3PY2A

Structure of c126s mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVSFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the role of the fully conserved Cys126 in triosephosphate isomerase by site-specific mutagenesis--distal effects on dimer stability.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3py2A00
2ZZ2A 4MYXA 4JTUA 4ZQRA 3BW2A 3B04A 4NQ1A 5L9FA 5I3JA 4A2RA 1W3TA 4POCA 4IPJA 4DPQA 1OABA 1JUBA 2NWRA 1EA0A 2X1RA 2QCNA 4Z0JA 3DFPA 4JIQA 3I6RA 3FS2A 1ZY9A 4IMFA 2Z6IA 1SSGA 3C4UA 3C61A 4DPPA 1L6SA 1Q6LA 1NFBA 4O14A 4BWLA 2V2CA 3JRKA 4CCCA 4MZ8A 1KFCA 2E6YA 3OG3A 5U7SA 4YCPA 3HGJA 1GTEA 1LROA 1WV2A 3WJYA 4WQ6A 4GC4A 3NO5A 2XN0A 4UC5A 4PFMA 2E6DA 1FDYA 3BV4A 4N4QA 3G1AA 3IIVA 4M5PA 1QAPA 5D2WA 4WZHA 4O13A 2J6XA 1X1OA 4AWUA 3W86A 1B57A 3G0XA 1TPWA 2ZZ4A 3HG2A 3M47A 3O6CA 1SW7A 3PULA 1H7OA 1C9DA 3JS3A 4PTNA 1FWTA 3H55A 4WD0A 5F1VA 3QJAA 1GVOA 2V81A 4UTTA 3DENA 3GKFA 4K7VA 4O17A 2YSWA 3VE7A 2ZRVA 1MEHA 2ZRYA 5EMUA 2Z6JA 3L65A 2F7FA 5EBUA 3JR2A 2X1TA 3PUDA 4LVGA 5K2ZA 4UXDA 1FCQA 1YXDA 4LUJA 3QQ0A 4UTHA 5KTLA 1KFKA 5EY5A 3LHVA 3RK8A 2EGZA 3HPSA 5DBUA 3QM3A 3UPBA 4NXKA 4E2DA 3W88A 5G1TA 4AHOA 4HT3A 1IXQA 3IVUA 3HQ1A 1VR6A 3NG3A 5TBOA 1EUAA 2Y62A 2A1YA 4WXZA 2AQWA 2EAWA 1QDSA 2YW4A 4GFSA 3GX9A 2V30A 4GUJA 5F2IA 3G1SA 4FX6M 1RPXA 4XTIA 4PL1A 2E6FA 4NX5A 2Q8LA 3MI2A 1VYSX 1WOAA 4N9DA 1QOQA 4IXXA 4ADTA 3UWUA 3B05A 3B0VC 1Z42A 1OX5A 4RJEA 3R8RA 3G0SA 5G4EA 1WYIA 1A5BA 3P5ZA 2GQ8A 3LHYA 3DKJA 4TR9A 2JGYA 3W84A 2J27A 1TTJA 5BRBA 3L0KA 3IVTA 3TX9A 4QNWA 1WBHA 1M7PA 3GXTA 4CCEA 3NQDA 5BOOA 1S5VA 4KKXA 3O8AA 3KFTA 5C5YA 3DH7A 5AYXA 5DXYA 3E12A 3GNDA 3PBUA 5T26A 2C3ZA 3GZ3A 5I3HA 2P1FA 2DZTA 3S0CA 3CC1A 2ZRUA 3HG4A 1OFBA 2Q8ZA 3G8RA 4JYFA 1OG0A 2BTMA 5AYZA 1K8ZA 1T96A 1LRQA 4ADSA 3MWAA 3W6YA 4MY1A 3H53A 3OBKA 4NZJA 1EP3A 5CZTA 4DQWA 4ADUA 4R33A 3G1VA 4S2CA 1THFD 3CWOX 4KFPA 1TJPA 3MW7A 5D38A 5K9DA 4O52A 2NV2A 1XC4A 5FESA 3DBPA 3E96A 3S1VA 5ABTA 4O1BA 4AHPA 2GUUA 4Z1BA 4UFMA 1DOSA 4XZ9A 4WX2A 2Y7DA 1H63A 4XBKA 4FNUA 3L5LA 1P0KA 4UMBA 3W7LA 2A6NA 5DBTA 1SUXA 1VH7A 2CFFA 1JCLA 4DBEA 5AN7A 2HS6A 3QYQA 5LSMA 1WBJA 2FPVA 4NJIA 2G97A 4OE7A 5D04C 3S5NA 3UWYA 3OVQA 4UIOA 1KM5A 3F4NA 4DXVA 1H7PA 3IRDA 5IBXC 4IX2A 3LXBA 5CSSA 4ICNA 4WUIA 3W2MA 2BWGA 1VLWA 3C0JA 4O50A 3W7IA 2GPTA 4Q4KA 4OHQA 2PCQA 4PODA 3S6DA 3KAOA 5KITA 2PE4A 1MZHA 2R8WA 4IXHA 2J9YA 2RDTA 1TV7A 1VHNA 1IIGA 5F4WA 4X2RA 2NWSA 4M7SA 1L9WA 4MIMA 3GR8A 3W1XA 3S1UA 3NL2A 4N9BA 3MI6A 3C2VA 3U8GA 1LM1A 4JGDA 1SU5A 3GDRA 2V5LA 3EX2A 4HPXA 1DVJA 1NAL1 2O7QA 3PAJA 2DZUA 1L2UA 3CLMA 5AHLA 1JRCA 2NX3A 1G4TA 3TAOA 3TSBA 3KVJA 5D02A 3Q37A 1EP1A 2ISSA 1PV8A 4E38A 3NVTA 3W7GA 1OFEA 5LHEA 1TREA 5CPLA 1WDWA 2V8ZA 3WK2A 4UMCA 4UTWA 1SFJA 2RH9A 1DV7A 3EWBX 3M16A 3LCLA 2CZFA 3BARA 1WOBA 3G1YA 1GWJA 4R7JA 5HWMA 5KINA 2A4AA 1F05A 1VRDA 4MZ1A 1AMKA 1H50A 1H7WA 4JYDA 5D2VA 2ZRWA 1SO5A 1W8SA 2WNNA 5D32A 2QDHA 3HIJA 4QSHA 1P5BA 4RK8A 1TPUA 3M7WA 1AL8A 5F4XA 2Y63A 4UFKA 1OFQA 4FX8A 2OX1A 2RFGA 3PBYA 5AC6A 3NL5A 3HF3A 3MO7A 1H51A 3E49A 3W87A 3LV6A 3TC7A 3QMSA 4FX7A 2BZNA 1FCUA 3LHTA 5AHFA 2G96A 2WOQA 1R2RA 3QZEA 4X9SA 4O53A 3NOEA 3VFLA 3E9AA 4U28A 3FJ6A 1IXPA 1YDOA 1LBLA 3SZ8A 1O94A 1TYGA 2FFCA 3MBFA 3NM3A 5FEZA 1XBZA 4JNMA 4BI7A 3EWZA 2QJGA 4ZMGA 2CWNA 5LNWA 2ISWA 1H62A 4JTKA 1TPH1 3LTSA 3E02A 3PC0A 3S5OA 5LGXA 1PS9A 2GOUA 2YFNA 4E0CA 3PSVA 3B06A 1OYBA 3QPZA 3DFOA 4FEZA 1MXSA 3LB0A 5FF3A 4GUHA 2I9EA 3T44A 4KFOA 5FF4A 1LOQA 5LGZA 2C1HA 4XWUA 3YPIA 3P5YA 4UFJA 4CCDA 3GDMA 3GAYA 1ZFJA 3W1RA 4O8RA 4NJJA 1WA3A 1TV8A 1XBXA 2FPYA 1VJIA 4CQAA 2YXGA 4MUZA 1R46A 5U4NA 3P61A 1W5NA 1OFAA 2JBMA 2J9ZA 3BW3A 3SFKA 1ZHAA 2JKEA 3GYEA 1QPOA 3C2OA 2E68A 1GG1A 2GQ9A 1ONRA 3NQVA 1IXNA 3GDTA 4YL2A 4S1FA 4BI6A 3M5XA 2J88A 2ZTKA 4QAIA 4NU7A 5A5WA 3W71A 3RFAA 4JTSA 2ZRZA 5DCDA 2B7PA 3LLDA 2WNQA 1VC4A 3M9YA 3NGJA 1D3HA 2TMDA 3P8JA 4LOCA 3K30A 4UTKA 3LXCA 3TFCA 3WK3A 2E5DA 1SO3A 1GVRA 4TX9A 3W7DA 1GYNA 3CIWA 1ADOA 4NUWA 1K8XA 4UTLA 3W7MA 1J5TA 5CG7A 2C13A 4M7TA 3TXZA 4Y96A 1GOXA 1XM3A 3W9ZA 2VFHA 1YYAA 4LS1A 4OU1A 1LOLA 3G3DA 3O15A 3DHFA 3NPVA 5DY2A 1W5QA 4OGZA 4UFHA 2VFEA 4YMZA 4MVAA 5BMXA 4OBTA 1TMHA 4MJMA 5E1QA 3A5VA 3S9YA 4HNUA 3W7JA 1WXJA 4DF1A 3PY2A 3DFQA 2E6AA 3VE9A 1LTDA 2C15A 5I3FA 4UCGA 5F2LA 4AF0B 1VPXA 4AVFA 1UUOA 3TK7A 3KVKA 3W85A 3LI0A 1ZAHA 4Z08A 1OX6A 5LZLA 3ABRA 1TPFA 1VZWA 4X22A 4UTUA 2E5BA 1OFDA 1OF8A 5HUOA 5LKYA 3LCFA 2PC4A 4N4PA 1EEPA 4NX0A 5DLCA 4FNQA 4YCOA 1VQTA 2TSYA 3NQ7A 3RLUA 3QW4B 4Z1CA 3NPWA 4HKPA 3SR7A 2Y7EA 1SZGA 1FBAA 4UUIA 4UTWC 3P62A 4AH7A 2H90A 2X2GA 4LRTA 2CLHA 5AHMA 1W31A 4LT9A 2WV8A 2CLKA 3TIMA 2B7QA 3EWXA 2DJLA 2NX9A 2VC6A 2QCEA 3W23A 5CPOA 4S2BA 2CZ5A 2BXVA 1ZNNA 5D33A 1JCMP 5G1YA 1W0MA 1A5SA 1OYAA 3P67A 4O28A 4CNOA 3W7RA 3GDKA 2QUVA 3TW6A 4K38A 4JDBA 3N34A 3VNDA 4HSNA 2VEMA 3QW3A 4NXSA 4O1DA 3ELFA 3EXSA 3I68A 1XDLA 4O57A 4DBDA 3LV5A 2CLOA 3PB2A 4LVBA 3TCEA 2C0AA 2CU0A 4GUFA 4XKYA 3DHDA 3NQFA 2GQAA 3NL6A 3NZRA 3O63A 3UZJA 4ORIA 3KOFA 2FLIA 3O06A 3STGA 