3PY2A

Structure of c126s mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVSFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Probing the role of the fully conserved Cys126 in triosephosphate isomerase by site-specific mutagenesis--distal effects on dimer stability.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3py2A00
3UWUA 3FOKA 1E51A 3LRLA 1SSGA 1MSSA 2ZA2A 5FF4A 4U28A 2A7NA 1LOQA 3NQ8A 1ME9A 4EF8A 2TRSA 2OCZA 1XUUA 3FKKA 2JGQA 2RHGA 4ML9A 2LLEA 2ZA1A 1PCWA 1LBMA 2VENA 3N9SA 3L5LA 4P61A 4LOCA 1OFEA 3W2NA 2P0OA 4K36A 1KFEA 1IXQA 1F05A 2C14A 2WNZA 2CLMA 3PBUA 4M6VA 2Z1BA 1QDSA 4MYXA 1BWLA 4IMDA 3W88A 1P0NA 3EWUA 4AEOA 3N73A 1F73A 3SSJA 3W2LA 1KTBA 3LXBA 1LOSA 4OGZA 4TMBA 3LRKA 3LCHA 4AXKA 3NQ7A 3TXVA 3WK2A 3W7PA 5DLCA 1ML1A 3BG3A 1PHQA 4FNUA 1TPC1 1FCQA 1F2JA 2RDUA 3S1VA 1EEPA 3GXPA 1WXJA 1KFKA 5CPMA 3BG9A 3EWBX 4O1DA 1YPIA 3FS2A 3UXDA 4E0CA 3NQFA 4DQWA 1THFD 3P67A 1TPUA 1VCGA 2QUVA 3CU2A 5T26A 1L6YA 4IX0A 5A5WA 1JCXA 4JDBA 1GWJA 2EPHA 5DBTA 4LUIA 4UUIA 1SQ7A 4FEZA 5KITA 4ZQMA 2YPIA 2GJLA 1D9EA 5TIMA 2ATSA 4O1BA 2CLHA 2Q3RA 2Y85A 2YGYA 4N6FA 4XTDA 4XQ6A 3H53A 3N14A 4POCA 3NYZA 3VI2A 2AGKA 2EAWA 3EB2A 3DFTA 1T0OA 4UTMA 3NAVA 1NVMA 1QMLA 3SECA 3G18A 1SZGA 3R5EA 3EXSA 3PBYA 2QR6A 1R47A 1KTCA 2NV1A 1X6UA 5AHMA 1I45A 4OWGA 1D3HA 1TIMA 1VS1A 5F4SA 2WJZA 1HG3A 1LCOA 3ZS4A 4JEQA 5AB3A 2ZZ1A 3LHYA 2PC4A 1G4TA 2A2IA 3BW3A 2ZZ3A 3MI6A 3IGSA 3HGSA 5DXYA 2VC6A 3NQ6A 1F7BA 2ABBA 3NQDA 4JIQA 3U6WA 4I7WA 1AW1A 3NNTA 4MY9A 1OYBA 4LVAA 4BWLC 5AHEA 3WJWA 2O7SA 1XBYA 4RK8A 2XN0A 1H7OA 3OG3A 5F1UA 3FJ6A 5AC6A 2VFIA 2BWGA 3SGUA 3IGUA 1KM0A 1H7NA 4K8EA 3STGA 5AYXA 3A21A 3INPA 3H55A 4UTUA 3BLFA 5FF3A 1UCWA 4Y8FA 4N9DA 3DFQA 4AF0B 1W0MA 3M44A 4ZQPA 4GUJA 2GVGA 4K7VA 1K02A 3VFLA 3BLIA 3TKFA 5F1VA 3PVFA 4OV4A 1WDWA 2C3ZA 5AHLA 2Y7EA 2A1YA 2E6FA 4WD0A 3TE9A 4JY8A 2J24A 1K7XA 3QFEA 3MP3A 3E02A 1TMHA 2VEKA 2TYSA 2PRLA 3ZWSA 1AW5A 3ATZA 4LVFA 4IX2A 4N4PA 1GTEA 4UTWA 2ZYFA 3NQAA 2CLKA 2WQPA 1TPH1 3JRKA 2FIQA 4A21A 3UWYA 1G69A 5H91A 4YXGA 4IXXA 1XL9A 3M7WA 3MO7A 1H60A 4MJZA 1VZWA 1SO3A 3G1VA 2YZRA 3ANYA 3TJXA 1LP6A 3HG4A 4N9BA 1FBAA 3R89A 3W7QA 1AL8A 2QKFA 5LNRA 2ZTJA 1TTPA 4JICA 4QM1A 1XUZA 4TIMA 4QAIA 2C13A 4JTEA 3W2JA 1YDOA 1XDLA 1H7PA 4JTFA 3DFNA 4NJKA 2X1SA 4WY0A 4S2CA 2A0NA 2QF7A 5F4XA 3KVKA 1KM4A 1C8VA 2UV8G 3HJZA 2RFGA 4W9TA 4YMZA 5F2LA 1NF7A 1N7KA 2WSQA 3EKLA 1F6PA 3PUEA 1GG1A 3CIXA 4FNSA 5L9FA 3M43A 3TDFA 1EWDA 4UTHA 3Q58A 4KWWA 1RVGA 3HBLA 3B05A 1Q6LA 1W5OA 5CPOA 5G1YA 3TW7A 3E9AA 4Z1BA 1F5ZA 4RV8A 4MYAA 2CW6A 4Z0JA 1QPNA 1ZNNA 3F03K 4XTIA 2E6AA 1OX4B 4XUGA 4LWWA 5IM51 4JYDA 5I3KA 1QWGA 1NSJA 1WV2A 1XBXA 3BW4A 1LYXA 4ADUA 4HNUA 3VCRA 3C61A 3BW2A 3W7NA 3I7RA 3ELFA 4IQLA 1YXYA 3VKJA 1GG0A 3TQKA 4ALDA 1G4EA 3W2KA 5CZTA 5I3JA 5HULA 1HTIA 4IGHA 4GFSA 1BKSA 5LSMA 1O94A 3GDLA 4BI6A 3QEZA 3PULA 5FF7A 2NXHA 1I4NA 5D02A 4RJEA 5K9DA 1VPXA 2TSYA 4IJBA 1GZGA 3W3OA 3V75A 3CT7A 3G1YA 3HPXA 1TRIA 2B7PA 5HWMA 4XBSA 1LLZA 3NQGA 1JCNA 1M7OA 4N9EA 1WOAA 1GYNA 3DENA 3TSDA 1R2SA 2W6RA 4O17A 1ONRA 2F84A 5HWJA 1M5WA 1T96A 3MMTA 4JTKA 5I3FA 4Y96A 3SR7A 1PVNA 3LV5A 3UPBA 4ZL1A 1ZHAA 4LVDA 3MYOA 3NG3A 2GJNA 4JS3A 3TMQA 4E2DA 3C2FA 3LCFA 5FEXA 5AOUA 2YXGA 1SZNA 2NX3A 4M5PA 4NX5A 2EF9A 2ALDA 3IEBA 1N55A 4ZQCA 2VKZG 1OFPA 3LRMA 3EEGA 4X9SA 3VE7A 4JTTA 3S0CA 1A53A 3QW4B 2ZZ4A 3LTPA 2Y7GA 3PSVA 1TSIA 5FEZA 4MFDA 3W84A 3DFPA 3HMJG 5CZSA 3EX6A 3F1QA 1H5YA 5D04C 5HQEA 4DF0A 2CZFA 5KZMA 3S5ZA 2ISSA 2X30A 3S1XA 5D37A 4O11A 4UFHA 1EB3A 3NO5A 3UZJA 4JNMA 1JCYA 2BZNA 3EXRA 4JXCA 4DBDA 4WXYA 5AN7A 3NPXA 1BEUA 2VEIA 1VJIA 2YFNA 3NXFA 4UR7A 2PCQA 5CPLA 4N6EA 1UASA 3NPWA 2R94A 1LTDA 4FB7A 1TPB1 3CC1A 3CPRA 2ZZ6A 2FB2A 2OMAA 3V1PA 4FX7A 4WJEA 4WX2A 3SFKA 2G5WA 2A21A 1SR9A 2E5BA 4M7SA 5G2IA 4UCGA 5D03A 3VNDA 2J6XA 1W37A 1ZAIA 3S42A 2Y62A 2NUXA 4FIRA 1ZALA 5BOOA 1OK4A 1HO1A 1R46A 3QMRA 2X1TA 2NXGA 4UNKA 4Z1CA 2NZLA 3DI0A 3MHGA 4FXSA 4MLRA 3HO8A 3OVPA 2V82A 3HF3A 5HJLA 4YCOA 3MUXA 1LRTA 1L2UA 5KTLA 1YXCA 2NXIA 5D30A 1XFBA 4S1FA 1KFCA 3GVGA 2DU2A 1VHCA 1BTMA 3WJZA 2QCCA 3UNDA 5D09A 3UXAA 3M1ZA 1GJPA 5CGQA 1QOPA 4Z1DA 5D2YA 1FY6A 3BVJA 1VQTA 4QSHA 3G1SA 4O10A 2J88A 2CLOA 3C8FA 1JJKA 1YTKA 4HNVA 5DY3A 5C54A 1JCMP 3E96A 2A7PA 1LORA 3O6YX 4JYEA 1GTHA 4GXMA 1I2NA 2V0TA 4K38A 4OU1A 1TPVA 2V5LA 3A5FA 2Z6IA 3BV4A 1OX6A 3NL5A 4NJIA 1UUOA 4R7JA 4TR9A 2FJKA 5EY5A 4UR8A 2E68A 4M6QA 5D2XA 5HR6A 5C2XA 2HMCA 2NWSA 3SW6A 1GVFA 3TJLA 3PB0A 3C2RA 1C9DA 3UWVA 3A9IA 1L6WA 2E5DA 3NZ1A 3Q94A 3M16A 1PIIA 1O95A 4AF0A 3L9CA 3C6CA 4Y9AA 1NFBA 4GC4A 5AHIA 1VLIA 1QFEA 4FIQA 3O05A 5KSWA 2C15A 2GVJA 2NWRA 3EWZA 1M6JA 4ORIA 3RFAA 3B0PA 4J9JA 3WK0A 5AC7A 4NNAA 4ZZ9A 2ZZ5A 1T99A 3IVSA 3NL6A 2ATMA 3TV8A 3D0CA 4O57A 5EA9A 3IIVA 1X1ZA 2Y88A 3W1XA 3IV3A 4UIOA 4D2JA 5G2WA 4Q33A 3G3DA 1KM5A 4LS2A 4XBKA 5HNRA 2C16A 4FHAA 1XCFA 4GNJA 4MIMA 5E93A 2BXVA 2X1RA 2WSYA 3S5OA 4NUWA 2W79A 4UC5A 4GUIA 3W7CA 4H4IA 3TX9A 1YXDA 3IIZA 3PC0A 1B57A 5BW6A 4M6PA 2QEZA 4UTJA 1LLWA 2G97A 3P60A 3QF0A 3W1RA 4LUJA 