3PY2A

Structure of c126s mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
b'RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVSFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Probing the role of the fully conserved Cys126 in triosephosphate isomerase by site-specific mutagenesis--distal effects on dimer stability.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3py2A00
3W71A 4ZQMA 3SGZA 5AHNA 4XWUA 3WJSA 1W5OA 1S5WA 2VENA 3PR2A 3TROA 4DO4A 2PCQA 1ZALA 1OFAA 2NXGA 2ZZ7A 5AHMA 3DFQA 5DCBA 3NO5A 1PV8A 2P0OA 1TPH1 3NQGA 2HS8A 1T99A 3F4NA 2QUUA 1MEWA 3E96A 3W84A 4JEQA 2E6YA 3LCHA 2VKZG 2ZA2A 4HNTA 1KTCA 2YR1A 6TIMA 5CSRA 4FNPA 1PS9A 4RZ5A 3O16A 3C2RA 4DXVA 1GOXA 1TPVA 3GIYA 3KVLA 1O5XA 1G67A 3TXZA 3QPYA 1VPXA 3M5XA 2WNZA 2WO5A 3MP3A 1FWNA 1AK5A 4N6EA 2VEPA 1NF7A 4ZMGA 3VFLA 3W1TA 5DELA 1K03A 4JS3A 1ZCOA 2RH9A 1H7RA 2AQWA 3R12A 4NJIA 4O18A 1H7NA 4KFNA 1YTKA 3PBVA 4ZQCA 3OVRA 4JTEA 2V5LA 2E6FA 5K7JA 3KFTA 4O0ZA 3SFKA 3W2KA 1H62A 4B5NA 5KSWA 2NUWA 3L0NA 1W3IA 4BF9A 5KINA 2W0UA 3UY8A 3P81A 3G1SA 3RMJA 3P8IA 1H60A 1OX4B 5K9DA 5U7SA 1BKSA 1TPC1 3EWZA 2JKEA 5AB3A 1OVDA 5H2ZA 4A2RA 8TIMA 4QNWA 2X1TA 4FB7A 2J6XA 4WY0B 3HJZA 3TAKA 4WX2A 3WJZA 5FF0A 1NEYA 1S5VA 3TR2A 4JTHA 3CQ0A 2W79A 1G4EA 3P5ZA 4DBDA 4AWSA 2ISVA 2FJKA 2QDHA 1OFEA 4NJKA 4JYFA 4O50A 2IQTA 1KV5A 2AGKA 3S6DA 2H3BA 3O6CA 5F2IA 1Q6RA 3MMTA 3CEUA 5C6MA 3G0SA 1SSDA 3EX4A 2E6DA 1DOSA 3F03K 1F76A 3KHJA 4XKYA 1SZGA 1G69A 3LCIA 3PVFA 3CB8A 3PC0A 5G1YA 3IGXA 5CSSA 4ALDA 1GQNA 1JUBA 1SZNA 3NM3A 3FLUA 2XN2A 3N34A 2NX3A 1H51A 4UFIA 4MFDA 3TQVA 4ML9A 4RXFA 3G1VA 3CLMA 3F4WA 1GPWA 2ZQ0A 4P2VA 1J5TA 1FWRA 1SO6A 1WOAA 3NAVA 4EF9A 1FDJA 3C61A 4RZ6A 1J4EA 2V2CA 2FFCA 2B7QA 1LOLA 5F4XA 4HSOA 1GZGA 2QEZA 5F4SA 1LM1A 3EWYA 4MYXA 2VOMA 3VNDA 3G0UA 1ZFJA 3SIZA 3SW6A 2YXGA 3DENA 5AFDA 1H7WA 2ZRWA 3M47A 4MJMA 3EX6A 4QIUA 4IXXA 2B7OA 1ICQA 1DJNA 1LP6A 3LBMA 1XM3A 1RZMA 3L66A 4XZ9A 3G8EA 5K4XA 4O1BA 3L5MA 1XFBA 2DZSA 4Y6GA 2NLIA 3PBUA 3VCRA 3L5AA 5AHLA 3LB0A 3QC3A 3PULA 1VCFA 3DKLA 4O1AA 3NQFA 3B04A 4OBTA 4UTTA 5LNRA 1XUUA 3SR7A 3I6RA 3N9SA 1VR6A 5D38A 5I3KA 1TPB1 5IM51 2HMCA 1PHQA 5E0KA 5K4ZA 3VI2A 1EUNA 3UZJA 3BW2A 