3PXTD

Crystal structure of ferrous co adduct of maug in complex with pre-methylamine dehydrogenase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3pxtD00
3AFCA 3NVXA 2CE8A 2CNXA 4PC0A 3SWSD 3BWSA 2OK4A 1TBGA 1L0QA 4GQBB 3SBRA 5CXCA 2UZXB 5FA5B 4J79A 5AJAA 3J80g 4BL0A 4CC9A 4CY5A 4I79A 2H6QA 4A09A 3GFCA 2OIZA 4A0AB 4E5ZA 1A0RB 3GREA 4A0BB 2B4EA 3FM0A 2I0SA 3V7DB 3SLED 5GXHA 4J82A 3I7PA 4GM3A 4XYIA 4YVDA 3RFHA 2EBSA 1NR0A 3JRPA 4O9DA 5IT9g 5CXCB 2J56H 1MG3A 3UR4A 3RLMD 5I5MA 3F3PA 3JAMg 5C2VB 2J57G 4A09B 1NEXB 5HYNB 1U4CA 2HKRA 4K3ID 2HYEA 3AL9A 3NVNA 1YFQA 3UVKA 4ERYA 2P9KC 1N6DA 1TYQC 1PBYB 4J8GA 3P4FA 5GXIA 3MMYA 3MKQA 4JXMA 4QRJA 1OMWB 3EI1A 1PEVA 5C9ZB 5K19A 5EALA 4GQ1A 4FA1D 3CFSB 4L3HD 2OJYA 2AGXA 3I8CA 5EMMB 3SJLD 3HFQA 3B7FA 1MG2A 2P9LC 2Z2PA 5JWZA 2AGLA 1N6EA 1JOFA 3I8EA 1GXRA 1RI6A 3I7KA 1SQ9A 3OKTA 2CO0A 2AH1A 4GGAA 2AH0A 3EI1B 4J78A 3JROA 3EG6A 4D6VA 3UVNA 4FAND 5I5JA 2YNOA 1ERJA 3PVWB 4X60B 3MZLA 2UZYB 4X3EA 3PSLA 3UKRC 4BUJC 4AEZA 1MDAH 5TEEA 5IC7A 3ZWLB 3JZHA 3RSEC 2G99A 3VH0A 5IJ7E 1N6FA 3DWLC 4JSVC 5HE0B 2H3XA 3BG1A 2I0RA 3IKOA 4L1QD 2B5MA 2H6KA 4R7AB 3K26A 4IMMA 2IUPA 4FA9D 2P9SC 3PVUB 4XEIC 4A08A 2HESX 3AL8A 2CO0C 3I7OA 4BH6A 3UVLA 2P9NC 4FHLA 3EU7A 3RN1D 3VGZA 1JMZB 2PM7B 3OL2A 1S4UX 2I0TA 3BG0A 4FWWA 3ULEC 2XL2A 2XYIA 3N0DA 4ERZA 4N14A 2OVPB 4EWRA 1XKSA 2PM6B 4CI1A 4PSWB 1PI6A 5FLXg 2IWKA 5EMKB 4GZ8A 4A08B 5THAA 4CY3A 3AL8B 4GM8A 3SMRA 2O9KA 2QC5A 3FRXA 4A7JA 4E54A 3OL2B 3SVWD 4A11A 3PXSD 4A2LA 2Z2NA 3I2NA 4Y5RD 4LG8A 4E5ZB 4H5IA 4H5JA 3I89A 1JJUB 3SHFA 5EMJB 3NVQA 1OLZA 3AH8B 4L9OA 2IUQA 1P22A 3IJ1A 4J87A 2HJ4A 4G56B 5FKSA 5CXBA 5TEFA 2MTAH 4J8BA 4CI2A 4XYHA 5EM2A 4J84A 4E54B 3OKWA 1GOTB 4FA4D 3EMHA 3DXMC 4A11B 4ESGA 4GGDA 4OWRA 2AQ5A 3MZKA 1VYHC 4ZOZA 2H9LA 3J81g 2G9AA 4PBZA 3EI3A 4JD2C 3RRMC 2YMUA 5CXBB 5C2WB 4QT8A 5EM2B 3SBQA 4CI3A 1GP2B 3UVOA 3DXKC 3IIYA 3MKSB 4Y7RA 1B9YA 2H47A 2TRCB 3I7NA 4X61B 1B9XA 1QNIA 5FXYA 4CZVA 2AGWA 3EI3B 2YNNA 2GC7A 5A2Qg 4GQ2P 3JPXA 3EI4A 5IGOA 3ORVD 2H14A 2QXVA 4LGNA 2H6NA 4PBYA 3ODTA 5FKTA 4X63B 2H68A 4J81A 2AGZA 3VA6A 1GG2B 4ERQA 4J0XA 1SQJA 3N0EA 4K3JB 4MK0B 2H9NA 2YNPA 4J86A 2OVQB 2B5LA 4CY2A 5AFU3 1Q47A 2PBIB 2IWFA 3SFZA 4AOWA 3EWEA 3IJ0A 3OKYA 5FQDA 2AGYA 2XU7A 5HE1B 4ZOYA 1U2VC 4JT5C 1K8KC 4CZXA 3SN6B 5I5IA 3DM0A 3RN0D 2HJBA 4J73A 4O3UB 2GC4A 3V5WB 2IAAA 2CE9A 2P9IC 4QL1A 5FKRA 2IURA 1JMXB 1FWXA 3OKYB 5GSAA 5KDOB 3IJCA 5HE3B 2I3TA 2GNQA 3U4YA 3C9CA 2XL3A 5SXMA 2P9PC 3JZGA 2BCJB 4JSXC 4FAVD 4U7AA 5B4WA 5H14A 1PGUA 3UKUC 4CY1A 4D0KA 3F3GA 3I7HA 1K32A 5GMKn 4TZ4A 5CYKA 4PSXB 2PM9A 3C75H 2IUVA 5EMLB 4O45A 2CN3A 2B5NA 3W15A 4GGCA 4O3TB 2P9UC 1R5MA 4PNKB 3IIWA 3SCYA 3C5MA 3C99A 4LG9A 2W18A 3CIKB 4L3GD 4KFMB 1XIPA 4GM9A 3EI2A 3OTTA 3PXWD 3UVMA 1XHMA 2H9MA 3MXXA 4FB1D 4ZOXA 2I3SA 5CYKB 2PM9B 2BBKH 3JB9L 3A0FA 2YB8B 4PXWA 1SHYB 2H9PA 2YBAA 3CFVA 3I7LA 3DSMA 5TDHB 2H13A 3OW8A 3PSCB 3SBPA 3EI2B 3E0CA 4GMBA 2HKMA 3KRWB 5TF2A 4A2MA 4O1QD 3RFGA 4CI8A 3JZNA 3KRXB 3F3FA 3L4MD 4OZUA 3K27A 4J77A 5IJ8E 4IA9A 5K1CC 3FGBA 3PXTD 4QQEA 5EARA 4J0WA 4Z8LA 4JSPC 4HDJA 5EAMA 2J55H 4CZYA 3SXTD 4ZOVA 3RMZD 4UI9R 3L4OD 4NSXA 5EAPA 5IGQA 2OK6A 2HXCA 3EI4B 4ES0A 3V9FA 4ZN4A 5FKQA 4U1EI 5AMSA 2OVRB 4JSNC 4A0AA 2Z2OA 2Q7QA 4A0BA 5HQGA 5HE2B 5H17A 3PE7A 5H1MA 2CN2A 4FA5D 4JT6C
