3PXTD

Crystal structure of ferrous co adduct of maug in complex with pre-methylamine dehydrogenase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3pxtD00
3F3PA 4CI8A 2PM6B 2AGXA 2HJBA 4ERYA 1XHMA 5H14A 3J81g 2GNQA 3SBRA 2IUQA 2AH0A 4ERZA 3EI1B 4GM3A 3RRMC 5CXBB 3VGZA 4BL0A 1TYQC 3SXTD 3MKSB 4FA9D 3PE7A 4LG8A 3EWEA 4CI2A 4PXWA 5CYKA 4A2LA 3JRPA 4J82A 2I3SA 2H6KA 3GFCA 3JROA 4QQEA 5EALA 5EM2A 1L0QA 5I5JA 1B9YA 4CZVA 2GC4A 3KRXB 3I7HA 5I5MA 5IC7A 3B7FA 4U7AA 1OMWB 2CN2A 4ERQA 3CIKB 4QRJA 4JT5C 4JSPC 3PSLA 2OVRB 2YMUA 5AMSA 1P22A 3CFSB 5EMMB 3HFQA 4H5JA 2HXCA 3OKYB 3GREA 4FHLA 4J0WA 4O9DA 4FWWA 4EWRA 3VA6A 1N6FA 2YNNA 5TEFA 4FAND 3ODTA 2OVQB 5HQGA 2BCJB 4LGNA 2IUPA 3EI4B 3IJ1A 3JZHA 3PVWB 1GOTB 4TZ4A 3L4MD 2P9PC 1SQ9A 4PSWB 3EI2A 3AL8B 4KFMB 2P9LC 4NSXA 1NR0A 5HE0B 1XKSA 4GM8A 5GSAA 3SLED 3UVMA 2I3TA 2YNOA 3UR4A 5TF2A 4CC9A 3IIYA 4GMBA 3VH0A 5GMKn 3SHFA 3W15A 5CYKB 5SXMA 4Y7RA 5AFU3 1N6EA 3SN6B 1OLZA 3DXKC 3I7PA 4HDJA 5GXHA 3AL9A 4L9OA 2UZXB 4QL1A 4X63B 3N0DA 4ESGA 4J81A 4JSNC 1JMXB 1GXRA 3JZNA 4D6VA 5TEEA 5A2Qg 3SFZA 2HJ4A 4PBYA 4O3TB 4O1QD 4E54A 4A08B 5FLXg 3UVOA 1SQJA 2IAAA 4A0AA 2P9UC 2G99A 2YNPA 3C5MA 3ULEC 3I7NA 4J8BA 4E5ZA 3DSMA 3F3GA 2H9PA 2XL2A 3A0FA 4J87A 3MKQA 3ZWLB 5JWZA 3IIWA 4PNKB 4JD2C 1GG2B 3I89A 3PXWD 4CY1A 3OKTA 2H9NA 4CY3A 5HE1B 2YB8B 1N6DA 3RN1D 2J55H 3I8CA 4J78A 3V7DB 2P9NC 3J80g 5EARA 3JB9L 1JMZB 4QT8A 3UKRC 4A0BB 4CY5A 2IUVA 3C99A 3NVQA 4UI9R 4A11A 3IJ0A 4MK0B 4ZOVA 4BUJC 4CI3A 5IGOA 5EMLB 5H1MA 2B5NA 3AH8B 5FQDA 1VYHC 4ZOYA 4GQBB 2PM9A 4J86A 3SBPA 5IGQA 5K1CC 2CNXA 5HE3B 1MDAH 5IJ8E 1TBGA 4U1EI 4E54B 2HKRA 3BG1A 4ZOXA 4D0KA 1U4CA 3NVNA 3SWSD 4GM9A 5CXBA 4J84A 1MG2A 1SHYB 3RMZD 3PSCB 3RLMD 3CFVA 2OK4A 2OVPB 5HE2B 2H14A 3IKOA 4PC0A 3UVKA 2IURA 4IA9A 2Z2PA 4K3JB 4X61B 4JSXC 1K8KC 3MZKA 4J0XA 3DWLC 5EM2B 1S4UX 2H68A 4N14A 2Q7QA 2G9AA 4I79A 2CE8A 5C2WB 4IMMA 3I2NA 5FKSA 4PBZA 4A7JA 5IT9g 2UZYB 2QC5A 2IWFA 4OZUA 4FB1D 3IJCA 3SBQA 2CN3A 2TRCB 4FAVD 2H13A 3PXTD 3DM0A 2H9MA 1YFQA 3I7KA 3KRWB 2HYEA 2B5LA 2P9KC 3FRXA 3FM0A 4A11B 3SMRA 1JOFA 4O3UB 3MZLA 5CXCA 3EU7A 3L4OD 2CO0A 1U2VC 2XL3A 3BWSA 3UVLA 5HYNB 4A09A 2W18A 5C2VB 2H9LA 3SJLD 1ERJA 3E0CA 3K27A 3C75H 2QXVA 2I0RA 2H6QA 3JZGA 2HKMA 5THAA 4AEZA 2CO0C 2Z2OA 3RFGA 4L3GD 5K19A 3I7LA 4XYIA 4JXMA 5C9ZB 3OL2A 3EI2B 4CZXA 2AGYA 2J56H 3FGBA 5EAMA 1B9XA 5FKQA 5IJ7E 5EMKB 3OW8A 3RFHA 4GQ1A 5EAPA 3DXMC 3I8EA 2P9SC 3I7OA 3C9CA 4ZOZA 2AH1A 4OWRA 4CY2A 3N0EA 4FA1D 2PBIB 1PBYB 4H5IA 3PXSD 2CE9A 2BBKH 5AJAA 3EG6A 4CI1A 4L3HD 3PVUB 4GGCA 3EI3A 2OJYA 4LG9A 3RSEC 2AGZA 2I0TA 4PSXB 2J57G 4A08A 3F3FA 2OK6A 1PGUA 5I5IA 2H6NA 2YBAA 4X60B 4ZN4A 2XYIA 5FA5B 3OKWA 1RI6A 5GXIA 2H3XA 3UKUC 2AGWA 1PI6A 1GP2B 3MXXA 4X3EA 5H17A 5EMJB 3EI1A 3EMHA 2AQ5A 3OTTA 5CXCB 5FKTA 4A0AB 3P4FA 4BH6A 3K26A 4GGDA 4R7AB 4A09B 2H47A 3ORVD 4E5ZB 5FKRA 4GGAA 4AOWA 3UVNA 4ES0A 4XEIC 1MG3A 1FWXA 2I0SA 2PM7B 5KDOB 4A2MA 2MTAH 2XU7A 2O9KA 4FA4D 5FXYA 1K32A 3V5WB 3BG0A 3OL2B 4JT6C 5B4WA 3JPXA 1Q47A 2AGLA 3RN0D 4A0BA 4K3ID 4JSVC 3MMYA 1NEXB 2Z2NA 1QNIA 4J77A 2EBSA 3SCYA 2HESX 4Z8LA 3OKYA 1R5MA 4GZ8A 3AFCA 1PEVA 1XIPA 4J79A 1A0RB 4G56B 2GC7A 4O45A 2P9IC 2IWKA 4XYHA 3V9FA 4FA5D 4GQ2P 1JJUB 2B5MA 4L1QD 4CZYA 2OIZA 3EI4A 5TDHB 2B4EA 3U4YA 2PM9B 3EI3B 4J73A 3JAMg 4YVDA 3AL8A 4J8GA 3SVWD 3NVXA 4Y5RD
