 2I3TA 2W18A 4ERQA 3PSCB 3RSEC 3AFCA 3IJCA 3OKWA 5JWZA 5GXIA 4FAVD 1TBGA 2HJBA 1ERJA 1P22A 4J82A 4BUJC 4GM8A 4A0BA 3DWLC 4A11A 2H68A 3SCYA 3V9FA 1SQJA 4O45A 4L1QD 4E54B 5I5IA 3PVWB 4IMMA 1PBYB 2IAAA 2CN2A 3F3FA 4CC9A 3MXXA 2H9PA 2IUPA 1MG3A 4A09B 3NVNA 4A7JA 4J81A 3B7FA 3EI2A 4A2MA 4J78A 3SXTD 3JZHA 2P9IC 2IWKA 2CO0C 2QXVA 4JSNC 3CFVA 4FA4D 4ZOVA 2H14A 1S4UX 2IUQA 4K3JB 4JSXC 2AGXA 4GQ1A 1MDAH 2J57G 3JAMg 5GXHA 1K32A 4J86A 3K27A 5SXMA 3MKSB 3RFHA 3C99A 2I0SA 2TRCB 3I7HA 4FB1D 2OVPB 3RN0D 3EI1B 2HYEA 4AEZA 4GM3A 4UI9R 4HDJA 1VYHC 4KFMB 1GXRA 2AH1A 4FHLA 3EG6A 4J0WA 5FLXg 4O3TB 4E5ZB 2AQ5A 4Z8LA 4ZOZA 1SQ9A 3I89A 1K8KC 2AGWA 5B4WA 2Q7QA 3RRMC 1N6DA 4A0AA 2OK6A 4GGCA 4J73A 3EI3B 2J55H 5CXBA 2P9SC 4Y7RA 3BWSA 5K19A 5THAA 1A0RB 3KRWB 5FXYA 2PM9A 2I0TA 4PSWB 5EM2B 3AL8A 3SFZA 4BL0A 4PSXB 4L9OA 2AGLA 3IIWA 2CE9A 1B9XA 2CO0A 4CY5A 5FKSA 3MMYA 3A0FA 5H1MA 4A09A 2H3XA 5EALA 4NSXA 3ZWLB 1N6EA 3EU7A 3MZLA 3PSLA 5TEFA 3SBRA 5FA5B 2XL2A 2HKRA 3E0CA 2G9AA 1QNIA 2QC5A 5HE0B 5C2WB 2OIZA 3FRXA 3SHFA 4ZOYA 3CIKB 2UZYB 3IKOA 3SWSD 2IWFA 2CE8A 4JSVC 2OK4A 3EI4A 2BBKH 4R7AB 3ORVD 2H13A 3OW8A 3OKYA 5IC7A 2MTAH 4FA5D 3C5MA 2J56H 3NVXA 3UKUC 4CI3A 4ERZA 5CXCA 3PXWD 3PXTD 2AH0A 4PNKB 2H47A 4ERYA 3I7OA 3IJ0A 1JMZB 4QL1A 3VGZA 3HFQA 4JSPC 1R5MA 2IUVA 1XIPA 3JZNA 3RFGA 3OL2A 1PGUA 5KDOB 4O3UB 3RN1D 5GSAA 3AL9A 2AGYA 1JJUB 5I5MA 2B4EA 4J84A 4FAND 3N0EA 5A2Qg 4L3GD 2HJ4A 1GOTB 4PBYA 3UR4A 3JB9L 4A08A 1GP2B 3SLED 2HXCA 5HE3B 4FA1D 2Z2PA 5K1CC 5IJ7E 3P4FA 4A0BB 2OJYA 3AH8B 4J79A 1OMWB 4A11B 5CYKA 4BH6A 1SHYB 4J8BA 2YB8B 4CI8A 5HYNB 2Z2OA 5AFU3 3SBPA 1TYQC 4G56B 5EAPA 1GG2B 2XU7A 3I8CA 2I0RA 3NVQA 4CZVA 5HE1B 3EI2B 1N6FA 4AOWA 3C9CA 3EWEA 2H6KA 3EMHA 2PM7B 4D6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EMM B;  3FGB A;  4J87 A;  3UVL A;  4LG9 A;  5EMK B;  3UVO A;  4TZ4 A;  4E54 A;  4XEI C;  3F3P A;  2YBA A;  3OKT A;  4X63 B;  5TDH B;  3GFC A;  3I8E A;  2P9P C;  3CFS B;  2IUR A;  4D0K A;  3MZK A;  4H5I A;  3FM0 A;  3N0D A;  2YNO A;  4O1Q D;  4J0X A;  2OVQ B;  4U7A A;  4Y5R D;  5FKT A;  3PVU B;  3RLM D;  2Z2N A;  4EWR A;  4CZY A;  5GMK n;  3K26 A;  1Q47 A;  2B5L A;  3IIY A;  1NR0 A;  5AJA A;  2B5N