4RXGA 1WQ5A 2UV8G 5IM51 1LLZA 3M5VA 1T8XA 4DO4A 4JICA 3TKFA 4PA8A 4A3UA 4BI5A 1KM3A 1EWDA 3NQAA 3LBMA 3TMLA 4L4LA 3C3NA 2IQTA 1T99A 3PBVA 1SW3A 1Q6QA 2DJXA 3EKLA 1B9BA 4IGHA 2YYTA 3NPXA 3GB6A 1ICSA 3B03A 3F4WA 1AW2A 3O6YX 1B3OA 3I7RA 1CI1A 5CPMA 4P61A 1NSJA 4RXFA 4QJ1A 1AW1A 1J2WA 2Z0IA 2WSRA 3N14A 5AHIA 3CB8A 3CT7A 1I2RA 1X7FA 1SFLA 3KVMA 2V5BA 2A7RA 1EP2A 3R12A 2VFGA 3PG9A 3LCHA 4ZQCA 3HMJG 2Y70A 2YDAA 3SW6A 2JKAA 1W56A 3U6WA 1KA9F 4QISA 3GXNA 3ZR4A 1JVNA 3W7NA 2ZFAA 3O6DA 4R34A 1OX4B 4WY0B 2E09A 2ZZ3A 1QPRA 4IUOA 4RZ4A 1A5CA 1TPEA 1KTCA 3USBA 4J9JA 4AWSA 3PWAA 1FCVA 5DXXA 4HHPA 4O19A 1FCBA 1F7BA 4LC8A 5HINA 3P84A 1RD5A 3HG5A 3FOKA 5LNVA 1QNVA 3GVGA 4IWWA 4K36A 3GR7A 2NXIA 2Q3RA 4JTJA 3WJZA 3DI1A 1MSSA 3P60A 1TQJA 3INPA 1RQBA 3STFA 3W22A 3DI0A 2YGYA 2B7OA 3G24A 2FB3A 3W2KA 3G1FA 2B7NA 2TPSA 4AMAA 4GNJA 1S5WA 2OCZA 4DF0A 3ABOA 4AHQA 4OV9A 4JTLA 4GBUA 3BG9A 3M5ZA 2HMCA 1MEIA 5F2GA 2QCMA 1B4EA 2ZRXA 3LDVA 2QCFA 1PE1A 2A7PA 1MEWA 4JTHA 1HG3A 1GEQA 4JY8A 3FKKA 3RF9A 3LRKA 1M6JA 1VS1A 3HOJA 1CX9A 3L0GA 1XBYA 3EWWA 3R5EA 1VHCA 4JDYA 3BLIA 2H3DA 3TXVA 3CPRA 4KFNA 3F1QA 5F2MA 5SWUA 4RV8A 1U5JA 2OMAA 4PL2A 2FB2A 4JY9A 3FA5A 3W7EA 1VGAA 4EOUA 3NZ1A 1I45A 2ZCGA 1YPFA 3M1ZA 3MHGA 2ABAA 3MJYA 3C56A 2H8ZA 3PVFA 3TSDA 2VEIA 2ZDRA 2RDWA 3DFTA 3EB2A 2QCDB 3C2EA 5IBXA 1FY6A 3IGUA 4YXGA 2A85A 5DY3A 1J4EA 4UFLA 1VYRA 1OFOA 2QCGA 4TO8A 5TQLA 3DU0A 2CZEA 3TJXA 3SJ3A 4JN6A 1OYCA 2VFIA 4A29A 3TV8A 3TNOA 3TW7A 1I2OA 3ZWSA 1BEUA 3W2NA 4RCXA 3HG3A 2JK2A 4Z1DA 2C19A 4JD4A 4PCFA 1Y0EA 4QNEA 1LZOA 1FWSA 4JTEA 5K9XA 4LS2A 1D9EA 3S5ZA 1TPDA 4LW7A 4FNRA 5FF7A 1O4UA 3IIOA 1R30A 1XBVA 4O10A 2Y85A 4XBSA 4N9EA 4B5NA 4O4VA 4HNNA 3RU6A 4HNVA 2OT0A 3EXTA 1G4PA 1C29A 1G69A 1JULA 1F6PA 3CM4A 3W1UA 5HWNA 3LCXA 1ICPA 1RV8A 2V2HA 1TCDA 5EKYA 3W1MA 3O16A 1O95A 3L21A 3VKJA 1FXPA 3PR2A 1K8YA 1HTIA 2QF7A 4XTDA 5I3GA 3M0ZA 1A50A 4BWLC 3B0UX 3QSRA 3RMJA 7TIMA 2ZA3A 4W9TA 3W1PA 1H1ZA 3S42A 2DU2A 1JR1A 2Y89A 5EYWA 4I7WA 4LY8A 3GLCA 3Q94A 2H6RA 5AOUA 5D2TA 4N9CA 4TMBA 2ZZ6A 5CKSA 3S1XA 2C14A 1UCWA 1RZMA 3A5FA 2ZA2A 3EX4A 4ML9A 5D30A 2NV1A 2ZZ1A 5K4ZA 1RQEA 3HGSA 2NZLA 3TQVA 2ZZ7A 1YXCA 1JUEA 2NUXA 2QCCA 6TIMA 1QCWA 3BLEA 1GTHA 4C1KA 3P82A 3S5YA 3PSWA 5I3KA 3NEVA 1KBJA 1HO4A 3O1NA 4NJKA 1TPVA 2X1SA 4XQ6A 4I9AA 4TMCA 5I3IA 1R2SA 1SSDA 2WKJA 1GVSA 1HFBA 1SO4A 3G1HA 2V9DA 5CGQA 4DO5A 5HQEA 5H2ZA 1DBTA 2V0TA 3N2XA 2NX1A 2XN2A 4FHAA 5BW6A 3DFSA 4A21A 1DHPA 1HL2A 2W79A 3C2RA 5E0KA 3BW4A 3BGJA 4LRSA 1H1YA 5LHFA 4A2SA 4UNKA 2QEZA 1W3IA 5BMWA 4IX0A 3M6YA 1ZJIA 2Y88A 2VXNA 3LTYA 2X1UA 3W76A 1TTQA 1Z48A 1FUYA 2E5CA 2FQIA 3BVJA 3QF0A 3SSJA 4MLRA 2VFFA 4M6VA 1NF7A 1P4CA 2CLIA 3T78A 4UR7A 4PC8A 1QMLA 2DZWA 3OVRA 2QJIA 1W54A 2ATSA 2W6RA 4UTTC 3GAKA 4ALDA 1Q45A 4HNTA 4LVDA 4AAJA 4EWND 2PRLA 2Y7GA 2RKXA 3HPZA 4MJZA 1LYXA 2QKFA 5K9CA 1DQXA 1SZFA 2FDSA 3V75A 4CNPA 4UMAA 5C6MA 3CWNA 1OX4A 4WY0A 1XFBA 5MHBA 2WNZA 3W2JA 3PG8A 3UQNA 4K8HA 1LORA 3NYZA 5D2YA 1JCNA 4GJ1A 4IOTA 3A21A 1EX5A 3TR2A 2HSAA 3MHUA 1YADA 3QRHA 1AW5A 3BPWA 4MY8A 5KZEA 4HIBA 2VENA 4ZQMA 3N2MA 3B4UA 3ZS4A 5EA9A 3EX6A 3FIGA 3QMRA 1F5ZA 3UY8A 1NEYA 3GKAA 1FWNA 4DF2A 3TJLA 1H7NA 3ZWTA 2DORA 3W1TA 2YYUA 3H54A 3N9RA 1UUMA 1O5XA 1LLWA 1NVMA 3W7PA 2D73A 1ICQA 4JTFA 4UR8A 1QFEA 5FF2A 4RX0A 2YX0A 4JTGA 1FX6A 4NZFA 4IMGA 2A7NA 3SECA 2H8XA 3RLVA 1PVNA 3VI2A 5HJLA 5EPDA 1TPC1 1NF0A 4JS3A 1TRIA 3LM7A 3STEA 4LNYA 1W1ZA 2AAMA 3B0PA 4K37A 4I7VA 4JX4A 1E51A 3M5YA 3TA6A 3G1XA 1DL3A 3BG5A 4JEQA 3QMTA 1QO2A 4LVFA 4O18A 4XKYB 1O5KA 3W72A 3BO9A 2QJHA 5D37A 3W83A 3OIXA 4QITA 1LBMA 2NUWA 4R53A 2OJPA 4EIVA 1H61A 2X16A 4O0KA 3W2UA 3W7QA 4GE8A 1N8FA 4IQLA 3WJWA 3EKZA 4FXRA 4WOQA 1UASA 4ZQOA 2DP3A 4AB4A 4GXMA 5F1UA 1GYLA 3AO0A 4MFEA 1KFJA 2QAPA 3NQCA 4NT0A 3TQ0A 5AC8A 4EF8A 1TQXA 2CZDA 1G7UA 2WPBA 3UY7A 3NQEA 2Z1BA 1OJXA 1QWGA 1I8JA 1TV5A 4Z0SA 4UFIA 5G5IA 2KZHA 5D2XA 3OHIA 4LWWA 4CQ9A 3HB9A 3MBDA 1LCOA 2A0NA 3GIYA 3HGOA 2DZSA 4LC6A 1ZCOA 4KWVA 4MOZA 2H3BA 1QPQA 4HPJA 2ABBA 4Y90A 5CZSA 5AYYA 3UWVA 5F4SA 1XXXA 5DCBA 4DO6A 2YFOA 3LRLA 1OFPA 1KM0A 3W1AA 1I4NA 4XUGA 5G2IA 2EPHA 3L68A 5L6UA 3OEXA 4AF0A 1L6YA 3LOTA 1T0OA 4WY0F 2VKZG 3EX3A 5KZMA 4QQ3A 3S8HA 2P10A 1VCVA 3P7YA 4MZYA 1F2JA 2ISVA 5BNKA 5DELA 3T40A 3D0CA 3HPXA 1KM6A 4FIRA 3W70A 2WSYA 3G18A 4NJGA 3THAA 3NR0A 1IIHA 1YDNA 3MP4A 4JX6A 4EF9A 3EX1A 2QUTA 1QPNA 1K3UA 3C52A 1GVFA 3W7KA 3HBLA 2CLLA 3HO8A 3L9CA 1QO5A 1SZEA 3LI1A 1DJQA 3FEMA 3QQ1A 3LLFA 3LCIA 4ZL1A 3FYOA 4K8EA 4JTTA 3RNDA 4EVZA 3TUUA 4WJEA 4TIMA 1W5OA 1GJPA 2E77A 4GWEA 3PBWA 1XL9A 1G4SA 5HR6A 1YPIA 1ZAJA 1GQNA 2CLMA 4DELA 4JYEA 4RLIA 1QOPA 3WJXA 1DJNA 1N7KA 3LRMA 2C6QA 1RVGA 1K7EA 4KWWA 1BWLA 3SGZA 4C1LA 3M44A 4MFDA 4Z1AA 1JUKA 5FEWA 3NQ8A 4GRSA 3W1LA 4FNSA 2YW3A 2TRSA 1SW0A 3CEUA 1KM1A 2FJKA 4AXKA 4RR4A 1JRBA 2TYSA 1W5MA 1MO0A 4NNCA 4UNLA 1A5AA 5KMYA 4OT7A 1JCYA 3W3OA 3V1PA 4ZVJA 3TMQA 1OK6A 1SO6A 5FF0A 3LX9A 1YTEA 3P81A 3OVPA 4LTSA 5C54A 5FEPA 4JR5A 1M5WA 3PS7A 2P0OA 3QPYA 3UWWA 4BK9A 2ZZ5A 1UBSA 1FWWA 4H4IA 3VCRA 1W3NA 1OVDA 