chains in the Genus database with same CATH superfamily
1GOFA 3F3PA 4CI8A 2PM6B 2AGXA 2HJBA 4ERYA 1XHMA 5H14A 3J81g 2GNQA 3SBRA 1E8MA 2IUQA 2AH0A 4ERZA 3EI1B 4GM3A 3RRMC 3V4PA 5CXBB 3VGZA 4BL0A 1TYQC 3SXTD 3MKSB 4FA9D 3PE7A 4LG8A 3EWEA 4CI2A 4PXWA 5CYKA 4A2LA 3JRPA 4AN1A 4J82A 1O6GA 2I3SA 2H6KA 3GFCA 3JROA 4QQEA 5EALA 5EM2A 4BCCA 1L0QA 5I5JA 1B9YA 4CZVA 2GC4A 1UOOA 3KRXB 3I7HA 5I5MA 5IC7A 3B7FA 1K3IA 4U7AA 1OMWB 2CN2A 4ERQA 3CIKB 4WJKA 2HU7A 4QRJA 4JT5C 5M5VA 4JSPC 5M5RA 1VE6A 3PSLA 2OVRB 2YMUA 5AMSA 1P22A 3CFSB 5EMMB 3HFQA 4H5JA 4Z7QA 4RE5A 2HXCA 3OKYB 3GREA 4FHLA 4J0WA 4O9DA 4FWWA 4EWRA 3VA6A 1N6FA 3IUMA 2YNNA 1VZ3A 3V4VA 5TEFA 4FAND 3ODTA 4WK0A 2OVQB 1QFMA 5HQGA 2BCJB 4LGNA 2IUPA 3EI4B 3IJ1A 3JZHA 3PVWB 3NIFA 1GOTB 2WQ8A 4TZ4A 3IVMA 3L4MD 2P9PC 1SQ9A 4Z7OA 4PSWB 3EI2A 3AL8B 3IJEA 4KFMB 2P9LC 2HU5A 4NSXA 1NR0A 5HE0B 1BPOA 1XKSA 4GM8A 5GSAA 3SLED 4AX4A 3UVMA 2I3TA 3K71A 2YNOA 3UR4A 4AN0A 5TF2A 4CC9A 3IIYA 4GMBA 3VH0A 5GMKn 3SHFA 3W15A 4BCBA 5CYKB 5SXMA 4Y7RA 5AFU3 1U8CA 1N6EA 3SN6B 1OLZA 3I7PA 3DXKC 4HDJA 5GXHA 5HDBA 3AL9A 1VZ2A 4L9OA 2UZXB 3ZDZA 4QL1A 4X63B 3N0DA 4ESGA 3O4IA 4J81A 3IURA 4IRZA 4JSNC 1JMXB 1GXRA 3JZNA 4O02A 4NBMA 5TEEA 4D6VA 3SFZA 5A2Qg 5M5SA 4JHNA 5E6SA 2HJ4A 4PBYA 4O3TB 4O1QD 1JTDB 4E54A 4A08B 1E8NA 5FLXg 4MMXA 3UVOA 1SQJA 2IAAA 4A0AA 2P9UC 2G99A 2YNPA 3C5MA 3ULEC 3FCUA 3VI4A 3I7NA 4J8BA 4E5ZA 3DSMA 3F3GA 2H9PA 2XL2A 3A0FA 4J87A 2XE4A 3GC3B 3MKQA 3O4HA 3ZWLB 3DDUA 5JWZA 3IIWA 4PNKB 4JD2C 1GG2B 3I89A 3PXWD 4CY1A 4MMYA 2VZ1A 3OKTA 2H9NA 4CY3A 5HE1B 2EIDA 4BCDA 2YB8B 1N6DA 3RN1D 2J55H 3I8CA 4J78A 3V7DB 2P9NC 3ZE2A 3J80g 4D9SA 3NIGA 4G1MA 5EARA 3ZDYA 3JB9L 1JMZB 4QT8A 3UKRC 3GD1I 4A0BB 4CY5A 2IUVA 3C99A 3NVQA 4UI9R 1UOPA 4A11A 3IJ0A 4MK0B 5FFOA 4ZOVA 4BUJC 4CI3A 5IGOA 5EMLB 5H1MA 2B5NA 3AH8B 5FQDA 3O4GA 3NIDA 3EQ9A 2XZGA 2VDOA 1VYHC 4ZOYA 4GQBB 2PM9A 4J86A 3SBPA 1C9IA 1GOGA 2VDPA 5IGQA 3O4JA 4NC4A 5K1CC 2CNXA 5HE3B 1MDAH 5IJ8E 1TBGA 3ZE1A 4U1EI 4E54B 2HKRA 2EIBA 3BG1A 2VDMA 4ZOXA 4D0KA 1U4CA 3NVNA 3SWSD 2EICA 4GM9A 4G1EA 1H2WA 5CXBA 3K72A 4J84A 1MG2A 1SHYB 2EIEA 3RMZD 3ZE0A 3PSCB 3RLMD 3CFVA 2OK4A 2OVPB 4WK2A 2H14A 3IKOA 4PC0A 5HE2B 3UVKA 1VE7A 4Z7NA 1O6FA 4DNWA 2IURA 4IA9A 2Z2PA 1UTCA 4K3JB 4X61B 5C2WB 4JSXC 3K6SA 1K8KC 2VDRA 3MZKA 4J0XA 3DWLC 5EM2B 1S4UX 2H68A 4N14A 2Q7QA 2G9AA 4I79A 2CE8A 4UM9A 4IMMA 3I2NA 1C9LA 5FKSA 4DNVA 5C92A 4BP8A 4PBZA 4A7JA 5IT9g 2UZYB 3IULA 2QC5A 2IWFA 4OZUA 4FB1D 3IJCA 3SBQA 2CN3A 2TRCB 4FAVD 2H13A 3PXTD 3DM0A 2H9MA 1YFQA 3I7KA 4L1MA 3KRWB 2HYEA 1H2ZA 3QHYB 2B5LA 1UOQA 2P9KC 2VDLA 3FRXA 3FM0A 4A11B 5M61A 3KCIA 3SMRA 1A12A 1JOFA 4O3UB 3MZLA 5E6RA 5CXCA 3EU7A 3L4OD 2CO0A 1H2YA 1U2VC 2XL3A 3BWSA 3UVLA 1E5TA 5HYNB 4A09A 2W18A 5C2VB 2H9LA 3T3PA 2VC2A 3SJLD 1ERJA 3K27A 3E0CA 3EQ8A 3C75H 2QXVA 2I0RA 2H6QA 4G55A 3JZGA 2HKMA 5THAA 4AEZA 2CO0C 2Z2OA 3RFGA 4L3GD 5K19A 1GOHA 3I7LA 4XYIA 4JXMA 4RE6A 5C9ZB 4NENA 2JKXA 3OL2A 3EI2B 4NAAA 4CZXA 2AGYA 2J56H 3FGBA 5EAMA 1B9XA 5FKQA 5IJ7E 5EMKB 3OW8A 3RFHA 2VZ3A 4GQ1A 5EAPA 3DXMC 3I8EA 1JV2A 2P9SC 3I7OA 3C9CA 4ZOZA 2AH1A 4OWRA 4CY2A 3N0EA 4FA1D 2PBIB 4MMZA 2VDQA 1PBYB 1TYEA 4H5IA 3PXSD 2CE9A 3MVDK 2BBKH 3QI0A 5C86A 5AJAA 2BKLA 4JHPC 3MUOA 1T2XA 3EG6A 4CI1A 4L3HD 4WK4A 3PVUB 4GGCA 3EI3A 2OJYA 4LG9A 3RSEC 2AGZA 2I0TA 4PSXB 2J57G 4A08A 3F3FA 2OK6A 1PGUA 5I5IA 2H6NA 2YBAA 