A;  4GQ2 P;  2P9N C;  1RI6 A;  4A2L A;  4J8G A;  4U1E I;  2XYI A;  4OWR A;  4A0A B;  4QQE A;  1U2V C;  2H9N A;  4O9D A;  2B5M A;  2UZX B;  3OTT A;  5CXB B;  4JT6 C;  5IT9 g;  5H17 A;  2O9K A;  2EBS A;  1L0Q A;  2BCJ B;  5HQG A;  3C75 H;  2GNQ A;  5FKQ A;  4X60 B;  3EI1 A;  3I7L A;  4JXM A;  2H9M A;  1PI6 A;  3JZG A;  2PM9 B;  2HES X;  1XHM A;  1JMX B;  3AL8 B;  5EMJ B;  4ZN4 A;  5EAM A;  3JRO A;  4YVD A;  3ULE C;  4CY1 A;  3J80 g;  4E5Z A;  4N14 A;  3DXM C;  3RMZ D;  3I7P A;  4ES0 A;  5HE2 B;  4K3I D;  3DSM A;  4CZX A;  1YFQ A;  4XYH A;  3GRE A;  4GQB B;  4J77 A;  2H6Q A;  3EI3 A;  3JPX A;  3UVN A;  5C2V B;  1FWX A;  1U4C A;  3PXS D;  3DXK C;  4X3E A;  1JOF A;  3PE7 A;  5FKR A;  4PBZ A;  1MG2 A;  2YNP A;  2XL3 A;  5C9Z B;  2P9U C;  3I2N A;  5TEE A;  3UVM A;  5EM2 A;  1B9Y A;  2I3S A;  3V7D B;  4CI2 A;  4GM9 A;  2OVR B;  1OLZ A;  3EI4 B;  4X61 B;  2P9L C;  4FWW A;  4JT5 C;  4MK0 B;  4GGA A;  3I7K A;  3I7N A;  3OKY B;  2PBI B;  3BG1 A;  4CI1 A;  3IJ1 A;  2HKM A;  5TF2 A;  2CN3 A;  4CY2 A;  2H6N A;  5EML B;  4GMB A;  5I5J A;  4I79 A;  2YMU A;  3SMR A;  4H5J A;  1PEV A;  5CXC B;  4GZ8 A;  4ZOX A;  3VA6 A;  3ODT A;  1XKS A;  3KRX B;  4PXW A;  4IA9 A;  2AGZ A;  3SBQ A;  3BG0 A;  2H9L A;  5EAR A;  4LG8 A;  3SJL D;  3JRP A;  3DM0 A;  3OL2 B;  3U4Y A;  4OZU A;  3W15 A;  2CNX A;  3SN6 B;  3L4M D;  4QRJ A;  4LGN A;  3V5W B;  4ESG A;  5IGO A;  4JD2 C;  4PC0 A;  3J81 g;  2P9K C;  4A08 B;  4XYI A;  5AMS A;  4QT8 A;  3SVW D;  3F3G A;  3UVK A;  1NEX B;  2G99 A;  4FA9 D;  4GGD A;  2GC7 A;  5IJ8 E;  2YNN A;  5FQD A;  5CYK B;  3L4O D;  5IGQ A;  2PM6 B;  3MKQ A;  4CY3 A;  5H14 A;  2GC4 A;  3VH0 A;  4L3H D;  3UKR C;  2I3T A;  2W18 A;  4ERQ A;  3PSC B;  3RSE C;  3AFC A;  3IJC A;  3OKW A;  5JWZ A;  5GXI A;  4FAV D;  1TBG A;  2HJB A;  1ERJ A;  1P22 A;  4J82 A;  4BUJ C;  4GM8 A;  4A0B A;  3DWL C;  4A11 A;  2H68 A;  3SCY A;  3V9F A;  1SQJ A;  4O45 A;  4L1Q D;  4E54 B;  5I5I A;  3PVW B;  4IMM A;  1PBY B;  2IAA A;  2CN2 A;  3F3F A;  4CC9 A;  3MXX A;  2H9P A;  2IUP A;  1MG3 A;  4A09 B;  3NVN A;  4A7J A;  4J81 A;  3B7F A;  3EI2 A;  4A2M A;  4J78 A;  3SXT D;  3JZH A;  2P9I C;  2IWK A;  2CO0 C;  2QXV