3MI3A 4OWGA 1R2TA 5CSRA 1C8VA 3W75A 3NL3A 3C6CA 1GZGA 1S3HA 1B4KA 2CLEA 2DZXA 3KRUA 1ML1A 2ALDA 2F84A 4M6QA 2PURA 3R2GA 2R14A 4CNNA 3UWQA 4OV4A 1V7YA 8TIMA 4UTIA 3CU2A 4LS0A 1VCFA 2B4GA 5D09A 4K39A 3QC3A 1H7XA 5FEXA 3WJSA 3L0NA 3DXIA 1G6CA 1CW2A 3LHUA 1RR2A 1X6UA 1O60A 1IXOA 3I7QA 4ZQNA 5EL1A 1XI3A 3IIXA 1KBIA 3TAKA 3IVSA 4D2JA 5C2XA 2GJNA 4NJHA 4Y9AA 2ZBTA 1BWKA 1BTMA 1JQXA 4LUIA 4PEKA 4IJBA 1Q3NA 3ATZA 3L66A 5LNUA 2PRMA 1KTNA 1GVQA 1ZALA 2NUYA 1KFEA 2E1DA 2FIQA 3A23A 5CPNA 4Q32A 1JCXA 4FNTA 4NNAA 1XUZA 1KV8A 5CZ0A 4MKNA 3UZ5A 1W37A 3NQ6A 5D03A 5D05A 2EKCA 3LHZA 3S1WA 2QDGA 1Q6OA 2GVGA 4CLMA 3DZ1A 4O16A 3NNTA 4BFAA 3KRZA 3PUEA 4QIUA 1V5XA 2FTPA 4ZZ9A 1P0NA 2O7SA 3I65A 1S5TA 1XKYA 1YDVA 3DGRA 4N02A 3L2IA 3SGUA 1XUUA 3DAQA 2JGQA 2ZA1A 3A22A 2HS8A 2VEKA 1Q6RA 3SY5A 1G67A 3ZFHA 3FJLA 3NPUA 1Z41A 2BLEA 1I2PA 2YZRA 1LOSA 5KZDA 1KLZA 3UPWA 3MP3A 3NDOA 3QEZA 4GUIA 1M7OA 3M43A 4CQ8A 3W73A 1OHLA 3TROA 1F74A 4A22A 1KV5A 1HUVA 4IMCA 3EEGA 3W07A 2GJLA 3KVLA 3CQ0A 5J5RA 1TTPA 3PB0A 1K02A 1WX0A 2GVJA 2ZQ0A 2VFDA 2BX7A 4H6KA 5AFDA 2V2DA 2YPIA 1VCGA 4JXCA 3CIXA 3HJZA 2NLIA 3W1NA 1DORA 2ATMA 3W7OA 3UXAA 4M6PA 2AGKA 4ORMA 1YTDA 4NNBA 4YWIA 1EPXA 2W0UA 2DZPA 3T4CA 3FFSA 3LERA 3BG3A 3N3MA 2A2IA 3MMTA 3EWUA 5AHNA 2R94A 4O12A 1ZAIA 1TJRA 1PCWA 2EHHA 3KX6A 5K7JA 3P8IA 3MP5A 1FDZA 2XFWA 3GXPA 1XDMA 3IIZA 2C16A 5FI8A 1RQHA 5DCEA 3DFNA 4WOZA 3IIPA 1TIMA 1TO3A 2YR1A 5TIMA 4DEFA 1SZNA 4FXSA 1X1ZA 4O15A 3W7CA 4MLJA 3TC6A 1SPQA 2DZVA 3B8DA 2X30A 4UTJA 1G7VA 3L67A 2JKPA 1OF6A 4FF7A 4JIPA 3PUOA 5G2HA 2VOMA 3NA8A 4O0ZA 1HO1A 5HWJA 3PM6A 2Y61A 2VEPA 4BF9A 3BK0A 5K4XA 4N2YA 2J24A 2C18A 3GDLA 2LLEA 1OK4A 2A6LA 1AK5A 1KM2A 3MUXA 3BGGA 3MHFA 3M41A 1YLVA 4YLWA 4O4WA 2Y7FA 2QAFA 2QCLA 1UB3A 3T55A 3LCWA 2PRHA 3PF3A 3CTLA 2YCEA 1EUNA 3N9SA 5A8GA 1KLYA 1PIIA 3UWZA 3TQKA 2G95A 4HSOA 4N6EA 4M19A 6ALDA 4X3ZA 3U2OA 2B0MA 4IPIA 2BSLA 3CHVA 3L5MA 4ONVA 5DN1A 1D3GA 4O54A 3QFEA 5LNSA 1R47A 1F6KA 4JX5A 4MPQA 4O1CA 3QH2A 4H3DA 1TRDA 3GK0A 3GNNA 3LBCA 1H5YA 1I2NA 3NXFA 4LVAA 3W1QA 1OFRA 1YXYA 1F73A 4IMEA 1P1XA 1TB3A 2FPTA 5LNRA 1Z44A 3SIZA 1UJPA 3STCA 3WK1A 2ZTJA 3KRSA 1G4EA 1W5PA 2RDUA 3ATYA 1PL9A 4FO4A 3Q2DA 4RZ6A 3KHJA 3A9IA 2VELA 4FIQA 1L6WA 3SI9A 2XN1A 1KFBA 3FLUA 1ZENA 2A21A 4RZ5A 3IV3A 4I7UA 3ANYA 2NXGA 1KM4A 2CW6A 3UXDA 3TU9A 3R13A 2QUUA 5G2WA 3A24A 3UNDA 1I2QA 5J5DA 1QR7A 3TFXA 3P74A 3G3MA 1SR9A 1PHWA 4Y6GA 3IEBA 2ZYFA 2J9XA 1XCFA 3IGXA 3I7SA 4HN4A 2WJZA 3AJXA 4G1KA 4Q33A 3UD6A 4QM1A 1LRNA 1K03A 3EXRA 3T7VA 1ME9A 3WFAA 1ALDA 2V82A 3R89A 1TSIA 4N6FA 1GPWA 4U4MA 3FYPA 3NQGA 3THQA 1N55A 1LBFA 2Q3OA 4P2VA 3O05A 3BLFA 5HR7A 1AG1O 3G1DA 1DQWA 1LRTA 1LDCA 1F76A 4AEOA 3G22A 2QCDA 2WO5A 3MYOA 1VYPX 1TTIA 3LHWA 1A53A 3ABSA 5H91A 1H60A 1SQ7A 4WXYA 4JTIA 1K7XA 2I1OA 3C2FA 2R91A 4OQVA 1FQ0A 3LCGA 3CEPA 4O1AA 3NQ2A 3FKRA 1IGSA 3C8FA 1YTKA 5HUPA 2QCHA 5KSWA 5G4WA 3E0IA 3MYPA 1GT8A 4MYAA 3W7HA 3QSTA 4Y8FA 4ZQPA 4K7YA 2RHGA 3NAVA 3OA3A 4TU1A 5E93A 2G5WA 2A5HA 5HMSA 1EWEA 5AB3A 2I14A 1IF2A 2OZ0A 1JQVA 2GVLA 5AHEA 4K6AA 4LV9A 1JCJA 3W2LA 1PCKA 3NQMA 4GUGA 5C55A 4E2BA 1VLIA 4RKAA 3TDFA 3LGEA 3TH6A 3EWYA 1KW1A 5CZJA 1FWRA 2NXHA 1X8FA 3HGRA 1H7RA 5K3VA 3G0UA 4IMDA 4O11A 5HNRA 1TPB1 3G8EA 1U83A 3W74A 1DKWA 3WK0A 1KFLA 3Q58A 4L4MA 4MY9A 4AWTA 1GG0A 2EF9A 3N73A 4PH6A 4FB7A 2QR6A 1AL7A 5GVJA 1EIXA 1ME8A 3IGSA 2OT1A 2CLFA 1K7FA 4LU0A 1WAUA 1PHQA 1EB3A 3DKLA 2Z2UA 3F03K 3N19B 3UYCA 4BR1A 3O07A 3NM1A 4NVTA 3TSMA 1ME7A 3KXQA 3LTPA 3L5AA 4LV4A 2WQPA 5HULA 3LXAA 4UTMA 3ABQA 1LP6A 1FDJA 4FNPA 3TE9A 5AC7A 2Y6ZA 3P80A 1BKSA 2WSQA 1FXQA 2HTMA 1JJKA 1KTBA
chains in the Genus database with same CATH superfamily
2C79A 1KRCC 4JTUA 3BW2A 2VD9A 4GVIA 3BV7A 4B9YA 4G2DA 4CN4A 5M03A 3ENLA 1XIHA 4GNKB 1OABA 4LYPA 3RO6A 1D7FA 4Z0JA 3I6RA 3A4XA 3FS2A 4IMFA 2DSKA 1NTHA 1NFBA 4TVCA 3VINA 1A5KC 2V2CA 4MZ8A 4E5TA 2E6YA 4YCPA 3HGJA 1GTEA 2XN0A 2HVMA 4IPLA 1R3RA 4C6QA 4M5PA 2GSJA 1T8QA 1KXTA 3MU7A 4RNJA 2PWDA 1Q2SA 1R3YA 4ECLA 3W86A 1SGJA 1TPWA 3O6CA 5IDZA 5CPQA 1ONXA 2OQYA 4EKJA 4DJEA 5D4YA 2VL4A 3MWCA 4OJYA 3ECQA 3VDBA 1S2UA 5D8WA 3VE7A 3FW6A 4OKDA 3UPMA 3JR2A 1CYGA 5K2ZA 1FCQA 3SCOA 1YNPA 1KFKA 1KO0A 3HPSA 2BFGA 2QV5A 5G1TA 1V79A 3HQ1A 1EO5A 1UR2A 5TBOA 2VURA 4HCHA 2A1YA 3TLQA 3PZIA 4CCZA 4MWAC 2E8ZA 2PEVA 4B4FA 1ZBWA 4GFSA 3QR3A 1KCKA 4GY1A 5F2IA 4QDMA 4XTIA 2WZTA 3CQIA 1ISXA 1EDTA 1TELA 1VYSX 4N9DA 4DZHA 1PYMA 4Q8MA 4ADTA 1ADSA 4XD3A 5EU9A 4KETA 3VMPA 4J2MA 2BOEX 4LYRA 4I6KA 1OX5A 2QMKA 3VYLA 3AYTA 3TN6A 3P5ZA 4GI8A 2GQ8A 3LHYA 3DKJA 4TR9A 4QG8A 1VJZA 3W84A 4ZXLA 3UW6A 4E8GA 2I9UA 5BRBA 4C6KA 3FY1A 3EOSA 3TX9A 1WBHA 3GXTA 4KKXA 3DH7A 5AYXA 1EBHA 3N6QA 4JFSA 5BWFA 1GKPA 3UP8A 4A4AA 5FIPA 2P1FA 2DZTA 3DN5A 2D3NA 3RPTA 2X0HA 2ZRUA 1XH0A 3AS0A 5AYZA 1K8ZA 4DBSA 3GXIA 3N12A 2HRWA 4MY1A 3H53A 4KIRA 2J7CA 3OBKA 1BYAA 1EP3A 4DYJA 4D6IA 8RUCA 1V3IA 4DQWA 1QNSA 1WUFA 2RGMA 2PS2A 1XPGA 3BAIA 4S2CA 3HURA 5HJYA 2JF7A 4QXIA 2J7BA 2BODX 4HCLA 3S1VA 3MY9A 5ABTA 1PKLA 1DOSA 4WX2A 4YN5A 2VX4A 3MDUA 3UBPC 4KBXA 