3T3MA 4X60B 4ZN4A 2XYIA 5FA5B 3OKWA 1RI6A 5GXIA 2H3XA 3UKUC 2AGWA 3ZDXA 4BP9A 1PI6A 3VI3A 1GP2B 3MXXA 4X3EA 5H17A 5EMJB 3EI1A 3EMHA 2AQ5A 3OTTA 5CXCB 5FKTA 4A0AB 3P4FA 3IUJA 1M1XA 5FFGA 4BH6A 3K26A 4GGDA 4R7AB 4A09B 2H47A 1H2XA 3ORVD 4E5ZB 5FKRA 1I2MB 4GGAA 4AOWA 3UVNA 2HU8A 4ES0A 4XEIC 1MG3A 1FWXA 3MUNA 4UM8A 2I0SA 2PM7B 5KDOB 3IUNA 4A2MA 2MTAH 4DNUA 2XU7A 2O9KA 4FA4D 5FXYA 1K32A 3V5WB 3BG0A 3OL2B 4JT6C 5B4WA 3JPXA 1Q47A 1YR2A 2AGLA 3RN0D 4O2WA 4A0BA 4K3ID 4JSVC 5M5TA 3MMYA 1NEXB 2Z2NA 1QNIA 4J77A 2EBSA 2VDKA 2HESX 3SCYA 4Z8LA 3OF7A 3IUQA 3OKYA 2QZPA 1R5MA 3FCSA 2XDWA 4GZ8A 3AFCA 1PEVA 1XIPA 4J79A 1A0RB 4G56B 4AMZA 2GC7A 4O45A 2P9IC 2IWKA 4XYHA 3V9FA 4FA5D 4GQ2P 1JJUB 5M5UA 2B5MA 4L1QD 4CZYA 2OIZA 3EI4A 5TDHB 2B4EA 3U4YA 1L5GA 2PM9B 3EI3B 1QFSA 5E6UA 4J73A 3JAMg 4YVDA 3AL8A 4AMYA 4J8GA 3EQ7A 2QR5A 4QAMA 3SVWD 3NVXA 4Y5RD 2VDNA
chains in the Genus database with same CATH topology
3F3PA 4CI8A 2PM6B 2AGXA 2HJBA 4ERYA 1XHMA 5H14A 3J81g 2GNQA 3SBRA 2IUQA 2AH0A 4ERZA 3EI1B 4GM3A 3RRMC 5CXBB 3VGZA 4BL0A 1TYQC 3SXTD 3MKSB 4FA9D 3PE7A 4LG8A 3EWEA 4CI2A 4PXWA 5CYKA 4A2LA 3JRPA 4J82A 2I3SA 2H6KA 3GFCA 3JROA 4QQEA 5EALA 5EM2A 1L0QA 5I5JA 1B9YA 4CZVA 2GC4A 3KRXB 3I7HA 5I5MA 5IC7A 3B7FA 4U7AA 1OMWB 2CN2A 4ERQA 3CIKB 4QRJA 4JT5C 4JSPC 3PSLA 2OVRB 2YMUA 5AMSA 1P22A 3CFSB 5EMMB 3HFQA 4H5JA 2HXCA 3OKYB 3GREA 4FHLA 4J0WA 4O9DA 4FWWA 4EWRA 3VA6A 1N6FA 2YNNA 5TEFA 4FAND 3ODTA 2OVQB 5HQGA 2BCJB 4LGNA 2IUPA 3EI4B 3IJ1A 3JZHA 3PVWB 1GOTB 4TZ4A 3L4MD 2P9PC 1SQ9A 4PSWB 3EI2A 3AL8B 4KFMB 2P9LC 4NSXA 1NR0A 5HE0B 1XKSA 4GM8A 5GSAA 3SLED 3UVMA 2I3TA 2YNOA 3UR4A 5TF2A 4CC9A 3IIYA 4GMBA 3VH0A 5GMKn 3SHFA 3W15A 5CYKB 5SXMA 4Y7RA 5AFU3 1N6EA 3SN6B 1OLZA 3DXKC 3I7PA 4HDJA 5GXHA 3AL9A 4L9OA 2UZXB 4QL1A 4X63B 3N0DA 4ESGA 4J81A 4JSNC 1JMXB 1GXRA 3JZNA 4D6VA 5TEEA 5A2Qg 3SFZA 2HJ4A 4PBYA 4O3TB 4O1QD 4E54A 4A08B 5FLXg 3UVOA 1SQJA 2IAAA 4A0AA 2P9UC 2G99A 2YNPA 3C5MA 3ULEC 3I7NA 4J8BA 4E5ZA 3DSMA 3F3GA 2H9PA 2XL2A 3A0FA 4J87A 3MKQA 3ZWLB 5JWZA 3IIWA 4PNKB 4JD2C 1GG2B 3I89A 3PXWD 4CY1A 3OKTA 2H9NA 4CY3A 5HE1B 2YB8B 1N6DA 3RN1D 2J55H 3I8CA 4J78A 3V7DB 2P9NC 3J80g 5EARA 3JB9L 1JMZB 4QT8A 3UKRC 4A0BB 4CY5A 2IUVA 3C99A 3NVQA 4UI9R 4A11A 3IJ0A 4MK0B 4ZOVA 4BUJC 4CI3A 5IGOA 5EMLB 5H1MA 2B5NA 3AH8B 5FQDA 1VYHC 4ZOYA 4GQBB 2PM9A 4J86A 3SBPA 5IGQA 5K1CC 2CNXA 5HE3B 1MDAH 5IJ8E 1TBGA 4U1EI 4E54B 2HKRA 3BG1A 4ZOXA 4D0KA 1U4CA 3NVNA 3SWSD 4GM9A 5CXBA 4J84A 1MG2A 1SHYB 3RMZD 3PSCB 3RLMD 3CFVA 2OK4A 2OVPB 5HE2B 2H14A 3IKOA 4PC0A 3UVKA 2IURA 4IA9A 2Z2PA 4K3JB 4X61B 4JSXC 1K8KC 3MZKA 4J0XA 3DWLC 5EM2B 1S4UX 2H68A 4N14A 2Q7QA 2G9AA 4I79A 2CE8A 5C2WB 4IMMA 3I2NA 5FKSA 4PBZA 4A7JA 5IT9g 2UZYB 2QC5A 2IWFA 4OZUA 4FB1D 3IJCA 3SBQA 2CN3A 2TRCB 4FAVD 2H13A 3PXTD 3DM0A 2H9MA 1YFQA 3I7KA 3KRWB 2HYEA 2B5LA 2P9KC 3FRXA 3FM0A 4A11B 3SMRA 1JOFA 4O3UB 3MZLA 5CXCA 3EU7A 3L4OD 2CO0A 1U2VC 2XL3A 3BWSA 3UVLA 5HYNB 4A09A 2W18A 5C2VB 2H9LA 3SJLD 1ERJA 3E0CA 3K27A 3C75H 2QXVA 2I0RA 2H6QA 3JZGA 2HKMA 5THAA 4AEZA 2CO0C 2Z2OA 3RFGA 4L3GD 5K19A 3I7LA 4XYIA 4JXMA 5C9ZB 3OL2A 3EI2B 4CZXA 2AGYA 2J56H 3FGBA 5EAMA 1B9XA 5FKQA 5IJ7E 5EMKB 3OW8A 3RFHA 4GQ1A 5EAPA 3DXMC 3I8EA 2P9SC 3I7OA 3C9CA 4ZOZA 2AH1A 4OWRA 4CY2A 3N0EA 4FA1D 2PBIB 1PBYB 4H5IA 3PXSD 2CE9A 2BBKH 5AJAA 3EG6A 4CI1A 4L3HD 3PVUB 4GGCA 3EI3A 2OJYA 4LG9A 