3E12A 1IF2A 2TMDA 4LU0A 4DO6A 3LHTA 2A6LA 1O5KA 3BARA 5FI8A 1TREA 3M5XA 4Z1AA 5L6UA 1FWRA 3O6DA 3CHVA 4R53A 2NV2A 3HOJA 3IGXA 5AYZA 2J9XA 1K8XA 1OFBA 4HHPA 3I68A 3BPWA 2VFEA 2G95A 3P82A 1YLVA 4O4WA 3FLUA 5MHBA 3B0UX 1DL3A 1QO2A 5TBOA 4BWLA 1M7PA 2E6DA 1KTNA 3SY5A 1ME8A 1FWNA 4NNBA 2E6YA 3W2MA 4JYFA 2H90A 6TIMA 3C52A 3LCLA 2CFFA 2WKJA 3N34A 3HG2A 5SWUA 1IXPA 3I7QA 4JTLA 3G0XA 3TFCA 4Y90A 3IVTA 2QCFA 2E1DA 5J5DA 4IMCA 3GX9A 3S1UA 4JDYA 3STCA 1WOBA 1PS9A 5AFDA 3ZWTA 1QAPA 1WBHA 2B7NA 1TPDA 3QH2A 2WNNA 2OZ0A 4MLJA 1RR2A 3EWXA 2FQIA 3GKFA 1P5BA 4QISA 3S9YA 2Y63A 2ISVA 1A5AA 3KRUA 3L0NA 1LROA 3NGJA 4IOTA 2DZXA 4LS1A 5ABTA 1JULA 1RQHA 5BMWA 2FB3A 3P61A 3M5ZA 4RXFA 3P81A 4BI5A 4TO8A 1H62A 2V5BA 4KFPA 3E0IA 2Z2UA 5FEWA 3O8AA 5FF2A 1EX5A 3PG9A 1ICQA 3LDVA 3EX3A 3I7SA 1TTQA 3A22A 1B4KA 3MW7A 3RLUA 1GT8A 3UY7A 3ABSA 3IRDA 1WYIA 4N02A 2QJIA 1DVJA 2FTPA 3DXIA 3W86A 3BG5A 2QCHA 3DI1A 3K30A 1I2PA 2QDGA 5D33A 2ZCGA 3W85A 2ZRUA 5K7JA 3PM6A 2KZHA 4HPXA 1K8ZA 4JTIA 1V5XA 3CB8A 1KV5A 1L9WA 3MI3A 2NUYA 2Z6JA 3WK1A 4P2VA 1VCVA 2DZTA 4ZQOA 3LGEA 1H63A 4E38A 3G1FA 3ATYA 3KRSA 1OF8A 1Q6RA 3KOFA 5LZLA 2JKPA 4JGDA 3N9RA 3QM3A 1W5MA 1W56A 3W87A 4NX0A 1N8FA 3O16A 2P1FA 1AG1O 5EMUA 5DCDA 3G1DA 3QQ1A 4UMAA 1CX9A 3G1AA 4K6AA 4TU1A 3SZ8A 3IVUA 3UWWA 5EL1A 4IPJA 3C4UA 2Y6ZA 2J9ZA 2CLIA 2QUTA 3MYPA 3LHZA 5KMYA 1EP2A 2CLFA 2YW3A 1V7YA 1PHWA 3QSRA 3R13A 4R33A 1YTEA 4CNNA 3P84A 4E2BA 1EP3A 3G0SA 5U7SA 1OABA 4IWWA 4LRTA 1G7VA 4BR1A 2AQWA 4XKYB 3UZ5A 2VFDA 4MFEA 4HKPA 1QOQA 3W7OA 2X2GA 5EPDA 3JR2A 1DJNA 1MEWA 3W70A 1TQXA 3TW6A 7TIMA 1DBTA 4NXKA 3G3MA 2YDAA 1ZENA 5BRBA 2JKAA 3W22A 2CWNA 3IIPA 1TPFA 8TIMA 3QRHA 4NNCA 1VR6A 3MJYA 3GK0A 3N2XA 3LERA 1C29A 3LX9A 4JTUA 5CSSA 3RNDA 3CIWA 3L68A 4N2YA 3T55A 1H1YA 4IMGA 1U5JA 2PRHA 4O28A 4O54A 4M19A 4BK9A 3G22A 4KFNA 3N3MA 3LCGA 3W7MA 1KA9F 1OJXA 2GVLA 3M0ZA 3W1PA 4LT9A 4PFMA 2Q8LA 1WBJA 1SZEA 3NM3A 1RQBA 4QJ1A 2YR1A 5HMSA 1RQEA 4O15A 4RXGA 2VEMA 1WA3A 3LI0A 3W7LA 3TAKA 1OVDA 4WOQA 3LCWA 4MUZA 1EUAA 2HTMA 2A6NA 3KX6A 4PL1A 3TK7A 1KM2A 2I1OA 2I9EA 3L5AA 1H50A 4K8HA 4MZYA 3W1TA 1JUBA 4MOZA 1JCJA 4NQ1A 5IBXA 3GLCA 4I7UA 1TO3A 1ZCOA 3HIJA 1LDCA 5CPNA 4K37A 1TTJA 1NAL1 4HT3A 1ZFJA 4LC6A 1MEHA 1TQJA 4OBTA 4GJ1A 1OFOA 4HNTA 2VFHA 1KM1A 4HNNA 3RLVA 1Z48A 1FDZA 3BGJA 3KVJA 1IXOA 3TMLA 2ZZ2A 2H8XA 1DV7A 3W7HA 4UTTA 2RDWA 5C5YA 3TR2A 2YX0A 3C0JA 2QCEA 3MP5A 1GVRA 3HGJA 3NZRA 1W3NA 3AJXA 2JGYA 4LW7A 4TMCA 5K4XA 1G7UA 4M7TA 4MY1A 2ZRYA 3CTLA 1JRBA 3LBMA 5TQLA 1F74A 4FX8A 3TC6A 1PCKA 2G96A 4O52A 3PAJA 2V9DA 4I7VA 4EWND 3G1HA 4HIBA 1FCUA 2PURA 2V2DA 3AO0A 2BSLA 1Q6OA 3A5VA 2OX1A 4RZ6A 3W7KA 1IGSA 1RV8A 2YYUA 2C19A 2B7OA 3CLMA 3FKRA 1R2TA 3O15A 1H51A 1UB3A 3ABQA 3NM1A 4QIUA 2ZRZA 4GWEA 2EHHA 1ALDA 1KBJA 1LBLA 1Q45A 2YSWA 3Q37A 5DY2A 1VHNA 3A24A 1FCBA 4FO4A 3B03A 3O1NA 4KWVA 3C3NA 4QITA 5A8GA 3PG8A 3Q2DA 2VELA 2ZDRA 3OBKA 3GAYA 4A22A 5BMXA 3DKJA 3W7GA 4EOUA 5G2HA 5KZDA 2VFFA 4EIVA 1QPOA 3TNOA 1HL2A 1OF6A 2F7FA 5GVJA 3PWAA 3LHUA 3TXZA 3BLEA 3A23A 1EIXA 4ZQRA 3LLFA 3CWOX 1Y0EA 4MJMA 2FPTA 1I2OA 4YLWA 2ZRWA 5D2VA 4O50A 4LV9A 2NUWA 5FESA 1DHPA 2QJGA 3MP4A 3W2UA 3LCXA 1G4SA 1RD5A 3W72A 4DF2A 1XI3A 5D05A 2C0AA 1T8XA 1IXNA 3OHIA 4DBEA 4A29A 1QPRA 2CZ5A 4CQ9A 1WX0A 3HPSA 1LM1A 4GRSA 1W5QA 2ZTKA 3LCIA 2NLIA 4O18A 3PY2A 4H6KA 4PA8A 2DZVA 1UBSA 2Y61A 5H2ZA 2FFCA 3ABRA 1YYAA 5DCBA 4JTGA 4IUOA 5AC8A 2ZQ0A 1CI1A 2CZEA 3DAQA 2HSAA 3MBFA 1SFLA 2YW4A 4Q32A 3LHWA 3HGRA 5LHFA 2E5CA 3O6CA 2YFOA 2Y89A 4JTSA 2H6RA 4NZJA 4UFJA 2Y70A 1FQ0A 2ZZ7A 4UFMA 3W1LA 1RZMA 5LGXA 1FCVA 5K3VA 3G24A 3RMJA 2EKCA 2R91A 3CM4A 4AMAA 1G6CA 1W3TA 4MPQA 4DXVA 4AHPA 4GUHA 3WFAA 1H61A 3GKAA 3S5NA 1GQNA 4A2RA 3T4CA 1FDJA 2A4AA 3QW3A 4GBUA 5G4EA 3UWQA 4JY9A 4H3DA 2QCMA 5LNVA 1ICPA 3GAKA 3W6YA 3LBCA 3HGOA 3QJAA 3QQ0A 3M5YA 4RX0A 3CEUA 4O19A 3NQEA 4O1CA 4I9AA 4HN4A 3W1UA 1JCLA 3LB0A 1S5WA 3GIYA 2PRMA 1JVNA 1RPXA 1SW7A 3W75A 4LV4A 3M6YA 5EYWA 4L4MA 2GUUA 3UWZA 3EX4A 4NU7A 3W23A 5CG7A 4DF1A 1S5TA 3JS3A 4BI7A 4K39A 1VGAA 5DCEA 1KFBA 1GVOA 1KBIA 4QNWA 5CZ0A 4UFLA 1O4UA 3L0GA 1SW3A 1TV7A 3OA3A 2YCEA 5LHEA 4YL2A 5G4WA 1XBZA 4C1KA 3NQ2A 3S5YA 3L67A 1GVSA 4IMEA 3FFSA 4RR4A 1FDYA 1VYSX 1GYLA 1PV8A 3HG3A 4NXSA 5E0KA 1DKWA 3LLDA 4WZHA 2J9YA 4O14A 3STFA 2DZWA 2FPYA 2DJXA 3C2EA 4GE8A 2ZRVA 3O07A 1W5PA 4LVGA 1AL7A 4LTSA 4XKYA 3QSTA 3ABOA 3LM7A 4CQ8A 1QR7A 2V8ZA 4GUGA 2V2CA 1GPWA 3BGGA 1CW2A 4O13A 1SUXA 3W1AA 4C1LA 2QUUA 4X2RA 2PE4A 1X8FA 3S1WA 3LI1A 1K7FA 2BLEA 3GNNA 1VC4A 1AW2A 1VH7A 4ADSA 1FUYA 2ISWA 3L2IA 3G1XA 1KLZA 1IIHA 3W7RA 4DO5A 1DQXA 2WNQA 4EVZA 1QCWA 2JBMA 1OK6A 1S5VA 4JX6A 3TUUA 3DFOA 2OT0A 1G67A 3KFTA 3W7IA 2QCNA 3QMTA 2QDHA 1Z44A 4IXHA 3S8HA 1JR1A 3P80A 3FJLA 3IIOA 1BWKA 4O4VA 1UJPA 1JRCA 4WOZA 5CZJA 4HSNA 3E49A 4Y6GA 3OVRA 3LXCA 3U2OA 1OFDA 1FX6A 2J27A 5HUOA 1XM3A 4N4QA 4QNEA 5CKSA 4DEFA 3NQVA 1J5TA 1OX4A 1YDNA 1J2WA 1VLWA 4ZVJA 3MBDA 3I6RA 4UXDA 3CWNA 3C2OA 3B0VC 2A5HA 3P74A 4X22A 3TU9A 3B04A 3W1NA 3GDTA 2A7RA 3TC7A 3C56A 3STEA 2AAMA 4RCXA 4TX9A 1P1XA 1SZFA 3PUOA 1G4PA 