1JFXA 4FNUA 3T8LA 1UD4A 3EA3A 4LAMA 1CLXA 1JCLA 5AN7A 2D2GA 2XGBA 3CZEA 3L12A 2VUNA 3AFBA 1Z32X 2WWDA 1FWHC 2C7FA 1E1FA 4NJIA 2G3FA 3WEMA 4MF4A 3W4RA 5IXEA 2XFFA 4ZOBA 4H7VA 1H7PA 4NF7A 2GZXA 3K5XA 6REQB 3IRDA 2AMGA 1BG4A 4ICNA 1VLWA 1RY0A 3C0JA 1V08A 2PCQA 1UWIA 1RK6A 2YL5A 2PE4A 1EEXA 5CAKA 4LYKA 1GCYA 3WO8A 1TV7A 3VCCA 1E9YB 4HZ8A 5F4WA 4M7SA 3GR8A 1IV8A 2CKRA 3MI6A 1LM1A 4JGDA 2V5LA 3EX2A 1NAL1 3F4CA 3WLKX 5AHLA 4HPGA 3TAOA 4F79A 3KVJA 1BTCA 5D02A 2D2HA 3NSMA 2UZ9A 3GVWA 3ABZA 3TW9A 2F6UA 3VCNA 4BQ2A 3IJ9A 1ITXA 4KS0A 3GFZA 5CPLA 4LXFA 3TTYA 1W9VA 1V6WA 1VBRA 1SFJA 1DV7A 4IL0A 2J7HA 3DOPA 1IEVA 3EWBX 3WLHA 3BAXA 2CZFA 1I1WA 4F0RA 3HU7A 1XLHA 1WOBA 2DH2A 1F05A 3UETA 1H0IA 3AXIA 2WBKA 4JYDA 5D2VA 2UBPC 4JCLA 3WFZA 3HIJA 1P5BA 3VXGA 4RK8A 2WLYA 2ZUWA 1CXIA 1QVBA 2OX1A 3VIIA 2RFGA 4DXXA 3BQ6A 1NDWA 3MO7A 2F6XA 4FP1A 1BF6A 3KZSA 4FX7A 1FCUA 5AHFA 2G96A 1R2RA 1CT5A 4O53A 4AD4A 2PPGA 3VFLA 3WQOA 3NYDA 1RCQA 1YDOA 1LBLA 3SZ8A 5FEZA 1XBZA 1EC7A 1UA3A 4YVXA 3EWZA 2QJGA 2CNCA 4WCJA 3GG8A 2CWNA 3ZLHA 2E7FA 3FHAA 5BU9A 2ISWA 3LTSA 1QW9A 3GTIA 3TA9A 2WVTA 1JYVA 1E55A 2G3JA 1PS9A 2CHOA 3VD5A 4E0CA 1BSIA 3QPZA 3DFOA 4GINA 4S38A 3B9AA 1TMQA 3CHCA 4W88A 2YXOA 3GH4A 4KWSA 1OC7A 3VDHA 1R85A 3TTQA 2PDKA 3P5YA 3MPGA 4CCDA 3GDMA 3GAYA 3L2LA 1GYMA 3W00A 4O8RA 4NJJA 3IJ8A 1WA3A 1BYCA 1CZ1A 1VJIA 4C6FA 4MUZA 4QE1A 3BANA 3E5PA 1JZ2A 4E8DA 3PBGA 3WQFA 2J9ZA 3BW3A 1R5YA 1OT1A 1QPOA 4K8GA 2GGGA 1XKJA 4XAYA 3W6LA 2E68A 1Z3NA 1GG1A 2GQ9A 3CPGA 3NQVA 3E3HA 4YL2A 2J88A 4Q8TA 3W71A 1ZRQA 3WFLA 2C91A 3FVDA 1Q4WA 1J01A 2IPWA 3E2RA 3M0HA 1YRRA 1VC4A 1AJ0A 3QV7A 2TMDA 2PDBA 4DWSD 3P93A 2HK0A 2ZXQA 3QN3A 1NY1A 5CGMA 1SO3A 4TX9A 3V1HA 1LQAA 2ACUA 1ADOA 1WO2A 3W7MA 3D5HA 1J5TA 1V3LA 2C13A 4M7TA 1RD6A 1ZJHA 2VFHA 4X0NA 3AMLA 3GQYA 3APTA 4OGZA 2VFEA 4YMZA 1JZ6A 4XAFA 5BMXA 4HK6A 4A3QA 4HNUA 3H7RA 4DF1A 3S3GA 4LAOA 4RZBA 2E6AA 5DO8A 3VE9A 4QTGA 4OOZA 1AQHA 5F2LA 2OG9A 1OX6A 3ABRA 3OLGA 4CD6A 1OFDA 5LKYA 3U3HA 4LCRA 3T0DA 1PO9A 4R9OA 3EOLA 3GHUA 2ACQA 4XZIA 3E6EA 3NPWA 4HKPA 2Y7EA 1SZGA 4UTWC 2FZNA 5ABGA 2X2GA 4LRTA 4HOXA 4LT9A 1YPXA 4GIYA 1WZMA 3WD4A 2B7QA 3RPMA 2VZUA 1JZ3A 1UD5A 2X09A 4IUGA 2XM2A 3QQWA 1VRXA 1FFQA 5G1YA 1W0MA 1OYAA 2XIOA 4H7ZA 3CAKA 3P67A 1AH3A 2PGFA 2QUVA 1IEXA 4JDBA 4LYQA 7TAAA 1EJXC 3QW3A 3K2GA 2VM8A 3DX5A 3I68A 1B5TA 2FH6A 5HAOA 3LV5A 3TCEA 2C0AA 2CU0A 3FSUA 4XKYA 3DHDA 4X61A 2GQAA 4RNFA 1RP8A 3UZJA 3A6OA 2HEJA 4X2PA 3KOFA 5J04A 2OFJA 3QLLA 3HMCA 4KCUA 3BDKA 3S46A 1LLZA 5IM51 1XLJA 2XIIA 1Y7VA 3S2LA 3TKFA 2WJFA 1EWDA 2PDNA 5AY7A 1NQKA 4W85A 3WLIA 2FVMA 4L4LA 1UKOA 2IQTA 2OWXA 1T99A 3LY0A 1IT8A 1R38A 4D6EA 2WKGA 2FFIA 2DJXA 3JW7A 1B9BA 2YYTA 3MVIA 3NPXA 1P1MA 4BF5A 4ML4A 5CPMA 4P61A 4RXFA 1KKOA 1AW1A 4XX6A 3UG8A 4YVPA 4JIRA 2O9TA 5AHIA 2DH3A 1S5NA 2BGSA 3NIYA 1KKRA 1OIFA 2A3CA 5FJJA 4YYCA 3URBA 2V5BA 2V6AA 1HJQA 1EP2A 5E70A 5I77A 3PG9A 1OINA 1W1B1 3FVMA 3ARSA 2Y70A 2YDAA 3S47A 1PX8A 1KA9F 1Y5VA 3GXNA 1E0VA 3ZR4A 2ZFAA 1DJIA 4WY0B 1OX4B 2E09A 2ZZ3A 1QPRA 4IUOA 1U22A 2G4FA 1KTCA 3EDFA 3USBA 4Z2JA 1BVNP 2JALA 1BD0A 3VUSA 4HHPA 1FCBA 2V68A 1EF2A 2PGWA 2DUZA 3FOKA 2GGEA 3CH9A 1PAMA 3I10A 1LG1A 1EC8A 3URAA 4Q7NA 3M4HA 2PWGA 3CQJA 4R7WA 4AMCA 3H21A 4HQVA 2Z24A 2PZNA 3DI0A 1UP3A 1GNXA 2B7OA 2YGYA 4RE0A 3HZ3A 2V5JA 2FB3A 2B7NA 4AMAA 4GNJA 3ABOA 3CL8A 4OV9A 3UT0A 2F2KA 5AZ1A 1IZCA 2WSKA 1GOQA 2ESCA 3P3BA 1OC6A 5F2GA 1B4EA 2ZRXA 3LDVA 4F0LA 2QCFA 1MEWA 3HPFA 2BGNE 4PUWA 4JY8A 3RF9A 3HOJA 5LIWX 1C92A 3FAWA 1UP0A 4C7GA 2H3DA 4W5UA 3NO3A 5FA5A 5HOSA 5HMDA 3DUGA 4RV8A 1X8CA 4PL2A 1NFGA 3C86A 1DE5A 1S5MA 2P88A 1VGAA 3DCPA 4H8UA 3KBJA 3WIJA 3MHGA 3C56A 1AFSA 1VBJA 2H8ZA 2I56A 3EB2A 2RDWA 4H6QA 3UYIA 3N15A 3ARXA 1RCOB 5IBXA 3BQ5A 1ENUA 1E1CB 4UFLA 4FAMA 1YEYA 4FS9A 3TJXA 2GUYA 1RHCA 1OYCA 4GBDA 4QE5A 1BEUA 4H83A 4G5DA 1JDEA 3MUZ1 5BRPA 1CGYA 3EDJA 4Z1DA 4PCFA 1LZOA 1FWSA 1WXYA 3M0YA 3DDMA 2WAGA 1Q13A 1O4UA 2VC5A 5MF5A 1BG9A 2VZOA 3BZJA 3IIOA 4HK7A 1QTWA 1UOKA 1RSCA 2G3NA 1XLMA 3LGDA 3RU6A 4QRNA 3WDPP 3E2QA 1MDLA 1C29A 4HCDA 3W1UA 5HWNA 3LCXA 3LSCA 2X2YA 1TCDA 2X0SA 5EKYA 3U2CA 1OGGA 3O16A 1IR1A 1NP2A 1DTNA 4I9JA 3ZLGA 1HTIA 3IK2A 3PZTA 3T0CA 5A6JA 1A50A 1V4YA 5FKYA 1CIUA 2AL2B 3AUJA 3P6LA 1SJCA 4AYSA 4M1BA 1TVLA 4GH3A 3ZQ9A 2FJUB 1OCBA 2DU2A 2WHKA 4IG2B 4M8UA 4PBGA 5AOUA 4NRSA 4TMBA 1B3VA 2C14A 1E1CA 2WBGA 1RZMA 1SYTA 1XLGA 4ZE4A 3MMWA 3LA4A 1RQEA 2NZLA 1HL8A 2QCCA 3TZNA 6TIMA 1GTHA 1E6NA 3S5YA 4EANA 3PSWA 5I3KA 3VPLA 1CXKA 3O1NA 4NJKA 4XQ6A 1P0EA 5C2GA 4TMCA 1XCXA 1HW6A 3IAQA 1HFBA 5H8PA 4M81A 3CBWA 2Y5SA 1M7XA 2GDQA 2VZSA 3FNDA 3GFXA 4PMNA 2PAJA 4XAPA 5I03A 1T41A 3OA5A 3CAQA 4HD5A 1FA2A 2R82A 1E9LA 4A2SA 3KBSA 1QXLA 1QBAA 9RUBA 2QEZA 3CQHA 3C2YA 3OZPA 3LTYA 5I02A 1Z48A 2E5CA 1FUYA 2VCBA 2VFFA 4H6RA 4LH8A 2FKPA 1UD6A 2CLIA 4UR7A 3I4KA 4NHVA 4AZHA 3OVRA 3GAKA 4IHCA 2OELA 2OO6A 2E28A 4AAJA 1SFSA 3T6CA 2RKXA 3HPZA 4GI6A 4MJZA 3SCWA 4ZBCA 3MA8A 1KB3A 1BFNA 5DMYA 4UMAA 1Q4NX 4EAYA 2NQ5A 1HNYA 5B7YA 2ZX9A 1OX4A 4WY0A 1XFBA 3RIKA 3UQNA 2NQHA 