A;  4JSN C;  3CFV A;  4FA4 D;  4ZOV A;  2H14 A;  1S4U X;  2IUQ A;  4K3J B;  4JSX C;  2AGX A;  4GQ1 A;  1MDA H;  2J57 G;  3JAM g;  5GXH A;  1K32 A;  4J86 A;  3K27 A;  5SXM A;  3MKS B;  3RFH A;  3C99 A;  2I0S A;  2TRC B;  3I7H A;  4FB1 D;  2OVP B;  3RN0 D;  3EI1 B;  2HYE A;  4AEZ A;  4GM3 A;  4UI9 R;  4HDJ A;  1VYH C;  4KFM B;  1GXR A;  2AH1 A;  4FHL A;  3EG6 A;  4J0W A;  5FLX g;  4O3T B;  4E5Z B;  2AQ5 A;  4Z8L A;  4ZOZ A;  1SQ9 A;  3I89 A;  1K8K C;  2AGW A;  5B4W A;  2Q7Q A;  3RRM C;  1N6D A;  4A0A A;  2OK6 A;  4GGC A;  4J73 A;  3EI3 B;  2J55 H;  5CXB A;  2P9S C;  4Y7R A;  3BWS A;  5K19 A;  5THA A;  1A0R B;  3KRW B;  5FXY A;  2PM9 A;  2I0T A;  4PSW B;  5EM2 B;  3AL8 A;  3SFZ A;  4BL0 A;  4PSX B;  4L9O A;  2AGL A;  3IIW A;  2CE9 A;  1B9X A;  2CO0 A;  4CY5 A;  5FKS A;  3MMY A;  3A0F A;  5H1M A;  4A09 A;  2H3X A;  5EAL A;  4NSX A;  3ZWL B;  1N6E A;  3EU7 A;  3MZL A;  3PSL A;  5TEF A;  3SBR A;  5FA5 B;  2XL2 A;  2HKR A;  3E0C A;  2G9A A;  1QNI A;  2QC5 A;  5HE0 B;  5C2W B;  2OIZ A;  3FRX A;  3SHF A;  4ZOY A;  3CIK B;  2UZY B;  3IKO A;  3SWS D;  2IWF A;  2CE8 A;  4JSV C;  2OK4 A;  3EI4 A;  2BBK H;  4R7A B;  3ORV D;  2H13 A;  3OW8 A;  3OKY A;  5IC7 A;  2MTA H;  4FA5 D;  3C5M A;  2J56 H;  3NVX A;  3UKU C;  4CI3 A;  4ERZ A;  5CXC A;  3PXW D;  3PXT D;  2AH0 A;  4PNK B;  2H47 A;  4ERY A;  3I7O A;  3IJ0 A;  1JMZ B;  4QL1 A;  3VGZ A;  3HFQ A;  4JSP C;  1R5M A;  2IUV A;  1XIP A;  3JZN A;  3RFG A;  3OL2 A;  1PGU A;  5KDO B;  4O3U B;  3RN1 D;  5GSA A;  3AL9 A;  2AGY A;  1JJU B;  5I5M A;  2B4E A;  4J84 A;  4FAN D;  3N0E A;  5A2Q g;  4L3G D;  2HJ4 A;  1GOT B;  4PBY A;  3UR4 A;  3JB9 L;  4A08 A;  1GP2 B;  3SLE D;  2HXC A;  5HE3 B;  4FA1 D;  2Z2P A;  5K1C C;  5IJ7 E;  3P4F A;  4A0B B;  2OJY A;  3AH8 B;  4J79 A;  1OMW B;  4A11 B;  5CYK A;  4BH6 A;  1SHY B;  4J8B A;  2YB8 B;  4CI8 A;  5HYN B;  2Z2O A;  5AFU 3;  3SBP A;  1TYQ C;  4G56 B;  5EAP A;  1GG2 B;  2XU7 A;  3I8C A;  2I0R A;  3NVQ A;  4CZV A;  5HE1 B;  3EI2 B;  1N6F A;  4AOW A;  3C9C A;  3EWE A;  2H6K A;  3EMH A;  2PM7 B;  4D6V A; 
#chains in the Genus database with same CATH topology