chains in the Genus database with same CATH superfamily
1M1XA 3AFCA 3NVXA 2CE8A 2CNXA 4PC0A 3SWSD 3BWSA 2OK4A 1TBGA 1L0QA 4GQBB 3SBRA 5CXCA 2UZXB 5FA5B 1GOHA 4G55A 4J79A 4RE6A 5AJAA 3J80g 4BL0A 4CC9A 4CY5A 1VZ2A 4I79A 4DNVA 2H6QA 4A09A 1YR2A 2HU5A 2OIZA 3GFCA 4A0AB 4O02A 4E5ZA 2VDRA 1A0RB 3GREA 3NIDA 1C9LA 4A0BB 2B4EA 3FM0A 2I0SA 3V7DB 3SLED 5GXHA 4AX4A 4J82A 3I7PA 4GM3A 4XYIA 4DNWA 4YVDA 1E8NA 3RFHA 2EBSA 1NR0A 3JRPA 4O9DA 4Z7QA 5IT9g 5CXCB 2J56H 1MG3A 3UR4A 3RLMD 5I5MA 3V4PA 3F3PA 3JAMg 1O6GA 5C2VB 2J57G 4A09B 1NEXB 3GD1I 1TYEA 3O4HA 5HYNB 1U4CA 2HKRA 4K3ID 2HYEA 3AL9A 2HU7A 3NVNA 1YFQA 3UVKA 1A12A 4ERYA 2P9KC 1N6DA 1TYQC 1PBYB 5C92A 4J8GA 3P4FA 2XDWA 5GXIA 3MMYA 3MKQA 4JXMA 4QRJA 1OMWB 3EI1A 1PEVA 5C9ZB 5K19A 5EALA 4AMYA 4GQ1A 4FA1D 3CFSB 4L3HD 4WJKA 5M5VA 2OJYA 2AGXA 3I8CA 5EMMB 3SJLD 2BKLA 3HFQA 3IURA 3B7FA 1MG2A 2P9LC 2Z2PA 1GOFA 5JWZA 1T2XA 2VZ3A 2AGLA 1N6EA 1JOFA 3IJEA 3I8EA 1VE7A 1GXRA 1BPOA 1RI6A 1SQ9A 3I7KA 3OKTA 5E6UA 5HDBA 2CO0A 2AH1A 4GGAA 2AH0A 3EI1B 4J78A 3JROA 4BCCA 3EG6A 4D6VA 1H2YA 3UVNA 4FAND 5I5JA 2YNOA 1ERJA 3PVWB 4X60B 3MZLA 3K6SA 3K71A 3FCSA 4G1EA 1QFSA 2UZYB 2HU8A 4X3EA 3PSLA 1C9IA 3UKRC 4BUJC 4DNUA 2EIEA 4AEZA 1MDAH 5TEEA 1JV2A 5IC7A 3ZWLB 3JZHA 3RSEC 2G99A 1UTCA 3VH0A 5IJ7E 1N6FA 3DWLC 4JSVC 1VZ3A 5HE0B 2H3XA 3BG1A 2I0RA 5M5TA 3IKOA 1E8MA 4L1QD 2B5MA 3ZDYA 2H6KA 4R7AB 1E5TA 3K26A 2VZ1A 4IMMA 1H2WA 2IUPA 4FA9D 2P9SC 3PVUB 4XEIC 4A08A 2HESX 3AL8A 3ZDZA 2CO0C 1H2ZA 3I7OA 4BH6A 3UVLA 2P9NC 4FHLA 3EU7A 3RN1D 2XE4A 1JMZB 2PM7B 3VGZA 3OL2A 3V4VA 1S4UX 2I0TA 3BG0A 4FWWA 3ULEC 2XL2A 3MVDK 3GC3B 2XYIA 3N0DA 4ERZA 2VDOA 4N14A 2OVPB 4EWRA 1XKSA 2PM6B 4L1MA 4CI1A 4PSWB 1PI6A 3ZDXA 5FLXg 2IWKA 5EMKB 3IUMA 4WK4A 4GZ8A 4A08B 5THAA 4CY3A 3AL8B 4GM8A 3SMRA 2O9KA 5C86A 2QC5A 3FRXA 4A7JA 4E54A 3OL2B 3SVWD 4A11A 4BCBA 5M61A 2JKXA 3PXSD 4A2LA 2Z2NA 3I2NA 4Y5RD 4LG8A 5FFOA 4E5ZB 4G1MA 4H5IA 4H5JA 3I89A 1JJUB 3O4GA 3SHFA 1VE6A 4WK0A 5EMJB 4NAAA 3NVQA 1OLZA 2XZGA 3AH8B 4MMXA 4QAMA 4L9OA 2IUQA 4Z7OA 4AN0A 1P22A 3IJ1A 4J87A 2HJ4A 4G56B 5FKSA 2VDQA 5CXBA 4NBMA 5TEFA 2MTAH 4J8BA 4CI2A 4XYHA 5EM2A 4J84A 4E54B 3OKWA 1GOTB 4FA4D 3EMHA 3DXMC 2EICA 4A11B 4ESGA 3EQ9A 4GGDA 4OWRA 2AQ5A 3MZKA 1VYHC 4ZOZA 2H9LA 2WQ8A 3FCUA 3J81g 1UOQA 2G9AA 4PBZA 3EI3A 3MUNA 4JD2C 5E6RA 1I2MB 3RRMC 2YMUA 5CXBB 5C2WB 4QT8A 5EM2B 3SBQA 4CI3A 3T3MA 1GP2B 3UVOA 3DXKC 3IIYA 3MKSB 4Y7RA 3I7NA 1B9YA 2H47A 2TRCB 4X61B 1B9XA 1QNIA 5FXYA 1H2XA 2QR5A 4CZVA 2AGWA 3IUQA 1U8CA 1L5GA 3EI3B 2YNNA 2GC7A 5A2Qg 5E6SA 4GQ2P 3JPXA 4JHNA 3EI4A 5IGOA 3ORVD 2H14A 2QXVA 4LGNA 2H6NA 3IUJA 3ODTA 4PBYA 4RE5A 5FKTA 4X63B 2H68A 4J81A 4O2WA 2AGZA 3VA6A 1GG2B 4ERQA 4J0XA 1SQJA 3N0EA 2VC2A 3ZE1A 4K3JB 4MK0B 2H9NA 2YNPA 4J86A 2OVQB 4AN1A 2B5LA 4CY2A 4WK2A 1Q47A 1QFMA 5AFU3 2PBIB 2IWFA 3KCIA 3SFZA 4AOWA 3EWEA 3IJ0A 3OKYA 2QZPA 3OF7A 5FQDA 2AGYA 3T3PA 2XU7A 5HE1B 4BCDA 4ZOYA 1U2VC 3ZE0A 4UM9A 4JT5C 1K8KC 4CZXA 3SN6B 3IULA 3DM0A 3VI4A 5I5IA 4Z7NA 2VDMA 3RN0D 2HJBA 4J73A 4O3UB 3QI0A 5FFGA 2GC4A 3V5WB 3EQ7A 2IAAA 2CE9A 2P9IC 4QL1A 5FKRA 2IURA 4UM8A 1JMXB 1FWXA 3OKYB 5GSAA 5KDOB 1UOPA 5M5UA 3NIGA 3IJCA 5HE3B 2I3TA 2GNQA 4IRZA 3U4YA 3C9CA 2XL3A 5SXMA 2P9PC 3JZGA 2BCJB 4JSXC 4FAVD 4U7AA 5B4WA 5H14A 1PGUA 4AMZA 3UKUC 4CY1A 4D0KA 3F3GA 2VDPA 1JTDB 2EIDA 3I7HA 1K32A 5GMKn 4MMYA 4TZ4A 5CYKA 4PSXB 2PM9A 3C75H 3MUOA 