3VIOA 5D2YA 4GJ1A 4IOTA 1EX5A 5DRCA 2HSAA 1GVEA 2PWFA 3QRHA 1AW5A 1RJPA 2NQJA 3Q45A 1E4LA 2WM1A 2ONEA 3FIGA 3SDOA 3D6NA 4DF2A 1IWBA 1QI2A 2DORA 3B40A 3DESA 3W1TA 3H54A 4ERAA 1UUMA 5JVLA 3W7PA 2D73A 4L6DA 2XDFA 1XWYA 4KW2A 2C8NA 2CZVA 2WW5A 4NZFA 2A7NA 3AC0A 2H8XA 2BASA 1XISA 3VI2A 3AROA 1ODZA 3H8AA 5H8UA 4QEHA 1TPC1 1Q7MA 5AYIA 1WDSA 2QHAA 2WM0A 3CZLA 3M5YA 3TA6A 3EZ4A 2EKGA 2Z2AA 1AH0A 3BG5A 1X7IA 3H4XA 3WLQA 5I24A 1MUMA 1XP3A 1QO2A 1RCXB 4JPGA 4XKYB 1AUSL 1O5KA 1JDFA 1NP0A 4XISA 2G0WA 4QITA 1H61A 3SUSA 3W2UA 4QJ3B 5EMMA 3EKZA 1HJVA 2DP3A 4S3KA 1UR9A 4M80A 2I5GA 4S23A 4LUTA 1EXBA 2Z1BA 1OJXA 2J8TA 1I8JA 4E4PA 3QY8A 4U10A 3ARZA 3DG3A 3WUFA 1S2CA 3SUVA 2DZAA 3OHIA 4H9YA 3QC0A 2OEKA 2A0NA 3VIPA 7ENLA 4IIFA 1XG4A 1ZCOA 2H3BA 1QPQA 4HPJA 2I5IA 2PCEA 1SMDA 3L4XA 4AD3A 1PKMA 2DPEA 3UWVA 3PN8A 3LRLA 1PIGA 3RX2A 3LK6A 1KM0A 3W1AA 1L8PA 3FEQA 1JD7A 3Q4DA 4XUGA 4MAZA 4LAZA 4NZ3A 5L6UA 3ZSSA 2IXUA 4UZUA 4Q4SA 1T0OA 3NO1A 1LL7A 3WEOA 4PMDA 1K4HA 3VIKA 1VCVA 5FJUA 5BNKA 4P7QA 5DELA 3D0CA 3H26A 4U31A 3EMQA 2OVLA 5KETA 1WZKA 3M46A 3SEPA 2VO5A 3POCA 1IIHA 3DC0A 4RDZA 1MZRA 1QPNA 1GHRA 1G0CA 3MZ2A 1NDVA 2CLLA 1QO5A 1M9HA 4D6HA 1DJQA 3VKAA 1CBGA 2SFPA 3E5BA 5JUVA 2WB5A 4WHBA 2CWXA 1YHTA 3RNDA 2MNRA 3RO8A 1WZAA 3OGSA 1EJVC 5HJXA 3SB0A 4QLKA 5C70A 4GWEA 1YPIA 3U7BA 4MJ2A 1POKA 4RLIA 1QOPA 1EJTC 4Q7BA 1QI5A 2D22A 1DJNA 3LRMA 3AIUA 3WENA 1K7EA 4KWWA 4MFDA 1UKQA 4JKLA 1AA1B 5ENLA 3EYPA 5FEWA 4GRSA 4FNSA 1UH2A 2YW3A 1FTXA 4AXKA 4RR4A 4KCTA 4FOKA 4PMYA 1W5MA 4P5UA 1MO0A 3R58A 3W26A 4CQDA 2A79A 1FHUA 1K9TA 2Z28A 3RCYA 2J77A 1XYBA 3KBVA 1FP9A 4XZMX 4ZVJA 2QPSA 1SO6A 1OWQA 5ABEA 1YTEA 1TZ9A 5E9XA 1MW2A 1M5WA 4L6OA 3PS7A 4QS6A 4MB5A 1JCTA 3UWWA 4BK9A 3RAOA 1CPUA 3K46A 2ZOXA 2F8QA 4OWGA 4W8BA 1C8VA 3W75A 4HNOA 2ISDA 1W9PA 1ML1A 1O5RA 2ALDA 1AMYA 3VMOA 3RMEA 3R2GA 4JTRA 5ABHA 1DYSA 1V7YA 4ZO7A 8TIMA 4UTIA 4LS0A 5D09A 2B4GA 4K39A 3QC3A 5H1WA 1H7XA 3VNYA 4HZMA 3DXIA 3LHUA 4HYVA 5A6LA 4F40A 3QZAA 1VEMA 1UZ1A 3I7QA 4ZQNA 1OD8A 5A6BD 5C2XA 2GJNA 5CLTA 1I0DA 4EACA 1G5AA 2Q01A 3LMZA 1DWIM 3DHUA 1JQXA 4LUIA 4B92A 4IJBA 4DIAA 4H2CA 1WE5A 3L66A 2PRMA 1KTNA 3WMSA 1PXGA 1ZALA 1KFEA 2FIQA 1MW3A 3BOFA 3E38A 1Z6KA 1XUZA 5EMYA 4K1WA 3LZ5A 5DRIA 1Y65A 4J4KA 3IK4A 3WKZA 3LHZA 2NVCA 4M3PA 4ASTA 4GO9A 4BFAA 4NRRA 3PUEA 1V5XA 2FTPA 3RR1A 1LL6A 1S5TA 1XKYA 5CBIA 3L4TA 4H9UA 2IPFA 2YB1A 1HP4A 5DANA 3UJSA 3W6MA 4QGCA 1XLDA 1W2VA 1J96A 1S1RA 6REQA 5DMNA 2B81A 3OOQA 4J2PA 3QY6A 1UD2A 3M64A 3NZPA 4EPBC 4IIHA 1M7OA 4DJFA 3C0LA 1OHLA 3TROA 4PMOA 3RLHA 1KGXA 1YDYA 3CZJA 3EEGA 1R6WA 2GJLA 1JEZA 4ZE5A 3KVLA 3CQ0A 4D8LA 4Q6XA 4A6GA 4ZODA 5JIWA 2ZQ0A 1K1DA 4H7CA 3HJZA 2NLIA 1XJBA 2J74A 2CIPA 3MUY1 2ATMA 2VJXA 4S39A 1J0HA 1ZBVA 2DZPA 3FFSA 3LERA 1TV4A 1J0JA 5GJMA 3BG3A 3OIHA 3EWUA 2EHHA 2QIWA 1FDZA 3BL3A 5E0CA 4P8XA 1L6FA 4E3VA 1TVPA 3TWBA 1XDMA 3GNPA 1RQHA 3T2PA 4S3FA 4V33A 3IIPA 1TIMA 1H4PA 2CYGA 3SRDA 3UG5A 1J9YA 4H1ZA 3WUGA 1FHVA 2XUCA 3TC6A 1G7VA 1F3XA 1OF6A 2GJPA 4FF7A 1UHVA 4O0ZA 1HO1A 5HWJA 2FDMA 4R9XA 4BF9A 4Q8QA 1EGZA 4N2YA 2C18A 2B31A 1XYZA 3U4AA 1AK5A 4Q22A 4GQ0A 3BGGA 3UR8A 2BHZA 4C6NA 3HFTA 1ZGDA 3N2BA 3PF3A 1GUVA 3CTLA 3CS2A 4JQ1A 1KLYA 1OD0A 4GKTA 2G95A 5EFFA 2A3AA 3LQGA 1F07A 3QY7A 2BSLA 3IACA 1D3GA 1ZLPA 3QFEA 1DJGA 1R47A 4JX5A 2OZ8A 2G37A 4H3DA 1YE4A 3OTRA 4OIFA 3BH4A 3NXFA 1YXYA 2VMFA 2PWUA 1P1XA 1RK5A 1TB3A 2FPTA 3L23A 4IL2A 4LFYA 4HU3A 3WK1A 1F8IA 1G4EA 1HX0A 1PL9A 4EWJA 3KHJA 3PZNA 3PWGA 1R3WA 2NXGA 2ZX6A 1O6IA 5EB8A 3THUA 3UXDA 1KGUA 4GI9A 1IE7C 4PUUA 4AY8A 3WNMA 3T8QA 3A24A 3WNNA 4G1NA 4REQA 2UWFA 3DYOA 2CPUA 3GWQA 1UC5A 3P74A 1SR9A 1PHWA 5A6SA 4Q33A 3EXRA 2PI6A 3T7VA 1ME9A 2FZBA 2V82A 2BB0A 4HNCA 2DY3A 1T6MA 4YNGA 1EHAA 3JZEA 3O05A 3BLFA 5HR7A 5JBDA 1AG1O 1DQWA 1B2YA 1IGWA 1XICA 2QCDA 2WO5A 3MYOA 1VYPX 3RJXA 4CNTA 2Z27A 4L61A 1VFTA 1SQ7A 4JTIA 1FQ0A 4E4UA 4O1AA 1CGWA 1E4IA 2QCHA 2QYGA 2XSXA 3APYA 4Y8FA 3M0MA 3B8UA 4K7YA 3OA3A 4TU1A 2G5WA 1VENA 2PGRA 3VNLA 5CH9A 4U33A 2REQA 2GVLA 5AHEA 1M65A 2YCIX 4LAKA 1JCJA 1WKYA 3QOMA 3NQMA 4GUGA 5C55A 2PODA 1OSEA 3B9EA 2PDCA 3BAYA 3L4UA 1QI4A 4O11A 1TPB1 3W74A 1DKWA 2GJRA 3WK0A 4DUWA 2E1WA 2G50A 8XIAA 1FWCC 2EF9A 1KCXA 4UNIA 1W9DM 4H8VA 2OT1A 3KOYA 1WAUA 1PHQA 3DKLA 1EBGA 3O07A 3NM1A 3F4VA 4MSSA 3LTPA 2GWNA 3L5AA 4M56A 4UTMA 3GVRA 4QG6A 1LP6A 4RDYA 4E2VA 4J7RA 5GNXA 1Q6FA 5HMFA 4MYXA 1EHNA 3B04A 3N29A 5L9FA 4PB3A 2C1IA 3I4EA 4A2RA 1Q63A 1W3TA 4P7LA 2GK1B 4UQAA 1ISWA 3C5QA 4DPQA 2NWRA 1VEPA 3OW1A 1W32A 2QCNA 3W28A 3DFPA 3WYZA 1ZY9A 4YTRA 2V3GA 2VVNA 3MANA 4YS1A 3KOZA 3R11A 2NVDA 3WQ6A 3C4UA 3C61A 1AODA 1L6SA 1V3KA 2BY3A 4BWLA 4GA8A 4D8ZA 4GYJA 3HM7A 2OB3A 5GJNA 3NJ3A 4C6DA 4QBXA 3OG3A 3R43A 1NWUA 2G3IA 4IQJA 2YCLB 1CLKA 3NO5A 4JL2A 4PFMA 4UC5A 4DYKA 8A3HA 1FDYA 3BV4A 4XZNX 1I0BA 4C90A 3IIVA 3VM7A 5D2WA 4WZHA 1M01A 3T4WA 1Q6EA 4AWUA 4K2SA 3H7VA 3S9ZA 2HNHA 1GQLA 1POJA 2ZZ4A 3M47A 4PTXA 1C9DA 2V38A 4PTNA 3H55A 5JH2A 4WD0A 1UP2A 4JNZA 5BXRA 1EOMA 2O9PA 4UTTA 3DENA 3KDOA 3AWNA 3M0XA 3A4JA 3BMWA 1MEHA 5EMUA 