5D32A 1TPEA 3H54A 5LGZA 1Z42A 4OE7A 1R30A 2C1HA 3IIXA 3M41A 4FNRA 3LV6A 5KINA 3R2GA 5LNSA 2RH9A 3FA5A 4AVFA 4ONVA 4X3ZA 5AHNA 3USBA 3HQ1A 1AK5A 2CU0A 2ZA3A 3GB6A 5F2GA 5F4WA 1EA0A 2BTMA 1EUNA 1DORA 4YCPA 3DU0A 1JQVA 5AHFA 1R2RA 4L4LA 4CCCA 4DPPA 2Y7FA 3UQNA 4LRSA 2DZSA 1PE1A 3TIMA 2QAFA 3GR7A 4DELA 1SO4A 5F2IA 2DZUA 1P4CA 3TH6A 1X1OA 2DJLA 5J5RA 3UD6A 3QPYA 5HWNA 1GVQA 2FLIA 1KV8A 1FXQA 2WOQA 4UNLA 4JD4A 2GOUA 4WUIA 3SJ3A 2QCDB 3HB9A 4S2BA 1OX5A 1PL9A 1A5CA 5FEPA 4AH7A 1XDMA 4JX4A 2FPVA 4FNQA 2RKXA 1GOXA 3BK0A 1OFQA 1KFJA 3RU6A 1TJPA 2A85A 3VE9A 5LKYA 2WO5A 1W1ZA 4AHQA 2X1UA 4IPIA 3P7YA 1LZOA 4YWIA 3W7DA 1QPQA 2H3BA 3FIGA 4UTIA 5DELA 1MXSA 4WY0F 3NDOA 3KXQA 1TYGA 4Q4KA 4MY8A 4FF7A 4ADTA 4PCFA 2CZDA 1KM6A 1LOLA 3GDRA 3PS7A 4UTKA 2OT1A 4NJGA 1EP1A 3NVTA 4FNTA 3FYPA 2GQ9A 3T78A 4WQ6A 2JK2A 4NJJA 2HS6A 1I8JA 4A3UA 3OEXA 1Q6QA 4JTHA 1TTIA 4FXRA 4JTJA 3FYOA 3OVQA 4LC8A 5EKYA 3L5MA 1W31A 1OYAA 1SPQA 1VYPX 1GEQA 5C55A 1B4EA 3TFXA 3P62A 5K9CA 3F4NA 5BNKA 2GQAA 3MWAA 3EXTA 2V2HA 3SI9A 4JN6A 1KLYA 4RLIA 2W0UA 1X7FA 5G1TA 3TQ0A 1OHLA 1U83A 1KW1A 2Q8ZA 5I3GA 2C6QA 1B9BA 1HO4A 1EPXA 3S6DA 2OJPA 1A5BA 1YTDA 4MKNA 3DKLA 3W76A 1WAUA 1OG0A 5G5IA 3KVLA 1XXXA 3L0KA 4LS0A 1DOSA 1K3UA 1TV8A 3PBWA 1ZY9A 3PSWA 3G0UA 1FWTA 5EBUA 3O06A 2ZFAA 1F76A 3NPUA 3G8EA 3NL3A 3W1MA 1YPFA 4Z08A 4Z0SA 4PEKA 2QCGA 1SO6A 2RDTA 3PUDA 1ZAHA 3ZFHA 2JKEA 1H1ZA 3G8RA 3HG5A 3U8GA 4O1AA 4JIPA 3W07A 1B3OA 5K9XA 1HUVA 4K7YA 1L6SA 4ICNA 1OFRA 1TCDA 3GDKA 1W3IA 3W73A 3LTSA 1D3GA 4MZ8A 2WPBA 6ALDA 4OT7A 3RF9A 3P8IA 4O16A 1K8YA 2C18A 1FWSA 3F4WA 1XBVA 4G1KA 4CQAA 3EX1A 2DZPA 2D73A 1SFJA 2WSRA 2E09A 1Q3NA 1SO5A 3HPZA 3THQA 4AAJA 2R14A 4O0ZA 1LRQA 3EWYA 4U4MA 5D2TA 1I2QA 5AYYA 3L21A 5LNWA 2TPSA 5K2ZA 3SIZA 2YYTA 4UTWC 3MHFA 1TB3A 1J4EA 3TSMA 3PF3A 1OFAA 4RZ4A 3LHVA 3QMSA 2I14A 5C6MA 1O5XA 4MZ1A 3RK8A 2V81A 5DXXA 2QCLA 3TSBA 3GR8A 3T44A 3DHDA 2XN1A 1XC4A 4FNPA 3WJXA 4GUFA 3LXAA 4XZ9A 2QAPA 2Q3OA 4QQ3A 4NVTA 4O0KA 3QC3A 4NZFA 3R12A 1DQWA 1F6KA 3T7VA 4AHOA 4ORMA 2X16A 1UUMA 3MHUA 5FF0A 1VYRA 1VRDA 2FDSA 3NPVA 3PB2A 4UMCA 3NQMA 4OHQA 1QNVA 4FX6M 3GXNA 1AMKA 4B5NA 4O53A 3ZR4A 4NJHA 1QO5A 4CNOA 1IIGA 3O63A 4EF9A 3T40A 4UMBA 4LNYA 4OQVA 4JX5A 3TCEA 2Y7DA 3P5YA 1VCFA 3KRZA 1JUEA 3TQVA 2WV8A 3B4UA 1WQ5A 3P8JA 1H7XA 2GPTA 3DGRA 1JUKA 3KAOA 4UTLA 3QPZA 3DZ1A 1JQXA 1S3HA 4AB4A 3W1QA 5IBXC 4DPQA 4ZMGA 3TA6A 3NR0A 3QYQA 3W7EA 4PC8A 5I3IA 3W74A 2DORA 1LRNA 1TV5A 4O12A 1YADA 1O60A 2B0MA 3QZEA 5KZEA 2ABAA 3CQ0A 2ZRXA 4AWUA 3M5VA 3EWWA 3GXTA 2ZBTA 2H8ZA 3KHJA 4IMFA 3EX2A 1H7RA 1LBFA 4AWSA 1ZJIA 4UFIA 1W8SA 2DP3A 1ME7A 2BX7A 1HFBA 4PL2A 1A5SA 3KVMA 4UTTC 3N2MA 1DJQA 3L65A 4O8RA 1Z41A 3SGZA 4HSOA 1NEYA 1OYCA 5U4NA 1MZHA 3DBPA 2E77A 2EGZA 2CLEA 1ZAJA 4CNPA 1TJRA 4KKXA 3GDMA 2Z0IA 3DFSA 5D38A 3UPWA 1MEIA 1KM3A 3NL2A 3W71A 2GQ8A 3B8DA 4HPJA 5HINA 4CLMA 2VFGA 1ICSA 3NEVA 3WK3A 1TPWA 2NX9A 4WXZA 4DO4A 5DN1A 3WJSA 2IQTA 4R34A 5HUPA 3PBVA 4JR5A 1I2RA 4NT0A 4LVBA 1FXPA 3GZ3A 1XKYA 1P0KA 3R8RA 1H7WA 3YPIA 1SU5A 4WY0B 4PTNA 5LNUA 3NOEA 4RZ5A 3MI2A 2R8WA 2CLLA 3C2VA 3OIXA 3BO9A 3I65A 3THAA 5HR7A 5CSRA 3M9YA 2B7QA 4CCDA 1ADOA 4MVAA 5E1QA 2VOMA 4BF9A 1A50A 3GNDA 1SW0A 4AWTA 2QCDA 1SSDA 3DH7A 3LTYA 4XWUA 2V30A 4PH6A 5F2MA 4UFKA 4A2SA 4ZQNA 4LY8A 4PODA 1MO0A 3UY8A 2P10A 2XFWA 3LOTA 4BFAA 3NA8A 1K03A 5K4ZA 1EWEA 4KFOA 3NQCA 3DHFA 5DBUA 2B4GA 3GYEA 3FEMA 3WJYA 2QJHA 4OV9A 3B06A 3TAOA 5D2WA 4N9CA 3W7JA 3PR2A 3N19B 3EKZA 4CCEA 2VXNA 2H3DA 2NX1A 1YDVA 3CEPA 3W83A 1W54A 3W9ZA 2HS8A 1TRDA 5I3HA 3UYCA 1KFLA 1K7EA 2O7QA 2VEPA 3P5ZA 1FWWA 1W5NA 3TROA 2XN2A 3M47A 4RKAA 1NF0A 3L66A
chains in the Genus database with same CATH superfamily
4C7FA 2W63A 3SFWA 2Y24A 2A7NA 3QGAC 1DJIA 2TRSA 3NURA 5C9XA 1XUUA 2RHGA 2F6KA 1J01A 1PCWA 1PWLA 3MV11 3ZM8A 1LBMA 2VMFA 3L5LA 2IUZA 4C7GA 4Z2HA 2P0OA 3FJNA 4HB7A 3K46A 1KFEA 3AMKA 1IXQA 3OQ8A 1HJWA 4KRTA 4W8LA 1KRAC 3MUCA 1EKOA 4M6VA 2PA6A 4MYXA 1BWLA 3TYUA 1P0NA 4RDVA 3N73A 1F73A 5EMJA 3SSJA 3LRKA 3TXVA 1S5MA 3KHDA 1ML1A 3BG3A 1PHQA 2XWDA 4S3FA 3QBUA 2DUAA 1VEMA 2RDUA 4EPEC 2PDUA 2FVLA 4PMRA 5CPMA 8XIMA 4QX4A 1YPIA 3UXDA 1O5RA 3NQFA 4DQWA 4PEEA 1U1JA 1YMYA 4LEQA 1US3A 1TPUA 1VCGA 1XSJA 4L61A 4BQ4A 5A5WA 1GWJA 2EPHA 4DBWA 4UUIA 2W27A 1MW1A 4FEZA 4C6IA 1D9EA 4AXNA 4D6DA 2CLHA 1C8XA 1JD7A 4HCLA 2ZIDA 3BQ6A 1R3YA 1BVNP 1BXBA 4XQ6A 4HOWA 3N14A 3NTYA 4PUDA 3OBAA 3EOLA 1ZP3A 3N17A 3WEMA 1H5VA 4UTMA 1R7OA 3SECA 2HEJA 3SCQA 4GI6A 4PUUA 3G18A 1SZGA 4BA0A 2QR6A 1R47A 4R7OA 1JD9A 2GGJA 4HP5A 4DB7A 4XZMX 1HG3A 3FDKA 3LHYA 4DVOA 2O4MA 1C93A 3WLNA 2WZMA 3HGSA 4RDYA 4JIQA 1F7BA 4HU4A 4JIRA 1OINA 2VX7A 4ICCX 4PE8A 3GU1A 1D2KA 4BWLC 4Q4OA 5AHEA 3WJWA 5C70A 2BHZA 2XN0A 1H7OA 3VNKA 1KC7A 1V03A 3EA2A 1S3TC 4GNVA 4CU7A 2J7BA 1Q6DA 1KWGA 4A3HA 1F3TA 3DHPA 3SRKA 2Z4GA 2FGZA 2F38A 4HCDA 3ZO9A 3H55A 1RD6A 4N9DA 3EKGA 2OOFA 1VF8A 2V3GA 3UF9A 3EOEA 1X98A 5AYIA 3KCLA 3UZXA 3GH4A 2YOCA 3WLJA 2PUZA 3BLIA 3TKFA 5F1VA 3PVFA 2C3ZA 2Y7EA 1JZ4A 4WD0A 4JY8A 5AECA 2J24A 2J4GA 2HRWA 4X0NA 2TYSA 2PRLA 3KDOA 