2IUVA 5EMLB 4O45A 2CN3A 2B5NA 3W15A 4GGCA 4D9SA 4O3TB 2P9UC 1R5MA 3O4JA 1UOOA 4PNKB 3IIWA 3SCYA 3C5MA 3C99A 4LG9A 2W18A 3CIKB 2EIBA 4L3GD 4KFMB 1XIPA 4GM9A 3EI2A 3OTTA 3O4IA 3PXWD 3UVMA 1XHMA 3QHYB 2H9MA 3MXXA 4FB1D 4ZOXA 2I3SA 2VDKA 1GOGA 5CYKB 2PM9B 2BBKH 3JB9L 3A0FA 2YB8B 4PXWA 3I7LA 1SHYB 2H9PA 2YBAA 3CFVA 3DSMA 5TDHB 2H13A 3OW8A 3PSCB 3SBPA 3EI2B 3E0CA 4GMBA 5M5SA 4MMZA 2HKMA 3KRWB 4NC4A 5TF2A 4A2MA 1K3IA 4O1QD 3RFGA 3NIFA 4CI8A 3JZNA 4BP9A 3KRXB 3F3FA 3L4MD 4OZUA 3K27A 4J77A 5IJ8E 4IA9A 3DDUA 5K1CC 3FGBA 5M5RA 2VDLA 3PXTD 4QQEA 4NENA 4J0WA 4Z8LA 5EARA 4JSPC 4HDJA 5EAMA 2J55H 4CZYA 3VI3A 3SXTD 3ZE2A 3IUNA 4ZOVA 3RMZD 4UI9R 3L4OD 4NSXA 5EAPA 5IGQA 3EQ8A 2OK6A 2HXCA 4JHPC 3EI4B 3K72A 4ES0A 3V9FA 4ZN4A 5FKQA 4U1EI 5AMSA 2OVRB 4JSNC 4A0AA 2Z2OA 2Q7QA 2VDNA 1O6FA 4A0BA 5HQGA 5HE2B 4BP8A 5H17A 3PE7A 5H1MA 2CN2A 4FA5D 4JT6C 3IVMA
chains in the Genus database with same CATH topology
3AFCA 3NVXA 2CE8A 2CNXA 4PC0A 3SWSD 3BWSA 2OK4A 1TBGA 1L0QA 4GQBB 3SBRA 5CXCA 2UZXB 5FA5B 4J79A 5AJAA 3J80g 4BL0A 4CC9A 4CY5A 4I79A 2H6QA 4A09A 3GFCA 2OIZA 4A0AB 4E5ZA 1A0RB 3GREA 4A0BB 2B4EA 3FM0A 2I0SA 3V7DB 3SLED 5GXHA 4J82A 3I7PA 4GM3A 4XYIA 4YVDA 3RFHA 2EBSA 1NR0A 3JRPA 4O9DA 5IT9g 5CXCB 2J56H 1MG3A 3UR4A 3RLMD 5I5MA 3F3PA 3JAMg 5C2VB 2J57G 4A09B 1NEXB 5HYNB 1U4CA 2HKRA 4K3ID 2HYEA 3AL9A 3NVNA 1YFQA 3UVKA 4ERYA 2P9KC 1N6DA 1TYQC 1PBYB 4J8GA 3P4FA 5GXIA 3MMYA 3MKQA 4JXMA 4QRJA 1OMWB 3EI1A 1PEVA 5C9ZB 5K19A 5EALA 4GQ1A 4FA1D 3CFSB 4L3HD 2OJYA 2AGXA 3I8CA 5EMMB 3SJLD 3HFQA 3B7FA 1MG2A 2P9LC 2Z2PA 5JWZA 2AGLA 1N6EA 1JOFA 3I8EA 1GXRA 1RI6A 3I7KA 1SQ9A 3OKTA 2CO0A 2AH1A 4GGAA 2AH0A 3EI1B 4J78A 3JROA 3EG6A 4D6VA 3UVNA 4FAND 5I5JA 2YNOA 1ERJA 3PVWB 4X60B 3MZLA 2UZYB 4X3EA 3PSLA 3UKRC 4BUJC 4AEZA 1MDAH 5TEEA 5IC7A 3ZWLB 3JZHA 3RSEC 2G99A 3VH0A 5IJ7E 1N6FA 3DWLC 4JSVC 5HE0B 2H3XA 3BG1A 2I0RA 3IKOA 4L1QD 2B5MA 2H6KA 4R7AB 3K26A 4IMMA 2IUPA 4FA9D 2P9SC 3PVUB 4XEIC 4A08A 2HESX 3AL8A 2CO0C 3I7OA 4BH6A 3UVLA 2P9NC 4FHLA 3EU7A 3RN1D 3VGZA 1JMZB 2PM7B 3OL2A 1S4UX 2I0TA 3BG0A 4FWWA 3ULEC 2XL2A 2XYIA 3N0DA 4ERZA 4N14A 2OVPB 4EWRA 1XKSA 2PM6B 4CI1A 4PSWB 1PI6A 5FLXg 2IWKA 5EMKB 4GZ8A 4A08B 5THAA 4CY3A 3AL8B 4GM8A 3SMRA 2O9KA 2QC5A 3FRXA 4A7JA 4E54A 3OL2B 3SVWD 4A11A 3PXSD 4A2LA 2Z2NA 3I2NA 4Y5RD 4LG8A 4E5ZB 4H5IA 4H5JA 3I89A 1JJUB 3SHFA 5EMJB 3NVQA 1OLZA 3AH8B 4L9OA 2IUQA 1P22A 3IJ1A 4J87A 2HJ4A 4G56B 5FKSA 5CXBA 5TEFA 2MTAH 4J8BA 4CI2A 4XYHA 5EM2A 4J84A 4E54B 3OKWA 1GOTB 4FA4D 3EMHA 3DXMC 4A11B 4ESGA 4GGDA 4OWRA 2AQ5A 3MZKA 1VYHC 4ZOZA 2H9LA 3J81g 2G9AA 4PBZA 3EI3A 4JD2C 3RRMC 2YMUA 5CXBB 5C2WB 4QT8A 5EM2B 3SBQA 4CI3A 1GP2B 3UVOA 3DXKC 3IIYA 3MKSB 4Y7RA 1B9YA 2H47A 2TRCB 3I7NA 4X61B 1B9XA 1QNIA 5FXYA 4CZVA 2AGWA 3EI3B 2YNNA 2GC7A 5A2Qg 4GQ2P 3JPXA 3EI4A 5IGOA 3ORVD 2H14A 2QXVA 4LGNA 2H6NA 4PBYA 3ODTA 5FKTA 4X63B 2H68A 4J81A 2AGZA 3VA6A 1GG2B 4ERQA 4J0XA 1SQJA 3N0EA 4K3JB 4MK0B 2H9NA 2YNPA 4J86A 2OVQB 2B5LA 4CY2A 5AFU3 1Q47A 2PBIB 2IWFA 3SFZA 4AOWA 3EWEA 3IJ0A 3OKYA 5FQDA 2AGYA 2XU7A 5HE1B 4ZOYA 1U2VC 4JT5C 1K8KC 4CZXA 3SN6B 5I5IA 3DM0A 3RN0D 2HJBA 4J73A 4O3UB 2GC4A 3V5WB 2IAAA 2CE9A 2P9IC 4QL1A 5FKRA 2IURA 1JMXB 1FWXA 3OKYB 5GSAA 5KDOB 3IJCA 5HE3B 2I3TA 2GNQA 3U4YA 3C9CA 2XL3A 5SXMA 2P9PC 3JZGA 2BCJB 4JSXC 4FAVD 4U7AA 5B4WA 5H14A 1PGUA 3UKUC 4CY1A 4D0KA 3F3GA 3I7HA 