 1GOH A;  3FGB A;  4J87 A;  5EMM B;  2VC2 A;  3UVL A;  4LG9 A;  5EMK B;  3UVO A;  4TZ4 A;  4E54 A;  4RE5 A;  4NAA A;  1O6G A;  4XEI C;  4IRZ A;  3F3P A;  2XZG A;  1T2X A;  5FFO A;  2YBA A;  1VZ3 A;  5FFG A;  3OKT A;  4X63 B;  4AMY A;  3V4P A;  5TDH B;  3GFC A;  3I8E A;  2P9P C;  3CFS B;  2IUR A;  4D0K A;  3MZK A;  4H5I A;  3FM0 A;  3N0D A;  2YNO A;  4O1Q D;  4J0X A;  1JV2 A;  2OVQ B;  4U7A A;  4Z7N A;  4WK4 A;  4G1E A;  4Y5R D;  2QR5 A;  3PVU B;  5FKT A;  3RLM D;  2Z2N A;  3MUN A;  4CZY A;  4EWR A;  5GMK n;  3K26 A;  1Q47 A;  2B5L A;  3IIY A;  1NR0 A;  2VDP A;  5AJA A;  3IUQ A;  2B5N A;  4GQ2 P;  4L1M A;  2P9N C;  5M5T A;  1RI6 A;  1UTC A;  2VDK A;  4J8G A;  3ZDY A;  4U1E I;  4A2L A;  2XYI A;  5M5U A;  1H2W A;  4OWR A;  2EIB A;  4A0A B;  4QQE A;  1U2V C;  2H9N A;  4O9D A;  3ZDZ A;  2B5M A;  1UOP A;  2UZX B;  3OTT A;  5M5R A;  5CXB B;  4JT6 C;  4BCC A;  1I2M B;  5IT9 g;  1H2Y A;  5H17 A;  3FCS A;  2O9K A;  2EBS A;  1L0Q A;  3O4J A;  2BCJ B;  5HQG A;  3C75 H;  2GNQ A;  5FKQ A;  4X60 B;  3EI1 A;  3I7L A;  4JXM A;  2H9M A;  1PI6 A;  3JZG A;  2PM9 B;  2HES X;  1XHM A;  2XDW A;  1JMX B;  3AL8 B;  5EMJ B;  4ZN4 A;  5EAM A;  3JRO A;  4YVD A;  3VI3 A;  3ULE C;  4BP9 A;  4CY1 A;  3J80 g;  4E5Z A;  4N14 A;  3DXM C;  3RMZ D;  3I7P A;  4ES0 A;  3IVM A;  5HE2 B;  1GOF A;  4K3I D;  3DSM A;  4CZX A;  1YFQ A;  4XYH A;  3GRE A;  4GQB B;  4J77 A;  2H6Q A;  3EI3 A;  3JPX A;  3UVN A;  5C2V B;  5M5V A;  1FWX A;  1U4C A;  3PXS D;  3DXK C;  4X3E A;  4AX4 A;  1JOF A;  3PE7 A;  5FKR A;  4PBZ A;  1MG2 A;  2YNP A;  2XL3 A;  5C9Z B;  2JKX A;  2P9U C;  3I2N A;  5TEE A;  3UVM A;  3NIF A;  3DDU A;  5EM2 A;  3T3M A;  1B9Y A;  2I3S A;  3V7D B;  5E6U A;  4CI2 A;  4GM9 A;  2OVR B;  1OLZ A;  3QI0 A;  3EI4 B;  3GD1 I;  4X61 B;  3IUN A;  2P9L C;  4FWW A;  4JT5 C;  4MK0 B;  4GGA A;  3I7K A;  3I7N A;  2EIE A;  3OKY B;  2PBI B;  3BG1 A;  3T3P A;  4CI1 A;  3IJ1 A;  4AN0 A;  3EQ9 A;  4O02 A;  2HKM A;  5TF2 A;  2CN3 A;  4CY2 A;  2H6N A;  5EML B;  4GMB A;  4WK0 A;  5I5J A;  4I79 A;  2YMU A;  3SMR A;  4H5J A;  1PEV A;  5CXC B;  4GZ8 A;  3K6S A;  3K72 A;  4ZOX A;  3VA6 A;  2VDM A;  3ODT A;  1XKS A;  3KRX B;  4PXW A;  4IA9 A;  3NID A;  2AGZ A;  3SBQ A;  3BG0 A;  2H9L A;  