3ZWSA 4LUSB 4LVFA 3HQNA 4AD0A 3ZR6A 2WMKA 1XIGA 2CLKA 1TPH1 4KRZA 2FIQA 2GGHA 3SCPA 1XLIA 5H91A 4IXXA 1SZRA 3K13A 3MO7A 2OGYA 4Q4PA 2DGAA 3BAIA 3G1VA 2REQB 1KFWA 2DH3A 1XGZA 3HG4A 4NRSA 1FBAA 2Z1VA 2R82A 2QKFA 2BVTA 3IJIA 1TTPA 3MWCA 1VBHA 4TVDA 4KEZA 4QM1A 3B9DA 1DWGM 2C13A 3BCDA 2VX5A 5CPTA 2A0NA 1NQKA 3KVKA 5HJXA 2PF8A 2G37A 3DX5A 4YMZA 3EKLA 4XX6A 1CENA 3WIJA 1ZGDA 3L4YA 2CC0A 3TDFA 3DUGA 4UTHA 3URQA 3QOKA 1R3QA 4QG9A 3TW9A 3Q58A 2G4FA 4PUEA 3GFYA 2XGIA 4KWWA 4US5A 1N8WA 3ITTA 3WNMA 2PZ0A 4Z1BA 3B8WA 4MYAA 1E0XA 3AI0A 2CW6A 4Z0JA 1ZNNA 3UR7A 2E6AA 1OX4B 4XUGA 4LWWA 2UY4A 1EFZA 4M82A 4Q7BA 1NP2A 4YU1A 3C61A 3BW2A 2HWGA 3ELFA 1GG0A 5CZTA 4IF2A 1UZ4A 2E7FA 5HULA 4GFSA 1BKSA 1CB2A 1ELSA 3KOXA 1O94A 4BI6A 3AIWA 3DYMA 4RJEA 4U5KA 3TYAA 4AG0A 2BOEX 2TSYA 3W3OA 4DZAA 2RGLA 5BOEA 1TRIA 1LLZA 1WKFA 1JCNA 3OOQA 4N9EA 2YCLA 4IIEA 4GO8A 1ONRA 2F84A 3FDGA 1I60A 1M5WA 1T96A 3A4AA 3SR7A 1PVNA 1GOMA 3LV5A 1Q6GA 3UPBA 3N6QA 3MYOA 4M24A 3D6NA 4JS3A 3TMQA 3SCTA 3LCFA 5FEXA 4N42A 4MWAE 2NX3A 2EF9A 2ALDA 1PIGA 4ZQCA 5AC5A 4AY7A 1OFPA 3LRMA 5LIKX 2ZUNA 2NSOA 4JTTA 3QW4B 3A4JA 3D47A 5FEZA 4MFDA 4H19A 4KT2A 2PTYA 4P5UA 3DDMA 4G7FA 3S5ZA 4O1EA 2R6OA 3MMDA 3S1XA 2BOGX 4UFHA 3WF1A 3NO5A 1OCQA 4JNMA 2XH4A 4DBDA 3XISA 1WUEA 4NIRA 4CN6A 2HBXA 3PNZA 3T9PA 2YFNA 4MPKA 2PCQA 1V6VA 5D8ZA 4CNTA 2R94A 1IT0A 4DJED 1TVLA 1GQLA 2ZZ6A 2G5WA 4JTAA 4M7SA 5G2IA 3IV8A 4UCGA 2PWFA 2OWXA 2JE8A 3S42A 2Y62A 3BJTA 1OK4A 1ZS2A 1HO1A 1R46A 1FOBA 3SADA 4MLRA 3OZPA 3W6MA 1K77A 4EPDC 5CLWA 3BLPX 2JALA 5LA2A 3V3WA 4WKFA 1Z9AA 1FH9A 2PODA 3RCMA 2NXIA 5FKYA 1XFBA 3QVQA 3NO3A 4MNKA 1KFCA 3GVGA 3I3EA 1LL6A 1TWIA 3WJZA 3UNDA 3B8TA 3M1ZA 3ALFA 2DEPA 2XU2A 1QOPA 1DQUA 3P14A 3PFRA 5D2YA 4DYJA 4IG2A 2ODOA 3STPA 1U5HA 2J88A 4MNMA 3PK7A 3O6YX 5JH2A 1FWAC 5BXSA 4DZHA 1YDYA 1QWKA 1TPVA 2V5LA 2P50A 1Z3NA 3HPAA 2XIJA 2FJKA 4Z2IA 4UR8A 2CESA 4UOQA 3WH7A 3EOSA 1JAEA 3T1GA 3C2RA 3A9IA 1L6WA 1TG7A 3SCNA 4A3QA 3L9CA 3GC2A 1A5MC 4Y9AA 2VGGA 5AHIA 1VLIA 2OXNA 4NP7A 1QFEA 3FGCA 3TZNA 4C6QA 3O05A 3VUPA 4B4FA 2NWRA 3EWZA 4B5XA 1DJXA 4JFWA 2VCAA 3B0PA 4Q8OA 3F2DA 3BMVA 4W8BA 1LG1A 2Z1XA 2QV4A 1FWCC 2ATMA 4F48A 3D0CA 3VKCA 3BZJA 4O57A 4AISA 2Y88A 3IV3A 2EEXA 4Y8EA 1JL8A 5REQB 4D71A 3OYXA 2PDIA 3IJLA 4HMCA 4Q8VA 4Q6XA 1AUSL 3EGJA 1ENUA 1ITUA 2X1RA 3U7VA 2WSYA 2IQDA 3GE7A 1TV3A 4GUIA 1W3HA 2VR5A 4M6PA 4A8IA 4UTJA 2G97A 1TX0A 3V1HA 3B4YA 3TQPA 3VIOA 4DHGA 2TMDA 4DO6A 2OQYA 1O5KA 3RRAA 4LQ1A 2D3LA 4JQ2A 2F6XA 3O6DA 1XQKA 4MHBA 3EMZA 1M53A 3IGXA 3F5JA 1K8XA 4HHPA 1RCOB 3BMXA 3I68A 3BPWA 3VD7A 2ASHA 4GZIA 4BWLA 4MJ4A 1K9EA 1NWTA 3IAQA 1A3HA 5HATA 3EWCA 1W1B1 1WKEA 6TIMA 3TYCA 3LCLA 3N04A 4GIYA 3N34A 3HV8A 2J47A 4DM2A 4FR1A 3I7QA 4PN2A 3IVTA 1T5AA 2QCFA 4PR4A 4JDYA 2HV5A 1H1NA 3BH4A 1HL9A 1PS9A 3UR2A 1FWBC 2ZKMX 1QAPA 3VIJA 1B1YA 3QH2A 2IKGA 4PUKA 4MLJA 3EWXA 3GS6A 3VPLA 2FQIA 4D6GA 5I3DA 3GKFA 2CHRA 1P5BA 2WHKA 3T42A 4ZGYA 2DZXA 2CPUA 4JIEA 1LWHA 2QPXA 2AGTA 2NQLA 4WJ8A 4INFA 2V5BA 3KCOA 3DBNA 3FSTA 3HFTA 3RILA 5F7UA 2WJDA 3GRIA 1EX5A 1E6QM 2VX4A 3MO4A 4PTWA 2NQHA 1B4KA 4AD1A 3MW7A 5BU9A 3EDJA 5LIYX 3NWRA 1WYIA 2FTPA 2WBKA 1PX8A 3K30A 3MDUA 2QDGA 4K1WA 1P6BA 2ZRUA 3IJ9A 4IMAA 1L9WA 1TELA 2NUYA 2Z6JA 2ZADA 3LGEA 1XLKA 4W85A 1H63A 4DBUA 1Q7ZA 5FJUA 1Q6RA 5LZLA 1Y8BA 2JKPA 1W5MA 1W56A 3W87A 4NX0A 1RUSA 4DI8A 5DCDA 3ALGA 1C92A 3IVUA 1OIMA 3W00A 1KRMA 3SAZA 4IPJA 3W37A 2PLCA 3H2NA 1LWJA 2JF7A 1W3JA 1WDDA 2PTXA 3MYPA 1XLBA 5KMYA 1IHIA 3WY1A 5T91A 3QSRA 3R13A 4R33A 4AYGA 3ES7A 3SCUA 1C90A 3M7SA 4AMCA 1OABA 1BXNA 4TV6A 3VDGA 3PJXA 2NVDA 3UZ5A 3VOHA 4CD4A 4LX4A 3AWOA 3TNBA 4HKPA 4MNJA 7ENLA 3CBWA 4BEQA 1AFSA 3W70A 1TQXA 1JDCA 3MVTA 4AUBA 1E4NA 2D2HA 5BRBA 2ZXBA 2ANUA 1TPFA 2HVMA 4ACZA 2QJNA 3N2XA 3LERA 3RNDA 2OLHA 3GHUA 3T55A 1J10A 3DOPA 1OGSA 1A49A 4H9ZA 4BK9A 4QDMA 3N3MA 3W7MA 2QVNA 5XIMA 1QI2A 1UROA 1OJXA 3ZVHB 4AZCB 1JEZA 5BXPA 4KESA 3GWQA 3U7BA 3DC0A 3ZIZA 4TUFA 3NM3A 1RQEA 4O15A 3TAKA 1OZMA 3SY1A 2PF0A 4H9VA 2UY2A 1TJ1A 3GTXA 2VRQA 3CQIA 2ISDA 3TTQA 1FHUA 1HQTA 4WK9A 4LF1A 3K8MA 3KTXA 1E73M 4K8HA 3W1TA 1JUBA 4P7OA 4I7UA 3DN5A 1OGGA 1FWDC 2F9RA 1FWIC 3AYSA 2W92A 3G6MA 2GK1B 5E5CA 1TZ7A 1ZFJA 1QUMA 2E25A 4PMDA 2Z2AA 1E1CA 1OFOA 1KM1A 1Y5WA 4H9TA 3DFYA 1XICA 1Z48A 4KCTA 4J7RA 1G0CA 1GPFA 3VAVA 1PKNA 4UTTA 4HNCA 3C0JA 4U3AA 4LW7A 3BE7A 4MY1A 3LU2A 3CTLA 1UD3A 5TQLA 1F74A 2J6VA 2VDGA 1PCKA 4AWEA 2WC4A 4HNOA 3S6OA 2PDJA 4RNIA 2YA1A 1FWFC 1XJBA 4HPNA 3A5VA 1CPUA 4RZ6A 2QLYA 1J8VA 3QY7A 1RV8A 2X7VA 3ABQA 4LGXA 4D8LA 2G3NA 4GWEA 2EHHA 4OTKA 2VZSA 5DY2A 1XD1A 1CEOA 1KGXA 4IL2A 2AL1A 2UWFA 3VA8A 3B03A 3SIMA 1S2WA 1IWPA 1QJWA 2AQVA 1ZZMA 4A22A 1X96A 4NKCA 5KZDA 1NU5A 1QPOA 1R86A 3TNOA 4AZHA 4RE2A 3GTHA 3CWOX 4DWSC 1Y0EA 4XAYA 1W91A 1KQYA 1PZ2A 4GX9A 1DXEA 1C91A 1WDPA 3PN8A 4LV9A 5CCZA 3LQLA 5C2GA 2QJGA 4KGLA 3GG0A 4AX7A 3LCXA 2PGFA 3GXIA 1RD5A 3R6IA 3W72A 1XI3A 2VDIA 2C0AA 2BHUA 1T8XA 2INZA 4D6JA 1QPRA 1QVBA 3BLDA 3CUJA 1NWRA 4XO6A 1LM1A 1W5QA 4PCNA 1XCXA 3LCIA 2QYGA 3S2CA 2OFJA 2Y61A 2FFCA 4ZOAA 