3PY2A

Structure of c126s mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVSFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Probing the role of the fully conserved Cys126 in triosephosphate isomerase by site-specific mutagenesis--distal effects on dimer stability.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3py2A00
1Y0EA 2PRLA 4S1FA 2GUUA 2OZ0A 3L0NA 1W56A 3LHYA 3U6WA 3BARA 3FOKA 3MO7A 4XQ6A 1W3IA 4DF2A 1K8YA 3MYOA 3PBVA 3Q37A 5K9XA 1P4CA 1A5AA 3LLFA 1AL7A 3LOTA 2TSYA 2Y89A 5CPNA 2ISSA 3A22A 3K30A 2A7PA 1YTEA 4N6FA 1WYIA 3N14A 3C56A 3JS3A 2VFGA 2AGKA 3TAOA 1TYGA 1M7OA 3O1NA 1JQVA 4ONVA 3Q2DA 4M6PA 4GUFA 4LS2A 3C6CA 4OBTA 4MLJA 2ZBTA 5D02A 1VYPX 5C2XA 4IWWA 3CTLA 2WNQA 4NX0A 3P74A 4ZVJA 1GEQA 3L21A 4PL1A 1X7FA 3L68A 4FO4A 1NVMA 4OE7A 3UXDA 2C15A 3BGGA 1JVNA 4O11A 3NQ7A 2WNNA 5FF2A 1HO1A 5ABTA 4NNAA 5DCDA 3B8DA 4O54A 4MUZA 3LTPA 2ZA3A 3C3NA 3QW4B 1SQ7A 3NL3A 4JTJA 3U2OA 3M7WA 3NAVA 5K3VA 4RV8A 5K9CA 4OT7A 3G1SA 4PEKA 4WOQA 3W23A 3USBA 2BXVA 3HGOA 1XDMA 4NZJA 4HKPA 4RKAA 2J24A 2WSYA 1L6WA 2WPBA 4MIMA 1ZAHA 1FQ0A 2Z6JA 5IBXC 3P61A 3W7JA 5F4XA 1UUOA 2DJLA 4FNPA 2TYSA 5CZ0A 8TIMA 1K7XA 3ABQA 2V5BA 2QCHA 3N9RA 1WV2A 2X30A 2ZRWA 4AMAA 1QOPA 4WOZA 1O5KA 1NSJA 2RDWA 2VENA 1H50A 3MI3A 1UASA 1KM6A 3TAKA 3W6YA 4IPIA 1T8XA 1LRQA 2NX1A 3DENA 5EBUA 4O12A 4FX8A 4UNKA 2HSAA 1ADOA 1H7OA 3P8JA 2BZNA 3FJLA 1OFDA 4AAJA 1OFRA 2A1YA 2A6NA 5DXYA 1Q6LA 3KFTA 3O15A 4TX9A 1H60A 1PS9A 2WQPA 1OFQA 2CFFA 5D30A 4Z0JA 1OX5A 3HGRA 2J9YA 3M0ZA 3UY8A 3QRHA 2H3BA 2TRSA 2NUYA 2RDTA 1J2WA 2G97A 4UFMA 2YR1A 1F74A 4TU1A 4XBSA 3CPRA 1EUAA 2DZWA 3QQ1A 4LV9A 1YTDA 4FXRA 3TIMA 2CLHA 3HG3A 3DKJA 2YFNA 3L2IA 2CZEA 2ZTKA 1IXOA 3W1RA 2H8XA 2YX0A 3O06A 3IRDA 3UXAA 5DY2A 4JDBA 1DV7A 4Y9AA 5EMUA 1C8VA 4MKNA 4A2RA 1FWTA 1VQTA 1SW7A 2E77A 5FF7A 4KKXA 3PSVA 5D2XA 1TRIA 3KRZA 6TIMA 4RZ4A 3HJZA 1XXXA 2QEZA 2YYTA 4IX2A 2RH9A 4UTJA 4M6VA 1GPWA 2CWNA 3TC6A 5HWNA 3W2KA 3D0CA 1EIXA 4WD0A 2E6YA 2VKZG 3O16A 1PHWA 3W7GA 1LDCA 4JTSA 1EA0A 2W0UA 6ALDA 2WJZA 4I7VA 3IVTA 2DZSA 3HPSA 1GYLA 4NJGA 1FCQA 5DCEA 3RFAA 1TPFA 1NAL1 4N9DA 5L6UA 5F4WA 3W1UA 2GPTA 3MI2A 3FKKA 2NV2A 3GVGA 3A21A 4JS3A 3W2MA 3KVKA 1GTHA 1JCYA 3MP5A 4HT3A 4UXDA 5EKYA 1LYXA 1ME8A 2OT0A 2X2GA 1JR1A 1OFPA 3A23A 1F76A 1ZNNA 3CWOX 2VOMA 3IIOA 1MSSA 3S6DA 3MHFA 3OIXA 4DXVA 1PVNA 1TJRA 2PRHA 4IMCA 1LP6A 4FIRA 3RNDA 2V30A 4RXFA 4MY8A 3MHGA 5E0KA 1PHQA 4QNEA 4C1KA 4K7YA 5SWUA 4LWWA 5EYWA 4E2BA 3QMTA 4K6AA 3H53A 3EX3A 4WXZA 4QAIA 4PODA 4RX0A 3PBYA 1PCKA 1W5PA 2Q8ZA 3A24A 2J6XA 1VHNA 3G1YA 5D32A 1WA3A 4J9JA 4HIBA 2DZUA 3UZ5A 1B9BA 2OCZA 4AB4A 1LCOA 1RV8A 3GXTA 4WY0F 1A5BA 4HPJA 1SFJA 4MYAA 1SO4A 3STGA 1JCLA 4ADSA 3W85A 1E51A 5BMWA 3W7PA 2ZDRA 4JYEA 3WK3A 2FQIA 1RR2A 1R2RA 1F5ZA 4A29A 3TQ0A 3EX4A 1V7YA 7TIMA 3FS2A 1TTPA 3P60A 3NEVA 3R8RA 3QF0A 1YADA 4Q33A 1LLZA 3CLMA 3EXRA 1EP2A 3G18A 3L0KA 4ML9A 3FYPA 2BWGA 1ICSA 1AMKA 3NL6A 3W3OA 1D3GA 3GNNA 1JUEA 1ZHAA 3W7KA 2G5WA 4JTFA 1SU5A 3T44A 2NUXA 5IM51 1DQXA 1Z42A 1MZHA 3RU6A 2YPIA 3W2NA 2NX3A 2VFDA 3R12A 1PV8A 1SSDA 3W2UA 4UTWC 1P5BA 2C6QA 5G5IA 2Y61A 1TPVA 2H8ZA 3QC3A 4CNNA 3BV4A 3ANYA 4LC6A 2J9XA 4LOCA 5DN1A 1QOQA 1RZMA 1JJKA 3GXNA 3F1QA 4LS1A 1O4UA 1UCWA 3G3MA 1QAPA 1BEUA 2QDGA 5G2IA 3UY7A 3BG3A 1EWEA 1LTDA 1IGSA 3W1TA 3PWAA 1CI1A 4QQ3A 4PCFA 2I14A 2B7NA 4O8RA 5KZDA 4IMGA 1OFBA 2DP3A 1IXNA 3GK0A 3ATZA 4ORMA 3S0CA 1NEYA 1X1ZA 4MZ1A 1TV8A 2QCDA 4UR8A 4JX6A 5CZSA 4XKYA 2BLEA 3NOEA 4N6EA 5HWMA 1PL9A 3RLUA 1DHPA 5CGQA 2Z1BA 1F2JA 4NJIA 5FF3A 1W8SA 1K02A 3L0GA 4X9SA 5DBUA 3NVTA 5FEXA 3DI1A 1C9DA 5FF4A 1W0MA 1YXCA 3DBPA 1G4TA 2H6RA 1GG1A 3RK8A 3THQA 2V2CA 3NGJA 1WDWA 2E6FA 3VI2A 3TA6A 4O1BA 4I7WA 3G1XA 5F2GA 2E5CA 3WK0A 2GOUA 1GVSA 4XTDA 1DBTA 1G4SA 5D33A 4CNPA 4AHQA 1ONRA 1O95A 1G67A 3GAYA 5LNWA 1W54A 3TH6A 3L65A 5F2MA 1TQJA 2V8ZA 4G1KA 4LNYA 4NJKA 3C2EA 3OVQA 1FDZA 2WOQA 3NQ8A 3WJSA 1TPDA 4DPPA 3HG4A 2QCEA 2ZRYA 1L6YA 1EWDA 1W3TA 5LNUA 1FUYA 2CLEA 2J9ZA 2A6LA 5F1VA 1H7RA 2C13A 3PUDA 1VJIA 2C3ZA 4FB7A 3P67A 3M6YA 1X1OA 4FNTA 1RPXA 3W7CA 3LX9A 4O1AA 2B7OA 4Z1BA 4OV4A 3R89A 1I2PA 5MHBA 1KW1A 4WUIA 3ABRA 3KX6A 2JGQA 2GVGA 2ABAA 1SSGA 3UWQA 1GVRA 3P80A 1DVJA 4ORIA 5AYXA 3NA8A 1ZCOA 3R2GA 3LCWA 1ZENA 4MLRA 1QPRA 3VNDA 4A22A 1F6KA 4CQAA 2YYUA 2FPVA 1O94A 3PAJA 1GQNA 1O5XA 2HTMA 3W87A 5AHFA 4ALDA 2ZFAA 2TPSA 1DORA 3FA5A 4QISA 1IIHA 3T78A 4O1CA 3MYPA 4X2RA 2VFIA 1U5JA 4I7UA 3QYQA 4L4LA 3WJYA 3BK0A 2QUUA 2Y6ZA 3PF3A 5D2TA 4LUJA 3P84A 1OG0A 4UIOA 5C6MA 2ZZ2A 1MEIA 3PBWA 3A9IA 3SECA 3CIXA 3TJXA 1QFEA 2FJKA 3IVUA 2ZYFA 2P1FA 1QO2A 4CQ9A 5AN7A 3BO9A 2QCGA 4YL2A 5U7SA 3W2JA 1KM5A 4K7VA 2V5LA 1U83A 4JICA 3NYZA 3I7SA 3O6CA 3S1UA 4JX4A 1WOAA 2JBMA 3G0XA 3CU2A 3NQGA 2WNZA 1OX4B 4AF0B 3SZ8A 1XL9A 3C2OA 3E0IA 3NQEA 3W72A 1WQ5A 4QSHA 5AYYA 1J4EA 1UB3A 3KVJA 4JDYA 4FIQA 4JNMA 2G96A 2B7QA 3G24A 2HS6A 3HPZA 3EX1A 1KBJA 2BX7A 5AHMA 3CC1A 5LSMA 3GIYA 1KFCA 2RDUA 3N2XA 2A5HA 4FHAA 2YFOA 5EL1A 1DOSA 5HUPA 4S2BA 3OVPA 1UUMA 3BGJA 1HG3A 3AJXA 2NZLA 4HHPA 4KFNA 3QW3A 3G1DA 4UFJA 