3RSEC 2AGZA 2I0TA 4PSXB 2J57G 4A08A 3F3FA 2OK6A 1PGUA 5I5IA 2H6NA 2YBAA 4X60B 4ZN4A 2XYIA 5FA5B 3OKWA 1RI6A 5GXIA 2H3XA 3UKUC 2AGWA 1PI6A 1GP2B 3MXXA 4X3EA 5H17A 5EMJB 3EI1A 3EMHA 2AQ5A 3OTTA 5CXCB 5FKTA 4A0AB 3P4FA 4BH6A 3K26A 4GGDA 4R7AB 4A09B 2H47A 3ORVD 4E5ZB 5FKRA 4GGAA 4AOWA 3UVNA 4ES0A 4XEIC 1MG3A 1FWXA 2I0SA 2PM7B 5KDOB 4A2MA 2MTAH 2XU7A 2O9KA 4FA4D 5FXYA 1K32A 3V5WB 3BG0A 3OL2B 4JT6C 5B4WA 3JPXA 1Q47A 2AGLA 3RN0D 4A0BA 4K3ID 4JSVC 3MMYA 1NEXB 2Z2NA 1QNIA 4J77A 2EBSA 3SCYA 2HESX 4Z8LA 3OKYA 1R5MA 4GZ8A 3AFCA 1PEVA 1XIPA 4J79A 1A0RB 4G56B 2GC7A 4O45A 2P9IC 2IWKA 4XYHA 3V9FA 4FA5D 4GQ2P 1JJUB 2B5MA 4L1QD 4CZYA 2OIZA 3EI4A 5TDHB 2B4EA 3U4YA 2PM9B 3EI3B 4J73A 3JAMg 4YVDA 3AL8A 4J8GA 3SVWD 3NVXA 4Y5RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3P A;  4CI8 A;  2PM6 B;  2AGX A;  2HJB A;  4ERY A;  1XHM A;  5H14 A;  3J81 g;  2GNQ A;  3SBR A;  2IUQ A;  2AH0 A;  4ERZ A;  3EI1 B;  4GM3 A;  3RRM C;  5CXB B;  3VGZ A;  4BL0 A;  1TYQ C;  3SXT D;  3MKS B;  4FA9 D;  3PE7 A;  4LG8 A;  3EWE A;  4CI2 A;  4PXW A;  5CYK A;  4A2L A;  3JRP A;  4J82 A;  2I3S A;  2H6K A;  3GFC A;  3JRO A;  4QQE A;  5EAL A;  5EM2 A;  1L0Q A;  5I5J A;  1B9Y A;  4CZV A;  2GC4 A;  3KRX B;  3I7H A;  5I5M A;  5IC7 A;  3B7F A;  4U7A A;  1OMW B;  2CN2 A;  4ERQ A;  3CIK B;  4QRJ A;  4JT5 C;  4JSP C;  3PSL A;  2OVR B;  2YMU A;  5AMS A;  1P22 A;  3CFS B;  5EMM B;  3HFQ A;  4H5J A;  2HXC A;  3OKY B;  3GRE A;  4FHL A;  4J0W A;  4O9D A;  4FWW A;  4EWR A;  3VA6 A;  1N6F A;  2YNN A;  5TEF A;  4FAN D;  3ODT A;  2OVQ B;  5HQG A;  2BCJ B;  4LGN A;  2IUP A;  3EI4 B;  3IJ1 A;  3JZH A;  3PVW B;  1GOT B;  4TZ4 A;  3L4M D;  2P9P C;  1SQ9 A;  4PSW B;  3EI2 A;  3AL8 B;  4KFM B;  2P9L C;  4NSX A;  1NR0 A;  5HE0 B;  1XKS A;  4GM8 A;  5GSA A;  3SLE D;  3UVM A;  2I3T A;  2YNO A;  3UR4 A;  5TF2 A;  4CC9 A;  3IIY A;  4GMB A;  3VH0 A;  5GMK n;  3SHF A;  3W15 A;  5CYK B;  5SXM A;  4Y7R A;  5AFU 3;  1N6E A;  3SN6 B;  1OLZ A;  3DXK C;  3I7P A;  4HDJ A;  5GXH A;  3AL9 A;  4L9O A;  2UZX B;  4QL1 A;  4X63 B;  3N0D A;  4ESG A;  4J81 A;  4JSN C;  1JMX B;  1GXR A;  3JZN A;  4D6V A;  5TEE A;  5A2Q g;  3SFZ A;  2HJ4 A;  4PBY A;  4O3T B;  4O1Q D;  4E54 A;  4A08 B;  5FLX g;  3UVO A;  1SQJ A;  2IAA A;  4A0A A;  2P9U C;  2G99 A;  2YNP A;  3C5M A;  3ULE C;  3I7N A;  4J8B A;  4E5Z A;  3DSM A;  3F3G A;  2H9P A;  2XL2 A;  3A0F A;  4J87 A;  3MKQ A;  3ZWL B;  5JWZ A;  3IIW A;  4PNK B;  4JD2 C;  1GG2 B;  3I89 A;  3PXW D;  4CY1 A;  3OKT A;  2H9N A;  4CY3 A;  5HE1 B;  2YB8 B;  1N6D A;  3RN1 D;  2J55 H;  3I8C A;  4J78 A;  3V7D B;  2P9N C;  3J80 g;  5EAR A;  3JB9 L;  1JMZ B;  4QT8 A;  3UKR C;  4A0B B;  4CY5 A;  2IUV A;  3C99 A;  3NVQ A;  4UI9 R;  4A11 A;  3IJ0 A;  4MK0 B;  4ZOV A;  4BUJ C;  4CI3 A;  5IGO A;  5EML B;  5H1M A;  2B5N A;  3AH8 B;  5FQD A;  1VYH C;  4ZOY A;  4GQB B;  2PM9 A;  4J86 A;  3SBP A;  5IGQ A;  5K1C C;  2CNX A;  5HE3 B;  1MDA H;  5IJ8 E;  1TBG A;  4U1E I;  4E54 B;  2HKR A;  3BG1 A;  4ZOX A;  4D0K A;  1U4C A;  3NVN A;  3SWS D;  4GM9 A;  5CXB A;  4J84 A;  1MG2 A;  1SHY B;  3RMZ D;  3PSC B;  3RLM D;  3CFV A;  2OK4 A;  2OVP B;  5HE2 B;  2H14 A;  3IKO A;  4PC0 A;  3UVK A;  2IUR A;  4IA9 A;  2Z2P A;  4K3J B;  4X61 B;  4JSX C;  1K8K C;  3MZK A;  4J0X A;  3DWL C;  5EM2 B;  1S4U X;  2H68 A;  4N14 A;  