4IUOA 4MMWA 2BASA 1MMFA 1MVYA 2ZVRA 1CI1A 3L4UA 1GYMA 3LHWA 3HGRA 3WQ6A 2D2GA 5LHFA 2E5CA 3MU7A 4DN1A 3R8HA 2YFOA 3I4EA 2HJPA 4UFJA 2ZZ7A 1OBAA 5H1WA 1RZMA 5LGXA 3SUTA 3MCMA 3G24A 4H9XA 4XD4A 2EKCA 4HYWA 3AROA 3GXMA 1G6CA 4GX8A 5HJYA 4LYQA 4DXVA 1A0DA 3VZYA 1RK6A 4NAFA 3OYZA 1AZ1A 1H0IA 1HJUA 1Z7AA 2PBOA 3WFAA 5A1AA 1DJZA 2D20A 3S5NA 1FDJA 2VVNA 1EPVA 6CGTA 2Z28A 3U0HA 2DVUA 4GBUA 4JNYA 3B8UA 2QCMA 3W6YA 3QQ0A 3FX4A 3CEUA 3NQEA 1KKRA 4O1CA 3W1UA 1JCLA 5CBJA 3I3BA 2KAUC 3GIYA 1RPXA 1JZ5A 4IIGA 4ECLA 4J27A 1V02A 3O9NA 1G94A 3CHCA 4B9YA 4EK7A 3W23A 1Q85A 5CG7A 1L8NA 4DF1A 3JS3A 3PTDA 2Z29A 2BB0A 3OW1A 4IFRA 1KFBA 3IANA 1GVOA 4BS0A 5JBDA 1I1WA 3L0GA 1UWSA 1TV7A 3OA3A 3D5HA 3LK6A 5J04A 1GVSA 1J6OA 4IMEA 4QXIA 1EH9A 1KRBC 4QP0A 4W93A 1M04A 1PV8A 1JPKA 3F5LA 5E0KA 3TR9A 4OBSA 4LUSA 3UEQA 2FFIA 2DZWA 3HMCA 3MKCA 2FPYA 4LUTB 3QHOA 1KNWA 4MWAC 2ZRVA 3O07A 2WJEA 4XKYA 3QSTA 4GKLA 1QR7A 4GUGA 2V2CA 5FOOA 7A3HA 1CW2A 4O13A 4LAUA 4H9MA 3W1AA 4ACYA 2GUYA 3RLGA 2VRJA 3LI1A 1K7FA 3OODA 1VH7A 3A47A 1UP0A 3PZGA 3UXIA 3U5YA 4YNGA 1Y5XA 1Q65A 1A4MA 2BGNE 3ECQA 3URAA 2JBMA 3BOLA 5BWFA 1JZ8A 3TUUA 3KFTA 3W7IA 2QPUA 2QDHA 1F9CA 3E0FA 4PMZA 4DBSA 1JR1A 3TZFA 3RHGA 3RIKA 3IIOA 3C0SA 1UJPA 5CZJA 5FJJA 4QG6A 3USZA 3T81A 3OVRA 3SN1A 3U2OA 1FX6A 3BWWA 5BZAA 2J27A 5HUOA 4OBRA 3VNYA 1J18A 4N4QA 2VD8A 3L4WA 4DO7A 2GYIA 4W4QA 1J5TA 1Z69A 4JIHA 2AL2A 1P6WA 1UD8A 3TN5A 3V7PA 1OX4A 5DRIA 2PS2A 2IXVA 3P2VA 4ZVJA 1R0MA 3GBDA 3UXKA 2WANA 1DXIA 6A3HA 3GU9A 1P1XA 1SZFA 4GINA 3R0KA 4DY1A 4DZIA 3ID7A 3IIXA 5LNSA 2R24A 4NYYA 4QHRA 3BAYA 5AHNA 3D46A 3HQ1A 4PMUA 4S38A 1UMLA 5AZ1A 4ICMA 2W3ZA 3B9NA 4X60A 5AHFA 5CC5A 4DPPA 4WIWA 3OIHA 2O0TA 4D6CA 1SO4A 1P4CA 2VEGA 2VC7A 5HPCA 1EBHA 4MWAD 4GPNA 2WOQA 1O6IA 2ZXQA 5GJMA 5FEPA 4WF7A 4JX4A 2RKXA 3UT0A 1NDWA 1BSLA 1KFJA 3RU6A 2GZXA 3GXDA 1MRQA 4PBGA 2QJJA 3QYSA 3W7DA 4MDOA 3WKZA 4UTIA 3KXQA 4QS6A 3VNIA 3ZMRA 4E4FA 1TYGA 7PTDA 5AKQA 3EOUA 1JYWA 4MY8A 1NJJA 4ADTA 2WHJA 4F2TA 3GDRA 1A4LA 5CJMA 4WKAA 3CK5A 2GQ9A 3GH5A 3WBXA 4CN1A 4NJJA 1XYZA 3WCZA 3MC5A 3M4HA 2X1IA 1Q6QA 3TONA 4JTHA 1XSIA 3CO8A 4EPKA 4FXRA 3FYOA 3MDWA 5CG0A 2HNHA 3QQWA 4M51A 5DQPA 1SPQA 3D3AA 1VYPX 2GVEA 1B4EA 3TFXA 5BNKA 1V3HA 1EGMA 2J13A 1DJGA 1OHLA 1IR2A 2OVLA 1U83A 4P7RA 2Q8ZA 5I3GA 2EKGA 4LH8A 1SJBA 3W76A 2FGLA 1OG0A 2XM1A 4JN7A 2GGGA 4DJFC 3POCA 1TV8A 1YRRA 5EBUA 4LNCA 2ZFAA 4I9MA 3G8EA 3WLRA 4H6RA 3W1MA 4JIIX 1YPFA 4Z08A 1V6WA 1EHAA 3ARTA 3ANUA 1XLHA 3AYVA 3II1A 3CAKA 3ZFHA 4GCAA 3G8RA 3HG5A 1Y65A 3FCPA 5K9XA 1NARA 4ICNA 3WLSA 4GC3A 3WLIA 3N12A 4CCZA 1J11A 3M0KA 4ZENA 1UZHA 3F4WA 1RJQA 3K4DA 2DZPA 1SFJA 1Q3NA 2QS8A 4DWSA 1L0PA 1LRQA 4U4MA 5D2TA 3D3FA 5AYYA 3L21A 5LNWA 2WVVB 2TPSA 5K2ZA 3SIZA 4NHVA 1TB3A 3UZWA 1J4EA 4WSHA 1PYMA 2ONEA 1YX1A 3WQCA 4YTUA 1GKRA 5CBBA 3TSBA 3GR8A 1E56A 3UNTA 4XZ9A 1QASA 2Q3OA 4NVTA 3KP0A 4LEFA 1F6KA 4S3KA 3T7VA 2PAJA 4C6NA 2PTWA 4ORMA 5BYWA 2WZHA 2NSXA 4QROA 4UMCA 3NQMA 1VJZA 2G50A 2DDXA 5JBEA 1AMKA 3JUGA 3BANA 4WDTA 1Q4NX 4O53A 4CNOA 3EA3A 2PP3A 2VD9A 1IIGA 4EF9A 3H22A 1VFHA 4GMEA 3AAMA 3WQ8A 2PGEA 4A8LA 2WV8A 3U4AA 4PMQA 1H7XA 1UKTA 4XIMA 4C90A 4XSLA 1TVPA 1E6RA 3CUIA 3QPZA 2XSAA 3DZ1A 3BSGA 3LY0A 4G9PA 1S3HA 1PO9A 1CNVA 4P7QA 5CQ1A 1QNPA 4UNIA 1YADA 4DJFD 5KZEA 1PIFA 5A6BD 4A3YA 2ZRXA 4AWUA 3SUWA 3BV7A 3GXTA 1UJQA 2GFTA 3W82A 1R9YA 1HF6A 1RPKA 2ZX7A 3APYA 3C0QA 1W8SA 2DP3A 3VZZA 1A5SA 3TWAA 4WDUA 1DJQA 1TZ9A 2OLSA 2PD5A 1Z41A 3SGZA 3DFHA 1NEYA 3M07A 3VIMA 2OSYA 3GFZA 1VENA 4KKXA 2Z0IA 3CJPA 2MNRA 4TV5A 4P7NA 2CZVA 3NL2A 4GHRA 3B8DA 5HINA 1LQ0A 2VFGA 4J2PA 4DRSA 4KBXA 5FL1A 1ICSA 3NEVA 4KGJA 4LANA 1S38A 4IP7A 1VFUA 1JCTA 5BWAA 3GNRA 2IQTA 1OD0A 5HUPA 3OLIA 1AD4A 1UD6A 1VJSA 4JR5A 1I2RA 3FJ4A 3ZXWA 1FTXA 1E40A 2E9BA 4AD3A 1SU5A 4WCJA 4C6LA 5LNUA 3NOEA 1S2VA 1REQA 3C2VA 3WQ5A 3O0KA 3M9YA 2L5HA 2EPLX 2D1ZA 1UKQA 4N7QA 4MVAA 4YYCA 1DXFA 3PZNA 4BF9A 2DT2A 3PANA 1YEYA 1B30A 1M01A 5I07A 3R25A 2Q8XA 3LMYA 5M1TA 3POHA 4UQCA 7XIMA 2Y4SA 1OGBA 4UFKA 2OKTA 3LLXA 4Q22A 3NIYA 4GY7A 4BZYA 4KFOA 1K9FA 2QIIA 1J0JA 2QJHA 4RNHA 4WSKA 3W7JA 8XIAA 2VX6A 4CCEA 2ZOXA 2VXNA 2POTA 3LYEA 4U2YA 2NX1A 2INFA 3CEPA 2C7FA 2SFPA 3GUGA 3CNYA 1W54A 2CXEA 5FJPA 4FAMA 5HNTA 1C8YA 4JQ1A 2VEPA 1FWWA 3I10A 1VIWA 3MB9A 4PMYA 3RN6A 2QGHA 4MTVA 3GYCA 2FHFA 4Y9OA 3UWUA 4G1NA 3Q4DA 3APTA 2DT1A 1MSSA 2FTWA 3VD3A 3MCOA 1P1MA 4U28A 3QGVA 3HM7A 4WKHA 3NQ8A 4AD4A 4EF8A 2OCZA 1IT8A 2VI0A 3MKVA 2VOTA 2VENA 3ISIX 2NW0A 5LA0A 3N9SA 3MTWA 4P61A 5CC7A 1OFEA 4B5TA 4HK5A 3W2NA 3ZVHA 1P6CA 4AZCA 1WKDA 3A3XA 4QR6A 3WH8A 3VMOA 2CLMA 1M7XA 2Z1BA 2Y1HA 4RV3A 1EA9C 2FKPA 3W2LA 3LXBA 3VIFA 3QFWA 4TMBA 4AXKA 3NQ7A 3W7PA 3ZJ8A 3IJDA 5DLCA 4HOXA 4PSRA 4EXQA 4ZOCA 2OSXA 5H6HA 1F2JA 1V8EA 1VFFA 3GXPA 3NZGA 1KFKA 3E0VA 6XIAA 3BG9A 1XG4A 1XF0A 3WMCA 4AIEA 3IJ7A 3CU2A 1L6YA 3HA1A 3ZJ6A 3OZMA 4LUIA 2ZX9A 4UQ9A 5A6JA 2YPIA 3VOCA 2ATSA 4O1BA 3VIGA 3RPTA 3PPCA 3GUWA 2E9MA 1D8WA 2EXOA 3NYZA 4MDPA 1XRTA 2AGKA 3DFTA 4Q3MA 1IEXA 3GW0A 3OGRA 4TOQA 1HJXA 1NVMA 1QMLA 4XIAA 3B8SA 1WCGA 3R5EA 