3E9AA 4GUHA 4OQVA 4CCDA 3W7LA 3B05A 3LRMA 3P5YA 1VLWA 4UTKA 1G7UA 3G0SA 1G69A 1FXQA 1JCXA 1VPXA 3G1FA 3EWXA 3NQVA 5AC7A 5D38A 1JUKA 4PTNA 3W7EA 1I2QA 4N4PA 1QR7A 2CU0A 4IQLA 3HO8A 2XN2A 1WX0A 3NPUA 4UTIA 1YTKA 2E6AA 2EAWA 2Q3RA 1QWGA 3LHZA 4O0KA 1VYSX 2CW6A 1B57A 3WJXA 4TIMA 1D3HA 3LLDA 1F7BA 1H61A 3T4CA 1H7XA 4JX5A 3STFA 2GJLA 5AFDA 4PL2A 3CEUA 1OHLA 4ICNA 2WSQA 2NV1A 3VE9A 3B06A 3T7VA 2QCCA 2EF9A 4GE8A 3PR2A 4UCGA 4GBUA 4LY8A 5AHNA 5AOUA 1JCNA 2QCFA 3DGRA 5HINA 1H7NA 2DU2A 3W1AA 2ZQ0A 5HWJA 3A5FA 1XKYA 1A50A 3SJ3A 3W88A 3E96A 1IF2A 2F7FA 2RHGA 1SR9A 1KM3A 4UMAA 2QDHA 3M44A 2DZPA 3BVJA 2ABBA 4NQ1A 4ADUA 2TMDA 3OVRA 4M7SA 3FLUA 1R47A 1FBAA 4JTHA 4NZFA 3LTYA 1M7PA 3S1WA 2B7PA 5CZJA 1I2RA 3L5MA 4JTTA 5HUOA 4K37A 2X1UA 3MI6A 4JY8A 2ZZ3A 1TPH1 4NNCA 2BSLA 4AWTA 3WK2A 3TKFA 3PUEA 2RFGA 1JRCA 2CZDA 2GQ9A 4FF7A 3HG2A 3QJAA 2Q3OA 4ADTA 2A7NA 2ZA2A 1H7PA 2NXGA 1TPWA 3E12A 5CPOA 3UWVA 3OBKA 3TW7A 1XBYA 1K8XA 1B3OA 3CM4A 4RCXA 1S5WA 4ZMGA 4RLIA 3M5ZA 5D2WA 1KV8A 3QQ0A 1XFBA 3VFLA 3W7DA 3PC0A 1AL8A 4BR1A 2YXGA 1FCUA 1OF8A 4GUJA 4PH6A 1Z44A 4XTIA 5F1UA 4JXCA 1H5YA 5HR7A 1Z41A 2ATMA 2X16A 1IXPA 2QF7A 4OV9A 4Y90A 2EGZA 4H3DA 1EPXA 5J5DA 3N9SA 4Q32A 3GAKA 4LT9A 5EA9A 3I6RA 4HSOA 3GNDA 2ZRZA 3KVLA 2Z0IA 1HUVA 3LI1A 3W7RA 4EIVA 3N34A 1T0OA 4K8HA 3CEPA 2VXNA 3LRLA 3WK1A 3C4UA 3DFOA 2ZZ6A 4D2JA 4A3UA 1FWWA 3MMTA 1LOSA 3TQVA 1H1ZA 3VCRA 3OHIA 2B0MA 3UWUA 3N73A 4E0CA 4CQ8A 4LW7A 1K8ZA 3E49A 3EWUA 2VEMA 4Y8FA 5D04C 3PB2A 2JK2A 3W7NA 3O6YX 3HPXA 3P5ZA 4K8EA 3GLCA 3LBMA 1OYCA 2CZ5A 1K3UA 4IJBA 3PB0A 3DHFA 2QUTA 5KMYA 3BLIA 1NFBA 5DXXA 2E68A 2QJGA 3MBDA 1CX9A 2W79A 4JTUA 3BPWA 3L5LA 1LBLA 5D2YA 2FB3A 2BTMA 1QNVA 2QUVA 1GJPA 1YDVA 4XUGA 2FFCA 1MXSA 5K2ZA 3KOFA 4GWEA 4H6KA 2GQ8A 3SW6A 4DBDA 3NPVA 2X1SA 1LLWA 4QJ1A 1KM1A 3GR8A 3LHVA 5I3FA 1BWKA 3UWZA 2ZTJA 3P8IA 4AXKA 5DY3A 4DO6A 4ZQCA 1S5VA 3S5OA 1G7VA 4Z1AA 3G8RA 5K4ZA 5K4XA 5HR6A 4JYDA 1I45A 3M5YA 1JQXA 4YXGA 3TR2A 3TMQA 3W70A 3V75A 5D09A 4M5PA 1KA9F 1I8JA 3TW6A 5I3GA 2GVLA 4UFKA 4FNUA 5DLCA 3VKJA 1H62A 3JR2A 4DPQA 1LBMA 5G2WA 1RD5A 4Z0SA 4GUIA 3EX6A 4JTIA 5A5WA 5C5YA 5KSWA 5LZLA 2EHHA 3LCLA 1KFJA 1Q6RA 4IUOA 3W1QA 5CPMA 1TJPA 4CLMA 5G1YA 1SW3A 4UR7A 3NQ6A 4MZ8A 1DL3A 3TFXA 1Z48A 4WY0A 3G22A 1SZFA 2C14A 3G1AA 1JCMP 3IIXA 5AC8A 3G3DA 1TMHA 3LCHA 3STEA 5G4EA 5A8GA 2FTPA 3LHUA 4FNSA 3S8HA 2YDAA 4U4MA 1ZAJA 3M5XA 3TXVA 5BMXA 1Q3NA 4GFSA 4DF0A 4IMFA 1AK5A 1JUBA 4UTTA 5DCBA 1S5TA 3LCXA 3HF3A 1OYAA 3FFSA 1W5QA 3LCGA 1WBJA 5G2HA 4JR5A 1KTCA 1ZALA 5G1TA 5LHEA 2OT1A 5KTLA 2FIQA 5C54A 2J27A 3EWBX 4AVFA 1GWJA 1DKWA 3QH2A 1DJNA 3ELFA 3HIJA 1TPUA 4R34A 3LRKA 4IMEA 5HNRA 2YGYA 3FJ6A 3HGJA 1N7KA 2ZZ7A 3TUUA 1GVOA 1TB3A 1KBIA 1X6UA 3H55A 1VLIA 4TMBA 4Q4KA 2PURA 3L9CA 2HS8A 3E02A 2AQWA 4IX0A 3H54A 3VE7A 1GT8A 3Q58A 2C18A 1AW2A 2E1DA 3C52A 2JGYA 1LRTA 3IVSA 4O0ZA 5AYZA 3B0VC 3ZS4A 4A21A 3NXFA 1D9EA 1O60A 3PS7A 1MEWA 4KFOA 4AH7A 3INPA 3W74A 4LVBA 3TX9A 3R5EA 4R33A 1MO0A 3W7IA 2VC6A 4HNUA 1LRNA 2Y7EA 1W3NA 4FEZA 4YWIA 3UD6A 5L9FA 1IIGA 2NLIA 1NF0A 3MHUA 1H63A 2NX9A 4BWLA 3S5NA 3S5ZA 3U8GA 2P10A 4O28A 2QCNA 4LU0A 1GTEA 1EX5A 1KLYA 2Y62A 2H3DA 1X8FA 5KINA 3ZFHA 3NQAA 3EKZA 4RZ5A 4LTSA 4KFPA 3N2MA 2I9EA 1TCDA 3I7QA 1G6CA 3CIWA 1VH7A 5D05A 2QJHA 3TJLA 3SR7A 3TFCA 4Y96A 1KM2A 1SZGA 1I4NA 5AHIA 4JTKA 2E5DA 5KZEA 5EPDA 3KHJA 2V2DA 2GVJA 3NQCA 3LB0A 3TQKA 4O13A 3ABSA 3O05A 3W1MA 3HB9A 4ZQRA 3KAOA 1P1XA 3DAQA 1PE1A 1W1ZA 4O4VA 2Z6IA 3EWYA 5HMSA 1YPFA 4IMDA 4TMCA 2DZVA 3G1VA 3W9ZA 1VS1A 2I1OA 4N9CA 4MJZA 3CT7A 1TV5A 1JCJA 4O18A 4E2DA 5F2IA 1YYAA 3R13A 2PCQA 5K7JA 4UFIA 3GKFA 1XBXA 2F84A 3IGSA 4UMBA 4LRTA 1XUZA 2LLEA 3MP4A 4PC8A 4S2CA 3BW3A 1KM0A 3OG3A 3ZWSA 3IGUA 4LC8A 3I65A 3PSWA 1DJQA 4K38A 3TU9A 2B4GA 1YDOA 1M6JA 5TIMA 3W7HA 2Y7DA 4EOUA 4GXMA 1VCFA 1VCGA 5DELA 2QCDB 3GDTA 2NXIA 3NQDA 4XKYB 1QPQA 3M47A 4Z1CA 1P0KA 2VFFA 2P0OA 3TNOA 4MY1A 5HQEA 4NJJA 1TPC1 3O07A 3UYCA 4IPJA 3NQFA 3GXPA 1I2NA 3MWAA 4UNLA 4MOZA 2VEIA 1KFBA 3O63A 3FIGA 1JULA 3W86A 1YXYA 5DBTA 1SZEA 3LXCA 1FCBA 5LGZA 5I3JA 3CHVA 3TXZA 4A2SA 3UWYA 4UTMA 3DKLA 4HSNA 3EEGA 1FDYA 2O7SA 2A4AA 4RXGA 3TK7A 4AWSA 1HL2A 1EEPA 2O7QA 2VFEA 1LROA 5LKYA 3DFPA 1A53A 1YDNA 1OVDA 4MZYA 1W5MA 4M6QA 4BFAA 4OU1A 2CLLA 2XN0A 1W31A 4ZQNA 2YSWA 4UUIA 3DHDA 4N2YA 3QSTA 2R8WA 4JY9A 1LBFA 1TQXA 1VR6A 4B5NA 4O1DA 1LOQA 1I2OA 1FWSA 3L67A 4Z1DA 2D73A 4N9EA 3WJWA 3GX9A 4W9TA 4O50A 2A0NA 3RLVA 1BKSA 2VEPA 2R14A 2E5BA 3CWNA 1K03A 5E1QA 3G0UA 4BI6A 1H7WA 2ZCGA 4LVGA 3S9YA 2E09A 1ML1A 2OX1A 2QCLA 3SI9A 3C2VA 4LV4A 3LDVA 3BW2A 4CNOA 2CLKA 4PA8A 3IEBA 4ZZ9A 1TSIA 1K7EA 1TIMA 2ATSA 5H2ZA 3KXQA 3N3MA 3SGZA 2PE4A 1VRDA 1OFAA 1N55A 4TR9A 1SZNA 2IQTA 3WJZA 4MFDA 2FDSA 1TPB1 1FCVA 1KFKA 4DEFA 2Z2UA 1OFOA 2ZA1A 1SO6A 2ALDA 4UTUA 4UFHA 3G1HA 1LOLA 2CLMA 4EF8A 1VYRA 2YW4A 4M19A 4O15A 3ZWTA 3DFSA 4O19A 4ZQOA 2FB2A 2CZFA 1JRBA 4P61A 2VEKA 4HN4A 2Y70A 1HTIA 5H91A 5HULA 3LHTA 3C8FA 3NG3A 4POCA 2YW3A 1YLVA 4O14A 2Y63A 3GKAA 4XWUA 4RK8A 4FXSA 2NWRA 2JKAA 5I3HA 3UPWA 3L66A 3QSRA 4GRSA 3EKLA 1AG1O 