2Q7Q A;  2G9A A;  4I79 A;  2CE8 A;  5C2W B;  4IMM A;  3I2N A;  5FKS A;  4PBZ A;  4A7J A;  5IT9 g;  2UZY B;  2QC5 A;  2IWF A;  4OZU A;  4FB1 D;  3IJC A;  3SBQ A;  2CN3 A;  2TRC B;  4FAV D;  2H13 A;  3PXT D;  3DM0 A;  2H9M A;  1YFQ A;  3I7K A;  3KRW B;  2HYE A;  2B5L A;  2P9K C;  3FRX A;  3FM0 A;  4A11 B;  3SMR A;  1JOF A;  4O3U B;  3MZL A;  5CXC A;  3EU7 A;  3L4O D;  2CO0 A;  1U2V C;  2XL3 A;  3BWS A;  3UVL A;  5HYN B;  4A09 A;  2W18 A;  5C2V B;  2H9L A;  3SJL D;  1ERJ A;  3E0C A;  3K27 A;  3C75 H;  2QXV A;  2I0R A;  2H6Q A;  3JZG A;  2HKM A;  5THA A;  4AEZ A;  2CO0 C;  2Z2O A;  3RFG A;  4L3G D;  5K19 A;  3I7L A;  4XYI A;  4JXM A;  5C9Z B;  3OL2 A;  3EI2 B;  4CZX A;  2AGY A;  2J56 H;  3FGB A;  5EAM A;  1B9X A;  5FKQ A;  5IJ7 E;  5EMK B;  3OW8 A;  3RFH A;  4GQ1 A;  5EAP A;  3DXM C;  3I8E A;  2P9S C;  3I7O A;  3C9C A;  4ZOZ A;  2AH1 A;  4OWR A;  4CY2 A;  3N0E A;  4FA1 D;  2PBI B;  1PBY B;  4H5I A;  3PXS D;  2CE9 A;  2BBK H;  5AJA A;  3EG6 A;  4CI1 A;  4L3H D;  3PVU B;  4GGC A;  3EI3 A;  2OJY A;  4LG9 A;  3RSE C;  2AGZ A;  2I0T A;  4PSX B;  2J57 G;  4A08 A;  3F3F A;  2OK6 A;  1PGU A;  5I5I A;  2H6N A;  2YBA A;  4X60 B;  4ZN4 A;  2XYI A;  5FA5 B;  3OKW A;  1RI6 A;  5GXI A;  2H3X A;  3UKU C;  2AGW A;  1PI6 A;  1GP2 B;  3MXX A;  4X3E A;  5H17 A;  5EMJ B;  3EI1 A;  3EMH A;  2AQ5 A;  3OTT A;  5CXC B;  5FKT A;  4A0A B;  3P4F A;  4BH6 A;  3K26 A;  4GGD A;  4R7A B;  4A09 B;  2H47 A;  3ORV D;  4E5Z B;  5FKR A;  4GGA A;  4AOW A;  3UVN A;  4ES0 A;  4XEI C;  1MG3 A;  1FWX A;  2I0S A;  2PM7 B;  5KDO B;  4A2M A;  2MTA H;  2XU7 A;  2O9K A;  4FA4 D;  5FXY A;  1K32 A;  3V5W B;  3BG0 A;  3OL2 B;  4JT6 C;  5B4W A;  3JPX A;  1Q47 A;  2AGL A;  3RN0 D;  4A0B A;  4K3I D;  4JSV C;  3MMY A;  1NEX B;  2Z2N A;  1QNI A;  4J77 A;  2EBS A;  3SCY A;  2HES X;  4Z8L A;  3OKY A;  1R5M A;  4GZ8 A;  3AFC A;  1PEV A;  1XIP A;  4J79 A;  1A0R B;  4G56 B;  2GC7 A;  4O45 A;  2P9I C;  2IWK A;  4XYH A;  3V9F A;  4FA5 D;  4GQ2 P;  1JJU B;  2B5M A;  4L1Q D;  4CZY A;  2OIZ A;  3EI4 A;  5TDH B;  2B4E A;  3U4Y A;  2PM9 B;  3EI3 B;  4J73 A;  3JAM g;  4YVD A;  3AL8 A;  4J8G A;  3SVW D;  3NVX A;  4Y5R D; 
#chains in the Genus database with same CATH topology
 1GOF A;  3F3P A;  4CI8 A;  2PM6 B;  2AGX A;  2HJB A;  4ERY A;  1XHM A;  5H14 A;  3J81 g;  2GNQ A;  3SBR A;  1E8M A;  2IUQ A;  2AH0 A;  4ERZ A;  3EI1 B;  4GM3 A;  3RRM C;  3V4P A;  5CXB B;  3VGZ A;  4BL0 A;  1TYQ C;  3SXT D;  3MKS B;  4FA9 D;  3PE7 A;  4LG8 A;  3EWE A;  4CI2 A;  4PXW A;  5CYK A;  4A2L A;  3JRP A;  4AN1 A;  4J82 A;  1O6G A;  2I3S A;  2H6K A;  3GFC A;  3JRO A;  4QQE A;  5EAL A;  5EM2 A;  4BCC A;  1L0Q A;  5I5J A;  1B9Y A;  4CZV A;  2GC4 A;  1UOO A;  3KRX B;  3I7H A;  5I5M A;  5IC7 A;  3B7F A;  1K3I A;  4U7A A;  1OMW B;  2CN2 A;  4ERQ A;  3CIK B;  4WJK A;  2HU7 A;  4QRJ A;  4JT5 C;  5M5V A;  4JSP C;  5M5R A;  1VE6 A;  3PSL A;  2OVR B;  2YMU A;  5AMS A;  1P22 A;  3CFS B;  5EMM B;  3HFQ A;  4H5J A;  4Z7Q A;  4RE5 A;  2HXC A;  3OKY B;  3GRE A;  4FHL A;  4J0W A;  4O9D A;  4FWW A;  4EWR A;  3VA6 A;  1N6F A;  3IUM A;  2YNN A;  1VZ3 A;  3V4V A;  5TEF A;  4FAN D;  3ODT A;  4WK0 A;  2OVQ B;  1QFM A;  5HQG A;  2BCJ B;  4LGN A;  2IUP A;  3EI4 B;  3IJ1 A;  3JZH A;  3PVW B;  3NIF A;  1GOT B;  2WQ8 A;  4TZ4 A;  3IVM A;  3L4M