1K32A 5GMKn 4TZ4A 5CYKA 4PSXB 2PM9A 3C75H 2IUVA 5EMLB 4O45A 2CN3A 2B5NA 3W15A 4GGCA 4O3TB 2P9UC 1R5MA 4PNKB 3IIWA 3SCYA 3C5MA 3C99A 4LG9A 2W18A 3CIKB 4L3GD 4KFMB 1XIPA 4GM9A 3EI2A 3OTTA 3PXWD 3UVMA 1XHMA 2H9MA 3MXXA 4FB1D 4ZOXA 2I3SA 5CYKB 2PM9B 2BBKH 3JB9L 3A0FA 2YB8B 4PXWA 1SHYB 2H9PA 2YBAA 3CFVA 3I7LA 3DSMA 5TDHB 2H13A 3OW8A 3PSCB 3SBPA 3EI2B 3E0CA 4GMBA 2HKMA 3KRWB 5TF2A 4A2MA 4O1QD 3RFGA 4CI8A 3JZNA 3KRXB 3F3FA 3L4MD 4OZUA 3K27A 4J77A 5IJ8E 4IA9A 5K1CC 3FGBA 3PXTD 4QQEA 5EARA 4J0WA 4Z8LA 4JSPC 4HDJA 5EAMA 2J55H 4CZYA 3SXTD 4ZOVA 3RMZD 4UI9R 3L4OD 4NSXA 5EAPA 5IGQA 2OK6A 2HXCA 3EI4B 4ES0A 3V9FA 4ZN4A 5FKQA 4U1EI 5AMSA 2OVRB 4JSNC 4A0AA 2Z2OA 2Q7QA 4A0BA 5HQGA 5HE2B 5H17A 3PE7A 5H1MA 2CN2A 4FA5D 4JT6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFC A;  3NVX A;  2CE8 A;  2CNX A;  4PC0 A;  3SWS D;  3BWS A;  2OK4 A;  1TBG A;  1L0Q A;  4GQB B;  3SBR A;  5CXC A;  2UZX B;  5FA5 B;  4J79 A;  5AJA A;  3J80 g;  4BL0 A;  4CC9 A;  4CY5 A;  4I79 A;  2H6Q A;  4A09 A;  3GFC A;  2OIZ A;  4A0A B;  4E5Z A;  1A0R B;  3GRE A;  4A0B B;  2B4E A;  3FM0 A;  2I0S A;  3V7D B;  3SLE D;  5GXH A;  4J82 A;  3I7P A;  4GM3 A;  4XYI A;  4YVD A;  3RFH A;  2EBS A;  1NR0 A;  3JRP A;  4O9D A;  5IT9 g;  5CXC B;  2J56 H;  1MG3 A;  3UR4 A;  3RLM D;  5I5M A;  3F3P A;  3JAM g;  5C2V B;  2J57 G;  4A09 B;  1NEX B;  5HYN B;  1U4C A;  2HKR A;  4K3I D;  2HYE A;  3AL9 A;  3NVN A;  1YFQ A;  3UVK A;  4ERY A;  2P9K C;  1N6D A;  1TYQ C;  1PBY B;  4J8G A;  3P4F A;  5GXI A;  3MMY A;  3MKQ A;  4JXM A;  4QRJ A;  1OMW B;  3EI1 A;  1PEV A;  5C9Z B;  5K19 A;  5EAL A;  4GQ1 A;  4FA1 D;  3CFS B;  4L3H D;  2OJY A;  2AGX A;  3I8C A;  5EMM B;  3SJL D;  3HFQ A;  3B7F A;  1MG2 A;  2P9L C;  2Z2P A;  5JWZ A;  2AGL A;  1N6E A;  1JOF A;  3I8E A;  1GXR A;  1RI6 A;  3I7K A;  1SQ9 A;  3OKT A;  2CO0 A;  2AH1 A;  4GGA A;  2AH0 A;  3EI1 B;  4J78 A;  3JRO A;  3EG6 A;  4D6V A;  3UVN A;  4FAN D;  5I5J A;  2YNO A;  1ERJ A;  3PVW B;  4X60 B;  3MZL A;  2UZY B;  4X3E A;  3PSL A;  3UKR C;  4BUJ C;  4AEZ A;  1MDA H;  5TEE A;  5IC7 A;  3ZWL B;  3JZH A;  3RSE C;  2G99 A;  3VH0 A;  5IJ7 E;  1N6F A;  3DWL C;  4JSV C;  5HE0 B;  2H3X A;  3BG1 A;  2I0R A;  3IKO A;  4L1Q D;  2B5M A;  2H6K A;  4R7A B;  3K26 A;  4IMM A;  2IUP A;  4FA9 D;  2P9S C;  3PVU B;  4XEI C;  4A08 A;  2HES X;  3AL8 A;  2CO0 C;  3I7O A;  4BH6 A;  3UVL A;  2P9N C;  4FHL A;  3EU7 A;  3RN1 D;  3VGZ A;  1JMZ B;  2PM7 B;  3OL2 A;  1S4U X;  2I0T A;  3BG0 A;  4FWW A;  3ULE C;  2XL2 A;  2XYI A;  3N0D A;  4ERZ A;  4N14 A;  2OVP B;  4EWR A;  1XKS A;  2PM6 B;  4CI1 A;  4PSW B;  1PI6 A;  5FLX g;  2IWK A;  5EMK B;  4GZ8 A;  4A08 B;  5THA A;  4CY3 A;  3AL8 B;  4GM8 A;  3SMR A;  2O9K A;  2QC5 A;  3FRX A;  4A7J A;  4E54 A;  3OL2 B;  3SVW D;  4A11 A;  3PXS D;  4A2L A;  2Z2N A;  3I2N A;  4Y5R D;  4LG8 A;  4E5Z B;  4H5I A;  4H5J A;  3I89 A;  1JJU B;  3SHF A;  5EMJ B;  3NVQ A;  1OLZ A;  3AH8 B;  4L9O A;  2IUQ A;  1P22 A;  3IJ1 A;  4J87 A;  2HJ4 A;  4G56 B;  5FKS A;  5CXB A;  5TEF A;  2MTA H;  4J8B A;  4CI2 A;  4XYH A;  5EM2 A;  4J84 A;  4E54 B;  3OKW A;  1GOT B;  4FA4 D;  3EMH A;  3DXM C;  4A11 B;  4ESG A;  4GGD A;  4OWR A;  2AQ5 A;  3MZK A;  1VYH C;  4ZOZ A;  2H9L A;  3J81 g;  2G9A A;  4PBZ A;  3EI3 A;  4JD2 C;  3RRM C;  2YMU A;  5CXB B;  5C2W B;  4QT8 A;  