5EAR A;  4LG8 A;  3SJL D;  3JRP A;  3DM0 A;  3ZDX A;  4BP8 A;  3OL2 B;  3U4Y A;  4OZU A;  3W15 A;  2CNX A;  3SN6 B;  3L4M D;  4QRJ A;  4MMZ A;  2WQ8 A;  4LGN A;  4WK2 A;  3V5W B;  5C86 A;  4ESG A;  5IGO A;  1TYE A;  1BPO A;  4JD2 C;  4PC0 A;  3J81 g;  3EQ7 A;  2P9K C;  4A08 B;  4XYI A;  5AMS A;  4QT8 A;  3OF7 A;  3SVW D;  3F3G A;  3UVK A;  1NEX B;  2G99 A;  4G55 A;  4FA9 D;  4GGD A;  2GC7 A;  5IJ8 E;  2YNN A;  3IUL A;  5FQD A;  5CYK B;  3L4O D;  5IGQ A;  3QHY B;  2PM6 B;  3MKQ A;  4CY3 A;  2VDL A;  2GC4 A;  5H14 A;  4DNV A;  3VH0 A;  4L3H D;  3UKR C;  2I3T A;  2W18 A;  4AMZ A;  4ERQ A;  3PSC B;  3RSE C;  3AFC A;  3IJC A;  3OKW A;  5JWZ A;  5GXI A;  4NEN A;  3GC3 B;  4FAV D;  1TBG A;  2HJB A;  3IUM A;  1ERJ A;  1P22 A;  4J82 A;  4BUJ C;  4GM8 A;  4A0B A;  3DWL C;  4A11 A;  2H68 A;  1U8C A;  3SCY A;  3K71 A;  3V9F A;  2HU8 A;  1SQJ A;  4O45 A;  4L1Q D;  4G1M A;  4E54 B;  5I5I A;  3PVW B;  1E8M A;  4IMM A;  1PBY B;  2EID A;  2IAA A;  2VDR A;  1QFM A;  2CN2 A;  3F3F A;  4UM8 A;  4CC9 A;  3MXX A;  2H9P A;  1GOG A;  2IUP A;  1MG3 A;  2VDQ A;  4A09 B;  4BCD A;  3NVN A;  3NIG A;  4A7J A;  4J81 A;  3B7F A;  3EI2 A;  4A2M A;  3IUR A;  4J78 A;  3SXT D;  3JZH A;  2XE4 A;  1H2X A;  2P9I C;  2IWK A;  2CO0 C;  2QXV A;  4JSN C;  4MMX A;  3CFV A;  3ZE1 A;  4FA4 D;  4ZOV A;  2H14 A;  1S4U X;  2IUQ A;  4K3J B;  5E6R A;  2VZ3 A;  4JSX C;  2AGX A;  4GQ1 A;  1MDA H;  2J57 G;  1E8N A;  1H2Z A;  3JAM g;  3FCU A;  1JTD B;  1C9L A;  5GXH A;  1K32 A;  4J86 A;  3K27 A;  4NC4 A;  5SXM A;  1VE7 A;  3MKS B;  3RFH A;  3C99 A;  2I0S A;  2TRC B;  3I7H A;  4D9S A;  4FB1 D;  2OVP B;  3IUJ A;  3RN0 D;  4RE6 A;  3EI1 B;  2HYE A;  4AEZ A;  4GM3 A;  4UI9 R;  4HDJ A;  1VYH C;  4KFM B;  1GXR A;  2AH1 A;  4FHL A;  3EG6 A;  1UOO A;  4J0W A;  5FLX g;  4O3T B;  4E5Z B;  2AQ5 A;  4Z8L A;  4ZOZ A;  1SQ9 A;  3I89 A;  1K8K C;  2AGW A;  5B4W A;  2Q7Q A;  3RRM C;  1N6D A;  4A0A A;  2OK6 A;  4GGC A;  4J73 A;  3MUO A;  1M1X A;  3EI3 B;  5C92 A;  2J55 H;  4JHP C;  5CXB A;  2P9S C;  4Y7R A;  3BWS A;  5K19 A;  5THA A;  1YR2 A;  1A0R B;  3KRW B;  5FXY A;  1L5G A;  2PM9 A;  2I0T A;  4PSW B;  5EM2 B;  3AL8 A;  3SFZ A;  4UM9 A;  