3MUXA 4UTTC 1W5NA 1CW2A 1T99A 2VFHA 5LHFA 4YMZA 4BF9A 1LORA 3B03A 3GDKA 1LM1A 5AC6A 1GZGA 2OJPA 3NQ2A 4UTLA 4YCOA 5LGXA 1KFLA 5FI8A 4IXXA 2QAFA 3KVMA 3O8AA 4RR4A 3M43A 4AWUA 3UWWA 5G4WA 3NL5A 4X3ZA 3W7QA 5FEPA 3RF9A 4LS0A 4JTLA 2ZRUA 4DBEA 3B0PA 2A7RA 1XC4A 4GNJA 3NM1A 2C16A 2VELA 3NDOA 1G4PA 4NT0A 1VGAA 1ZJIA 2A2IA 3T40A 4CCCA 4XZ9A 5AHEA 1Q6QA 2DZTA 3NZ1A 2CLIA 3PUOA 5CPLA 4IOTA 3DZ1A 5GVJA 3SIZA 2ZRVA 4N4QA 4O17A 5C55A 3W1LA 2DORA 1ICPA 5TBOA 1DQWA 3W83A 3HMJG 5U4NA 1V5XA 4MJMA 4YLWA 5J5RA 4L4MA 1XCFA 3B4UA 3W75A 4RZ6A 1N8FA 4UFLA 3HGSA 1XDLA 1TREA 1ME7A 3BLEA 4ZQMA 3IIPA 4BWLC 3F03K 3W07A 3NQMA 1QMLA 1G4EA 2ISWA 1Q6OA 3NPXA 1KFEA 5FEWA 3W1NA 3Q94A 3TSBA 4EF9A 1EP3A 4LUIA 3IV3A 2W6RA 4O10A 5LNSA 1FY6A 1GVQA 3EXSA 4P2VA 1UJPA 4UTHA 4BK9A 1FX6A 4IGHA 3TSMA 1ZFJA 3QM3A 3S1XA 3PY2A 4LVAA 3MBFA 4JIQA 1QO5A 1SUXA 5D03A 3I68A 2E6DA 1F05A 4DQWA 3NPWA 2JKPA 3WFAA 1GYNA 3HOJA 4R7JA 5AB3A 5LNRA 3LV6A 3I7RA 1UBSA 4NNBA 1W37A 1BWLA 1EUNA 4ZL1A 3T55A 2G95A 3HBLA 1KLZA 3DH7A 2Y85A 2FLIA 3TCEA 5LNVA 3QFEA 3ATYA 3HQ1A 5EY5A 2NXHA 4GC4A 4BI7A 1R30A 3W73A 3G8EA 3S1VA 3P62A 3LBCA 3M9YA 3B04A 2ZZ5A 5BW6A 1L9WA 1TTQA 5TQLA 2H90A 1OJXA 1HFBA 2WO5A 2ISVA 2HMCA 3JRKA 3NR0A 2CLOA 2GJNA 2WKJA 1FWRA 2XFWA 1WXJA 4BI5A 1QCWA 3F4WA 2PRMA 4OWGA 1THFD 3EXTA 4LVDA 4OGZA 2V2HA 3M16A 3GDLA 4WJEA 1RQHA 2QR6A 4U28A 3UZJA 2J88A 2NWSA 4NJHA 3BG9A 3C61A 1TTJA 1ICQA 1SO5A 4C1LA 3UQNA 3IGXA 2X1RA 1YPIA 3EWZA 1EP1A 3FYOA 1VCVA 3MP3A 3QPYA 1L6SA 4YCPA 4KWVA 3W7MA 5IBXA 2V81A 3LI0A 4MY9A 1ZAIA 1SW0A 4DO4A 1R2SA 2RKXA 4JN6A 4I9AA 2Q8LA 3SSJA 3PG8A 2UV8G 1KTNA 4EVZA 1ME9A 2WSRA 4TO8A 2ZRXA 1VHCA 1XM3A 4HNNA 5BNKA 2DZXA 4IXHA 3SY5A 5F4SA 1WAUA 3LGEA 4JTGA 4FNQA 3PULA 2FPTA 4NVTA 4PFMA 5CG7A 1KTBA 2V0TA 3LM7A 4JTEA 2C19A 3SGUA 3IIVA 4FNRA 3CB8A 1H51A 5D2VA 3PG9A 3S42A 1QPNA 4UC5A 4O52A 4CCEA 1FWNA 3EWWA 1OK6A 3C2FA 5FEZA 3P82A 1J5TA 4M7TA 1FXPA 3BLFA 4FX6M 1XBZA 3TC7A 3PBUA 3QPZA 4NXKA 3KRSA 3LHWA 1KV5A 4JD4A 5BOOA 2WV8A 2ZZ1A 4K36A 4K39A 1RQBA 3GR7A 1PIIA 3SFKA 3IIZA 1T96A 4NUWA 1EB3A 2PC4A 2C0AA 3EX2A 1KM4A 3BG5A 4LVFA 4JEQA 1A5SA 3LCFA 3QMSA 4AEOA 4JGDA 3TSDA 5BRBA 4DELA 3ABOA 1H1YA 2QCMA 3LXAA 3DFQA 1OYBA 3L5AA 3UPBA 4GJ1A 1F6PA 2QKFA 3LXBA 4JYFA 4O57A 4GUGA 2QJIA 3W2LA 3KRUA 1AW5A 4O53A 3DU0A 1GG0A 4HNTA 2Y7GA 1K7FA 1W5OA 2A85A 3TROA 3STCA 2JKEA 3OEXA 1R2TA 4WY0B 4DO5A 3W76A 4R53A 3DFNA 1OX4A 4AF0A 4Y6GA 1TRDA 3W1XA 1OABA 3W22A 5KITA 1OK4A 1GVFA 1R46A 3HG5A 1VZWA 4AHPA 4O16A 3TV8A 4ZQPA 1Q45A 5E93A 5HJLA 5T26A 3THAA 2C1HA 1XUUA 3QMRA 5FESA 1F73A 4WXYA 4LRSA 1WOBA 5I3KA 5FF0A 2QAPA 1TPEA 4NX5A 3MW7A 1TTIA 3PM6A 3N19B 1HO4A 3BW4A 1YXDA 2CLFA 1QPOA 3DFTA 4N02A 5AHLA 2A21A 4JIPA 1RQEA 5CSRA 3QEZA 2R91A 4EWND 4O4WA 1IXQA 1ZY9A 4RJEA 3NO5A 4N9BA 3C2RA 2DJXA 3CQ0A 4Z08A 5F2LA 1OX6A 2ZZ4A 3W7OA 4WX2A 3GB6A 1S3HA 2Y7FA 1C29A 2YCEA 2EKCA 2R94A 1OF6A 1L2UA 4OHQA 3UNDA 3LTSA 4MVAA 1XI3A 3FEMA 4MPQA 3S5YA 1M5WA 3M41A 4E38A 3F4NA 2XN1A 1GOXA 3TMLA 3GYEA 3GDMA 1RVGA 1MEHA 3TE9A 1LZOA 2Y88A 3V1PA 3W71A 1VC4A 5I3IA 2GQAA 4KWWA 3P81A 3TDFA 4WZHA 4WQ6A 4QITA 3NNTA 2EPHA 1SPQA 4MYXA 4DF1A 3PVFA 3GZ3A 4MFEA 5CSSA 5KZMA 3W1PA 2NUWA 5K9DA 1TV7A 4AHOA 3LCIA 1TO3A 3O6DA 4NU7A 1B4KA 3NM3A 4HNVA 3C0JA 3A5VA 3MJYA 4X22A 3AO0A 4NXSA 2KZHA 2X1TA 1SFLA 4XBKA 3GDRA 2V82A 2V9DA 3DI0A 3QZEA 3LERA 1FDJA 1B4EA 1AW1A 2FPYA 4H4IA 1WBHA 3LV5A 1P0NA 3M5VA 5CZTA 1OFEA 4QIUA 4HPXA 1NF7A 3DXIA 3OA3A 3P7YA 3RMJA 3EB2A 4UMCA 3YPIA 1A5CA 1QDSA 3FKRA 1SO3A 2YZRA 3W84A 5D37A 3B0UX 2AAMA 3ZR4A 4UTWA 3NL2A 3M1ZA 5CKSA 2OMAA 4QNWA 1ALDA 1XBVA 4FX7A 4QM1A 3NZRA 1BTMA 1PCWA
chains in the Genus database with same CATH superfamily
4S1FA 2GUUA 3PZVA 3N12A 4FZIA 4Q8MA 4I9TA 2PLKA 1M41A 3FOKA 4XQ6A 2J25A 1K8YA 3A3WA 3Q37A 1BYCA 1KR1A 4FLOA 2HV5A 4HMDA 3CV1A 1CXKA 3AICA 3GIQA 3LOTA 4PCNA 2TSYA 4IICA 2YL5A 1WDSA 3TYUA 2HWGA 2A7PA 1WYIA 4DRSA 3TAOA 2NLYA 2CBUA 2VX4A 4RNJA 1JQVA 3Q2DA 4M6PA 2OOGA 5D02A 1KRBC 2HVMA 1GVYA 1DEDA 3B97A 5JBFA 2CHOA 1F61A 2X40A 3L68A 2C0HA 1NVMA 3UXDA 4G2DA 1DIDA 5FF2A 1OCNA 3B8DA 3OO2A 3AHXA 4MUZA 1XLBA 2ZA3A 3QW4B 1US2A 4YYFA 1H49A 3GIPA 3M0IA 3DN5A 4RV8A 4I5UA 4HA4A 4OT7A 1SZRA 3NDZA 1E9LA 3KRBA 4NZJA 2QIIA 4GYPA 4EPBC 2J7DA 2O9TA 2J24A 3SCTA 1EKOA 4MIMA 3NSNA 4D72A 2Z6JA 4ZGYA 4CKQA 3WDQA 5I77A 2ZVRA 1UUOA 3QKEA 4DUWA 1OCQA 1O12A 1JEZA 2C91A 1BF6A 1GHSA 3PJXA 4YHGA 5MKGB 1NSJA 2VENA 3UJFA 1UASA 2WJFA 3WUGA 3SN0A 4L1GA 4HHMA 4HYVA 1WKEA 3DENA 1DE5A 4FX8A 3ZMRA 3ITTA 1LUCB 5XIAA 3P8JA 3NQBA 1XWYA 1OBAA 3MO4A 5C9XA 1W17A 3GG0A 4MTVA 1EJVC 2W27A 2WQPA 2V67A 2RUSA 2CFFA 5D30A 4UOQA 2H3BA 4ROPA 1US0A 1A47A 1R85A 2TRSA 2Z1XA 1HVXA 3EMQA 4IG2B 1NY1A 4U33A 2YR1A 3H23A 3N2TA 3CPRA 1EUAA 4LV9A 3TIMA 4LUSA 3HG3A 3RJYA 3SURA 3KBSA 1PEZA 2YFNA 4W4QA 7PTDA 1IXOA 3K8MA 4US5D 3W1RA 3AALA 3PP7A 2VGFA 4Y9AA 2BODX 4MKNA 4A2RA 1VQTA 2PZNA 2E77A 4KKXA 1CENA 3KRZA 6TIMA 4WHBA 1QBAA 2GQ3A 2YYTA 4UTJA 3MCMA 1GPWA 2YOCA 3TC6A 1WKFA 4QS5A 1V79A 2BOGX 3D0CA 4WD0A 2E6YA 2VKZG 1MXDA 3KS6A 2ZVIA 1PHWA 