3D46A 1E6PA 5LXEA 1E3XA 2F7FA 5EBUA 3VDGA 1HZYA 3PUDA 2XWDA 4IFOA 1YXDA 3JUGA 4LUJA 3N25A 1JPHA 2Z2BA 5KTLA 3IS4A 3LHVA 2EGZA 5DBUA 2Y5EA 3UPBA 2VEGA 4NXKA 4E2DA 3W88A 1IXQA 1ZZMA 1R9ZA 3TLLA 1XGEA 1UUQA 3NG3A 3DG7A 5AZ0A 2WCSA 1TA3B 1W1IE 2EAWA 2EEXA 1QDSA 1UG6A 3AHTA 4GUJA 2V30A 4F4RA 3BSMA 4PL1A 2YKKA 4NX5A 3ZMRA 1UWRA 2J62A 2VGFA 3MI2A 5JH1A 1QOQA 4IXXA 4EPEC 5HDRA 3B05A 1Z42A 3CUFA 3AQUA 1V6UA 2RJGA 4DWSB 3ES8A 3UR7A 4MKSA 4LPCA 1HKVA 2VHLA 4RJEA 2J79A 1V93A 3G0SA 5G4EA 3R8RA 6CGTA 4I3GA 1U1HA 3SY8A 1AQ0A 2JGYA 1XRFA 1TTJA 4HVXA 1X97A 3HV8A 3IVTA 1M7PA 2XISA 3NFUA 4XD6A 7REQA 4CCEA 3R10A 5BOOA 1S5VA 2CBJA 4ACYA 4JEJA 2O4QA 2BGQA 3CWHA 5C5YA 2XVNA 5DXYA 3WEZA 3GNDA 1QW7A 2CERA 4FALA 3HG4A 2Q8ZA 4JYFA 3GHSA 3IUIA 1ISYA 3ITGA 1XLFA 4I5XA 4Q4QA 5CZTA 3GU1A 4ADUA 4JOMA 1PB0A 3AICA 1O1ZA 1TJPA 4UR9A 4J3SA 3MW7A 5D38A 4E3TA 1XC4A 3UVIA 5FESA 2D3LA 2GUUA 2PA6A 4UFMA 1Z89A 2XVGA 4J35A 1H63A 3L5LA 3WQWA 4D8AA 4Z2HA 1E0UA 2CFFA 3TYCA 4PBFA 1XYLA 3QV8A 1F3TA 1GQIA 2W5FA 1WBJA 3ZLFA 3CB3A 2FPVA 1PDZA 3BJFA 5D04C 3S5NA 2PDGA 2IKGA 1ISZA 3IWPA 4DM1A 3F4NA 1D8CA 1YMYA 4V28A 5CSSA 2EQDA 2BBFA 1OT2A 3WBAA 2XU2A 2OLAA 3W2MA 3W7IA 1E56A 4PODA 3S6DA 2ZX5A 2E4TA 2IW0A 3KAOA 3DFYA 3GS6A 1UR8A 1RJQA 1ZUAX 2R8WA 4IXHA 3CXOA 2RDTA 1VHNA 3GRIA 4X2RA 4ZTYA 2NWSA 4ZO9A 4MIMA 1QT1A 4N9BA 4Z2GA 4HU4A 1SU5A 3W24A 3ARTA 4HPXA 2CXGA 2VGBA 5DF0A 3IPWA 3GIQA 1L2UA 3CLMA 3VTRA 5B80A 2NX3A 1G4TA 3WF0A 4GQGA 3TSBA 4AG0A 4ZSUA 1EP1A 2CETA 1OFEA 2QUMA 3M0KA 3VGGA 5LHEA 4WGHA 1TREA 4UMCA 1CGVA 4UTWA 2ZXBA 2ICSA 2RH9A 1OCNA 4KEMA 4GY0A 3BARA 3AALA 1GWJA 4R7JA 2NW0A 5HWMA 5KINA 3FDGA 1BXBA 1CB7B 2A4AA 1AMKA 1H50A 5AECA 1ZQ5A 1SO5A 4F0KA 1W8SA 2WNNA 2ZX7A 3SUTA 4JIIX 2AQVA 1AL8A 5F4XA 5T8GA 2PTWA 2WMKA 3CIVA 4NAFA 1L2QA 4UFKA 1OFQA 4FX8A 5AC6A 3NL5A 2CCRA 1DJYA 3E49A 3W87A 2ZXAA 3UA3A 1YQ2A 4C60A 3OP2A 3SCTA 2OGJA 2WOQA 3QZEA 1I9CB 3E9AA 1NQ6A 3JU2A 4U28A 3QR1A 3PZMA 1IXPA 2BS9A 3MBFA 1TYGA 4GJJA 3RDKA 4NASA 2BOGX 1ZP4A 4ZMGA 1DJXA 4GYKA 1O68A 3AHYA 1TPH1 2W67A 3JVAA 4I9MA 3S1GA 3E02A 3PC0A 3S5OA 5LGXA 4UBPC 3GW0A 3WN6A 2YFNA 2Z1KA 1OYBA 1OY0A 1HIZA 5FF3A 4GUHA 4KFOA 3PJUA 3OJGA 4UFJA 4MB4A 2IPGA 1WKDA 2J7FA 1XBXA 1W3HA 5AVHA 4CQAA 1PJ9A 4EXBA 4S3AA 1GOWA 4XO7A 5U4NA 1CLVA 1OFAA 3IRSA 2OTDA 3GYEA 3C2OA 3VGDA 4GYPA 2DIJA 1JFHA 1KXVA 1IXNA 3GDTA 4QX4A 1F4HA 4S1FA 1KGWA 1WZLA 2GGHA 3TYEA 4BI6A 2ZTKA 4QAIA 1TUFA 4NU7A 5A5WA 2UY2A 3OZOA 4S3JA 1QATA 4P7NA 2ZRZA 4P8WA 3FX4A 1HVQA 3NGJA 1D3HA 3P8JA 4LOCA 4BJHA 5A6MA 3LXCA 4GNVA 2E5DA 5FCZA 4BHYA 3W7DA 3CK5A 4NUWA 1K8XA 4UTLA 4LUSB 4S3DA 5CG7A 3TXZA 1JAEA 1GOXA 4OU1A 4LS1A 3DHFA 3GH7A 3GVQA 1GGOA 3NPVA 5DY2A 1Q85A 2IS7A 1W5QA 3WZ0E 1Z7AA 2XFRA 2F61A 4DRSA 4OBTA 4C6JA 3THDA 3BAJA 3UU0A 3EKGA 3A5VA 2CBUA 4GFIA 3LPGA 3W7JA 2D20A 2EPNA 4YIWA 4GISA 3PY2A 4ROQA 1TUXA 2FZ9A 1W9BM 4UCGA 1IHIA 2O0TA 1EQCA 3VMNA 3LI0A 1ZAHA 1FH7A 4UTUA 2E5BA 1R87A 2PC4A 4N4PA 3SY1A 1JI2A 1NM9A 2DEPA 5XINA 5LXXA 1VQTA 2WVUA 2WVVB 4JZ5A 3AIQA 3TTEA 2GDVA 4D72A 3QW4B 1DTUA 4Z1CA 2ACSA 1FBAA 3ANUA 1NWRA 2KX9A 4AH7A 3TIMA 2CLHA 5KZ6A 2CLKA 4ERIA 5CPOA 1KBBA 2CZ5A 1ZNNA 1X1NA 7XIMA 1A5SA 3VD7A 3I6EA 4J28A 3POHA 4W7WA 4CU6A 4A3HA 3GDKA 4KT2A 3N34A 4DB7A 2VEMA 1J0ZA 4NXSA 1TX2A 4O1DA 3ELFA 4PMZA 3RUBL 3EXSA 2P0IA 1UZ4A 1XDLA 4KPLA 1IT7A 2HBXA 4O57A 1E9IA 1ZCCA 2CC0A 4LVBA 3VIFA 4DBDA 4O0QA 1NDZA 1C3FA 3LNMA 4H00A 2W62A 2FLIA 4RXGA 4GO8A 3M5VA 1GPFA 4PA8A 1M3UA 3A4AA 3VIHA 1VFOA 1QWKA 3CMJA 3DGBA 3WMLA 2JFEX 5CLWA 3C3NA 3ARPA 3PBVA 1S1PA 1V6XA 4EX4A 1HVXA 3AXHA 4TXEA 3SN4A 2WC3A 3GB6A 1ICSA 1H1NA 2ZUVA 3F4WA 3O6YX 1B3OA 1CI1A 3CH0A 3GW3A 1NSJA 1XRTA 1J2WA 3PZUA 2WSRA 4KWUA 3VC6A 3CUXA 1WKEA 3SIMA 1X7FA 1VAHA 2YA1A 3QFWA 1MQPA 3R12A 2VFGA 3K1DA 3LCHA 4ZQCA 3HMJG 1YBQB 2JKAA 1UROA 3U6WA 7A3HA 3W7NA 3URNA 3O6DA 4PRRA 4R34A 2DT3A 3BICA 3QKZA 4DVOA 4RZ4A 1A5CA 5MKGA 1DIKA 3WH5A 5CSYA 4A8LA 2DVXA 3PWAA 5JXQA 3GVVA 3VIMA 1F7BA 4LC8A 5HINA 3B0YA 3P84A 1RD5A 5HNNA 3HG5A 5FOOA 4IWWA 4K36A 3GR7A 5BYWA 2NXIA 1H11A 4JTJA 3WJZA 2V3FA 1MSSA 2WPGA 2YBVA 1RPKA 3T0BA 1RQBA 3W22A 2RDXA 4WVXA 1MRQA 4GQBA 1M53A 2TPSA 1Q65A 2PTZA 3WDIA 4DF0A 3CZGA 4JTLA 4ROPA 2QJMA 3TJIA 4AZBA 1UD3A 4O1FA 4L1WA 3M5ZA 2Y0FA 5D8ZA 4KRZA 1GEQA 4QCEA 2H9AB 3LRKA 5A6BA 2DFAA 1VS1A 2DW6A 3E0VA 1XBYA 3G5EA 2XTKA 1VHCA 4JDYA 2GJXA 3BLIA 4RW3A 3TXVA 1FWGC 1T40A 3F1QA 5IFTA 1F3EA 1CENA 2OMAA 2PWHA 4MWAA 4B5VA 3H12A 1PZ3A 4JY9A 1PZ0A 3FA5A 2ABAA 4XB3A 3BXWA 3PVFA 3SCPA 4GPNA 5C9RA 1QU4A 3IGUA 2PU1A 2A85A 2P3ZA 1J4EA 4ACZA 1VYRA 4TO8A 2CZEA 2QDDA 2O4MA 1LT8A 4YHEA 4ZEPA 4JN6A 2VFIA 3LMYA 1AH4A 4QP0A 3ZWSA 3WMBA 4PFHA 4E4FA 4CD5A 2BVYA 4EXQA 1HJWA 2JK2A 4JTAA 5HK4A 4QNEA 2PDIA 4KRTA 3EAUA 4OBRA 1D9EA 3S5ZA 2X42A 5FF7A 4RPQA 2FMNA 1N8WA 1WDPA 1XBVA 2Y85A 2E3ZA 3UZZA 1J2BA 2HCVA 1NOWA 3G1RA 4N9EA 4B5NA 5DMMA 4O4VA 4F9DA 1B0IA 4K1GA 4HNVA 1J79A 4FMVA 4BCEA 1JULA 1E71M 1RVKA 1UPPA 3V0SA 4V15A 4PUEA 1K8YA 3VIJA 3T1GA 1VFUA 2P76A 3M0ZA 4HSHA 1OBAA 3CT2A 3RMJA 4QR6A 1GOOA 2RAGA 4HPNA 4NAEA 