4BL0 A;  4PSX B;  2VDN A;  4L9O A;  2AGL A;  3IIW A;  2CE9 A;  1B9X A;  2CO0 A;  5E6S A;  3EQ8 A;  4CY5 A;  5FKS A;  3MMY A;  1UOQ A;  3A0F A;  5H1M A;  3O4G A;  4A09 A;  2H3X A;  5EAL A;  4NSX A;  3ZWL B;  1N6E A;  3EU7 A;  3MZL A;  3PSL A;  5TEF A;  3SBR A;  2BKL A;  5FA5 B;  2VDO A;  2XL2 A;  2HKR A;  3E0C A;  2G9A A;  1QNI A;  2QC5 A;  5HE0 B;  5C2W B;  2OIZ A;  3FRX A;  1QFS A;  3SHF A;  4ZOY A;  3CIK B;  2UZY B;  3IKO A;  3SWS D;  4JHN A;  2IWF A;  4DNU A;  2CE8 A;  4JSV C;  2OK4 A;  5M5S A;  3EI4 A;  5HDB A;  2BBK H;  4R7A B;  3ORV D;  3MVD K;  2H13 A;  3OW8 A;  4BCB A;  3O4I A;  3OKY A;  5IC7 A;  2MTA H;  4FA5 D;  1C9I A;  4Z7O A;  3O4H A;  3C5M A;  4WJK A;  2J56 H;  3NVX A;  3UKU C;  4CI3 A;  4ERZ A;  5CXC A;  3PXW D;  3PXT D;  2AH0 A;  4PNK B;  3ZE0 A;  2H47 A;  4NBM A;  4ERY A;  2VZ1 A;  3I7O A;  3IJ0 A;  3V4V A;  1JMZ B;  4QL1 A;  4MMY A;  3VGZ A;  3HFQ A;  4JSP C;  1R5M A;  2IUV A;  1XIP A;  3JZN A;  3RFG A;  3OL2 A;  1PGU A;  5KDO B;  3IJE A;  4O3U B;  3RN1 D;  5GSA A;  3AL9 A;  1O6F A;  2AGY A;  1JJU B;  5I5M A;  2B4E A;  2EIC A;  4J84 A;  4FAN D;  1A12 A;  3N0E A;  5A2Q g;  4L3G D;  2HJ4 A;  1GOT B;  4PBY A;  3UR4 A;  3JB9 L;  4A08 A;  1GP2 B;  3SLE D;  2HXC A;  3ZE2 A;  4O2W A;  5HE3 B;  4FA1 D;  2Z2P A;  5K1C C;  5IJ7 E;  3P4F A;  3VI4 A;  3KCI A;  4Z7Q A;  4A0B B;  2OJY A;  3AH8 B;  1VZ2 A;  4J79 A;  1OMW B;  4A11 B;  2QZP A;  5CYK A;  4BH6 A;  1E5T A;  1K3I A;  1SHY B;  2YB8 B;  4J8B A;  5M61 A;  4CI8 A;  5HYN B;  2Z2O A;  5AFU 3;  3SBP A;  1TYQ C;  4G56 B;  5EAP A;  1VE6 A;  1GG2 B;  2XU7 A;  4DNW A;  4AN1 A;  3I8C A;  2I0R A;  3NVQ A;  4QAM A;  4CZV A;  2HU5 A;  5HE1 B;  3EI2 B;  1N6F A;  2HU7 A;  4AOW A;  3C9C A;  3EWE A;  2H6K A;  3EMH A;  2PM7 B;  4D6V A; 
#chains in the Genus database with same CATH homology
 5EMM B;  3FGB A;  4J87 A;  3UVL A;  4LG9 A;  5EMK B;  3UVO A;  4TZ4 A;  4E54 A;  4XEI C;  3F3P A;  2YBA A;  3OKT A;  4X63 B;  5TDH B;  3GFC A;  3I8E A;  2P9P C;  3CFS B;  2IUR A;  4D0K A;  3MZK A;  4H5I A;  3FM0 A;  3N0D A;  2YNO A;  4O1Q D;  4J0X A;  2OVQ B;  4U7A A;  4Y5R D;  5FKT A;  3PVU B;  3RLM D;  2Z2N A;  4EWR A;  4CZY A;  5GMK n;  