5EM2 B;  3SBQ A;  4CI3 A;  1GP2 B;  3UVO A;  3DXK C;  3IIY A;  3MKS B;  4Y7R A;  1B9Y A;  2H47 A;  2TRC B;  3I7N A;  4X61 B;  1B9X A;  1QNI A;  5FXY A;  4CZV A;  2AGW A;  3EI3 B;  2YNN A;  2GC7 A;  5A2Q g;  4GQ2 P;  3JPX A;  3EI4 A;  5IGO A;  3ORV D;  2H14 A;  2QXV A;  4LGN A;  2H6N A;  4PBY A;  3ODT A;  5FKT A;  4X63 B;  2H68 A;  4J81 A;  2AGZ A;  3VA6 A;  1GG2 B;  4ERQ A;  4J0X A;  1SQJ A;  3N0E A;  4K3J B;  4MK0 B;  2H9N A;  2YNP A;  4J86 A;  2OVQ B;  2B5L A;  4CY2 A;  5AFU 3;  1Q47 A;  2PBI B;  2IWF A;  3SFZ A;  4AOW A;  3EWE A;  3IJ0 A;  3OKY A;  5FQD A;  2AGY A;  2XU7 A;  5HE1 B;  4ZOY A;  1U2V C;  4JT5 C;  1K8K C;  4CZX A;  3SN6 B;  5I5I A;  3DM0 A;  3RN0 D;  2HJB A;  4J73 A;  4O3U B;  2GC4 A;  3V5W B;  2IAA A;  2CE9 A;  2P9I C;  4QL1 A;  5FKR A;  2IUR A;  1JMX B;  1FWX A;  3OKY B;  5GSA A;  5KDO B;  3IJC A;  5HE3 B;  2I3T A;  2GNQ A;  3U4Y A;  3C9C A;  2XL3 A;  5SXM A;  2P9P C;  3JZG A;  2BCJ B;  4JSX C;  4FAV D;  4U7A A;  5B4W A;  5H14 A;  1PGU A;  3UKU C;  4CY1 A;  4D0K A;  3F3G A;  3I7H A;  1K32 A;  5GMK n;  4TZ4 A;  5CYK A;  4PSX B;  2PM9 A;  3C75 H;  2IUV A;  5EML B;  4O45 A;  2CN3 A;  2B5N A;  3W15 A;  4GGC A;  4O3T B;  2P9U C;  1R5M A;  4PNK B;  3IIW A;  3SCY A;  3C5M A;  3C99 A;  4LG9 A;  2W18 A;  3CIK B;  4L3G D;  4KFM B;  1XIP A;  4GM9 A;  3EI2 A;  3OTT A;  3PXW D;  3UVM A;  1XHM A;  2H9M A;  3MXX A;  4FB1 D;  4ZOX A;  2I3S A;  5CYK B;  2PM9 B;  2BBK H;  3JB9 L;  3A0F A;  2YB8 B;  4PXW A;  1SHY B;  2H9P A;  2YBA A;  3CFV A;  3I7L A;  3DSM A;  5TDH B;  2H13 A;  3OW8 A;  3PSC B;  3SBP A;  3EI2 B;  3E0C A;  4GMB A;  2HKM A;  3KRW B;  5TF2 A;  4A2M A;  4O1Q D;  3RFG A;  4CI8 A;  3JZN A;  3KRX B;  3F3F A;  3L4M D;  4OZU A;  3K27 A;  4J77 A;  5IJ8 E;  4IA9 A;  5K1C C;  3FGB A;  3PXT D;  4QQE A;  5EAR A;  4J0W A;  4Z8L A;  4JSP C;  4HDJ A;  5EAM A;  2J55 H;  4CZY A;  3SXT D;  4ZOV A;  3RMZ D;  4UI9 R;  3L4O D;  4NSX A;  5EAP A;  5IGQ A;  2OK6 A;  2HXC A;  3EI4 B;  4ES0 A;  3V9F A;  4ZN4 A;  5FKQ A;  4U1E I;  5AMS A;  2OVR B;  4JSN C;  4A0A A;  2Z2O A;  2Q7Q A;  4A0B A;  5HQG A;  5HE2 B;  5H17 A;  3PE7 A;  5H1M A;  2CN2 A;  4FA5 D;  4JT6 C; 
#chains in the Genus database with same CATH topology
 1M1X A;  3AFC A;  3NVX A;  2CE8 A;  2CNX A;  4PC0 A;  3SWS D;  3BWS A;  2OK4 A;  1TBG A;  1L0Q A;  4GQB B;  3SBR A;  5CXC A;  2UZX B;  5FA5 B;  1GOH A;  4G55 A;  4J79 A;  4RE6 A;  5AJA A;  3J80 g;  4BL0 A;  4CC9 A;  4CY5 A;  1VZ2 A;  4I79 A;  4DNV A;  2H6Q A;  4A09 A;  1YR2 A;  2HU5 A;  2OIZ A;  3GFC A;  4A0A B;  4O02 A;  4E5Z A;  2VDR A;  1A0R B;  3GRE A;  3NID A;  1C9L A;  4A0B B;  2B4E A;  3FM0 A;  2I0S A;  3V7D B;  3SLE D;  5GXH A;  4AX4 A;  4J82 A;  3I7P A;  4GM3 A;  4XYI A;  4DNW A;  4YVD A;  1E8N A;  3RFH A;  2EBS A;  1NR0 A;  3JRP A;  4O9D A;  4Z7Q A;  5IT9 g;  5CXC B;  2J56 H;  1MG3 A;  3UR4 A;  3RLM D;  5I5M A;  3V4P A;  3F3P A;  3JAM g;  1O6G A;  5C2V B;  2J57 G;  4A09 B;  1NEX B;  3GD1 I;  1TYE A;  3O4H A;  5HYN B;  1U4C A;  2HKR A;  4K3I D;  2HYE A;  3AL9 A;  2HU7 A;  3NVN A;  1YFQ A;  3UVK A;  1A12 A;  4ERY A;  2P9K C;  1N6D A;  1TYQ C;  1PBY B;  5C92 A;  4J8G A;  3P4F A;  2XDW A;  5GXI A;  3MMY A;  3MKQ A;  4JXM A;  4QRJ A;  1OMW B;  3EI1 A;  1PEV A;  5C9Z B;  5K19 A;  5EAL A;  4AMY A;  4GQ1 A;  4FA1 D;  3CFS