1K3UA 1FCQA 2QCLA 3PS7A 3G1XA 3FS2A 4FNQA 1FY6A 2A7NA 4PC8A 1QPRA 3THQA 2QAFA 2Y7FA 1A5SA 1QCWA 4FO4A 4UFMA 3NL6A 3NQ6A 4FXSA 4YLWA 1D3HA 3C6CA 2ZZ4A 1UB3A 3PM6A 4K8HA 4PODA 5D03A 4NXKA 3MWAA 4OQVA 3L9CA 4WUIA 1GVQA 3G0XA 4ORIA 4NNBA 3HGRA 5D2TA 5G1TA 3A22A 1KBJA 3G1HA 3IIXA 3NPXA 4I7WA 1BEUA 2QR6A 3NVTA 1X1ZA 4FEZA 3BW4A 2RDUA 4NVTA 1UJPA 1SW0A 1TCDA 4UFLA 3P74A 4KFPA 4XTIA 1CX9A 4O57A 3TC6A 1Q6OA 4MPQA 5AN7A 2DP3A 3TSDA 1UUMA 3OG3A 4UIOA 2OT0A 4FNUA 4IXHA 2Q3RA 3W74A 5K3VA 1C8VA 2CLMA 4H6KA 3LX9A 1YDOA 3SGUA 1XBXA 3TE9A 2NUXA 3T44A 4C1KA 3OVPA 3NQVA 1I4NA 3P7YA 2BTMA 3HMJG 3B03A 4OWGA 4UNLA 4PL2A 1OFBA 4FF7A 1IXQA 4EIVA 4LU0A 4DBEA 3HIJA 5C55A 3SZ8A 3V1PA 3UWVA 3GDLA 5E1QA 4IMDA 3CIXA 3R89A 3C0JA 3CTLA 5HWJA 2EHHA 4U28A 1W3NA 1SFJA 2VFHA 2X30A 2V81A 2YDAA 3S9YA 5KZMA 1QO5A 3TXVA 1OX5A 1NFBA 3RLVA 4DPPA 3M41A 3MHFA 3KXQA 1H7PA 3CWOX 2WV8A 3H54A 5HUOA 5G2HA 3KOFA 4UCGA 3W7IA 1LBFA 2QCFA 1HG3A 2CU0A 2E5CA 4HSNA 3F1QA 2WKJA 3W72A 4D2JA 3LV6A 4UTMA 2DZTA 5FI8A 4EOUA 4XQ6A 2E77A 1ICPA 2XN0A 3GAYA 4PEKA 5BOOA 3S5ZA 5AYZA 4A29A 1P1XA 3TSBA 1W1ZA 4O54A 1H1YA 4A21A 1XDLA 4IPJA 1F2JA 1OX4A 5D2WA 3MHUA 2P10A 2BZNA 1M5WA 3AJXA 4UFHA 2H6RA 2E68A 2WSYA 3P8JA 4O12A 1H1ZA 1K7FA 1Q6QA 4WY0A 1JCXA 1TTPA 1ME8A 5CZJA 4YMZA 4QITA 4O52A 1L6YA 3S1WA 4FIRA 1H63A 3C8FA 4UTHA 5D32A 4RCXA 1FXQA 4GUJA 3JS3A 4MIMA 3HPZA 3NDOA 4HPJA 1JUKA 5T26A 3Q2DA 3M5VA 4I9AA 4JD4A 2ZBTA 1XL9A 4HT3A 1W54A 2J9XA 2B0MA 1BWLA 1RD5A 1TPFA 4O0KA 3NZRA 4BK9A 4BWLA 4QISA 3EXTA 4JTUA 1XDMA 1TV8A 2YW4A 1JCYA 3UNDA 5CKSA 4QNEA 4AHPA 1MO0A 2PRMA 3W7CA 4P61A 3MW7A 3A9IA 1M6JA 3W7RA 3W23A 3MP5A 3BGGA 3Q37A 2BLEA 3QW3A 1JCJA 3B8DA 3W6YA 4KWVA 1WX0A 4MLRA 1SO5A 3W70A 2A6NA 2VEKA 3EX3A 2Y7GA 5J5RA 5A8GA 4UTJA 1KM6A 2ABBA 4NX0A 1D9EA 1KM1A 2QJHA 1W37A 1MSSA 1PE1A 3BG3A 3ZWSA 1DL3A 2ZCGA 3P5YA 2V8ZA 4YCPA 4C1LA 3N19B 3LLDA 1T8XA 3LXBA 3CM4A 4JNMA 3UXDA 1VCGA 1P5BA 1U5JA 3W87A 3QW4B 4UTIA 4N6FA 1NF0A 3N73A 1SU5A 1XC4A 3W86A 1JUEA 4OGZA 1YXYA 2VEIA 3C2OA 2CLEA 2F7FA 3IVSA 1JR1A 1LYXA 1QDSA 5LNSA 4LV4A 5HULA 3LTYA 1MEHA 3S5YA 1OFPA 2JK2A 4POCA 3W9ZA 2J9YA 1FCUA 1ZNNA 3DXIA 3L67A 2R94A 1EUAA 4MFEA 2KZHA 3PSWA 3S5OA 1VJIA 