3K26 A;  1Q47 A;  2B5L A;  3IIY A;  1NR0 A;  5AJA A;  2B5N A;  4GQ2 P;  2P9N C;  1RI6 A;  4A2L A;  4J8G A;  4U1E I;  2XYI A;  4OWR A;  4A0A B;  4QQE A;  1U2V C;  2H9N A;  4O9D A;  2B5M A;  2UZX B;  3OTT A;  5CXB B;  4JT6 C;  5IT9 g;  5H17 A;  2O9K A;  2EBS A;  1L0Q A;  2BCJ B;  5HQG A;  3C75 H;  2GNQ A;  5FKQ A;  4X60 B;  3EI1 A;  3I7L A;  4JXM A;  2H9M A;  1PI6 A;  3JZG A;  2PM9 B;  2HES X;  1XHM A;  1JMX B;  3AL8 B;  5EMJ B;  4ZN4 A;  5EAM A;  3JRO A;  4YVD A;  3ULE C;  4CY1 A;  3J80 g;  4E5Z A;  4N14 A;  3DXM C;  3RMZ D;  3I7P A;  4ES0 A;  5HE2 B;  4K3I D;  3DSM A;  4CZX A;  1YFQ A;  4XYH A;  3GRE A;  4GQB B;  4J77 A;  2H6Q A;  3EI3 A;  3JPX A;  3UVN A;  5C2V B;  1FWX A;  1U4C A;  3PXS D;  3DXK C;  4X3E A;  1JOF A;  3PE7 A;  5FKR A;  4PBZ A;  1MG2 A;  2YNP A;  2XL3 A;  5C9Z B;  2P9U C;  3I2N A;  5TEE A;  3UVM A;  5EM2 A;  1B9Y A;  2I3S A;  3V7D B;  4CI2 A;  4GM9 A;  2OVR B;  1OLZ A;  3EI4 B;  4X61 B;  2P9L C;  4FWW A;  4JT5 C;  4MK0 B;  4GGA A;  3I7K A;  3I7N A;  3OKY B;  2PBI B;  3BG1 A;  4CI1 A;  3IJ1 A;  2HKM A;  5TF2 A;  2CN3 A;  4CY2 A;  2H6N A;  5EML B;  4GMB A;  5I5J A;  4I79 A;  2YMU A;  3SMR A;  4H5J A;  1PEV A;  5CXC B;  4GZ8 A;  4ZOX A;  3VA6 A;  3ODT A;  1XKS A;  3KRX B;  4PXW A;  4IA9 A;  2AGZ A;  3SBQ A;  3BG0 A;  2H9L A;  5EAR A;  4LG8 A;  3SJL D;  3JRP A;  3DM0 A;  3OL2 B;  3U4Y A;  4OZU A;  3W15 A;  2CNX A;  3SN6 B;  3L4M D;  4QRJ A;  4LGN A;  3V5W B;  4ESG A;  5IGO A;  4JD2 C;  4PC0 A;  3J81 g;  2P9K C;  4A08 B;  4XYI A;  5AMS A;  4QT8 A;  3SVW D;  3F3G A;  3UVK A;  1NEX B;  2G99 A;  4FA9 D;  4GGD A;  2GC7 A;  5IJ8 E;  2YNN A;  5FQD A;  5CYK B;  3L4O D;  5IGQ A;  2PM6 B;  3MKQ A;  4CY3 A;  5H14 A;  2GC4 A;  3VH0 A;  4L3H D;  3UKR C;  2I3T A;  2W18 A;  4ERQ A;  3PSC B;  3RSE C;  3AFC A;  3IJC A;  3OKW A;  5JWZ A;  5GXI A;  4FAV D;  1TBG A;  2HJB A;  1ERJ A;  1P22 A;  4J82 A;  4BUJ C;  4GM8 A;  4A0B A;  3DWL C;  4A11 A;  2H68 A;  3SCY A;  3V9F A;  1SQJ A;  4O45 A;  4L1Q D;  4E54 B;  5I5I A;  3PVW B;  4IMM A;  1PBY B;  2IAA A;  2CN2 A;  3F3F A;  4CC9 A;  3MXX A;  2H9P A;  2IUP A;  1MG3 A;  4A09 B;  3NVN A;  4A7J A;  4J81 A;  3B7F A;  3EI2 A;  4A2M A;  4J78 