B;  4L3H D;  4WJK A;  5M5V A;  2OJY A;  2AGX A;  3I8C A;  5EMM B;  3SJL D;  2BKL A;  3HFQ A;  3IUR A;  3B7F A;  1MG2 A;  2P9L C;  2Z2P A;  1GOF A;  5JWZ A;  1T2X A;  2VZ3 A;  2AGL A;  1N6E A;  1JOF A;  3IJE A;  3I8E A;  1VE7 A;  1GXR A;  1BPO A;  1RI6 A;  1SQ9 A;  3I7K A;  3OKT A;  5E6U A;  5HDB A;  2CO0 A;  2AH1 A;  4GGA A;  2AH0 A;  3EI1 B;  4J78 A;  3JRO A;  4BCC A;  3EG6 A;  4D6V A;  1H2Y A;  3UVN A;  4FAN D;  5I5J A;  2YNO A;  1ERJ A;  3PVW B;  4X60 B;  3MZL A;  3K6S A;  3K71 A;  3FCS A;  4G1E A;  1QFS A;  2UZY B;  2HU8 A;  4X3E A;  3PSL A;  1C9I A;  3UKR C;  4BUJ C;  4DNU A;  2EIE A;  4AEZ A;  1MDA H;  5TEE A;  1JV2 A;  5IC7 A;  3ZWL B;  3JZH A;  3RSE C;  2G99 A;  1UTC A;  3VH0 A;  5IJ7 E;  1N6F A;  3DWL C;  4JSV C;  1VZ3 A;  5HE0 B;  2H3X A;  3BG1 A;  2I0R A;  5M5T A;  3IKO A;  1E8M A;  4L1Q D;  2B5M A;  3ZDY A;  2H6K A;  4R7A B;  1E5T A;  3K26 A;  2VZ1 A;  4IMM A;  1H2W A;  2IUP A;  4FA9 D;  2P9S C;  3PVU B;  4XEI C;  4A08 A;  2HES X;  3AL8 A;  3ZDZ A;  2CO0 C;  1H2Z A;  3I7O A;  4BH6 A;  3UVL A;  2P9N C;  4FHL A;  3EU7 A;  3RN1 D;  2XE4 A;  1JMZ B;  2PM7 B;  3VGZ A;  3OL2 A;  3V4V A;  1S4U X;  2I0T A;  3BG0 A;  4FWW A;  3ULE C;  2XL2 A;  3MVD K;  3GC3 B;  2XYI A;  3N0D A;  4ERZ A;  2VDO A;  4N14 A;  2OVP B;  4EWR A;  1XKS A;  2PM6 B;  4L1M A;  4CI1 A;  4PSW B;  1PI6 A;  3ZDX A;  5FLX g;  2IWK A;  5EMK B;  3IUM A;  4WK4 A;  4GZ8 A;  4A08 B;  5THA A;  4CY3 A;  3AL8 B;  4GM8 A;  3SMR A;  2O9K A;  5C86 A;  2QC5 A;  3FRX A;  4A7J A;  4E54 A;  3OL2 B;  3SVW D;  4A11 A;  4BCB A;  5M61 A;  2JKX A;  3PXS D;  4A2L A;  2Z2N A;  3I2N A;  4Y5R D;  4LG8 A;  5FFO A;  4E5Z B;  4G1M A;  4H5I A;  4H5J A;  3I89 A;  1JJU B;  3O4G A;  3SHF A;  1VE6 A;  4WK0 A;  5EMJ B;  4NAA A;  3NVQ A;  1OLZ A;  2XZG A;  3AH8 B;  4MMX A;  4QAM A;  4L9O A;  2IUQ A;  4Z7O A;  4AN0 A;  1P22 A;  3IJ1 A;  4J87 A;  2HJ4 A;  4G56 B;  5FKS A;  2VDQ A;  5CXB A;  4NBM A;  5TEF A;  2MTA H;  4J8B A;  4CI2 A;  4XYH A;  5EM2 A;  4J84 A;  4E54 B;  3OKW A;  1GOT B;  4FA4 D;  3EMH A;  3DXM C;  2EIC A;  4A11 B;  4ESG A;  3EQ9 A;  4GGD A;  4OWR A;  2AQ5 A;  3MZK A;  1VYH C;  4ZOZ A;  2H9L A;  2WQ8 A;  3FCU A;  3J81 g;  1UOQ A;  2G9A A;  4PBZ A;  3EI3 A;  3MUN A;  4JD2 C;  5E6R A;  1I2M B;  3RRM C;  2YMU A;  5CXB B;  5C2W B;  4QT8 A;  5EM2 B;  3SBQ A;  4CI3 A;  3T3M A;  1GP2 B;  3UVO A;  3DXK C;  3IIY A;  3MKS B;  4Y7R A;  3I7N A;  1B9Y A;  2H47 A;  2TRC B;  4X61 B;  1B9X A;  1QNI A;  5FXY A;  1H2X A;  2QR5 A;  4CZV A;  2AGW A;  3IUQ A;  1U8C A;  1L5G A;  3EI3 B;  2YNN A;  2GC7 A;  5A2Q g;  5E6S A;  4GQ2 P;  3JPX A;  4JHN A;  3EI4 A;  5IGO A;  3ORV D;  2H14 A;  2QXV A;  4LGN A;  2H6N A;  3IUJ A;  3ODT A;  4PBY A;  4RE5 A;  5FKT A;  4X63 B;  2H68 A;  4J81 A;  4O2W A;  2AGZ A;  3VA6 A;  1GG2 B;  4ERQ A;  4J0X A;  1SQJ A;  3N0E A;  2VC2 A;  3ZE1 A;  4K3J B;  4MK0 B;  2H9N A;  2YNP A;  4J86 A;  2OVQ B;  4AN1 A;  2B5L A;  4CY2 A;  4WK2 A;  1Q47 A;  1QFM A;  5AFU 3;  2PBI B;  2IWF A;  3KCI A;  3SFZ A;  4AOW A;  3EWE A;  3IJ0 A;  3OKY A;  2QZP A;  3OF7 A;  5FQD A;  2AGY A;  3T3P A;  2XU7 A;  5HE1 B;  4BCD A;  4ZOY A;  1U2V C;  3ZE0 A;  4UM9 A;  4JT5 C;  1K8K C;  4CZX A;  3SN6 B;  3IUL A;  3DM0 A;  3VI4 A;  5I5I A;  4Z7N A;  2VDM A;  3RN0 D;  2HJB A;  4J73 A;  4O3U B;  3QI0 A;  5FFG