3QY6A 3VIIA 1VS1A 2WJZA 1NFPA 1HGWA 5EMYA 2PC4A 3LGDA 2A2IA 3BW3A 2ZZ3A 1P48A 1XCWA 3HU7A 3M0MA 5CAKA 5DXYA 2VC6A 3NQDA 4MY9A 2C1GA 1V79A 4HHLA 3KUMA 1S2TA 1W9XA 1ZJAA 2OZ3A 4RK8A 5C71A 1GVYA 3ZLGA 3E3HA 2ICSA 3FJ6A 2CITA 5AC6A 3TTYA 2VFIA 1OB0A 2VCBA 4F9DA 2QQ6A 1YBQB 2YL9A 3VKAA 4FLOA 3CPUA 5AYXA 2VUYA 1MZRA 4KWOA 3WDIA 4UTUA 1PYFA 4DJDA 3I6EA 4Z17A 5E9AA 4HSHA 3BLKA 1W0MA 1KCZA 5E0CA 1H4PA 1A5OC 2CEQA 2P0IA 1H41A 4QGCA 4GUJA 3TJ4A 3VMNA 1CECA 1K02A 4XAFA 3BAXA 2G0WA 3FNDA 2E6FA 1YHTA 2V5DA 4HHHA 3GHTA 3WUFA 4RE3A 1B54A 1AODA 3H70A 3E02A 3XINA 3GVQA 1AW5A 2PBGA 4IJCA 4F0MA 1GNXA 2Y5JA 3AHVA 4N4PA 2IPJA 1QI0A 1CGVA 4XAGA 1EGZA 4V15A 4A4AA 3UWYA 3WDRA 3NO1A 4JHMA 1BG4A 1G69A 4YXGA 1XSKA 4L6OA 1ITQA 1OT1A 4MJZA 1DJHA 2R9RA 4NZ5A 1SO3A 2TAAA 2YZRA 3ANYA 3LPGA 1GOOA 4F0HA 2YL8A 1W6TA 2GJXB 3VNJA 2C79A 4YVVA 3N3TA 4MNLA 4PMVA 3V35A 4TIMA 4QAIA 4DXXA 3CH9A 4ZSUA 3UA3A 3CZLA 5TNVA 4JTFA 1ISZA 3IK2A 4WY0A 4S2CA 1CXHA 5F4XA 3KM8A 1KM4A 1Q2SA 5HXMA 3PZIA 4C1NB 4G8TA 5F2LA 3WQFA 1VFLA 3VYLA 3CIXA 4FNSA 1ISWA 3M43A 2IXUA 4TVUA 2X09A 1Q6LA 3B05A 3FYYA 3TW7A 1TUXA 4C6FA 1F5ZA 4RV8A 3ZZ1A 2WCAA 2HVNA 5IM51 2HQAA 5I3KA 3UU0A 1XBXA 4ADUA 3TC3A 2HDJA 4W8AA 3NYDA 3VCRA 2V63A 4HNLA 1FKXA 1DWAM 4IQLA 1YXYA 2VQUA 4W7VA 3W2KA 4Y2WA 4ZEPA 3Q65A 1RH9A 4HZMA 1HTIA 2PMQA 3EPOA 5LSMA 3QEZA 5FF7A 1PSCA 5K9DA 2WKGA 2C0HA 1GZGA 3G1YA 3HPXA 2OQLA 3W53A 2I7GA 3VM5A 2B7PA 5HWMA 1KR0A 4XBSA 3NQGA 1M7OA 1VPYA 3CQJA 4BKNA 3CO4A 3RAOA 2PC8A 4PZVA 2EQDA 5C7HA 5I3FA 9CGTA 4E2DA 2FHCA 3C2FA 3R11A 3OP2A 5AOUA 1SZNA 2NT1A 4M5PA 1NDVA 1V0KA 1WNOA 3H2OA 1DIEA 1KR1A 2VKZG 3EB4A 3S0CA 3TN6A 2D22A 3RYSA 3HMJG 5CZSA 4Z42C 3WNPA 4AD5A 1XDJA 4DF0A 2ISSA 1E4IA 1HKMA 1MUMA 3UZJA 1GK8A 2BZNA 4WRHA 2ZWYA 4JXCA 3IS4A 2WJFA 4EWJA 3HJEA 3NPXA 2E9LA 5IDZA 3AQUA 1QI5A 3H8AA 3M0VA 3NXFA 3P0XA 2C71A 3R4IA 4UR7A 5CPLA 1CXKA 4N6EA 4YJ5A 3NPWA 1T40A 3UGVA 1LTDA 5DMNA 1UWAA 3CC1A 3CPRA 2FB2A 2ZUVA 3V1PA 4WJEA 2O92A 3T08A 1SR9A 4L5ZA 4ZB5A 2J6XA 2YB1A 3RGTA 1ZAIA 3NGFA 4ROPA 4FIRA 1ZALA 2X1TA 4NZ4A 4U10A 3VXGA 3WD0A 1MW3A 2V82A 5HJLA 3VCCA 4YCOA 2A79A 1LRTA 4H9UA 4LPCA 3WD2A 4CKQA 4XG1A 5KTLA 1YXCA 5D30A 4R85A 4S1FA 1XV8A 4WDXA 1VHCA 2PI6A 1BTMA 4L1WA 1EF3A 2Y5SA 2QCCA 3FVMA 5ABHA 3S46A 2J25A 5CGQA 3B0YA 2XVNA 1OY0A 2QUNA 1FFRA 1ZUAX 4PYSA 2P8CA 3C8FA 3QR0A 3GTFA 4CN4A 4JYEA 1GTHA 3H24A 4GXMA 1I2NA 2FVKA 1R9XA 2VYOA 1FHVA 4S3DA 1O1ZA 2WVSA 1B0IA 1BYBA 3ARQA 3EDFA 3BL3A 5D2XA 5FSDC 5HR6A 3DEQA 2HMCA 3T2QA 3CTTA 3TJLA 3PB0A 1C9DA 6REQA 2V5CA 4LAKA 1KXVA 1OSEA 3BAKA 1UH4A 4AF0A 4GC4A 5I23A 1F3EA 3OHMB 2C15A 2ZX5A 2GVJA 3ARPA 1UKPA 4PCTA 1M6JA 3WK0A 1BQGA 1MUCA 4TVCA 4ZZ9A 1KCKA 1UD4A 1NDYA 3NL6A 3TV8A 3ITLA 4WEVX 3K4AA 3IIVA 2YCIX 3GG7A 4L9XA 3ZSSA 1XIDA 3W1XA 4UIOA 4D2JA 1VD6A 3R43A 1KM5A 5IXEA 4IIFA 2WW5A 3MZ2A 4FHAA 5AYBA 3T0AA 3S47A 2D0GA 2F61A 2QDDA 3L2LA 3S5OA 2IMRA 3RR1A 2JEPA 3PC0A 1B57A 2Z1WA 3REQB 2QEZA 4O0QA 5IFPA 1LLWA 3QF0A 5J8LA 3E1F1 4LUJA 2I57A 3E12A 2WC3A 4DAIA 5GQBA 2A3HA 2A6LA 4S3JA 3KEHA 1UIOA 3BARA 2VP8A 1TREA 3U3HA 4Z1AA 1ECEA 3VOIA 2E67A 1HKWA 2NV2A 3N2BA 5AYZA 3QOMA 1R85A 3M46A 2VFEA 3P82A 3FLUA 3GBEA 1CIUA 3VNLA 1DL3A 3F2BA 3RU8X 1NOWA 1FWNA 3W2MA 4JYFA 1CWYA 2CFFA 2WKJA 1GW9A 5SWUA 4FOJA 3TFCA 5FCZA 1VPQA 1DE5A 4RDZA 3AIRA 2YDRA 4IMCA 3W02A 3ZWTA 4JKKA 1WBHA 1DWJM 1E9YB 1TPDA 2O9OA 5A8NA 2GDQA 3GY1A 4LYPA 3RX4A 4FXJA 3V5CA 1V3IA 3S9YA 2ISVA 5CSYA 2CBJA 3KRUA 3NGJA 2PDMA 3F4VA 1JULA 2J7GA 2FB3A 1RJPA 4RPQA 2QVHA 4I8DA 2EG6A 2BXYA 4RXFA 3IPWA 2WVTA 3GIQA 4KFPA 1POJA 5FF2A 2FZ8A 3GIPA 1ICQA 2WMIB 3WLLA 3I7SA 3B8VA 3Q45A 2O9PA 3RLUA 1GT8A 2XUCA 4KRUA 4KEVA 3DXIA 3BG5A 2GGEA 4PUNA 2Z2BA 1QHOA 1I2PA 4F2BA 5K7JA 2KZHA 3CB8A 1KV5A 1DYSA 3WK1A 4P2VA 4GO9A 5GNYA 1HKKA 3GD6A 3KRSA 1OF8A 4YVXA 3KOFA 3LQGA 2WQDA 5IOBA 3THCA 3N9RA 3QM3A 3ZT5A 3N4EA 1B3XA 4YTTA 1BRLA 4FLRA 1N8FA 1NM9A 4OOUA 5EMUA 3G1DA 3QQ1A 4UMAA 1KCLA 2IKIA 4TU1A 3SZ8A 4M81A 3UCQA 2PDLA 2MANA 3KS5A 1XPGA 3KW3A 2Y6ZA 2IQ0A 4GZ7A 2QT3A 1J0HA 4F3HA 2CLFA 2YW3A 3P0WA 5IRPA 1V7YA 1PHWA 3TOYA 6XIMA 4CNNA 3P84A 4HVXA 3NDZA 4Q4MA 1EP3A 3AIUA 3VNZA 5D8WA 3C0LA 1AA1B 3WUBA 1JAKA 4ERGA 4EAMA 2AQWA 1E43A 2OOGA 2PTDA 2WZEA 1QOQA 3N13A 2X2GA 2W66A 4HK6A 1XRSA 2J74A 5FJOA 4HZ6A 2Y0FA 3TW6A 1OQFA 3WQVA 4K68A 3G3MA 5KEZA 2JKAA 4KF1A 1JZ3A 3VM7A 3IIPA 3BTNA 3NUKA 2JQXA 5CSSA 1WZAA 3CIWA 1LL4A 4IH3A 4N2YA 1UW9A 3KRBA 3RUBL 2PRHA 3UESA 2A3CA 1KA9F 1FHLA 2VHLA 1GUVA 4H8VA 3CPGA 1RQBA 4L9YA 1WA3A 2BY3A 5KETA 1OVDA 1UKSA 4WOQA 3LCWA 1GOIA 2HTMA 1XH1A 2A6NA 3KX6A 3FEQA 4PL1A 3TK7A 2CWXA 1W1IE 2DV0A 4KEMA 2V69A 3L5AA 2BBFA 4OJYA 4GCXA 2QZRA 4MZYA 4I90A 3R58A 4NQ1A 5IBXA 3VOGA 1DWIM 1TTJA 1HKVA 1NAL1 2BVYA 4PGLA 3FAWA 4NI8A 4LC6A 4V28A 4HN8A 4UBPC 4GJ1A 3TVAA 1YW1A 2VFHA 5LIXX 3PP7A 1AD1A 5IHSA 1FDZA 3BGJA 3KVJA 3TMLA 4CUCA 4ZODA 5C0QA 4W5ZA 3MUAA 4CGTA 2RDWA 2EBNA 2YX0A 1EJRC 2QCEA 3MP5A 3HGJA 3NZRA 3WL0A 3PZVA 1QRQA 5K4XA 1PTGA 5HNUA 1JRBA 4DWDA 4FX8A 1I6NA 3T8LA 4K8GA 2ZC1A 3PPHA 2YLAA 3SBFA 2BSLA 4W84A 4S23A 