D;  2P9P C;  1SQ9 A;  4Z7O A;  4PSW B;  3EI2 A;  3AL8 B;  3IJE A;  4KFM B;  2P9L C;  2HU5 A;  4NSX A;  1NR0 A;  5HE0 B;  1BPO A;  1XKS A;  4GM8 A;  5GSA A;  3SLE D;  4AX4 A;  3UVM A;  2I3T A;  3K71 A;  2YNO A;  3UR4 A;  4AN0 A;  5TF2 A;  4CC9 A;  3IIY A;  4GMB A;  3VH0 A;  5GMK n;  3SHF A;  3W15 A;  4BCB A;  5CYK B;  5SXM A;  4Y7R A;  5AFU 3;  1U8C A;  1N6E A;  3SN6 B;  1OLZ A;  3I7P A;  3DXK C;  4HDJ A;  5GXH A;  5HDB A;  3AL9 A;  1VZ2 A;  4L9O A;  2UZX B;  3ZDZ A;  4QL1 A;  4X63 B;  3N0D A;  4ESG A;  3O4I A;  4J81 A;  3IUR A;  4IRZ A;  4JSN C;  1JMX B;  1GXR A;  3JZN A;  4O02 A;  4NBM A;  5TEE A;  4D6V A;  3SFZ A;  5A2Q g;  5M5S A;  4JHN A;  5E6S A;  2HJ4 A;  4PBY A;  4O3T B;  4O1Q D;  1JTD B;  4E54 A;  4A08 B;  1E8N A;  5FLX g;  4MMX A;  3UVO A;  1SQJ A;  2IAA A;  4A0A A;  2P9U C;  2G99 A;  2YNP A;  3C5M A;  3ULE C;  3FCU A;  3VI4 A;  3I7N A;  4J8B A;  4E5Z A;  3DSM A;  3F3G A;  2H9P A;  2XL2 A;  3A0F A;  4J87 A;  2XE4 A;  3GC3 B;  3MKQ A;  3O4H A;  3ZWL B;  3DDU A;  5JWZ A;  3IIW A;  4PNK B;  4JD2 C;  1GG2 B;  3I89 A;  3PXW D;  4CY1 A;  4MMY A;  2VZ1 A;  3OKT A;  2H9N A;  4CY3 A;  5HE1 B;  2EID A;  4BCD A;  2YB8 B;  1N6D A;  3RN1 D;  2J55 H;  3I8C A;  4J78 A;  3V7D B;  2P9N C;  3ZE2 A;  3J80 g;  4D9S A;  3NIG A;  4G1M A;  5EAR A;  3ZDY A;  3JB9 L;  1JMZ B;  4QT8 A;  3UKR C;  3GD1 I;  4A0B B;  4CY5 A;  2IUV A;  3C99 A;  3NVQ A;  4UI9 R;  1UOP A;  4A11 A;  3IJ0 A;  4MK0 B;  5FFO A;  4ZOV A;  4BUJ C;  4CI3 A;  5IGO A;  5EML B;  5H1M A;  2B5N A;  3AH8 B;  5FQD A;  3O4G A;  3NID A;  3EQ9 A;  2XZG A;  2VDO A;  1VYH C;  4ZOY A;  4GQB B;  2PM9 A;  4J86 A;  3SBP A;  1C9I A;  1GOG A;  2VDP A;  5IGQ A;  3O4J A;  4NC4 A;  5K1C C;  2CNX A;  5HE3 B;  1MDA H;  5IJ8 E;  1TBG A;  3ZE1 A;  4U1E I;  4E54 B;  2HKR A;  2EIB A;  3BG1 A;  2VDM A;  4ZOX A;  4D0K A;  1U4C A;  3NVN A;  3SWS D;  2EIC A;  4GM9 A;  4G1E A;  1H2W A;  5CXB A;  3K72 A;  4J84 A;  1MG2 A;  1SHY B;  2EIE A;  3RMZ D;  3ZE0 A;  3PSC B;  3RLM D;  3CFV A;  2OK4 A;  2OVP B;  4WK2 A;  2H14 A;  3IKO A;  4PC0 A;  5HE2 B;  3UVK A;  1VE7 A;  4Z7N A;  1O6F A;  4DNW A;  2IUR A;  4IA9 A;  2Z2P A;  1UTC A;  4K3J B;  4X61 B;  5C2W B;  4JSX C;  3K6S A;  1K8K C;  2VDR A;  3MZK A;  4J0X A;  3DWL C;  5EM2 B;  1S4U X;  2H68 A;  4N14 A;  2Q7Q A;  2G9A A;  4I79 A;  2CE8 A;  4UM9 A;  4IMM A;  3I2N A;  1C9L A;  5FKS A;  4DNV A;  5C92 A;  4BP8 A;  4PBZ A;  4A7J A;  5IT9 g;  2UZY B;  3IUL A;  2QC5 A;  2IWF A;  4OZU A;  4FB1 D;  3IJC A;  3SBQ A;  2CN3 A;  2TRC B;  4FAV D;  2H13 A;  3PXT D;  3DM0 A;  2H9M A;  1YFQ A;  3I7K A;  4L1M A;  3KRW B;  2HYE A;  1H2Z A;  3QHY B;  2B5L A;  1UOQ A;  2P9K C;  2VDL A;  3FRX A;  3FM0 A;  4A11 B;  5M61 A;  3KCI A;  3SMR A;  1A12 A;  1JOF A;  4O3U B;  3MZL A;  5E6R A;  5CXC A;  3EU7 A;  3L4O D;  2CO0 A;  1H2Y A;  1U2V C;  2XL3 A;  3BWS A;  3UVL A;  1E5T A;  5HYN B;  4A09 A;  2W18 A;  5C2V B;  2H9L A;  3T3P A;  2VC2 A;  3SJL D;  1ERJ A;  3K27 A;  3E0C A;  3EQ8 A;  3C75 H;  2QXV A;  2I0R A;  2H6Q A;  4G55 A;  3JZG A;  2HKM A;  5THA A;  4AEZ A;  2CO0 C;  2Z2O A;  3RFG A;  4L3G D;  5K19 A;  1GOH A;  3I7L A;  4XYI A;  4JXM A;  4RE6 A;  5C9Z B;  4NEN A;  2JKX A;  3OL2 A;  3EI2 B;  4NAA A;  4CZX A;  2AGY A;  2J56 H;  3FGB A;  5EAM A;  1B9X A;  5FKQ A;  5IJ7 E;  5EMK B;  3OW8 