4ZSTA 1YE6A 2H9AA 3IVTA 4QDWA 1QK2A 5C2GA 4NJGA 1UWRA 1DP0A 4OIFA 4TXEA 1E43A 3KVKA 1GTHA 1H0IA 4F0SA 4PMQA 4UXDA 1ZBVA 3AMLA 4GISA 2YIHA 2ZUUA 1F76A 2WWDA 1GQKA 2Q09A 1ONWA 4QDPA 1NWTA 1C91A 3OLGA 2X2YA 1PVNA 3FN9A 4IMCA 4MNKA 3RNDA 3GC4A 2WAGA 2V30A 1IWBA 4P8WA 4RXFA 4MY8A 1BAGA 4LAKA 4WK9A 1MW1A 3CZJA 1PHQA 3VKCA 4K7YA 4L5ZA 1ZBWA 7CGTA 3VABA 2Y24A 4IMAA 3ARTA 1UC5A 4WXZA 2R82A 1MRQA 3PBYA 1PCKA 3RX2A 1E0VA 1VHNA 3G1YA 4J9JA 2ISDA 2DZUA 1BTCA 3EA3A 4WEVX 1LCOA 4WY0F 1V6YA 3STGA 4XZBA 3HPAA 4ADSA 3W85A 1E51A 3UXLA 1XIIA 2ZDRA 3VIFA 3W7PA 1EOMA 3WK3A 4QLJA 1LG2A 2FQIA 1RR2A 1SVDA 3H2EA 3SCWA 2DH2A 4A29A 1XLEA 5ABHA 1TTPA 1TJ0A 5M5DA 2PDFA 5A8MA 3LA4A 4MWAE 2VMFA 1G01A 3FYPA 3PJTA 2BWGA 1NWUA 3NL6A 3R6IA 5E9AA 3W25A 1B3XA 1Q4NX 1SU5A 1DJIA 1OC7A 1WXYA 3BMWA 5IM51 3QZAA 1MZHA 1EQPA 3NSXA 2NX3A 3A4WA 3THCA 3R12A 3QYSA 3WF0A 1W9XA 1SSDA 1P5BA 3N2BA 3WNMA 4EE9A 3WMCA 1M03A 4LOCA 1RZMA 3GXNA 3HQOA 1QAPA 1BEUA 2QDGA 5G2IA 3QHNA 4O8RA 5KZDA 1OFBA 3OW1A 1S1RA 3VIOA 5A6AA 4N7QA 4ACZB 1NEYA 4NRRA 2QCDA 3UG8A 2PDHA 4JX6A 4V15A 5HWMA 3ARVA 3AIUA 4M81A 5CPTA 3TOYA 1F2JA 2VYOA 4NJIA 4Y9NA 1TELA 1XV8A 4J3SA 2ACSA 4X9YA 1C9DA 3M07A 3P2VA 4D8AA 3M6DA 3SEPA 1GG1A 4D6CA 3IV8A 4AWEA 3VD4A 1Q7ZA 3CL6A 5FJJA 4O1BA 3K4WA 3OGVA 3S9ZA 3OQEA 5BRPA 5I3DA 3A4AA 4XTDA 1GZ1A 5D33A 4CNPA 4FR6A 1G67A 1DIEA 5LNWA 2WK2A 1FA2A 2V8ZA 4AIUA 2HEJA 4E5TA 4G1KA 1CB7B 4BKNA 3LMZA 2OG9A 3BZGA 1FDZA 1HJSA 4ZXLA 4MJ2A 1B3ZA 4EPEC 4DPPA 2B31A 3SGGA 1W3KA 4PN2A 1EWDA 2V68A 4YN5A 4RPQA 4C6OA 2X0HA 1CXLA 3PUDA 1UD2A 1Q85A 4GLEA 4O1AA 1NJJA 1HJWA 3M46A 3NOYA 3R89A 1I2PA 3SUSA 3NO3A 1W1PA 3BAKA 2RAGA 4V27A 2FVLA 3P80A 2WMFA 3BLDA 1KNWA 1L6FA 4MLRA 5A2BA 4KEVA 1O94A 4GH1A 6CGTA 2HTMA 2ZFAA 3WIJA 3VMPA 1DORA 3FA5A 2WVUA 1W1IE 4X2RA 2XSBA 4I7UA 1V02E 4O8AA 4LCQA 1YHTA 2XVNA 1E4LA 1JD9A 2QUUA 1E9ZB 3VD9A 3PF3A 5D2TA 4LUJA 3P84A 1OG0A 4UIOA 2ZZ2A 3TJXA 2FJKA 3MTWA 4IP7A 3CPGA 1QO2A 5AN7A 2QCGA 2BDQA 2VC7A 1RALA 1F3TA 3FDGA 4GZJA 6REQA 4JICA 3NYZA 5REQB 2JBMA 4MWAC 3CU2A 1GONA 2EO7A 4J3ZA 4QE5A 4P8XA 3OZYA 4LUTA 4WKAA 1WQ5A 1UB3A 3IK4A 4JDYA 2FGZA 5CC7A 2B7QA 3G24A 5FCZA 3GC5A 4GBDA 1QI3A 3F7JA 3SIMA 1PTGA 3OZOA 1M68A 5AHMA 3GIYA 1KFCA 2GSEA 4YTRA 2RDUA 2A5HA 4FHAA 5EL1A 1DOSA 2DY3A 3OVPA 3WF3A 1FFRA 1UUMA 1HG3A 5EFFA 2PI6A 4XD3A 2HXUA 4AISA 4AD2A 3E9AA 4OQVA 4BQ3A 3LRMA 3QN3A 1JCXA 3AS1A 2G0WA 1AD4A 4Y9MA 2FZ8A 3V36A 4FA3A 3NPUA 2XG9A 4UTIA 2EAWA 2WMIA 1C8QA 1QWGA 3LHZA 5DT5A 1XIHA 1GHRA 1XLAA 2Q8XA 3HURA 3LMYA 5HQMA 1UR0A 4PL2A 2Q02A 4MKSA 2WMGA 2V3GA 2NV1A 3BJSA 2QCCA 1DHKA 3PR2A 3E38A 1RY8A 2QCFA 3DGRA 2YDRA 2DU2A 1KKRA 5FL1A 1XKYA 3W0KA 4YHEA 4HN8A 3AMGA 3E96A 3V0UA 3W88A 4G7EB 2W66A 2FTWA 5ECVA 5A8OA 3WDIA 3VDBA 5C0QA 2ABBA 2TMDA 3OVRA 4M7SA 4JTHA 2UWFA 2WANA 3AZSA 4NZFA 2NT0A 3L5MA 2X1UA 4PMZA 3MI6A 1J6PA 2RGMA 4XD5A 3WK2A 1FFQA 3WLMA 3PUEA 3ZT6A 4FF7A 2CHNA 1Y5VA 3AIWA 4ADTA 1W3HA 4IJCA 2E7FA 4UTFA 2NXGA 1TPWA 4FALA 4YVVA 4HK5A 3KZPA 3B8SA 3UWVA 3OBKA 1XBYA 1B3OA 2DT2A 4CU6A 1V93A 1KV8A 3A9BA 4HU0A 1XFBA 3W7DA 1Q6FA 1AL8A 4BR1A 2YXGA 4GYJA 1NU5A 3G77A 1BRLA 4XTIA 4JXCA 4DJED 1XP3A 2IUZA 4OV9A 3ARZA 2EGZA 3BTNA 5JMUA 4TV5A 1YKWA 5A6LA 3N9SA 1NP0A 3GAKA 3WKZA 3GNDA 1XQKA 2PB1A 3BCJA 3KVLA 4ICCX 4A3QA 4DLMA 3LI1A 4JAWA 3GU9A 4IP5A 3KDOA 2VXNA 2V3DA 3UCDA 3LRLA 3WK1A 3DYPA 1I75A 3MMTA 1H1ZA 1MVYA 3VCRA 3OHIA 5E0FA 3UWUA 3H4GA 1Y8BA 4AZGA 2VEMA 4NAFA 3QVQA 3P5ZA 1O66A 4OUIA 2CZ5A 2WJEA 4IJBA 4BY3A 4LUYA 3SCQA 3DHFA 1Z3NA 3CASA 5KMYA 1NFBA 2CETA 5DMLA 1ZJAA 2DEPA 2FB3A 2WM0A 2QUVA 1GJPA 2VT0A 4INFA 4QP0A 4S3DA 2FFCA 4Q4RA 4ZEPA 5K2ZA 2HBVA 1KM1A 4V1YA 1TE1A 3IGHX 3O0FA 1XRTA 3VGBA 3E0FA 3AUOA 3TYZA 2F38A 1S5VA 3M64A 1XYLA 4JYDA 2ZKMX 3TR2A 4KRZA 3AXIA 4KEUA 1ISVA 3W29A 3CJPA 1UR8A 1H62A 3JR2A 4DPQA 3LBOA 1X97A 4JTIA 1KGUA 1Z32X 4L80A 2J7CA 5LZLA 3LCLA 1KFJA 2O9PA 5G1YA 3NQ6A 3WBWA 1EJSC 3G22A 1SZFA 2C14A 4CN1A 1JCMP 3IIXA 1VF8A 1TMHA 3DESA 1TR9A 1O1HA 3A4XA 1PAMA 5A8GA 1V6WA 5BOEA 2YDAA 2WCAA 3CV6A 3M5XA 3TXVA 3OP2A 4WR3A 3AIEA 4IMFA 4NSBA 1HJQA 1S5TA 4UQBA 3A3XA 4JCMA 1OYAA 2DDXA 1OGGA 3RCMA 1W5QA 3LN3A 1WBJA 4XSMA 5GNYA 3GD6A 1VP5A 1KBBA 5C54A 5KTLA 5M03A 2PDJA 3URBA 3QOMA 4AVFA 3APGA 3ELFA 3LRKA 5HNRA 2FHFA 3WQGA 4ROQA 2YGYA 4MDOA 2X7VA 1TWSA 3B3DA 1GVOA 1KBIA 3JZUA 3CL7A 3L9CA 4KQNA 3E02A 2AQWA 5BWFA 3CMGA 1GT8A 3Q58A 1JYNA 1BXNA 2E1DA 2JGYA 3IVSA 5JQ9A 3PTMA 1HGWA 3NXFA 3PS7A 4DUOA 1GKRA 4EPKA 3FA4A 4C1NA 1PBGA 2Z2AA 4QLKA 3INPA 1KRCC 4L1WA 5HOSA 1MO0A 5LIXX 3DHUA 4HNUA 4FEZA 4LBUA 3UD6A 4BEQA 3T2OA 1H3GA 3MHUA 3VNZA 2X09A 4XV0A 2NX9A 1V3HA 3ZVHA 4C5ZA 1JZ8A 1M1BA 1GTEA 2WM1A 2Y62A 4QG9A 4LX4A 5AYBA 3DG3A 3NQAA 1OCBA 4RZ5A 1BVWA 2ZUTA 4KFPA 4XZHA 1RHCA 1GQIA 4E6MA 3UJ2A 4AZCB 5D05A 2XIJA 3VC6A 2VWTA 4E3VA 4LQ1A 5EPDA 3KHJA 2V2DA 2GVJA 4J3TA 3IK2A 3LB0A 4YPJA 3ABSA 1QNSA 4Q6XA 3HB9A 1NFGA 3BZJA 1P1XA 3DAQA 4IGMA 4IIEA 2G3NA 3VNJA 4Q8WA 3V5CA 5I79A 3B8TA 1KBLA 2I1OA 1CGYA 1TV5A 1W2VA 1JCJA 5F2IA 3QZ6A 1YYAA 3TWAA 4DYKA 3VDAA 1F3XA 3HZ3A 4LXFA 3EDEA 