1KRAC 3URQA 1N2VA 1H1ZA 1EFZA 3S42A 1JR1A 4AEFA 9XIMA 2Y89A 5EYWA 4I7WA 3BC9A 4LY8A 3KS5A 5D2TA 4N9CA 4C6MA 3F2CA 1UCWA 4XD5A 3A5FA 1QI3A 3EX4A 3S4TA 5A6KA 3HGSA 2HXTA 2ZZ7A 1YXCA 1JUEA 1NWTA 2NUXA 2QUNA 3BLEA 4C1KA 3P82A 2VYOA 3VUPA 4JFUA 1JNDA 3MKKA 4QE4A 3NEVA 3EPNA 5HQLA 3ALFA 4DLFA 4FLRA 4F0HA 3WQEA 1KQZA 3AI0A 2WXDM 1JDDA 3CYVA 2VDIA 4QJ5B 1SSDA 5IHSA 4AVOA 2WKJA 1GVSA 4D1JA 2TAAA 1S2WA 2GJXB 1GKRA 3AIEA 4DO5A 4L1XA 4FHAA 3WDRA 5BW6A 1H49A 4UCFA 3VKBA 4A21A 1VPYA 5AC4A 2W3ZA 1HN1A 3C2RA 4J3VA 5E0KA 3ZT6A 1OIMA 5AC5A 5M17A 1U2YA 1H1YA 3SQMA 4UNKA 3BZGA 1VJSA 3VM5A 1LG2A 1W3IA 1FHLA 4HHLA 5M5DA 1VIZA 1TTQA 2FQIA 5IFPA 3IANA 1P4CA 4GYPC 4PC8A 3GNXA 1ZJBA 2QJIA 1W54A 2HQAA 2W6RA 4W8AA 5HBFA 3H2NA 2JEPA 4LVDA 4EWND 3BWWA 3PFRA 4MHBA 2PDPA 3T0TA 1LYXA 3V4BA 1US2A 2QKFA 1RALA 4PMQA 5K9CA 2XGIA 2FDSA 3R6IA 3V75A 4M29A 3VNZA 2YOCA 4URIA 4CNPA 5C6MA 1UR3M 1DQUA 4KIEA 4NP7A 3WLMA 5C7HA 4K8HA 3NYZA 1MWOA 2XSAA 4MNJA 3TR2A 3CUIA 3GTHA 1J10A 1YADA 4WLCA 4RL3A 5KZEA 3ONBA 1JYXA 3N2MA 3TOYA 3EX6A 1NEYA 1UIPA 5REQB 4J3TA 4NYYA 2GLKA 1LLWA 4W89A 2V63A 3H70A 1ICQA 4JTFA 3QPEA 4RX0A 4CEXC 1FX6A 2WJEA 4I8DA 3CHEA 1PVNA 3RLVA 2J25A 1Q7QA 2V69A 3NSXA 4JN7A 3UVAA 4YTTA 2CHNA 2E40A 4HOZA 3STEA 4LNYA 1EJ7L 4I7VA 3NOYA 1E51A 4A8RA 4C6IA 2ISFA 1JGMA 3QV9A 5GQBA 4ATWA 3CUGA 3MTWA 4LVFA 4OZOA 4DNMA 1GZ1A 2QJHA 3W83A 5FSDC 2ZUMA 3W7QA 3KCJA 4GCXA 4O0KA 4GE8A 2QMJA 4F2TA 4IFRA 4M24A 2VI0A 4UWMA 2PLKA 4GXMA 5F1UA 4NT0A 2OOFA 4EF8A 5LIUX 5AC8A 2CZDA 2WPBA 1ESWA 4FOJA 3LPPA 1XCWA 2DQXA 4Z0SA 3EDDA 2KZHA 4ICCX 5D2XA 3SFWA 4HMDA 1XDJA 3AIBA 4B4HA 2V3DA 4KWVA 2GVYA 4Y90A 1PYFA 2ACRA 1BQCA 4HNLA 2AGTA 2X7WA 4H9ZA 4K68A 3ARVA 4FSAA 5AVNA 3ICJA 1RA0A 5E6YA 1V02E 2O9OA 5JQ9A 2EPHA 1W3KA 2W91A 3NQBA 4CNUA 2GVEA 1R7OA 4AF0A 4AIOA 3LOTA 3KWSA 3LNPA 3S8HA 1B1YA 2DSVA 2ISVA 1LQ0A 2V5DA 1VBUA 1WDQA 1KM6A 4FIRA 1HQTA 3ITVA 4RDWA 2P5NA 4NJGA 3THAA 3W27A 3NR0A 1YDNA 4PUJA 1M7JA 4EF9A 3W0KA 1K3UA 1ZSXA 1GVFA 4LUSA 3HBLA 1F8MA 3L9CA 3LI1A 1E4MM 3FEMA 4BKNA 3QQ1A 1XLCA 2OR2A 4TV5A 1HXJA 3FYOA 1EJRC 1BLIA 2J4GA 3A3HA 3TUUA 3LU2A 2E9MA 4TIMA 1GJPA 1UC4A 3RHGA 2EBNA 5HR6A 3R0KA 2CBVA 2CBIA 4DELA 2VX6A 5HPCA 2YA2A 1N7KA 4P8VA 3KUMA 4R7OA 4UOJA 3SGZA 3GC4A 4AUBA 2QXWA 1XYAA 3M44A 3PANA 4PN2A 5BOEA 5DT5A 1JUKA 1A0EA 4DNHA 3AIRA 3C0SA 1GOMA 4M6UA 4NZ1A 2FJKA 2FVKA 4ZOAA 4HHHA 1BXCA 5DEZA 3KBMA 2EXOA 3KL0A 4KRUA 3MDWA 4XBJA 3CO4A 4LTSA 5EFDA 4QCFA 4JR5A 2WSPA 4AW7A 3ZR6A 1C9WA 3EPMA 4CVWA 3GZAA 4HJWA 1OVDA 4IFKB 3A12A 4D6FA 5CSRA 3NL3A 3C6CA 4W8LA 3GFYA 1B54A 2DZXA 3KRUA 1WCGA 2PLJA 5A8NA 5I23A 1E73M 4OV4A 4LAUA 3DIPA 3A3XA 3GDBA 3U9IA 3UERA 3BCJA 4U5IA 1J5SA 4A35A 1G6CA 4C6EA 1RR2A 4Y9PA 2DIEA 1CWYA 2PBGA 4XVDA 1J6PA 2XVLA 3B9NA 4HYWA 3S6TA 1XI3A 5GNYA 1XLAA 5I00A 1J8VA 2YIHA 3H2MA 4GXPA 4QDPA 1BWKA 4DN1A 4Z2LA 5CJMA 4V1YA 4PEKA 3WH8A 5T9CE 3VO0A 4D1IA 2E1DA 5A8MA 1TWZA 1D8WA 5I06A 2OEJA 3RCNA 2X8RA 3VOCA 5D03A 5CEWA 4GVGA 5D05A 2EKCA 2GFTA 1SJAA 4AY7A 1QK2A 2OZTA 2I17A 1V02A 3BJTA 3ARYA 3RM8A 4J1OA 4ZZ9A 2FYMA 5IRPA 4B3KA 3ONCA 4ICMA 1REQA 3H2AA 3R0DA 2FGZA 3SGUA 1XUUA 1V77A 4NY2A 3WD2A 1E6QM 3ZFHA 2WNWA 3AMGA 3FJLA 1Z41A 1BF2A 4H41A 5KZDA 4PRTA 3GUWA 1JZ5A 2VT0A 3RILA 5CBJA 3GSMA 3W73A 1GW1A 1F74A 4A22A 4W86A 4DXKA 4IMCA 2DZBA 1FWEC 3U2ZA 4CD8A 4HB7A 3PB0A 6TAAA 1B90A 1U5VA 2VD8A 1GKQA 2VFDA 5E09A 2BX7A 4H6KA 3UESA 5AFDA 1AQFA 2V2DA 4JXCA 3QXBA 2DW7A 1CGXA 3MKVA 4JFWA 4KEUA 3VKKA 1EPXA 1UKTA 4M82A 1XW8A 2AMXA 4PUKA 1IWPA 4HA0A 2J78A 2WMJA 2Q8XA 3N3MA 1YX1A 3MMTA 2DUAA 2I5QA 4I6VA 4O12A 1TJRA 3P8IA 3EDEA 2XFWA 2ADAA 2C1GA 3GXPA 3SRKA 1UJQA 4NSBA 3Q67A 2C16A 3BSHA 4WF7A 1EGMA 1YNYA 3V5CA 3O0FA 1TO3A 2FH8A 3PZOA 1SZNA 4FXSA 4B5TA 4MLJA 4WEVX 3L67A 3B8SA 2OU4A 3F2BA 3APGA 3L4VA 1P0BA 3UZWA 3R4IA 5K4XA 1DWAM 4ATLA 3HJEA 2LLEA 3R8HA 1YLVA 3GU2A 3OZMA 4YLWA 1GHSA 1L6GA 3H24A 3NGFA 5IOBA 2QCLA 2W66A 3T55A 2PRHA 2ZWYA 1EUNA 5A2AA 3II1A 3UWZA 2FZDA 4HSOA 1DJZA 4PTWA 1HF6A 1TA3A 3ZM8A 1Q8AA 3L5MA 4LGXA 5DN1A 4O54A 3C0QA 3H2OA 3PPGA 1F6KA 1FFRA 3WUEA 3CZKA 4O1CA 1TRDA 2BXZA 2E9BA 3LBCA 5CGTA 2INFA 4C65A 3W1QA 3SURA 4IQDA 4IMEA 4I9TA 4ZTXA 5I09A 1AJ2A 3BLPX 1W1A1 1BGAA 5LYRA 4C7FA 3ATYA 4WJXA 1TX0A 4FO4A 3CO8A 3U0HA 3A9IA 4FIQA 3TR9A 2XN1A 4H9VA 2OGYA 1KFBA 3GYCA 3WD0A 4RZ5A 2CW6A 4B3LA 3TU9A 2ZXDA 2QUUA 1MRAA 2BMBA 3UNDA 5J5DA 3TFXA 3S2CA 2ZWZA 3P0WA 3QHMA 3IEBA 2ZYFA 3V35A 1K8CA 3TJ4A 4L80A 1VB9A 3I3BA 3AJXA 4G1KA 5DT7A 3LSBA 1LRNA 1K03A 3EGJA 3CHFA 4JKKA 1CTNA 3H22A 1ZTVA 1UW9A 3R89A 3E0WA 4PCPA 1OCQA 4DJFC 3FYPA 4YTQA 3R79A 4CD4A 3NTYA 2YCLA 4YYFA 3GE7A 2Q3OA 4P2VA 2VCAA 3KL3A 4AD0A 4HU0A 4IIGA 1LDCA 1PKNA 3PJWA 4AZCB 4AEOA 3G22A 4LBRA 3EEZA 4IGMA 1CXLA 1TTIA 4IGNA 2FHBA 3EOUA 4DWSC 1K7XA 2R91A 1C7TA 3CEPA 1M68A 3FKRA 1UZHA 2ZX8A 4YJ5A 4F48A 4F2UA 1IGSA 5I07A 1YTKA 3RU8X 3E0IA 3R7MA 3FDKA 1OEPA 4ZQPA 2WZMA 5E93A 2A5HA 2OLHA 2O56A 1EWEA 2OZ0A 5HXMA 1TWWA 4G6CA 3ZT7A 4K6AA 1W1YA 3W2LA 1DIEA 1LT7A 4PMVA 5I5RA 4P8UA 4BZYA 4E2BA 4RKAA 3TDFA 1VF8A 5CZJA 1LUCA 2NXHA 1X8FA 