5JVLA 2OX1A 3W7KA 4MSSA 4QEHA 2B7OA 1DEDA 1R2TA 3O15A 2VC9A 4QIUA 3M0YA 1JPMA 2ZRZA 3MUZ1 3F2CA 1ALDA 1KBJA 5FA5A 1PJ9A 1Q45A 1JGMA 1E55A 2YSWA 1UH2A 1RVKA 3BAWA 1VHNA 1FCBA 3GH7A 3O1NA 4KWVA 4XZWA 5A8GA 2PTZA 1MDLA 4AD2A 3E2RA 3GVVA 3DKJA 3NVDA 4ROQA 4EOUA 4HPHA 5G2HA 3ARRA 4EIVA 1FP8A 2QGYA 1OF6A 3PWAA 1RA0A 1A0EA 4F0KA 4ZQRA 3TLQA 2JIWA 3LLFA 3N18A 4KETA 3KWXA 4WVXA 4MJMA 5E9XA 2ZRWA 5I5RA 4FP1A 3ZVIA 1DHPA 2YZ5A 1XLAA 4TXEA 1PKLA 3MP4A 4GIAA 3W2UA 1G4SA 3WMBA 4E5TA 5D05A 2XINA 3OHIA 4A29A 2CZ5A 4CQ9A 3K2GA 3HPSA 4GRSA 4ML4A 1J2BA 1V02E 4FPSA 3IWPA 4YYFA 6ENLA 3I4KA 3G6LA 2DZVA 1UBSA 5H2ZA 3U57A 1EOKA 2GQ3A 5DCBA 3IJQA 3H4WA 2Y8VA 4HOZA 2ZQ0A 1Q2RA 3AXXA 1BPLB 1SFLA 4DAFA 4OUEA 3O6CA 3THUA 1HZYA 3TOPA 2HZGA 2YXXA 4NZJA 3ABXA 1FQ0A 4CD5A 4UOZA 4Y9NA 1U33A 3LNPA 4W86A 3UVAA 1QBBA 5ABGA 2E0PA 1JI2A 3EOOA 2BFGA 3WBYA 4IQJA 5CGTA 1XIJA 1PXGA 1HN1A 1A5UA 1V4YA 2HE5A 3O2LA 1RBOB 5FD0A 3T6CA 5G4EA 3AU6A 4D9PA 4U5IA 4JY9A 1ICPA 3GAKA 1XRVA 4UOJA 2P3ZA 5JMUA 2DIKA 3PJUA 4J2MA 3WD4A 1D3CA 1KBLA 4HN4A 2PU1A 3LB0A 1S5WA 2PRMA 4GLEA 3W75A 4LV4A 4AIBA 3V4BA 3ITVA 2VDHA 1GHSA 4G56A 3LMZA 1JF5A 3SN4A 3ARWA 1KBIA 3KOWA 5T9BG 1Z6KA 5A3HA 1SW3A 1ZU8A 4YL2A 5G4WA 4FALA 3L67A 3KWSA 4US5D 1HJSA 1UH3A 2QHAA 1GYLA 3LLDA 3OLEA 4O14A 3WQEA 1J79A 1U30A 5AVNA 1W5PA 4LTSA 3LM7A 3SUVA 2ZXAA 1E5NA 1GPWA 1AQHA 1RLCL 3ITYA 3ZQ9A 1SUXA 3C2YA 1X8FA 3GNNA 2J7CA 1EC9A 3EEZA 4ADSA 1FWHC 4XB3A 1EO7A 1KLZA 3DG3A 3TYDA 1DQXA 3ZR5A 2WNQA 2X40A 1EC7A 3WUGA 3MUIA 1OK6A 1S5VA 3S3GA 2HK1A 4GGBA 4JX6A 3U5UA 3LN3A 2QCNA 3QMTA 3U2EA 5C2CA 4C1NA 3SQSA 2PGRA 4R3UA 1GOQA 1E6PA 1XYBA 1VFSA 4O4VA 5A6TC 4WOZA 4HSNA 2CLPA 1OFDA 3IRSA 5CKSA 2WPGA 1Q8JA 1XLJA 3BC9A 1O12A 1QNOA 1EJ7L 4G7EB 3OGSA 3T0BA 3OO2A 2ZC8A 1VLWA 4UXDA 3AUJA 3C2OA 2A5HA 3B97A 3P74A 3TU9A 2IS7A 3W1NA 5C9WA 2A7RA 3STEA 3CAWA 5I79A 4X0VA 3CMGA 3PUOA 4ERAA 1TPEA 1TVNA 3H54A 4IIHA 1RBAA 3GHRA 5DMYA 4BY3A 1OT2A 3QN3A 3RM8A 1S46A 1O66A 1EXBA 2DUZA 3MZNA 2RH9A 2EPNA 4JHZA 2PLJA 4AVFA 1BYDA 3USBA 1AK5A 4BF5A 2WBGA 5F4WA 4A8RA 3SCOA 1EUNA 3JZEA 5MKGB 4XD5A 3WNKA 5LYRA 5T9CE 1Q7QA 2Y7FA 4LRSA 1K9DA 3CXOA 4Z2LA 2DZUA 4E4PA 1LWIA 2E28A 2FGBA 1V0MA 3BOFA 2FMOA 3UG4A 5HWNA 1GVQA 4AZ7A 1OWQA 1KV8A 1FXQA 4WGHA 4A05A 4JD4A 3SJ3A 2QCDB 1OX5A 4LYKA 4NAEA 4AH7A 1XINA 1XDMA 1TWWA 1TJPA 3H4XA 4IFKA 5LKYA 1W1ZA 4AHQA 2X1UA 4JQ3A 2XIMA 1QBAA 1LZOA 3RITA 4MJ2A 2E4TA 2MUCA 3FIGA 3BDKA 1MXSA 1F8IA 3ONCA 4EP8C 1UR0A 3ANVA 4PCFA 3PS7A 3OJGA 4UTKA 1CZ1A 4NJGA 5CC6A 1VFOA 1P0BA 4LAOA 2V38A 3FYPA 5MF5A 2PLMA 3SDOA 4WQ6A 2JK2A 4H7CA 3AISA 5FAJA 2QW5A 3AXHA 3KDNA 4OZOA 2GSEA 3MVIA 5BOFA 3VGFA 4FA3A 4ASTA 2QMKA 4JTJA 3OVQA 4LC8A 3L5MA 1F6YA 1W31A 4NI3A 1W3KA 1HJQA 3P62A 2YBTA 1OADA 2OQHA 4QJ5B 1KLYA 5G1TA 1V6UA 3K8LA 1VBUA 3UYIA 1EPXA 3S6DA 4GZJA 1H09A 1N82A 1WAUA 1M68A 1GZJA 3KVLA 4LF2A 2YXOA 1KO0A 2ALRA 4LS0A 4JHOA 1L6GA 5E6YA 3PPGA 4GXPA 3G0UA 1FWTA 1TR1A 1XPYA 4LALA 4C6KA 7CGTA 3WBAA 3CV6A 4PEKA 2QCGA 1SO6A 2RDTA 5T8GA 1HNYA 4O1AA 3WYZA 3UETA 1US0A 1B3OA 3AZTA 4DUXA 1HUVA 1IZCA 2HISA 3AXMA 1TCDA 3VFCA 2OYKA 3W73A 1G9HA 1W2PA 3MS8A 1V6XA 1D3GA 4HCHA 4KQNA 1NQ6A 4MZ8A 2WPBA 4QLJA 2I56A 2PGWA 4O16A 3L12A 2C18A 1FWSA 4PMXA 1QK0A 4KW2A 1WZLA 3EX1A 3H7VA 2D73A 1UBPC 4LSBA 3ITXA 2I5GA 2J8FA 4O0ZA 3EWYA 1JF6A 1W9BM 2PWHA 1EOMA 2HE8A 3MHFA 3N4AA 4J3VA 4BQ5A 3WH9A 3LSBA 4XBJA 3QMSA 1C3FA 1O5XA 1XYCA 3AXKA 3T44A 2I9UA 1XC4A 2FYMA 3GNXA 1BSIA 4GUFA 3LXAA 2WMJA 1R3RA 5JIPA 4RW5A 5EU9A 3SQMA 3R12A 4ZXOA 4AHOA 2NQ9A 2DY3A 3MHUA 3ZJ7A 3CAQA 2RUSA 4KIEA 2P53A 3W0KA 1QNVA 4FX6M 1EQPA 4W87A 3ZR4A 4NJHA 2WM1A 1PKMA 2FHBA 2OEKA 4UMBA 4LNYA 2J8GA 1ZP4A 2W9MA 1VCFA 1JUEA 2BOFX 3NEHA 5LA1A 1IWBA 1KD0A 2JFEX 4IIBA 1XS2A 3LZ3A 4UTLA 1JZ2A 1IE7C 3CUFA 1JQXA 4JCMA 2ESCA 4P8WA 3SUSA 3E5PA 2Y5EA 4ZMGA 3W7EA 3QYQA 4E8DA 2DORA 1LRNA 4O12A 4D1JA 2B0MA 3QZEA 1CXEA 3DC8A 2ABAA 1EHNA 2V3DA 3ABZA 1OIFA 4GI8A 3EWWA 1MQQA 4YTSA 1V51A 3R7MA 3DG6A 4IMFA 4XKMA 3V18A 4AWSA 1PDZA 4UFIA 1IZKA 4FOKA 3V16A 4QTGA 4PL2A 2F2HA 3WZ0E 4KIRA 1XLDA 5I03A 4UTTC 3CUXA 5HANA 3L65A 4O8RA 2Z7KA 3RO8A 3T0TA 1MZHA 2GL5A 3DBPA 2E77A 2EGZA 1GJWA 1ZAJA 1LUCB 3PBGA 1TJRA 3DFSA 4QQUA 4JPGA 4HU0A 4LB4A 5D38A 3W71A 2GQ8A 4HPJA 3UXLA 1DWFM 1CLXA 4FK9A 3L4XA 4PTXA 3WK3A 2J7HA 2NX9A 1V3MA 2CBVA 1G1YA 1CDGA 3WJSA 2WMIA 4NZCA 2VEFA 4LVBA 1FXPA 3RR4A 1A3WA 1H7WA 1OEPA 3KBWA 4IL0A 4PSPA 4PBFA 5I24A 4RZ5A 1AJZA 3MI2A 2CLLA 4H8UA 4A8NA 3BXWA 5CXPA 4MAVA 4YHEA 2Q02A 1ADOA 4GH3A 5E1QA 4FLQA 1A50A 4DYKA 2W4XA 3WDPP 1SSDA 3LTYA 2V30A 3ARZA 2CHNA 4V27A 4YTQA 4A2SA 3FXYA 1BHGA 9XIMA 2WAGA 1MO0A 3VGHA 3LOTA 4GKTA 4AZBA 4BFAA 3NA8A 1W8GA 5K4ZA 3S6TA 1EWEA 3NQCA 3DHFA 1CGTA 4GXWA 2DSKA 1R5YA 4HQVA 3AYTA 4NYUA 3T8QA 2X0YA 1V93A 3TAOA 4N9CA 2OG9A 4GY0A 5C9RA 1W9DM 1GCYA 3ZT6A 4GABA 3VUSA 4AX6A 1PDYA 4IPPA 1RBLA 4RL3A 2Z1KA 4Y9MA 1JXKA 4UQBA 8A3HA 4GGHA 1TRDA 4XD6A 5A8OA 4QS5A 3CZEA 3TROA 4IISA 4RKAA 4L65A 3LRLA 5HBFA 5HA7A 1Q63A 4OECA 3SURA 2ISFA 2ZA2A 2WVUA 1LOQA 2IPFA 1ME9A 2XIOA 2XJ7A 2BXZA 1Y7VA 