3VAVA 3LU2A 3ZJ6A 3R13A 1VFUA 1XF0A 5K7JA 3GKFA 3V5OA 1XDJA 4R27A 2Y1HA 4H9ZA 3MP4A 1GW9A 3MKKA 4S2CA 3WLSA 1KM0A 4GFIA 2VGIA 3IGUA 4LC8A 3I65A 4Z2JA 5HNNA 3GG7A 4F0LA 4EOUA 3NQDA 4P7RA 4ICMA 4MGGA 2ZC8A 1IWPA 3UYCA 3VD3A 1NELA 1V3MA 2YCJA 1J6OA 1PIFA 4NG3A 4M6UA 1UOKA 2HPIA 3MB9A 1JULA 3OB8A 1MMFA 2CITA 1JFHA 3LXCA 1FCBA 1VFFA 5I3JA 3UWYA 1JDAA 4WRHA 1JG9A 3BV7A 4ZA0A 1FDYA 3OJGA 1R7AA 2A4AA 5MKGA 1HL2A 1EEPA 2V38A 3TA9A 4MG4A 1LROA 3DC0A 1POKA 4EX4A 4H9YA 1O5QA 4NRSA 5JH2A 2A3CA 4N2YA 4GIRA 3QSTA 1LUCA 1ZZMA 4JY9A 1EHAA 3UZZA 3PJWA 1MWOA 2OZ8A 2QNEA 2WCGA 3UVAA 1FWSA 4Z1DA 5H6HA 4B2DD 2FZBA 2EPKX 1Q66A 1BKSA 1F3WA 3LQGA 3WZ0E 3GFYA 4LVGA 3S9YA 4IG2A 3T05A 1JPHA 2HZGA 4IQDA 3BW2A 3L2MA 3GVQA 2A3HA 2CLKA 3BJTA 4ZZ9A 1A5KC 1JF6A 1TJ2A 3HN3A 3NUKA 2ATSA 3BSHA 3SCRA 1WZKA 5ENLA 1SMAA 4OOZA 1VRDA 3WJZA 2WC7A 2FDSA 3GH7A 3MY9A 5JIPA 2CHRA 2DVXA 1SO6A 4RZBA 4GVFA 2OELA 3KBWA 4EF8A 5T8GA 2VI0A 5GQBA 3WCZA 1HQTA 2HXTA 4IGNA 4U10A 5HA7A 1J8VA 4IPPA 2P53A 1E6ZA 3PANA 4HN4A 1YE4A 1DWHM 1NIUA 4KH2A 4O1FA 2ISFA 3NG3A 4POCA 3Q65A 3KOXA 2YW3A 1YLVA 4GQGA 2W67A 2R9RA 1EJTC 3PZUA 1XFCA 1B54A 4NKCA 3GXDA 3WLTA 2PDYA 2NWRA 3L66A 3CIVA 4RE0A 4GRSA 1NOWA 4UTTC 3PZQA 3RJXA 2V5DA 3ONCA 4PBGA 1T99A 2GFTA 5XINA 4US6A 3B03A 2XISA 3GDKA 1WPCA 4W88A 4NYYA 1GZGA 2WQDA 1F07A 2PLCA 3DYOA 3NZGA 4UTLA 2BHUA 1RBAA 4ASTA 3KVMA 2OU4A 3F4DA 3PTDA 1CGTA 5G4WA 3U9IA 3LG3A 2Q6ZA 2EPMX 2PWHA 2AL1A 1VFHA 5A8PA 4JTLA 2ZRUA 4J3XA 1J2BA 4A05A 1Y65A 1XC4A 3BLLA 3NM1A 3NDOA 3WSUA 1G4PA 1N8IA 2VQUA 4NT0A 1ZJIA 4L6DA 3SY1A 1MQRA 2FH8A 1Q6QA 5I6SA 3CH0A 3PUOA 1R3RA 4W93A 4GVIA 4BQ2A 3IUHA 5U4NA 2PPGA 4UFLA 2GDUA 1XDLA 1ME7A 1PTDA 4AY1A 3UBPC 1TZ7A 4GG9A 4RE3A 1QMLA 1G4EA 1Q6OA 3S1GA 5FEWA 1ESWA 3TSBA 4EF9A 2J47A 4LUIA 3WH7A 2W6RA 4AD4A 1FY6A 1GVQA 3EWDA 4TVCA 4GKTA 4BK9A 4EP8C 1FX6A 2D2GA 3QM3A 4IIDA 4JKKA 4LVAA 1CXEA 3BL3A 3LQLA 4DQWA 3B8VA 1GYNA 5I00A 3HOJA 5AB3A 5LNRA 1MRAA 4Q4OA 1UBSA 4NNBA 3ZYZA 1VBHA 2G95A 2VX5A 2FLIA 4DJDA 5LNVA 1CGWA 1UW9A 1TWZA 3ATYA 5EY5A 2NXHA 3DUGA 3W73A 3S1VA 3M9YA 1XRVA 2H90A 3E0LA 2P5NA 1OJXA 1KQZA 3G6LA 3OPSA 4HNLA 2ISVA 2HMCA 3JRKA 2CLOA 4M80A 2WKJA 2YL8A 2PUZA 3A4JA 1F4HA 3DERA 4BI5A 1YIXA 4A35A 3UETA 2WB5A 1M01A 2QXWA 4R3UA 4IZGA 3STPA 2DT3A 3GDLA 4B3ZA 2QR6A 4U28A 3NDYA 3ARXA 4NJHA 3VGGA 1ADDA 1TTJA 3HFYA 1YPIA 3GVVA 5ABGA 4C65A 3C8NA 2CPUA 3QPYA 4MB4A 3CUGA 4E4PA 3OIHA 4AY7A 4KWVA 3W7MA 1E6QM 3THDA 5IBXA 2RJHA 2YBTA 2V81A 3LI0A 2DZBA 1ZAIA 3HPFA 3QV6A 1QNQA 2UV8G 3CMJA 1PO9A 5CGTA 2O9RA 2Z2BA 3RM4A 4GZEA 3IJ7A 5GPRA 3SY5A 4GHRA 5F4SA 5C9ZA 4JTGA 3PULA 4NVTA 2VEGA 2V0TA 4JTEA 2C19A 3SGUA 1LWJA 2DQXA 2GGEA 4DN1A 1QPNA 1KKOA 1OK6A 1P7TB 5FEZA 1XD0A 2DIEA 2F2HA 2J13A 3BLFA 2P3ZA 1KV5A 5BOOA 4CD4A 1UR4A 4K36A 1RQBA 3GR7A 4R9OA 3M0VA 2AKMA 2E8ZA 3SUWA 1LT8A 2PC4A 4LCRA 3EX2A 1B90A 2FYMA 4LVFA 4U2ZA 4GKLA 4AEEA 3WLNA 3RX3A 3QMSA 1OB0A 4FAMA 1H1YA 1WCGA 1OYBA 3NVDA 3L5AA 2NW0A 1F6PA 4MADA 4JYFA 2REQB 3QR0A 3O3RA 2QJIA 3KRUA 1AW5A 3DU0A 5IOBA 2G41A 3VINA 3VOFA 1W5OA 5REQA 4DO5A 4R53A 2DV0A 2OXNA 4Y6GA 1OABA 6ENLA 2ACQA 1OK4A 2Y8VA 4ZE5A 2ONEA 4O16A 3UEQA 4ZQPA 4QTGA 1WNOA 2FGLA 2CYGA 4LB4A 5A6TC 2F8QA 1YRRA 1W1VA 2DFAA 2OYKA 3SQLA 4PFHA 4DWSC 7XIMA 1S3TC 2PBGA 2QLYA 4RE4A 1Q65A 4XAPA 4V28A 4DYJA 3LPPA 1QPOA 3B8UA 4N02A 2A21A 4P8UA 6PTDA 2R1KA 1EGZA 5CSRA 5FSEC 1E5JA 4AC7C 1B3VA 1NFPA 4L7ZA 2R1PA 4O4WA 1ZY9A 1KXHA 4RJEA 5H8MA 4N9BA 1X39A 2V6AA 2ZZ4A 4XUYA 2YCEA 1PKMA 5GNZA 3WN6A 1L2UA 3UNDA 3S5YA 3M41A 4H9MA 5HQLA 3TMLA 1GOXA 3IPWA 3V1PA 2Y88A 5I78A 4MB1A 2GQAA 3W26A 1UZHA 1UR3M 3KUMA 2OWXA 4QITA 1VENA 1CTNA 1SPQA 4GXWA 1JFXA 4S3JA 4MFEA 3W1PA 2BNJA 4YVPA 3AMDA 3CUXA 3NCOA 3WD0A 1IT7A 4NU7A 1E0WA 3U5YA 4TVDA 3I3DA 1AH4A 4XAYA 3VGHA 1EYEA 2X1TA 2R1MA 4G7EA 3AI0A 3RLGA 5A6MA 3LERA 1B4EA 2FPYA 4H4IA 3SRHA 1P0NA 2OSWA 3E0VA 1A0CA 2FFIA 4HPXA 1NF7A 3WF2A 4IJRA 2PU1A 3OA3A 2D2OA 3P7YA 2J79A 1A5CA 1UIOA 4Q7BA 3FKRA 3L4UA 3VCNA 3W84A 3CAVA 3MUY1 1Q6CA 3NL2A 3SUVA 3M1ZA 4HCHA 3B40A 4FX7A 4QM1A 5CLTA 1J96A 3HV9A 1Y0EA 1W56A 1FTXA 3BARA 4GABA 2OB3A 1W3IA 3F2DA 3UR8A 4DF2A 3PBVA 3EOLA 2IKJA 3ITCA 4MNJA 4UZSA 2AQVA 4BQ5A 2DUXA 2Y89A 4U5KA 1BXBA 5CPNA 3QV7A 3ZQ9A 1VJZA 4N6FA 1EGVA 3JS3A 4G9PA 3FJ4A 4FPSA 1T41A 3N13A 4A8RA 3C6CA 3L4ZA 5BOFA 4NASA 1W6TA 1VYPX 2J8TA 3CTLA 1JZ2A 3KCLA 3WQWA 3P74A 4OE7A 1UP3A 2O4QA 3BGGA 1JVNA 4O11A 3NQ7A 2I57A 3EDJA 4F79A 4O54A 1P48A 3CTTA 4PTXA 3QLLA 1SQ7A 1TA3B 1DTUA 1MFUA 4EXQA 1PX3A 1US3A 4FR1A 1VIWA 4WOQA 3K4AA 3USBA 2BXVA 4RKAA 3EDKA 2GVEA 4JTCA 2WJDA 1ZAHA 3F4VA 1CEOA 3W7JA 5CPQA 2DJLA 5CZ0A 1XG4A 1K7XA 3FEQA 1LL4A 4KT2A 3ABQA 1WV2A 2BGNE 2PGEA 3QV9A 1O5KA 2RDWA 1H50A 3EA2A 1KM6A 1L8PA 1X7IA 3LK6A 3VIHA 3UG3A 4GY0A 2ZXDA 3W6YA 1IR2A 1LRQA 4JTDA 2Z1SA 3WUBA 1ADOA 3CMFA 4W85A 3M0MA 2VNCA 4PEEA 1Q6LA 3O15A 1UKPA 3VKKA 4LSBA 1PS9A 5IXEA 2YDSA 3AJ7A 2WZIA 1OX5A 2J9YA 1RJPA 3UY8A 2OZTA 1XRFA 3WLIA 4HPHA 2G97A 4UFMA 1F74A 3VU2A 3HA1A 2DZWA 3WO8A 2PDKA 4FXRA 1JZ4A 2CLHA 4PRWA 1CGVA 3M0XA 3DKJA 3SDOA 2ZTKA 3IAPA 