A;  2GC4 A;  3V5W B;  3EQ7 A;  2IAA A;  2CE9 A;  2P9I C;  4QL1 A;  5FKR A;  2IUR A;  4UM8 A;  1JMX B;  1FWX A;  3OKY B;  5GSA A;  5KDO B;  1UOP A;  5M5U A;  3NIG A;  3IJC A;  5HE3 B;  2I3T A;  2GNQ A;  4IRZ A;  3U4Y A;  3C9C A;  2XL3 A;  5SXM A;  2P9P C;  3JZG A;  2BCJ B;  4JSX C;  4FAV D;  4U7A A;  5B4W A;  5H14 A;  1PGU A;  4AMZ A;  3UKU C;  4CY1 A;  4D0K A;  3F3G A;  2VDP A;  1JTD B;  2EID A;  3I7H A;  1K32 A;  5GMK n;  4MMY A;  4TZ4 A;  5CYK A;  4PSX B;  2PM9 A;  3C75 H;  3MUO A;  2IUV A;  5EML B;  4O45 A;  2CN3 A;  2B5N A;  3W15 A;  4GGC A;  4D9S A;  4O3T B;  2P9U C;  1R5M A;  3O4J A;  1UOO A;  4PNK B;  3IIW A;  3SCY A;  3C5M A;  3C99 A;  4LG9 A;  2W18 A;  3CIK B;  2EIB A;  4L3G D;  4KFM B;  1XIP A;  4GM9 A;  3EI2 A;  3OTT A;  3O4I A;  3PXW D;  3UVM A;  1XHM A;  3QHY B;  2H9M A;  3MXX A;  4FB1 D;  4ZOX A;  2I3S A;  2VDK A;  1GOG A;  5CYK B;  2PM9 B;  2BBK H;  3JB9 L;  3A0F A;  2YB8 B;  4PXW A;  3I7L A;  1SHY B;  2H9P A;  2YBA A;  3CFV A;  3DSM A;  5TDH B;  2H13 A;  3OW8 A;  3PSC B;  3SBP A;  3EI2 B;  3E0C A;  4GMB A;  5M5S A;  4MMZ A;  2HKM A;  3KRW B;  4NC4 A;  5TF2 A;  4A2M A;  1K3I A;  4O1Q D;  3RFG A;  3NIF A;  4CI8 A;  3JZN A;  4BP9 A;  3KRX B;  3F3F A;  3L4M D;  4OZU A;  3K27 A;  4J77 A;  5IJ8 E;  4IA9 A;  3DDU A;  5K1C C;  3FGB A;  5M5R A;  2VDL A;  3PXT D;  4QQE A;  4NEN A;  4J0W A;  4Z8L A;  5EAR A;  4JSP C;  4HDJ A;  5EAM A;  2J55 H;  4CZY A;  3VI3 A;  3SXT D;  3ZE2 A;  3IUN A;  4ZOV A;  3RMZ D;  4UI9 R;  3L4O D;  4NSX A;  5EAP A;  5IGQ A;  3EQ8 A;  2OK6 A;  2HXC A;  4JHP C;  3EI4 B;  3K72 A;  4ES0 A;  3V9F A;  4ZN4 A;  5FKQ A;  4U1E I;  5AMS A;  2OVR B;  4JSN C;  4A0A A;  2Z2O A;  2Q7Q A;  2VDN A;  1O6F A;  4A0B A;  5HQG A;  5HE2 B;  4BP8 A;  5H17 A;  3PE7 A;  5H1M A;  2CN2 A;  4FA5 D;  4JT6 C;  3IVM A; 
#chains in the Genus database with same CATH homology
 3AFC A;  3NVX A;  2CE8 A;  2CNX A;  4PC0 A;  3SWS D;  3BWS A;  2OK4 A;  1TBG A;  1L0Q A;  4GQB B;  3SBR A;  5CXC A;  2UZX B;  5FA5 B;  4J79 A;  5AJA A;  3J80 g;  4BL0 A;  4CC9 A;  4CY5 A;  4I79 A;  2H6Q A;  4A09 A;  3GFC A;  2OIZ A;  4A0A B;  4E5Z A;  1A0R B;  3GRE A;  4A0B B;  2B4E A;  3FM0 A;  2I0S A;  3V7D B;  3SLE D;  5GXH A;  4J82 A;  3I7P A;  4GM3 A;  4XYI A;  4YVD A;  3RFH A;  2EBS A;  1NR0 A;  3JRP A;  4O9D A;  5IT9 g;  5CXC B;  2J56 H;  1MG3 A;  3UR4 A;  3RLM D;  5I5M A;  3F3P A;  3JAM g;  5C2V B;  2J57 G;  4A09 B;  1NEX B;  5HYN B;  1U4C A;  2HKR A;  4K3I D;  2HYE A;  3AL9 A;  3NVN A;  1YFQ A;  3UVK A;  4ERY A;  2P9K C;  1N6D A;  1TYQ C;  1PBY B;  4J8G A;  3P4F A;  5GXI A;  3MMY A;  3MKQ A;  4JXM A;  4QRJ A;  1OMW B;  3EI1 A;  1PEV A;  5C9Z B;  5K19 A;  5EAL A;  4GQ1 A;  4FA1 D;  3CFS B;  4L3H D;  2OJY A;  2AGX A;  3I8C A;  5EMM B;  3SJL D;  3HFQ A;  3B7F A;  1MG2 A;  2P9L C;  2Z2P A;  5JWZ A;  2AGL A;  1N6E A;  1JOF A;  3I8E A;  1GXR A;  1RI6 A;  3I7K A;  1SQ9 A;  3OKT A;  2CO0 A;  2AH1 A;  4GGA A;  2AH0 A;  3EI1 B;  4J78 A;  3JRO A;  3EG6 A;  4D6V A;  3UVN A;  4FAN D;  5I5J A;  2YNO A;  1ERJ A;  3PVW B;  4X60 B;  3MZL A;  2UZY B;  4X3E A;  3PSL A;  3UKR C;  4BUJ C;  4AEZ A;  1MDA H;  5TEE A;  5IC7 A;  3ZWL B;  3JZH A;  3RSE C;  2G99 A;  3VH0 A;  5IJ7 E;  1N6F A;  3DWL C;  4JSV C;  5HE0 B;  2H3X A;  3BG1 A;  2I0R A;  3IKO A;  4L1Q D;  2B5M A;  