2CERA 2JGQA 2CIPA 8CGTA 2D0FA 2LLEA 4F66A 2ZA1A 4U33A 4LOCA 5H8MA 3KE0A 4XUYA 2DZBA 1E1FA 3CT2A 1F05A 4PMJA 4RNJA 2WNZA 3PBUA 4I6KA 2FJUB 2WC7A 3W88A 3SQLA 3EWUA 4AEOA 2QDEA 4OGZA 3EB3A 3UJEA 5HDRA 1V3JA 3WK2A 3U9IA 4GD0A 1XW8A 2VWTA 1TPC1 2NQ5A 3VD5A 3ZLFA 1WXJA 1UG6A 4O1DA 1J0YA 1V6YA 1THFD 4DZ5A 1P7TA 4MG4A 2QUVA 5T26A 4IX0A 1MXGA 4PUJA 4I8YA 3QZAA 1JCXA 2X41A 3AYRA 3CZJA 2HCVA 3FN9A 4Q7NA 1SQ7A 4L4OA 5KITA 4ZQMA 1QTWA 2GJLA 5TIMA 2Q3RA 2Y85A 4N6FA 2DVXA 1E9LA 2EAWA 4OFCA 5AVHA 3WG6A 1T0OA 4UWMA 3GNOA 1OZQA 1VBRA 1ZQ5A 3GHSA 3S2LA 5BXRA 3PBYA 3R8GA 1KTCA 2NV1A 1X6UA 1EJUC 2FZDA 3NZQA 1D3HA 4X63A 1S5NA 1C7SA 5F4SA 5HQLA 2Z27A 1B2YA 4JEQA 3QPEA 5EMMA 3ITCA 4S3AA 4L6HA 2G4JA 4IG2B 1ONWA 3U6WA 4I7WA 1AW1A 3GNPA 4LVAA 3T09A 2O7SA 4M80A 4P8VA 3OG3A 5F1UA 3WH5A 1GQJA 2J7EA 1E6ZA 3WH6A 3GQYA 4MB3A 2WKLA 4YN5A 2BWGA 4IHCA 3SGUA 4XZHA 2HBVA 4K8EA 4PCPA 3STGA 4QLLA 3BLFA 3L23A 1NWUA 3BSHA 4QE5A 4CEUC 3NOYA 1JZ6A 1QPKA 3FGCB 4B4HA 3CYVA 3O7UA 4K7VA 2ADAA 3EWDA 4FS9A 2A1YA 4LBSA 1K7XA 1L2QA 5BRQA 3QFEA 4MAZA 5CSUA 3B9OA 3MP3A 1KKOA 1TMHA 1XLMA 2YJQA 1JNDA 2VEKA 2P76A 2OYLA 1V6TA 1QU4A 3MSDA 3ATZA 1W3LA 4IX2A 2VNCA 1GTEA 1NP0A 2ZYFA 2WQPA 2WHMA 3AALA 3LS9A 4GG9A 3HTWA 3C5QA 3EMQA 4DLMA 4PFHA 4A35A 4Q4QA 3M7WA 4F4RA 4AEFA 5DX7A 2EPOA 3K5XA 2X42A 1LP6A 4N9BA 4GQBA 2XH7A 3R89A 1AL8A 1QW9A 3GVWA 4ZFMA 2GJRA 5LNRA 4LY4A 5RUBA 4JICA 2Z7GA 4AZ6A 5A6LA 5B7YA 3DYOA 2AKMA 1YDOA 1H7PA 1V08A 1DPMA 3T07A 2QF7A 1SMDA 2DT0A 2UV8G 3HJZA 3CQHA 2WSQA 2XIBA 2FMNA 1EBGA 3Q67A 4IPLA 1J12A 5L9FA 2G3FA 1UZDA 4M3PA 2BVWA 3H2AA 4LCQA 3H7RA 4D6FA 1X1NA 1RVGA 4JTQA 1W5OA 4WHBA 5G1YA 1TX2A 1UQZA 5A95A 1QPNA 2JEQA 4IUGA 4JYDA 1QWGA 1AJ0A 4HNUA 1A47A 4HA1A 4EXAA 4ZO8A 4ZFCA 1QHPA 3VKJA 4B3KA 3TQKA 1PX3A 4ALDA 1RSCA 2BGQA 2VO5A 4YVPA 2VGFA 3V5OA 3SEPA 5I00A 1XX1A 1OCBA 3CWHA 3GDLA 1TKKA 4J3UA 4RZBA 2NXHA 2FTYA 3E2SA 2Q6ZA 2WSPA 1VPXA 3V75A 4TX8A 3CT7A 5GJPA 4L4PA 3R0UA 2W62A 1CB7B 2AAAA 1WOAA 2ZUMA 1S39A 3TSDA 1R2SA 2W6RA 2V68A 3GG8A 3CV2A 2ZUUA 4R27A 5HWJA 5C9ZA 2YDQA 4REQB 3GTNA 2UZ9A 3MMTA 3FY1A 3N2OA 3AFBA 4C6JA 4H7VA 4Y96A 4GZEA 1UOZA 1TA3B 1ZHAA 4GA8A 4LVDA 3NG3A 4I9TA 2XVKA 3LBOA 3N6HA 2BG5A 1YIXA 4C91A 3IUDA 3IEBA 1LQAA 4TTGA 1SFTA 3A3HA 3UW6A 4B15A 3EEGA 4X9SA 3VE7A 2IKJA 3XIMA 3K1DA 1A53A 3FSUA 2Y7GA 3PSVA 3E0LA 3LGGA 3W24A 3IAPA 3F1QA 2EG7A 2HK0A 3F7JA 4LBUA 4MUPA 5HQEA 3S9ZA 2CZFA 3VC5A 2X30A 3WQWA 1H2JA 2BNJA 4O11A 1S2UA 1EB3A 1JCYA 1ZLPA 3AMLA 1S2CA 3KTCA 4HPGA 1WZMA 3SRFA 1VJIA 3LSCA 5HK4A 1UASA 1JYXA 3AIVA 3SGGA 3JZUA 3ES8A 3N25A 3SFKA 1JYNA 4EANA 3B9EA 2E5BA 3NCOA 1HIZA 3VNDA 1W37A 1PTAA 5BOOA 5BROA 4Z1CA 1W1VA 2NZLA 3DI0A 4N0RA 3HO8A 1V3LA 1AQFA 4J40A 4W5UA 3ITGA 3H2CA 1E9IA 1B9ZA 1UP2A 1UIPA 3FA3A 1L2UA 3VD4A 4HU8A 2DU2A 2PLKA 5KZ6A 5I2UA 1X6NA 5EB8A 4UTFA 1S1PA 4GVHA 2WWCA 4ZO9A 4BHYA 1GJPA 4Z1DA 3BVJA 1VQTA 1UWIA 2XFRA 3VGGA 3VC6A 4AC7C 2CLOA 4HNVA 3H4GA 5DY3A 1XWYA 1PX4A 3W4RA 1LORA 4K38A 3BV4A 2Z6IA 1UUOA 4ZB2A 5A2AA 2XH0A 3G1RA 2XZ9A 2P3EA 2HPMA 2E68A 4M6QA 4S3EA 3WUEA 1V7AA 2DFAA 5C2XA 2ZUWA 2NWSA 3PTMA 3NZ1A 3Q94A 4C5ZA 3M16A 1PIIA 1E1CB 3KL0A 3BQ5A 4KPLA 1NFBA 4Q8QA 5KSWA 5EBAA 1IEVA 4IICA 4ORIA 3RFAA 3U2ZA 1XIMA 4I3GA 4NNAA 1T99A 3IVSA 1M03A 4CEXC 1J5SA 1UC4A 2ACSA 2R1PA 2X7WA 1X1ZA 3EA1A 5G2WA 4Q33A 2Z25A 3RDKA 4D72A 3C3UA 4LS2A 2PP0A 2C16A 1GGOA 2PFHA 3ARVA 4DWSD 4GNJA 4MIMA 3EDEA 4CQCA 4H83A 2BXVA 1I0BA 2W79A 4ES4A 5DANA 3T0DA 3W7CA 4H4IA 4GK8A 3NJ3A 3IIZA 5BW6A 5LXEA 4DIAA 1ZL1A 2REQA 3WSUA 4E2OA 1XQLA 4IGMA 5DO8A 4LU0A 3E0WA 2NV9A 3M5XA 1FWRA 3URBA 4R53A 3WX7A 4GBDA 3HOJA 1U1UA 4AIOA 4PCSA 2ACUA 2G95A 5MHBA 1QO2A 5TBOA 3ERPA 1KBBA 2E6DA 3SY5A 1ME8A 4L1XA 1XP3A 4GYFA 1J0ZA 4J4KA 5A6SA 2EJ1A 2ZVIA 1IXPA 1AZ2A 1B3VA 3RXZA 4Y90A 2E1DA 1Y5VA 3GX9A 1CXLA 1WOBA 4P8UA 4Q4RA 1IWAA 3WQDA 2WNNA 2OZ0A 5BCAA 1SMAA 4JKMA 2PP1A 1RY8A 2Y63A 3GC5A 4IOTA 3GTIA 5ABTA 2Y2WA 3M0JA 4X9YA 4IGNA 1HVXA 3T2OA 3WQ4A 3LUTA 3P61A 3P81A 1M7JA 4BI5A 3LPFA 4HK7A 2HROA 3N6JA 3GU2A 3E0IA 3U4FA 3QGKC 1OM0A 1PZ3A 3PG9A 5G1MA 3ONBA 3EX3A 1LT8A 3LM3A 3IRDA 4N02A 3W86A 4NAFB 3DI1A 3WN6A 1QHZA 3LNMA 2GLKA 1XRFA 2ZCGA 4DLFA 1EEXA 3PM6A 4HPXA 4RDWA 5XIAA 4JTIA 1V5XA 3IK4A 3MI3A 1VCVA 2DZTA 4CU6A 4ZQOA 3ZLHA 2XYLA 4H04A 1EGVA 2I5QA 2VZOA 3ATYA 3EPNA 4JTDA 1ZB5A 3MUY1 2Z1SA 4JL2A 4M0XA 2Q01A 1JDFA 4UQDA 3TLLA 2BHYA 3O16A 2P1FA 1NOUA 5FJIA 1FWJC 1X39A 1CX9A 3G1AA 3WLTA 1M9HA 1UKOA 4ATLA 2O9RA 4C6BA 5EL1A 3C4UA 3KCJA 2CLIA 4KH2A 2EJAA 3LHZA 1SVDA 2G41A 1EDQA 1EP2A 3AZRA 4M8UA 4S39A 1YTEA 4G5DA 4C6EA 3M0IA 1JFXA 1XH0A 3G0SA 1EL3A 4EAYA 5U7SA 4IWWA 2IPWA 4LRTA 1YQ2A 4BR1A 4XKYB 2GUBA 1LUCA 4MFEA 1YKWA 3BCFA 3W7OA 1VFMA 4NILA 3JR2A 1DJNA 2FDMA 5A8QA 1W2VA 7TIMA 1DBTA 1W9VA 3H21A 1KXTA 3AS3A 2ZICA 2YDAA 3W22A 8TIMA 3LENA 4NNCA 3GK0A 1C29A 3N9KA 1XC6A 5EFDA 5JU6A 4B91A 4H7ZA 3T2PA 4O28A 4O54A 4M19A 2YBVA 3G22A 1AH4A 1VB9A 3PFMA 3LCGA 4D6HA 3OTRA 2E3ZA 2GVLA 4EXBA 4L80A 2YA2A 3VU2A 3W1PA 5CH9A 4PB5A 4IT1A 4PFMA 2Q8LA 4DJEC 2PDFA 3W29A 1WBJA 4NG3A 3WF2A 1KQZA 4B3LA