4I90A 4RDZA 3CZGA 3O06A 1GYMA 3W37A 3IRDA 2Y0FA 2AMGA 3H2NA 2X1IA 2ON3A 9XIMA 1FWTA 3M7SA 1G5AA 1SW7A 3R0DA 4C5YA 4RZ4A 3HJZA 3NZPA 3ZJ8A 3UP8A 4M6VA 4F2TA 3OU8A 2QUNA 1QI2A 3I6TA 1EBGA 3K5XA 4DI9A 1LG1A 5I23A 4JTSA 3VCCA 2WJZA 1QRQA 1I6NA 3HPSA 3ARRA 3ZT7A 3RFAA 1GW1A 1TPFA 1QOXA 3W1UA 2GPTA 3U0HA 2XGBA 3GRIA 3GVGA 4JS3A 1JCYA 3AYTA 3MP5A 5EKYA 1LYXA 2OT0A 3VOHA 1SJBA 4D1JA 1GZJA 1ZNNA 4HU8A 3CWOX 3IIOA 1IWAA 5E0CA 2FMNA 3S6DA 1TJRA 1S39A 4DIAA 3LD5A 1SJCA 2NVDA 2XWEA 5JIWA 1SM9A 3MHGA 3B0XA 1R7OA 4C1KA 1XSJA 2ALRA 4J2MA 4E2BA 3MV01 3QMTA 2EJ1A 4GQQA 5DQPA 5H8UA 2Q8ZA 5D9NA 2WWCA 4HTYA 3A24A 4Z2LA 4D9PA 3LPGA 2VCAA 2VWSA 3T6CA 2G3JA 1G9HA 1A5BA 1Z9AA 2X42A 4AZCA 3PPGA 4JCLA 3P3BA 5BMWA 5C8BB 3AXKA 3VTRA 1HXJA 1F5ZA 4DJEC 3EX4A 3P60A 3QF0A 1UWUA 1UOZA 1YADA 3E5BA 3CLMA 4ML9A 3G18A 3L0KA 4PRRA 1AD1A 4JNZA 5PTDA 3ZJ7A 4HPGA 3W7KA 3SAZA 1AZ2A 3EBVA 1WDPA 3G6MA 1DQXA 4NAEB 3KBJA 4GX8A 3BOLA 1A5MC 2WBKA 3CZKA 1WP6A 5G5IA 4PTDA 1UHVA 4M0XA 3QC3A 4CNNA 3S2CA 3ANYA 5EU9A 5DN1A 1QOQA 1JJKA 1R3QA 4CEUC 1EZ2A 1LTDA 4CEXC 1CI1A 4QQ3A 1XIEA 2D0FA 3EDFA 1B30A 2I14A 3VX0A 4L9XA 2E8YA 1ONXA 2I17A 3SRKA 3F5JA 4ORMA 3VOIA 1O1ZA 2WHJA 4S3GA 3RO6A 3KWXA 4HOWA 4MZ1A 1TV8A 1ZGDA 2IXUA 2BLEA 1O7AA 9XIAA 4WJXA 3N11A 1XHGA 3RLUA 4K3ZA 3L7RA 2ACRA 5FF3A 2VL4A 2XIQA 4GOAA 3ZR5A 1XLMA 2P8CA 3TEVA 5DBUA 4NI3A 1W0MA 3WEMA 1G4TA 2H6RA 1MYRA 3THQA 2V2CA 5FAJA 1KFWA 3VZXA 4I7WA 2AGTA 2Q71A 3WEOA 1J0HA 1XH1A 3C86A 3GAYA 5FJPA 3TH6A 4EANA 2GUBA 3L65A 1TQJA 4GYPC 3BSGA 4C6FA 3GWQA 4ES4A 2PS2A 3TJ4A 4MUPA 1BPLB 2EJAA 3NQ8A 5LXXA 5EMJA 4B5UA 1UZ4A 3VFCA 2ZRYA 5BXPA 1HIZA 3KLLA 2HE5A 2CLEA 1T6MA 2J9ZA 4E8CA 3R10A 2PDBA 3IJ6A 4J4KA 4QCFA 3P67A 3M6YA 1QT1A 2Z1WA 3W7CA 2B7OA 4Z1BA 1VIZA 5FACA 1JZ6A 4WUIA 3ABRA 3KX6A 2JGQA 4HZ6A 3BICA 1E56A 2D2HA 2J62A 2ADAA 3TNBA 3GHSA 3NA8A 1ZCOA 3R2GA 4ZR8A 1WDQA 4ZOCA 1TV3A 3VNDA 1F6KA 4CQAA 2FPVA 1HJUA 4PUUA 3SSZA 1O5XA 3O6AA 4F2UA 4HJWA 1JYWA 2TPSA 3F2CA 3T78A 3MYPA 5A6BD 2DZAA 5EGRA 4YTSA 3QYQA 4L4LA 4J40A 4JHMA 1FWFC 5C6MA 4ZOBA 4JFWA 3SECA 3CIXA 3IVUA 3BO9A 3MPGA 5U7SA 4PGLA 1VBRA 2VRKA 3I7SA 3CO4A 4BHYA 4AFYA 2WNZA 4KS0A 1XS2A 3E0IA 2ZXBA 1OQFA 3MSRA 3GC2A 2W62A 4PUKA 3REQB 4QSHA 3KVJA 3URNA 4L56A 4WIWA 2PF0A 3AXHA 1HL8A 3EX1A 1R8LA 3KL5A 3CC1A 5ECUA 5LSMA 3E6EA 3N2XA 5CZKA 2XZ9A 2YFOA 4WKFA 1OADA 2UY2A 4A8NA 1RCQA 1FH8A 5C7HA 2VR5A 3TN6A 4GUHA 1PKYA 3UG5A 3W7LA 3B05A 1UH2A 1FXQA 4PRTA 3NQVA 3EWXA 5D38A 3TTYA 4PMNA 3T8LA 1PZ2A 1JUKA 4PTNA 4S3CA 1E71M 2XN2A 1WX0A 4O0KA 2Q3RA 1E9YB 1VYSX 3H2OA 3TYDA 4K2SA 3LLDA 2PTDA 3T4CA 4JX5A 4FF5A 5AFDA 4QE1A 1W8GA 4DJFA 3D5HA 1OHLA 2WSQA 1R86A 4BJHA 3B06A 3T7VA 5E5CA 4GE8A 1BSIA 4LY8A 5AOUA 2XZ7A 3G5EA 1OEPA 1SJAA 4H2HA 2BASA 1KCLA 1JZ5A 2F7FA 2RHGA 4ZSUA 4UMAA 1BKHA 2QDHA 1XC6A 2WLYA 4H01A 4AD1A 1UROA 3L12A 3BVJA 1B1YA 1W3JA 4F9JA 2PDGA 1VEMA 4PTWA 3S47A 1TIWA 5CZJA 3MDWA 2GGHA 4JTTA 4L6OA 1W2PA 4JY8A 1J12A 2OEJA 2ZZ3A 1TPH1 2BSLA 3RG6A 3EPOA 3TKFA 3D3AA 4I5RA 2RFGA 1ZP3A 1B9ZA 4D8LA 4AU0A 2Q3OA 3L4YA 1W9UA 5G4HC 1AH3A 2IPGA 2ZC1A 3DFYA 2VC5A 3OGSA 3M5ZA 3E74A 4B92A 5DX7A 3UZYA 1TWDA 4QEHA 1OF8A 3ZSSA 1Z44A 3CT2A 2CXEA 3MC5A 1EO5A 2QF7A 4Y90A 2C7FA 1H41A 1I1WA 1HF6A 3BQ5A 1EPXA 4U31A 5J5DA 2IW0A 4S3AA 4Q32A 4LT9A 4ZO9A 4ZB0A 1K6WA 3I6RA 1AODA 4P5UA 1YEYA 3N4FA 1HUVA 3WNPA 2I9UA 4LPCA 3ZZ1A 3IRSA 1UD5A 1VJSA 3P93A 4JKLA 4EIVA 3N34A 1HVQA 4I6KA 5A6KA 4J3WA 5I07A 4K8HA 3T8QA 1JPMA 4LJ3A 2YB1A 3C4UA 2ZZ6A 3MCOA 4CQDA 1CLXA 1LOSA 1OT1A 4WSKA 1QHOA 2WZHA 3N73A 4E0CA 1KCXA 4LW7A 1K8ZA 5D04C 1EF2A 1XLGA 2WZMA 2JK2A 4YNGA 3W7NA 4DVOA 2CESA 3O6YX 3APYA 4GO8A 1CBGA 1UR1A 3SM0A 4AD3A 6TAAA 3PB0A 2ASHA 1SMDA 3KDNA 4P7NA 5DXXA 2E68A 3MBDA 4D6IA 2W79A 4QLLA 3BPWA 3L5LA 1LBLA 5C7VA 2BTMA 4CQBA 4JNYA 1HP4A 4XUGA 1V08A 2FVKA 4J28A 1BWVA 3KOFA 4H6KA 4QJ1A 1ZCCA 3CBWA 3LHVA 2GLKA 1BWKA 3UWZA 3KM8A 2EKGA 2NQJA 1RA0A 2WVVB 5DY3A 3BLPX 2XVGA 4ZQCA 4HGXA 3BAJA 4IQJA 3G8RA 1EOKA 4Y8EA 4YXGA 3TMQA 3V75A 4CU7A 4M5PA 4AZ5A 1I8JA 3TW6A 2GVLA 4FNUA 4XZIA 1JD7A 4XIMA 5DLCA 3VKJA 3SN4A 5G2WA 2DVTA 1RD5A 1J5SA 3PZ9A 3EX6A 2Z1KA 2XSAA 5KSWA 2BB0A 4OJYA 3KBMA 2DPEA 2REQA 1E6NA 4M1BA 1E5NA 3UR5A 1SW3A 4UR7A 3L4XA 5CSUA 4MZ8A 3TFXA 4UQ9A 2QW5A 4HB7A 3AYSA 4DM1A 3G3DA 3LCHA 4H7ZA 3STEA 4DBWA 2D2JA 3TJIA 1R0MA 3W82A 1TWIA 4U4MA 4R9XA 4AVOA 4GFSA 4C6NA 5GJPA 3BANA 2QJJA 1HKMA 3CGTA 2DUAA 1MW0A 3QR1A 3VOJA 3FFSA 1XPGA 5G2HA 2OWCA 1OC6A 2PP3A 5LHEA 4QHRA 2OT1A 1CGUA 4RV3A 3CV7A 3LZ3A 1RCOB 3QH2A 4H2CA 3HIJA 2EBNA 1ADSA 1U2YA 4R34A 4IMEA 3F5LA 3V0SA 3L4VA 3TUUA 1X6UA 1MDRA 1VLIA 2HS8A 5E9XA 3H54A 4B5SA 1B3YA 3VE7A 1FRBA 2QS8A 2WHMA 4XAGA 5BXRA 2C18A 1AW2A 5ABFB 1LRTA 3U7VA 1A5LC 4LEQA 3NSMA 4J7RA 4HP5A 4O0ZA 2BY1A 3HFTA 4CGTA 3ZS4A 3RGTA 5CC6A 2BMBA 4I9MA 2IS7A 1O60A 3EOSA 5JBEA 2W63A 4KFOA 3OBEA 1R38A 1TWWA 1Q5MA 4LVBA 2XVPA 2JIWA 3NXLA 3SN1A 4JFSA 4AIBA 1LRNA 4CD8A 2ZIDA 5L9FA 2OO0A 1J0IA 3KCOA 4NYUA 1E4IA 3SCSA 1JIBA 4O28A 4XD4A 2QCNA 3ZLFA 4LU0A 1KLYA 1PXGA 3I3BA 1U1JA 3GTXA 3WBYA 2HISA 3N2MA 4F0HA 