3HGRA 1H7RA 5K3VA 5XIAA 2AL1A 4D9PA 3HA1A 3IJDA 5HNRA 2VZVA 6XIMA 4RE4A 1KFLA 3Q58A 4L4MA 4MY9A 3KCLA 3E2SA 1HKJA 1GG0A 3GNRA 4Q4OA 4W93A 3N73A 1DXIA 3REQB 4FB7A 3GXFA 1AL7A 2QNEA 2VDGA 1EIXA 3RGTA 3M0LA 3FXGA 4HN8A 3IGSA 4GC3A 3V0UA 2HXUA 4L56A 2NQ9A 4HMNA 1EO7A 3N19B 3UYCA 3VK5A 3N1AA 3UR2A 7ODCA 2YJQA 4BR1A 2DGAA 1EZWA 4C7DA 2WQPA 4A3YA 1Q6CA 3T09A 1E0TA 3WBYA 2D24A 3EWDA 4U2YA 1FDJA 4PGLA 3SUUA 2Y6ZA 4IJRA 2WSQA 2J66A 1QOXA 1DPMA 1KTBA 2QIIA 3WH9A 2OSWA 1V6TA 2ZZ2A 1NIUA 4NQ1A 3MUIA 1GORA 1RY8A 5I3JA 1NOFA 2FMOA 4JL1A 3BLKA 1OC5A 3LM3A 3CMGA 4MADA 4Z1YA 2QVHA 2DQWA 1V0NA 3N17A 1SJBA 4J3XA 1SSGA 1FHDA 4MB1A 1Q2RA 4O14A 3UR5A 2IKJA 4F0SA 4HPHA 4EK7A 5U7SA 5FJOA 3EBVA 1WV2A 3GG0A 3WJYA 4WQ6A 4GC4A 1QHZA 2E6DA 4GH1A 1B3ZA 2OZ3A 4N4QA 3G1AA 4XD4A 1QAPA 4O13A 1HJXA 2J6XA 1EDGA 6A3HA 4IJCA 2EPKX 4ENLA 1SFTA 4ZB5A 5XIMA 3PULA 4RNHA 4H19A 4REQB 3QJAA 1GVOA 2PD5A 2V81A 5CPTA 5AKQA 3PFMA 3A64A 3ZIZA 4K7VA 1TE1A 3MV01 4O17A 2Z1SA 2VTFA 5ABFB 2EG7A 2YSWA 2ZRVA 1J0KA 2ZRYA 1X96A 1TWIA 2YDRA 2Z6JA 3L65A 2X1TA 4UXDA 4EAMA 4ZGYA 3QQ0A 1D3CA 4PB5A 2I16A 5EY5A 3PP7A 3NZGA 2HPIA 4PMXA 3QM3A 2WZIA 1BKHA 4AHOA 1VR6A 3OB8A 2O55A 3SCVA 5A8QA 2Y62A 5CCZA 2AQWA 4B5WA 2J6VA 1CXHA 2WHMA 4F3HA 2PFHA 2ZADA 3G1SA 2E6FA 2Q8LA 3AXMA 3N6JA 1WOAA 1E6XM 5CBBA 3B0VC 3WLPA 1QJWA 1TG7A 4QQUA 3MO4A 4M51A 3V5OA 3L4WA 4GQQA 1MMFA 3XIMA 1LQ2A 1UQYA 1RBOB 3DG6A 1U1UA 4H6EA 2J27A 5DX7A 3L0KA 4ZFCA 2E25A 1QHPA 2XWEA 3TYZA 3QBUA 4FF5A 1UWUA 1JZ8A 3KFTA 3PZ9A 3VZZA 3E12A 4XKMA 3PBUA 5T26A 2C3ZA 3E2VA 1QBBA 2ANUA 1ONEA 5I3HA 3S0CA 3UJRA 3MT1A 1T96A 1LRQA 4ADSA 4CU7A 3MWAA 4NZJA 2VQUA 4U3CA 4MWAD 4W87A 1U33A 9XIAA 2AOSA 4R33A 4GVHA 4U5KA 5T9BG 4KFPA 1RXOB 2WCGA 3KE0A 4O52A 2NV2A 3DBPA 3E96A 2E8YA 1A3XA 1HJUA 4AHPA 5CC3A 3XINA 4XZ9A 4BQ4A 2Y7DA 3SN0A 1R3SA 4HGXA 1P0KA 4GOAA 2BHYA 3W7LA 2A6NA 5BXSA 5DBTA 3ISIX 1SUXA 4MM1A 1VH7A 4J3ZA 1RH9A 4WKFA 2Z4GA 4FR6A 4YU1A 3QYQA 5LSMA 1HGYA 1UIOA 5FJIA 3N4FA 3UWYA 4ZCWA 2A3HA 3OVQA 2NQZA 4DXVA 4TUFA 3F7JA 2QT3A 3TNBA 3U7VA 3TCSA 1X98A 3NURA 3OGVA 4WUIA 2BWGA 3W01A 4L6HA 3AS3A 2GPTA 4Q4KA 2DT2A 2D2JA 2DIKA 2VRKA 4AVNA 5KITA 2PDQA 1MZHA 1LF1A 1X6LA 4XSLA 2J9YA 1UWQA 1QRQA 1FWFC 1L9WA 1K9DA 2OPJA 3V16A 3ZT5A 3E0LA 5BXPA 3I3DA 3GDRA 3RYSA 3UNTA 3S2JA 4C91A 4DJDA 1DVJA 3L2MA 2O7QA 2YL6A 3PAJA 5LIXX 2DZUA 1W9XA 1XLBA 1WP6A 4JQ4A 4Q4PA 1FWAC 4XG1A 3QGVA 1PV8A 4E38A 3W7GA 4JKMA 1X6NA 4GGBA 2Z7KA 2PB1A 2CKSA 2V8ZA 4GLEA 3W81A 1A47A 2PLCA 1U5HA 3CMFA 3M16A 3OPSA 3NXLA 2J13A 4EP8C 1HKKA 4UQ9A 1VRDA 4Q4RA 5E5CA 2VDHA 5D32A 3UCCA 3WQGA 1XYCA 1DWFM 4YWSA 4XZWA 1H51A 4Q7IA 3TC7A 2DVTA 1MFVA 3LHTA 4Z17A 3R0UA 3N4EA 5IHRA 1VFFA 1IZKA 2YL8A 1MVYA 3WX7A 3W82A 3G6MA 1DIDA 2QGYA 3SAZA 1O94A 2VOTA 3NM3A 2W4XA 4BI7A 1O12A 1XSIA 4QDWA 1H62A 4GG9A 1DE6A 1TJ0A 2PDYA 4IPPA 4XZHA 1J0IA 4DLMA 2GOUA 3UWEA 3B06A 3NEHA 4B9ZA 3FHQA 1XLIA 1MXSA 2AAAA 4FEZA 2I9EA 3T44A 5FF4A 3KZPA 3T07A 4NL1A 5DFAA 3VA8A 2P53A 1W9UA 2AQOA 3YPIA 3VIGA 3W1RA 5LA0A 5C71A 2FPYA 2AKZA 1E5JA 1I6NA 3PK7A 3P61A 1W5NA 2VWTA 3N2CA 4QSFA 4AQLA 1YKWA 1LWHA 1ZHAA 1ZS2A 1H0GA 2JIEA 1ONRA 1OZQA 2DT1A 1Q6GA 3M5XA 3B9DA 3RFAA 4JTSA 3PAOA 2B7PA 4IIBA 4OECA 3M9YA 4BF7A 2PP3A 1E1EA 2X0YA 3K30A 4NZ5A 4UTKA 2I7GA 3T2OA 1GVRA 1GYNA 3CIWA 1CEOA 1KWGA 3UG3A 2HK1A 1YYAA 2ZDSA 1S2VA 2QZRA 2V67A 2O92A 4ZR8A 3FGCB 5EGRA 3CAWA 4MJMA 5E1QA 5A2CA 1EJWC 4G7EA 3S9YA 1P48A 2D69A 3U57A 1B3XA 3DFQA 1UYQA 1TE6A 1LTDA 5FJTA 3ALGA 5I3FA 1UUOA 3TK7A 3W85A 2YB4A 3K4WA 1TPFA 1E3ZA 1S2AA 3LCFA 1EEPA 4PRWA 4FNQA 2GGIA 4CNSA 3ITCA 1XRVA 3WF3A 4F2BA 2YDQA 3NQ7A 3SR7A 3BUVA 1EQPA 2I57A 1W31A 1I1XA 2WV8A 4BEUA 3GUGA 2NX9A 2YBTA 4A8NA 1XGZA 1XGDA 4PULA 1YW1A 4S2BA 2BXVA 1UMYA 5ABFA 1JPKA 1JCMP 3VABA 1OM0A 3W7RA 3TW6A 4L9YA 2RUSA 5HA7A 2R1NA 3VNDA 3QYSA 4HSNA 5TF0A 4B5XA 2DUXA 3RR4A 2XVKA 4UQEA 3WDJA 1EA9C 2CLOA 3PB2A 1HKIA 1N8IA 1WKFA 3CTTA 4GUFA 3NQFA 3NL6A 2Z00A 3W37A 4ORIA 3WELA 3STGA 3O06A 5JBEA 4PTVA 2JEQA 1WQ5A 3OQ8A 1QUMA 4H01A 3WL0A 4DO4A 1TZ7A 5LA2A 4H9XA 1E6RA 4LANA 4L7ZA 1VBGA 2PWVA 1TR1A 4L65A 3LBMA 3TMLA 2R24A 3UZXA 1FH8A 1O66A 1SW3A 1F3WA 1G9HA 3I7RA 5HATA 3S5SA 1V6YA 4AY1A 2QV4A 4QJ1A 3TYAA 3V7PA 5A8PA 4HYRA 1I2RA 3FJ4A 2OX4A 8XIMA 3KVMA 2A7RA 3N6HA 1IZJA 5HQMA 3ZVHB 3ITLA 3AHVA 2WANA 4QISA 3BOLA 4R27A 1W17A 2JF6A 3M07A 1J11A 1TPEA 3SRHA 4J9JA 2R9RA 4AWSA 4GGHA 3S83A 4A05A 2ZUUA 1R9XA 4AU0A 2Z26A 2DDXA 2BG5A 5LNVA 2Y8UA 1PUDA 3IUDA 5EMLA 4PBEA 4GHRA 1SVDA 2Q3RA 3V3WA 3WCZA 1B3WA 2PDLA 3GXDA 3DI1A 3P60A 1BQGA 1TQJA 2IMRA 3B9OA 5A8OA 4B3ZA 1EXPA 3BURA 3G24A 1TMLA 3W2KA 2WHJA 3PPFA 4AHQA 4QJ4B 3WLJA 1XPYA 1WAWA 2HMCA 4G8TA 5C9ZA 2XZ9A 2QCMA 3GNOA 4I5UA 3T2QA 4RNIA 4B91A 1B31A 1PE1A 2A7PA 4JTHA 3SCQA 1HG3A 3EOEA 3WUBA 1PTDA 4LF2A 1K70A 1M6JA 4YTSA 4C1NB 4DJDC 1JF6A 3L0GA 3EWWA 3LPFA 1EPVA 3SJNA 2IQDA 4KFNA 3GU9A 1S2TA 5F2MA 1DIOA 1AZ1A 5FACA 1CXEA 2FB2A 3W7EA 3NZ1A 2ZCGA 1YPFA 3KLKA 2A3EA 3MJYA 3TSDA 2BHUA 4AIUA 2VEIA 3DFTA 3BOXA 1IYXA 2EG6A 4PTDA 2W27A 2PTXA 4YXGA 3QGAC 2GOKA 2QCGA 2WC4A 3DU0A