A;  3SXT D;  3JZH A;  2P9I C;  2IWK A;  2CO0 C;  2QXV A;  4JSN C;  3CFV A;  4FA4 D;  4ZOV A;  2H14 A;  1S4U X;  2IUQ A;  4K3J B;  4JSX C;  2AGX A;  4GQ1 A;  1MDA H;  2J57 G;  3JAM g;  5GXH A;  1K32 A;  4J86 A;  3K27 A;  5SXM A;  3MKS B;  3RFH A;  3C99 A;  2I0S A;  2TRC B;  3I7H A;  4FB1 D;  2OVP B;  3RN0 D;  3EI1 B;  2HYE A;  4AEZ A;  4GM3 A;  4UI9 R;  4HDJ A;  1VYH C;  4KFM B;  1GXR A;  2AH1 A;  4FHL A;  3EG6 A;  4J0W A;  5FLX g;  4O3T B;  4E5Z B;  2AQ5 A;  4Z8L A;  4ZOZ A;  1SQ9 A;  3I89 A;  1K8K C;  2AGW A;  5B4W A;  2Q7Q A;  3RRM C;  1N6D A;  4A0A A;  2OK6 A;  4GGC A;  4J73 A;  3EI3 B;  2J55 H;  5CXB A;  2P9S C;  4Y7R A;  3BWS A;  5K19 A;  5THA A;  1A0R B;  3KRW B;  5FXY A;  2PM9 A;  2I0T A;  4PSW B;  5EM2 B;  3AL8 A;  3SFZ A;  4BL0 A;  4PSX B;  4L9O A;  2AGL A;  3IIW A;  2CE9 A;  1B9X A;  2CO0 A;  4CY5 A;  5FKS A;  3MMY A;  3A0F A;  5H1M A;  4A09 A;  2H3X A;  5EAL A;  4NSX A;  3ZWL B;  1N6E A;  3EU7 A;  3MZL A;  3PSL A;  5TEF A;  3SBR A;  5FA5 B;  2XL2 A;  2HKR A;  3E0C A;  2G9A A;  1QNI A;  2QC5 A;  5HE0 B;  5C2W B;  2OIZ A;  3FRX A;  3SHF A;  4ZOY A;  3CIK B;  2UZY B;  3IKO A;  3SWS D;  2IWF A;  2CE8 A;  4JSV C;  2OK4 A;  3EI4 A;  2BBK H;  4R7A B;  3ORV D;  2H13 A;  3OW8 A;  3OKY A;  5IC7 A;  2MTA H;  4FA5 D;  3C5M A;  2J56 H;  3NVX A;  3UKU C;  4CI3 A;  4ERZ A;  5CXC A;  3PXW D;  3PXT D;  2AH0 A;  4PNK B;  2H47 A;  4ERY A;  3I7O A;  3IJ0 A;  1JMZ B;  4QL1 A;  3VGZ A;  3HFQ A;  4JSP C;  1R5M A;  2IUV A;  1XIP A;  3JZN A;  3RFG A;  3OL2 A;  1PGU A;  5KDO B;  4O3U B;  3RN1 D;  5GSA A;  3AL9 A;  2AGY A;  1JJU B;  5I5M A;  2B4E A;  4J84 A;  4FAN D;  3N0E A;  5A2Q g;  4L3G D;  2HJ4 A;  1GOT B;  4PBY A;  3UR4 A;  3JB9 L;  4A08 A;  1GP2 B;  3SLE D;  2HXC A;  5HE3 B;  4FA1 D;  2Z2P A;  5K1C C;  5IJ7 E;  3P4F A;  4A0B B;  2OJY A;  3AH8 B;  4J79 A;  1OMW B;  4A11 B;  5CYK A;  4BH6 A;  1SHY B;  4J8B A;  2YB8 B;  4CI8 A;  5HYN B;  2Z2O A;  5AFU 3;  3SBP A;  1TYQ C;  4G56 B;  5EAP A;  1GG2 B;  2XU7 A;  3I8C A;  2I0R A;  3NVQ A;  4CZV A;  5HE1 B;  3EI2 B;  1N6F A;  4AOW A;  3C9C A;  3EWE A;  2H6K A;  3EMH A;  2PM7 B;  4D6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...