1TCDA 1G6CA 3CIWA 3TJLA 3TFCA 5CEWA 2VR4A 2XTKA 1JGMA 4LB3A 3N04A 1JZ7A 1I4NA 1GOMA 2ZWZA 2HPMA 1I60A 2J8GA 4GO9A 3W1MA 1HGYA 3M0JA 1Q6DA 1SR0A 2ZX6A 1C7TA 2ZX5A 2VDGA 1PE1A 1EXBA 4O4VA 4KESA 2Z6IA 5HMSA 3WUFA 1XSIA 3MCNA 3U7BA 1RXOB 3W9ZA 2XINA 5A2CA 3VKBA 1GGOA 2VUNA 4EAMA 3PFMA 5CSYA 3TYCA 1JYXA 4WF7A 2PP0A 4O18A 3R79A 2CKSA 2BY3A 4IIBA 1FH9A 4UFIA 1XBXA 4UMBA 3VDCA 4K1GA 4CVWA 3WBXA 1NTHA 4DLFA 4PC8A 3ZWSA 1QNRA 3MU7A 4JIIX 1QBBA 2B4GA 1M6JA 1U1HA 5TIMA 3QXBA 4XVDA 5XIMA 5A94A 4HZMA 3SCOA 1OWQA 4GXMA 1VCFA 4O1EA 1OD8A 1BSLA 3THUA 2HDJA 4XKYB 3FW6A 4KBXA 4UNIA 4Q4PA 1HKIA 4ZE4A 4X63A 4MY1A 3AHZA 4NJJA 3O07A 2WKLA 3UFYA 2OEMA 2PWUA 2VP8A 2E4TA 3WQPA 2W3ZA 1J0KA 3TZFA 3GU1A 4J35A 2HVOA 1KXTA 3FIGA 4G8TA 4F2BA 4Z1YA 5CJNA 4BS0A 5DBTA 4UBPC 3B4YA 5LGZA 2YL6A 3CHVA 3BOXA 3TXZA 3N17A 5FJTA 1BG4A 4UTMA 1FWGC 1W9PA 2PTYA 3PHAA 4HSNA 1PJ9A 3TK7A 2F6XA 3R7MA 3CYJA 1HJXA 4HCLA 3G1RA 4MZYA 3RUBL 3ES8A 1W31A 4ZQNA 4GQ0A 3ITLA 3HJEA 1IYXA 3UJEA 1TQXA 5T91A 1IZCA 1I2OA 4N9EA 1O68A 2WC4A 5C9WA 1TV4A 2ZDSA 3UR7A 4PCTA 2X41A 3RDKA 3G0UA 4BI6A 2XM2A 2ZCGA 5M1TA 4PTVA 4LV4A 3LDVA 1VBGA 3Q45A 3H70A 3QV8A 3T2QA 2YJQA 1LF1A 3KXQA 3N3MA 4JL2A 2PE4A 1OFAA 4C90A 3BLKA 1N55A 4TR9A 4LAMA 3GXIA 2OLAA 1V3KA 1KFKA 3R58A 4DEFA 3E2SA 4WJ8A 1OFOA 4IIFA 2ZA1A 2QGYA 3EGJA 4ZO6A 4OBSA 3AS0A 3GNOA 2PBOA 1A4MA 2YW4A 1L8NA 2DW6A 2W5FA 1LL7A 3LGDA 3ZWTA 3B9OA 3DFSA 4O19A 4F9DA 2J7GA 1CXHA 3CZEA 3ONBA 3WL0A 1HTIA 5H91A 2DT0A 2ANUA 4H1ZA 1QW9A 1CYGA 1OGSA 3TN5A 1UD6A 3ARUA 5A6JA 2G8ZA 4RK8A 5IHRA 4FXSA 4TX6A 2WMHA 4GGHA 3QSRA 1D7KA 1FVPA 3EKLA 3HMCA 1ITCA 4AUBA 1W5NA 1OINA 3RYSA 1CW2A 3IWPA 1DJGA 5FSDC 2VFHA 4MAVA 4YMZA 4BF9A 4EKJA 2GWGA 4H19A 4E3TA 2E9BA 4FLRA 4JPGA 2V3EA 1LM1A 4S3EA 5AC6A 3GW3A 3NQ2A 1QASA 1LQAA 1OM0A 4LBRA 3SUUA 3IJDA 5LGXA 1KFLA 2VVSA 5FI8A 2PWFA 2ZUSA 2FMOA 2OO6A 1SFSA 4LALA 3O8AA 3KBVA 4RR4A 2CBVA 3BMVA 1TUXA 4GVGA 3NL5A 3W7QA 4CD7A 3GSMA 4W87A 3ZLGA 2BHYA 2CCRA 3B0PA 1G94A 2J77A 4C6CA 2C16A 3OOQA 1AQFA 3OQ8A 2QZRA 1TE6A 1UMYA 1YW1A 3UT0A 3FHQA 3WQVA 2HBXA 3SRFA 2ACUA 5GVJA 4NZ3A 2WVSA 2DSUA 1NQ6A 3W4RA 2DORA 1ICPA 5TBOA 3TN3A 1DQWA 1QI0A 3W83A 3UG4A 1XLJA 1MNSA 4Q4QA 2IQ0A 3PTKA 3DFHA 3BURA 5J5RA 1MUCA 3B4UA 1EFZA 2PGRA 2ICSA 5I09A 1P6WA 4H6EA 2DQWA 4WLCA 3POHA 4R7WA 4ZQMA 3V3WA 2ZUNA 3IIPA 2UY4A 3WDHA 5M17A 1QW8A 3W07A 3ARPA 4ZO8A 3NPXA 2PLJA 3Q94A 1EP3A 2FKPA 2QF8A 2ZXQA 2I5GA 4BCEA 4NAEA 4Y9OA 3K1GA 3VNLA 4L6HA 1PKLA 3SADA 1U30A 1V6VA 4IGHA 4PB4A 1ZFJA 1UP0A 4Q8NA 3S1XA 3PY2A 3C3UA 1SUXA 5CBIA 1V4YA 2PDLA 2HQAA 3I68A 3WQ8A 3NPWA 5KZ6A 3WNNA 3WFAA 1C92A 2YZ5A 3WD4A 1S2WA 2VZTA 2CBIA 1NWSA 4ZL1A 2RGLA 3W02A 2YBUA 3HBLA 3QR3A 1EJ7L 1PDZA 3QFEA 2GVYA 3HQ1A 3LGGA 4D1IA 1R30A 2BV9A 4PCSA 3G8EA 3WELA 3AYRA 3LBCA 3P62A 3B04A 4LYQA 5BW6A 2YXOA 2WO5A 3TLLA 1FWRA 2BY0A 1WXJA 2PTWA 3T09A 5B7ZA 1THFD 1S2TA 3EXTA 4OGZA 3GBDA 5I7GA 3T0AA 1E73M 1TVLA 2GSHA 3SCNA 1IHIA 3WD3A 1SO5A 4DWSD 3IGXA 4U5IA 2X1RA 3CUJA 4LAZA 3EWZA 4PB3A 4WGHA 4RNFA 3CQHA 4H6RA 3UCQA 4OVXA 3S2JA 3OZMA 1WXZA 1E72M 1WO2A 4C6IA 2YL9A 3VYLA 2A3BA 2XIOA 4AVNA 4LFYA 1F8IA 5HATA 1SW0A 4DO4A 4I9AA 2Q8LA 3PG8A 1KTNA 4EVZA 3QLDA 3JUGA 4W7UA 3OHMB 4TO8A 2ZRXA 1ECQA 1VHCA 1AJ2A 3H4XA 4IH3A 2GK1B 4FNQA 3EKGA 5I2UA 3WMBA 3IIVA 1MZRA 4FNRA 3SY8A 3CB8A 1H51A 4CNTA 4C6LA 4UC5A 1E3XA 1FWNA 1JL8A 3LYEA 1HJVA 1IE7C 1NDWA 4BEUA 2WV8A 3SFKA 5TAOA 4C7GA 3CB3A 2BS9A 2HROA 4JEJA 1T96A 3MV11 1EB3A 2BVWA 4RNHA 2C0AA 3GHRA 4DAFA 3VM7A 1DWFM 3ITGA 4W5ZA 3BC9A 4JEQA 4ERIA 4GPNA 3ABOA 2QCMA 3CS2A 4B5VA 1FWEC 4DBUA 2KX9A 4GJ1A 2NQZA 4CU8A 4I5XA 2QKFA 1QATA 4G1NA 4D6HA 3W2LA 4JFUA 1A0EA 1GVEA 1VEOA 1YPXA 4IPNB 2Y7GA 1K7FA 3DX5A 3RILA 2X7WA 2A85A 2JKEA 3OEXA 4J3UA 3BLOA 3W76A 2POZA 4KPLA 4Z2GA 1XIBA 3CZ8A 5KITA 2ZUMA 4Q8QA 2CLPA 5HJLA 3REQA 4FOUA 4I6VA 3V5FA 1K1DA 4LRSA 3ICJA 2EG8A 1EBHA 1CGXA 5I3KA 5FF0A 1DWJM 4JN8A 4GY1A 1TPEA 4CD5A 1O5RA 4GYKA 2VOTA 4KIRA 1U5VA 4B9YA 2HJPA 1YXDA 1UUQA 3UNTA 3QKZA 2CLFA 4HMEA 5AHLA 3LPFA 1RQEA 3QEZA 2PDQA 3NO5A 3C2RA 1E0TA 3CQ0A 4H04A 4ZO7A 4Z08A 1OX6A 3W7OA 1HKKA 4WX2A 2GJXB 2YCLA 1C29A 1HKWA 4RE2A 3VDHA 2BXZA 1CPUA 4PCPA 4E38A 1V77A 1CDGA 3F4NA 2PWDA 2I56A 4GINA 3GYEA 4ERGA 1P6BA 2XPKA 2XIMA 1UJQA 1YMYA 5LIYX 3P81A 1DTNA 4WZHA 1I0BA 1Q7QA 2MNRA 3A13A 4MYXA 1KXVA 1HW6A 1XGZA 1XIDA 5KZMA 4UWMA 2CNCA 4XBJA 3O6DA 4FOKA 4NHVA 3NM3A 1P0DA 4HNVA 3A5VA 4X22A 6XIMA 3GG8A 3UGRA 4NXSA 4P8VA 4M82A 1S1PA 2V9DA 1ZL1A 3DI0A 1KRMA 3AU6A 1V7AA 4D8ZA 3VIPA 3AXMA 4AZBA 1AW1A 2C1IA 2F6KA 3UCCA 3LV5A 2VCBA 4QIUA 2HK1A 4HNCA 1ODUA 5D8ZA 3EB2A 3KTXA 5CJ5A 1QDSA 4AX6A 3D3FA 5D37A 3B0UX 2AAMA 4UTWA 3OZPA 5CKSA 2OMAA 4UQEA 1XBVA 4AQLA 1BTMA 3N9KA 1PCWA 1RLCL 3B9EA 2G3IA 2OZ0A 3L0NA 1UKTA 1LWIA 3LHYA 4PR4A 1KCKA 1X8CA 4F40A 4QAWA 3MYOA 3WX7A 2QDDA 3AZTA 2WSKA 1A5AA 3T0CA 3GTHA 4A3YA 3RPTA 1H5VA 2ISSA 3A22A 2YXXA 2W4XA 2E67A 4TTUA 1E0XA 1YTEA 4E4FA 1BGAA 2VFGA 4DJDC 2AGKA 2XUCA 2EPNA 3M0YA 1JNEA 4ML4A 2POTA 4PB5A 2QIWA 3AISA 3K8LA 2XWDA 3KCJA 4JQAA 5C2XA 3WQCA 1GEQA 1QI5A 4PL1A 