2H6K A;  4R7A B;  3K26 A;  4IMM A;  2IUP A;  4FA9 D;  2P9S C;  3PVU B;  4XEI C;  4A08 A;  2HES X;  3AL8 A;  2CO0 C;  3I7O A;  4BH6 A;  3UVL A;  2P9N C;  4FHL A;  3EU7 A;  3RN1 D;  3VGZ A;  1JMZ B;  2PM7 B;  3OL2 A;  1S4U X;  2I0T A;  3BG0 A;  4FWW A;  3ULE C;  2XL2 A;  2XYI A;  3N0D A;  4ERZ A;  4N14 A;  2OVP B;  4EWR A;  1XKS A;  2PM6 B;  4CI1 A;  4PSW B;  1PI6 A;  5FLX g;  2IWK A;  5EMK B;  4GZ8 A;  4A08 B;  5THA A;  4CY3 A;  3AL8 B;  4GM8 A;  3SMR A;  2O9K A;  2QC5 A;  3FRX A;  4A7J A;  4E54 A;  3OL2 B;  3SVW D;  4A11 A;  3PXS D;  4A2L A;  2Z2N A;  3I2N A;  4Y5R D;  4LG8 A;  4E5Z B;  4H5I A;  4H5J A;  3I89 A;  1JJU B;  3SHF A;  5EMJ B;  3NVQ A;  1OLZ A;  3AH8 B;  4L9O A;  2IUQ A;  1P22 A;  3IJ1 A;  4J87 A;  2HJ4 A;  4G56 B;  5FKS A;  5CXB A;  5TEF A;  2MTA H;  4J8B A;  4CI2 A;  4XYH A;  5EM2 A;  4J84 A;  4E54 B;  3OKW A;  1GOT B;  4FA4 D;  3EMH A;  3DXM C;  4A11 B;  4ESG A;  4GGD A;  4OWR A;  2AQ5 A;  3MZK A;  1VYH C;  4ZOZ A;  2H9L A;  3J81 g;  2G9A A;  4PBZ A;  3EI3 A;  4JD2 C;  3RRM C;  2YMU A;  5CXB B;  5C2W B;  4QT8 A;  5EM2 B;  3SBQ A;  4CI3 A;  1GP2 B;  3UVO A;  3DXK C;  3IIY A;  3MKS B;  4Y7R A;  1B9Y A;  2H47 A;  2TRC B;  3I7N A;  4X61 B;  1B9X A;  1QNI A;  5FXY A;  4CZV A;  2AGW A;  3EI3 B;  2YNN A;  2GC7 A;  5A2Q g;  4GQ2 P;  3JPX A;  3EI4 A;  5IGO A;  3ORV D;  2H14 A;  2QXV A;  4LGN A;  2H6N A;  4PBY A;  3ODT A;  5FKT A;  4X63 B;  2H68 A;  4J81 A;  2AGZ A;  3VA6 A;  1GG2 B;  4ERQ A;  4J0X A;  1SQJ A;  3N0E A;  4K3J B;  4MK0 B;  2H9N A;  2YNP A;  4J86 A;  2OVQ B;  2B5L A;  4CY2 A;  5AFU 3;  1Q47 A;  2PBI B;  2IWF A;  3SFZ A;  4AOW A;  3EWE A;  3IJ0 A;  3OKY A;  5FQD A;  2AGY A;  2XU7 A;  5HE1 B;  4ZOY A;  1U2V C;  4JT5 C;  1K8K C;  4CZX A;  3SN6 B;  5I5I A;  3DM0 A;  3RN0 D;  2HJB A;  4J73 A;  4O3U B;  2GC4 A;  3V5W B;  2IAA A;  2CE9 A;  2P9I C;  4QL1 A;  5FKR A;  2IUR A;  1JMX B;  1FWX A;  3OKY B;  5GSA A;  5KDO B;  3IJC A;  5HE3 B;  2I3T A;  2GNQ A;  3U4Y A;  3C9C A;  2XL3 A;  5SXM A;  2P9P C;  3JZG A;  2BCJ B;  4JSX C;  4FAV D;  4U7A A;  5B4W A;  5H14 A;  1PGU A;  3UKU C;  4CY1 A;  4D0K A;  3F3G A;  3I7H A;  1K32 A;  5GMK n;  4TZ4 A;  5CYK A;  4PSX B;  2PM9 A;  3C75 H;  2IUV A;  5EML B;  4O45 A;  2CN3 A;  2B5N A;  3W15 A;  4GGC A;  4O3T B;  2P9U C;  1R5M A;  4PNK B;  3IIW A;  3SCY A;  3C5M A;  3C99 A;  4LG9 A;  2W18 A;  3CIK B;  4L3G D;  4KFM B;  1XIP A;  4GM9 A;  3EI2 A;  3OTT A;  3PXW D;  3UVM A;  1XHM A;  2H9M A;  3MXX A;  4FB1 D;  4ZOX A;  2I3S A;  5CYK B;  2PM9 B;  2BBK H;  3JB9 L;  3A0F A;  2YB8 B;  4PXW A;  1SHY B;  2H9P A;  2YBA A;  3CFV A;  3I7L A;  3DSM A;  5TDH B;  2H13 A;  3OW8 A;  3PSC B;  3SBP A;  3EI2 B;  3E0C A;  4GMB A;  2HKM A;  3KRW B;  5TF2 A;  4A2M A;  4O1Q D;  3RFG A;  4CI8 A;  3JZN A;  3KRX B;  3F3F A;  3L4M D;  4OZU A;  3K27 A;  4J77 A;  5IJ8 E;  4IA9 A;  5K1C C;  3FGB A;  3PXT D;  4QQE A;  5EAR A;  4J0W A;  4Z8L A;  4JSP C;  4HDJ A;  5EAM A;  2J55 H;  4CZY A;  3SXT D;  4ZOV A;  3RMZ D;  4UI9 R;  3L4O D;  4NSX A;  5EAP A;  5IGQ A;  2OK6 A;  2HXC A;  3EI4 B;  4ES0 A;  3V9F A;  4ZN4 A;  5FKQ A;  4U1E I;  5AMS A;  2OVR B;  4JSN C;  4A0A A;  2Z2O A;  2Q7Q A;  4A0B A;  5HQG A;  5HE2 B;  5H17 A;  3PE7 A;  5H1M A;  2CN2 A;  4FA5 D;  4JT6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...