A;  3RFH A;  2VZ3 A;  4GQ1 A;  5EAP A;  3DXM C;  3I8E A;  1JV2 A;  2P9S C;  3I7O A;  3C9C A;  4ZOZ A;  2AH1 A;  4OWR A;  4CY2 A;  3N0E A;  4FA1 D;  2PBI B;  4MMZ A;  2VDQ A;  1PBY B;  1TYE A;  4H5I A;  3PXS D;  2CE9 A;  3MVD K;  2BBK H;  3QI0 A;  5C86 A;  5AJA A;  2BKL A;  4JHP C;  3MUO A;  1T2X A;  3EG6 A;  4CI1 A;  4L3H D;  4WK4 A;  3PVU B;  4GGC A;  3EI3 A;  2OJY A;  4LG9 A;  3RSE C;  2AGZ A;  2I0T A;  4PSX B;  2J57 G;  4A08 A;  3F3F A;  2OK6 A;  1PGU A;  5I5I A;  2H6N A;  2YBA A;  3T3M A;  4X60 B;  4ZN4 A;  2XYI A;  5FA5 B;  3OKW A;  1RI6 A;  5GXI A;  2H3X A;  3UKU C;  2AGW A;  3ZDX A;  4BP9 A;  1PI6 A;  3VI3 A;  1GP2 B;  3MXX A;  4X3E A;  5H17 A;  5EMJ B;  3EI1 A;  3EMH A;  2AQ5 A;  3OTT A;  5CXC B;  5FKT A;  4A0A B;  3P4F A;  3IUJ A;  1M1X A;  5FFG A;  4BH6 A;  3K26 A;  4GGD A;  4R7A B;  4A09 B;  2H47 A;  1H2X A;  3ORV D;  4E5Z B;  5FKR A;  1I2M B;  4GGA A;  4AOW A;  3UVN A;  2HU8 A;  4ES0 A;  4XEI C;  1MG3 A;  1FWX A;  3MUN A;  4UM8 A;  2I0S A;  2PM7 B;  5KDO B;  3IUN A;  4A2M A;  2MTA H;  4DNU A;  2XU7 A;  2O9K A;  4FA4 D;  5FXY A;  1K32 A;  3V5W B;  3BG0 A;  3OL2 B;  4JT6 C;  5B4W A;  3JPX A;  1Q47 A;  1YR2 A;  2AGL A;  3RN0 D;  4O2W A;  4A0B A;  4K3I D;  4JSV C;  5M5T A;  3MMY A;  1NEX B;  2Z2N A;  1QNI A;  4J77 A;  2EBS A;  2VDK A;  2HES X;  3SCY A;  4Z8L A;  3OF7 A;  3IUQ A;  3OKY A;  2QZP A;  1R5M A;  3FCS A;  2XDW A;  4GZ8 A;  3AFC A;  1PEV A;  1XIP A;  4J79 A;  1A0R B;  4G56 B;  4AMZ A;  2GC7 A;  4O45 A;  2P9I C;  2IWK A;  4XYH A;  3V9F A;  4FA5 D;  4GQ2 P;  1JJU B;  5M5U A;  2B5M A;  4L1Q D;  4CZY A;  2OIZ A;  3EI4 A;  5TDH B;  2B4E A;  3U4Y A;  1L5G A;  2PM9 B;  3EI3 B;  1QFS A;  5E6U A;  4J73 A;  3JAM g;  4YVD A;  3AL8 A;  4AMY A;  4J8G A;  3EQ7 A;  2QR5 A;  4QAM A;  3SVW D;  3NVX A;  4Y5R D;  2VDN A; 
#chains in the Genus database with same CATH homology
 3F3P A;  4CI8 A;  2PM6 B;  2AGX A;  2HJB A;  4ERY A;  1XHM A;  5H14 A;  3J81 g;  2GNQ A;  3SBR A;  2IUQ A;  2AH0 A;  4ERZ A;  3EI1 B;  4GM3 A;  3RRM C;  5CXB B;  3VGZ A;  4BL0 A;  1TYQ C;  3SXT D;  3MKS B;  4FA9 D;  3PE7 A;  4LG8 A;  3EWE A;  4CI2 A;  4PXW A;  5CYK A;  4A2L A;  3JRP A;  4J82 A;  2I3S A;  2H6K A;  3GFC A;  3JRO A;  4QQE A;  5EAL A;  5EM2 A;  1L0Q A;  5I5J A;  1B9Y A;  4CZV A;  2GC4 A;  3KRX B;  3I7H A;  5I5M A;  5IC7 A;  3B7F A;  4U7A A;  1OMW B;  2CN2 A;  4ERQ A;  3CIK B;  4QRJ A;  4JT5 C;  4JSP C;  3PSL A;  2OVR B;  2YMU A;  5AMS A;  1P22 A;  3CFS B;  5EMM B;  3HFQ A;  4H5J A;  2HXC A;  3OKY B;  3GRE A;  4FHL A;  4J0W A;  4O9D A;  4FWW A;  4EWR A;  3VA6 A;  1N6F A;  2YNN A;  5TEF A;  4FAN D;  3ODT A;  2OVQ B;  5HQG A;  2BCJ B;  4LGN A;  2IUP A;  3EI4 B;  3IJ1 A;  3JZH A;  3PVW B;  1GOT B;  4TZ4 A;  3L4M D;  2P9P C;  1SQ9 A;  4PSW B;  3EI2 A;  3AL8 B;  4KFM B;  2P9L C;  4NSX A;  1NR0 A;  5HE0 B;  1XKS A;  4GM8 A;  5GSA A;  3SLE D;  3UVM A;  2I3T A;  2YNO A;  3UR4 A;  5TF2 A;  4CC9 A;  3IIY A;  4GMB A;  3VH0 A;  5GMK n;  3SHF A;  3W15 A;  5CYK B;  5SXM A;  4Y7R A;  5AFU 3;  1N6E A;  3SN6 B;  1OLZ A;  3DXK C;  3I7P A;  4HDJ A;  5GXH A;  3AL9 A;  4L9O A;  2UZX B;  4QL1 A;  4X63 B;  3N0D A;  4ESG A;  4J81 A;  4JSN C;  1JMX B;  1GXR A;  3JZN A;  4D6V A;  5TEE A;  5A2Q g;  3SFZ A;  2HJ4 A;  4PBY A;  4O3T B;  4O1Q D;  4E54 A;  4A08 B;  5FLX g;  