3EPNA 1Z8AA 4FO4A 2C15A 3E0WA 3VIMA 1HO1A 1VB9A 5ABTA 5DCDA 4CN4A 4XZLX 1UQYA 3LTPA 4ENLA 3C3NA 1TVPA 2F2KA 4JTJA 1TCMA 3FSTA 5HNUA 3M7WA 1CIUA 3II1A 3G1SA 4PEKA 3W23A 1IEIA 1ZBKA 3HGOA 1XDMA 4YVXA 4XD6A 2WSYA 1H11A 4LEFA 1L6WA 5RUBA 2WPBA 4PYSA 1HX0A 1TFVA 3T4WA 5IBXC 3P61A 2NQHA 3RM9A 1BGGA 7ODCA 1ZJBA 2QCHA 3AU2A 2X30A 4AMAA 1QOPA 2C79A 4WOZA 1C90A 1Z6KA 3MUZ1 3PZTA 3WF4A 4DNMA 4D6JA 1NDZA 2WVVA 3TAKA 3GYCA 1EJRC 4IPIA 1T8XA 5EBUA 4O12A 4UNKA 3ABXA 1H7OA 1UQZA 3WUEA 3V18A 2BZNA 3FJLA 2A6NA 1FWDC 4I8YA 3KFTA 4TX9A 4IUGA 3IJ9A 3MKVA 3WLJA 4K1WA 3HU7A 1OFQA 3WQFA 2BVYA 2R6OA 3W27A 2PDCA 1XINA 3KHDA 2NUYA 1MDLA 2YCIX 3V7PA 5JVLA 1J2WA 1B3WA 2NSXA 4XBSA 1YTDA 1V3JA 4G6CA 4ILSA 1EC9A 2CZEA 5M3WA 1R3YA 3DHPA 2RDXA 2H8XA 2YX0A 2PDMA 4M3PA 4F3HA 2VDIA 3QGAC 3SQSA 3UXAA 5DY2A 4JDBA 2D3LA 1K8CA 1FHDA 5EMUA 4H9VA 3UF9A 1C8VA 1Y5XA 4DUVA 4DNHA 3LPOA 3N3TA 3N2OA 1JF5A 2HNEA 2ZX9A 1W9BM 2NQ5A 4U3AA 3PSVA 5D2XA 1TRIA 5DFAA 3QC0A 4IX2A 1Z69A 4P7LA 2O55A 4LH8A 2CWNA 5DMMA 5C9UA 1F8MA 5HWNA 3GQYA 3AUJA 3W2KA 2DW7A 1HT6A 3FVDA 2O92A 3NO1A 4X0NA 5LXEA 1P6CA 5J04A 2JF6A 3W7GA 1S46A 3GG1A 3AHVA 5CC5A 2PF8A 1EA0A 5DMNA 6ALDA 4HU4A 3RPMA 3LNPA 1FCQA 4H8VA 3QGVA 4N9DA 5F4WA 3V16A 3KOZA 2D22A 3FKKA 2NV2A 5ABFA 2OKOA 1ZSXA 4MAZA 1XICA 3PPHA 4HT3A 3PJUA 1ME8A 4UQAA 1JR1A 3A23A 1B5TA 3VGEA 3MJMA 1EF3A 1E4NA 2WYSA 2V5JA 3OIXA 4DXVA 1GNXA 1MQPA 2PRHA 1LP6A 4FIRA 3KTSA 2WMJA 4Y7EA 2GJPA 5E0KA 4QNEA 4DO7A 5SWUA 4LWWA 5EYWA 4BZYA 4K6AA 4H41A 2B81A 3EX3A 1FHUA 4PODA 3N1AA 2Z25A 2J6XA 5D32A 1WA3A 3UZ5A 2OCZA 4AB4A 4M56A 3GXTA 3K4DA 1BHGA 3U2ZA 4MYAA 1XGDA 3ZIZA 1JCLA 4BQ4A 3AWNA 2FHCA 3U4AA 2IMRA 4HCDA 5KEZA 3TQ0A 1V3IA 2OLSA 3NEVA 3JVAA 3N18A 4Q33A 4UZUA 2BGQA 1XCXA 1DYSA 3W3OA 1D3GA 3WLKX 1IEWA 3ITOA 5EMLA 2QV5A 2G5WA 2VVNA 1RVKA 4JTFA 4QQUA 3T44A 4YS1A 1Z42A 3UU0A 2YPIA 2WVTA 2VFDA 2FTYA 1J79A 3VILA 2C6QA 3VO0A 5AVHA 1J9YA 4QX4A 3KW3A 4LC6A 2J9XA 1U22A 4LS1A 4GACA 3F1QA 3C0LA 1O4UA 1GOQA 1QNPA 1BVNP 3BG3A 1EWEA 5J8LA 3AIVA 1IGSA 3PWAA 4B16A 3SCPA 1TJ1A 4PMYA 4QEEA 2DP3A 3GK0A 3W00A 3UPMA 3MWCA 4GI8A 2XU2A 3HQNA 5BYWA 1X1ZA 1K77A 1AQ0A 4UR8A 3GS6A 3UWEA 5CZSA 4XKYA 4DXKA 1B0IA 4KCVA 1EO7A 1W91A 3ZSTA 4OUEA 4GI9A 2J75A 3W28A 4Q8PA 3A6OA 1W8SA 4X9SA 3CV2A 3K46A 5FEXA 3GUWA 1YXCA 3DBPA 1A3HA 1V0NA 1ISZA 3NGJA 3M0LA 3VI2A 3PZGA 1C9WA 2Z00A 5F2GA 5I5RA 1GVSA 4WKHA 3LZ5A 4XZNX 5DANA 2C71A 4NZ1A 5BU9A 2OTDA 2FHBA 1ZQ5A 3OGRA 4LNYA 4NJKA 3U4FA 2WOQA 2FZNA 5EFDA 3WJSA 6XIAA 1JI2A 5BRQA 1TPDA 4LYRA 1IEXA 3P6LA 3XIMA 2EG6A 4B15A 1W3TA 3LNMA 5LNUA 5JXQA 5F1VA 3VOGA 2FZMA 1H7RA 2C13A 2C3ZA 1KRAC 4FB7A 2Z26A 3D6NA 1X1OA 4PMJA 3I4KA 1EPVA 4OV4A 5MHBA 8A3HA 3GO2A 4WDWA 2GVGA 1SSGA 1JAKA 3UWQA 1DVJA 1K9TA 4CCZA 4S23A 2OGYA 1FHLA 4B4HA 1ZENA 3EMCA 3B9AA 3IJLA 4A22A 3PAJA 3PBMA 3TP4A 2ZICA 1F3EA 5AHFA 3CZLA 3LUTA 5CG0A 1IIHA 2EPOA 2VFIA 1DJHA 1S2UA 1AFSA 1S2CA 3GU2A 1D3CA 3BK0A 2Y6ZA 3WLRA 3E1F1 4LAOA 1OZMA 4XG1A 2ZYFA 4CQ9A 1FWAC 1VFLA 5JH1A 3W2JA 1QUMA 2V5LA 1U83A 1IEQA 4WCJA 1UZDA 3O6CA 1K9FA 3S1UA 4JX4A 1WOAA 4HMCA 1OX4B 1GK8A 4AF0B 3SZ8A 1NDVA 4JTRA 3W72A 4V33A 1AMYA 1S2AA 4B91A 5AYYA 2V5KA 2PMQA 4FIQA 4JNMA 4CNSA 2G96A 2HS6A 3V4BA 2W91A 3ANVA 3HPZA 2VQTA 3BE7A 3WY1A 4NZ5A 4GMEA 2BX7A 2OEKA 2X05A 1QXLA 4HA0A 4KRUA 2WW5A 3PNZA 3H2CA 1BF2A 4UQCA 3QFWA 5HUPA 4S2BA 2F9RA 3BGJA 5M2FX 3CH9A 2NZLA 4PMUA 4HHPA 4KFNA 1JNDA 4UFJA 1L0PA 2PWGA 3VMNA 3P5YA 1VLWA 4XB3A 1G7UA 1G69A 5I24A 1VPXA 3S5SA 1ONEA 5AC7A 3SCUA 3OLEA 2VRJA 3W7EA 4N4PA 2PDUA 3HV8A 1QR7A 3N4AA 1YTKA 2E6AA 3GNRA 4A6GA 3WJXA 2EEXA 1D3HA 1UKSA 1QTWA 2PWVA 1F7BA 1SYTA 1H61A 4WGXA 1T5AA 3STFA 1WDDA 2GJLA 2HCVA 1T40A 2OWWA 1HKJA 3RRAA 3CEUA 2TODA 1D2KA 3VE9A 2CIPA 1VKFA 4YJ5A 2OR2A 2EF9A 1UWTA 4UCGA 4GBUA 5AHNA 2INZA 3U2EA 4U2YA 2F61A 1H7NA 3MMUA 3W1AA 1J93A 2ZQ0A 2E28A 1ZU8A 4S3FA 1A50A 4XO7A 3SJ3A 4C6JA 4W8AA 3FXGA 1SR9A 4V1XA 2PDXA 2DZPA 3PBGA 4Z17A 4NQ1A 4ADUA 3FLUA 2WC3A 1R47A 2O0TA 8XIMA 2PTZA 1M7PA 3S1WA 1I2RA 3OTRA 5HUOA 1TR1A 3IACA 1MI3A 4NNCA 4MSSA 1M53A 4AWTA 4ATLA 1JRCA 1E6PA 1ZBCA 2OOFA 2WPGA 1A5NC 1PX4A 4GX9A 4RCXA 1AVAA 1HN1A 4ZMGA 5D2WA 1GJWA 4D6EA 3EOUA 1JI1A 1FCUA 2XIBA 4GNVA 5F1UA 4Y9PA 1OD0A 1Z41A 2X16A 1RAKA 4Q6JA 3KP0A 4H3DA 1E40A 1M9HA 3ITXA 3P0XA 1XIGA 3XINA 1DJWA 4QS6A 3WNKA 5EA9A 4H83A 2Z0IA 3VX1A 4LCSA 4YTUA 4JQ3A 1PDYA 2XHYA 1SJDA 1T0OA 3CEPA 2P8BA 4TVUA 1DXEA 3DFOA 4A3UA 1FWWA 3TN4A 1Z7AA 4NIRA 4S39A 3BSMA 3VD7A 4EWJA 1MUWA 3WMSA 4DY1A 4CQ8A 3EWUA 3TYAA 2P0IA 4Y8FA 2IQDA 3WFZA 2GK1A 3FA3A 3ZXWA 3S4TA 3LBMA 1OYCA 1K3UA 4YTQA 1RLDA 2QUTA 2ZUWA 1CX9A 5D2YA 4PBEA 3RM8A 4C7DA 2W92A 1MXSA 4GWEA 2GQ8A 3NPVA 2FJUB 1ECEA 4J1OA 5CPSA 5I3FA 2BVTA 4FXJA 3WH6A 2ZTJA 1JGIA 3P8IA 3FYYA 3TTSA 3CYVA 2CZVA 4DO6A 1HP5A 1YBQB 4Z1AA 2PAJA 5K4ZA 5K4XA 5A1AA 3M5YA 1JQXA 3W70A 1U33A 4C6BA 3ARQA 1XYAA 4ACZA 3EZ4A 5I3GA 1KGWA 2A3LA 3EOOA 1H2JA 4UFKA 3H2MA 3T0TA 5D4YA 1LBMA 4F8XA 4GUIA 5C5YA 2NT1A 3BAWA 4FP1A 3AYVA 2QPUA 3W1QA 2JEQA 1QNOA 5CPMA 2Z1VA 1RJRA 4CLMA 5HBFA 3VKDA 1DL3A 2ZUVA 3LM3A 4GA8A