3UVO A;  1SQJ A;  2IAA A;  4A0A A;  2P9U C;  2G99 A;  2YNP A;  3C5M A;  3ULE C;  3I7N A;  4J8B A;  4E5Z A;  3DSM A;  3F3G A;  2H9P A;  2XL2 A;  3A0F A;  4J87 A;  3MKQ A;  3ZWL B;  5JWZ A;  3IIW A;  4PNK B;  4JD2 C;  1GG2 B;  3I89 A;  3PXW D;  4CY1 A;  3OKT A;  2H9N A;  4CY3 A;  5HE1 B;  2YB8 B;  1N6D A;  3RN1 D;  2J55 H;  3I8C A;  4J78 A;  3V7D B;  2P9N C;  3J80 g;  5EAR A;  3JB9 L;  1JMZ B;  4QT8 A;  3UKR C;  4A0B B;  4CY5 A;  2IUV A;  3C99 A;  3NVQ A;  4UI9 R;  4A11 A;  3IJ0 A;  4MK0 B;  4ZOV A;  4BUJ C;  4CI3 A;  5IGO A;  5EML B;  5H1M A;  2B5N A;  3AH8 B;  5FQD A;  1VYH C;  4ZOY A;  4GQB B;  2PM9 A;  4J86 A;  3SBP A;  5IGQ A;  5K1C C;  2CNX A;  5HE3 B;  1MDA H;  5IJ8 E;  1TBG A;  4U1E I;  4E54 B;  2HKR A;  3BG1 A;  4ZOX A;  4D0K A;  1U4C A;  3NVN A;  3SWS D;  4GM9 A;  5CXB A;  4J84 A;  1MG2 A;  1SHY B;  3RMZ D;  3PSC B;  3RLM D;  3CFV A;  2OK4 A;  2OVP B;  5HE2 B;  2H14 A;  3IKO A;  4PC0 A;  3UVK A;  2IUR A;  4IA9 A;  2Z2P A;  4K3J B;  4X61 B;  4JSX C;  1K8K C;  3MZK A;  4J0X A;  3DWL C;  5EM2 B;  1S4U X;  2H68 A;  4N14 A;  2Q7Q A;  2G9A A;  4I79 A;  2CE8 A;  5C2W B;  4IMM A;  3I2N A;  5FKS A;  4PBZ A;  4A7J A;  5IT9 g;  2UZY B;  2QC5 A;  2IWF A;  4OZU A;  4FB1 D;  3IJC A;  3SBQ A;  2CN3 A;  2TRC B;  4FAV D;  2H13 A;  3PXT D;  3DM0 A;  2H9M A;  1YFQ A;  3I7K A;  3KRW B;  2HYE A;  2B5L A;  2P9K C;  3FRX A;  3FM0 A;  4A11 B;  3SMR A;  1JOF A;  4O3U B;  3MZL A;  5CXC A;  3EU7 A;  3L4O D;  2CO0 A;  1U2V C;  2XL3 A;  3BWS A;  3UVL A;  5HYN B;  4A09 A;  2W18 A;  5C2V B;  2H9L A;  3SJL D;  1ERJ A;  3E0C A;  3K27 A;  3C75 H;  2QXV A;  2I0R A;  2H6Q A;  3JZG A;  2HKM A;  5THA A;  4AEZ A;  2CO0 C;  2Z2O A;  3RFG A;  4L3G D;  5K19 A;  3I7L A;  4XYI A;  4JXM A;  5C9Z B;  3OL2 A;  3EI2 B;  4CZX A;  2AGY A;  2J56 H;  3FGB A;  5EAM A;  1B9X A;  5FKQ A;  5IJ7 E;  5EMK B;  3OW8 A;  3RFH A;  4GQ1 A;  5EAP A;  3DXM C;  3I8E A;  2P9S C;  3I7O A;  3C9C A;  4ZOZ A;  2AH1 A;  4OWR A;  4CY2 A;  3N0E A;  4FA1 D;  2PBI B;  1PBY B;  4H5I A;  3PXS D;  2CE9 A;  2BBK H;  5AJA A;  3EG6 A;  4CI1 A;  4L3H D;  3PVU B;  4GGC A;  3EI3 A;  2OJY A;  4LG9 A;  3RSE C;  2AGZ A;  2I0T A;  4PSX B;  2J57 G;  4A08 A;  3F3F A;  2OK6 A;  1PGU A;  5I5I A;  2H6N A;  2YBA A;  4X60 B;  4ZN4 A;  2XYI A;  5FA5 B;  3OKW A;  1RI6 A;  5GXI A;  2H3X A;  3UKU C;  2AGW A;  1PI6 A;  1GP2 B;  3MXX A;  4X3E A;  5H17 A;  5EMJ B;  3EI1 A;  3EMH A;  2AQ5 A;  3OTT A;  5CXC B;  5FKT A;  4A0A B;  3P4F A;  4BH6 A;  3K26 A;  4GGD A;  4R7A B;  4A09 B;  2H47 A;  3ORV D;  4E5Z B;  5FKR A;  4GGA A;  4AOW A;  3UVN A;  4ES0 A;  4XEI C;  1MG3 A;  1FWX A;  2I0S A;  2PM7 B;  5KDO B;  4A2M A;  2MTA H;  2XU7 A;  2O9K A;  4FA4 D;  5FXY A;  1K32 A;  3V5W B;  3BG0 A;  3OL2 B;  4JT6 C;  5B4W A;  3JPX A;  1Q47 A;  2AGL A;  3RN0 D;  4A0B A;  4K3I D;  4JSV C;  3MMY A;  1NEX B;  2Z2N A;  1QNI A;  4J77 A;  2EBS A;  3SCY A;  2HES X;  4Z8L A;  3OKY A;  1R5M A;  4GZ8 A;  3AFC A;  1PEV A;  1XIP A;  4J79 A;  1A0R B;  4G56 B;  2GC7 A;  4O45 A;  2P9I C;  2IWK A;  4XYH A;  3V9F A;  4FA5 D;  4GQ2 P;  1JJU B;  2B5M A;  4L1Q D;  4CZY A;  2OIZ A;  3EI4 A;  5TDH B;  2B4E A;  3U4Y A;  2PM9 B;  3EI3 B;  4J73 A;  3JAM g;  4YVD A;  3AL8 A;  4J8G A;  3SVW D;  3NVX A;  4Y5R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...