5FEXA 1X1OA 1YXDA 4H4IA 4A2SA 4FHAA 3TX9A 2H3DA 3THAA 3STGA 4MLJA 2VFDA 2WOQA 4HNNA 2A0NA 4JTJA 1QOQA 3PBYA 2GUUA 1YLVA 2CLLA 3LTSA 5TQLA 3FKRA 3LHVA 3W1XA 1OFOA 1T0OA 4JX5A 3L0KA 1D3GA 2R14A 2QDGA 3PUOA 1K02A 1ADOA 3E49A 3L65A 4BI6A 4A22A 3KX6A 4WY0F 3WJYA 2QJIA 5EKYA 1LOSA 4UNKA 5I3HA 1XBYA 2QCHA 2X2GA 5D05A 3PAJA 3FA5A 1RR2A 4A3UA 3UYCA 3C2EA 2HSAA 3DFSA 2GQ8A 3S1VA 1OFQA 2A21A 3W7NA 4NX5A 1IXNA 4DF1A 3SECA 1F6PA 3IIPA 3NGJA 4K39A 3NXFA 3INPA 3O05A 2X16A 4LRTA 1EP3A 3STFA 3RNDA 3G1AA 4LNYA 3OEXA 1XXXA 3O63A 2VFIA 2DZXA 2RHGA 3CWNA 3W1QA 4OT7A 3B0VC 4BR1A 5TBOA 2FB2A 4NXSA 3EKLA 3IVTA 1PL9A 2YYTA 5AHFA 2Y85A 4UR7A 2NXIA 1GVSA 3W7EA 4J9JA 3QMRA 1QPQA 2DZWA 3MYPA 3DI0A 1X7FA 1OJXA 3B4UA 4JTFA 3TSMA 5EL1A 2P1FA 5BNKA 1RQEA 2PRHA 4DEFA 2PURA 3FOKA 4LW7A 2BWGA 1GVRA 2GPTA 1DKWA 3TUUA 5FEWA 3R5EA 4QJ1A 1VC4A 4WQ6A 1TTIA 5TIMA 4UMAA 4E0CA 1RQBA 1AW1A 1TJPA 2EGZA 1GYLA 5CZSA 5L6UA 1Q45A 3UQNA 2Y6ZA 3R8RA 1A53A 5AHEA 3BG9A 3S0CA 1M7OA 3L21A 2WQPA 3LDVA 5MHBA 2DU2A 5EBUA 1ONRA 4LVGA 3W2LA 2C0AA 1EP2A 4LC8A 3RLUA 3BPWA 1TB3A 1A5BA 1OF8A 3T4CA 2QCNA 2QUVA 2JGQA 4EVZA 4M7SA 3PF3A 3T40A 3OIXA 1L2UA 2DZUA 3GLCA 1GTHA 1RPXA 1TRIA 1OYBA 3QRHA 4JN6A 2A7PA 3LCLA 4Z1BA 2ZTKA 1KM2A 4AMAA 2F84A 4GUFA 3D0CA 4PA8A 3WFAA 2FPYA 4WZHA 3NQCA 3GDTA 1CI1A 3LI0A 4LVBA 1I2NA 3R13A 1SO4A 3E0IA 4NT0A 1WOBA 3MI2A 3M44A 2V2DA 4MOZA 1KFJA 1DBTA 3NZ1A 1SW3A 5LHFA 4WJEA 2QCDB 4OE7A 1ZHAA 1SZEA 5AOUA 3C4UA 5AYXA 1FWTA 5CZ0A 2FLIA 4GBUA 2YYUA 3NQMA 2YCEA 2OCZA 3NA8A 3EWXA 1AMKA 3UWZA 4CCCA 5CPNA 4FXRA 4ZQNA 2AAMA 3LV5A 4AHOA 4ONVA 3O6YX 4NNAA 3QPZA 2EAWA 1ML1A 3NQDA 2C3ZA 3DI1A 5J5DA 1MEIA 3BLIA 4N2YA 1MXSA 1GWJA 1KFEA 4BI5A 1OK6A 4NZJA 3NQEA 5G4WA 4AEOA 1P4CA 1YPIA 3BW3A 2A5HA 4K36A 2CZDA 3G1FA 3KRSA 4GUGA 5EMUA 1TIMA 3EX1A 3MHGA 3WJWA 5DY2A 3OA3A 2BSLA 4R33A 2VELA 2V5BA 1IIGA 1ICSA 3W73A 3LXCA 3CPRA 1O95A 4IQLA 4ZVJA 1JCLA 3B05A 4R7JA 3B0UX 3IEBA 1TRDA 3EXRA 1QOPA 3A24A 4H3DA 5EYWA 4ZZ9A 1KFLA 3W1LA 1UCWA 3K30A 3NOEA 3IV3A 4XUGA 3GDKA 3DGRA 1OFRA 2CZEA 4R53A 4BI7A 2QAPA 3W1UA 1GYNA 1EWEA 5AC6A 1ZY9A 5LGXA 3OBKA 3VE7A 3GKFA 4ZQOA 3GNDA 1T96A 2TRSA 3LCXA 2O7SA 4IMFA 2C6QA 3G1DA 1SO3A 1VQTA 4N9CA 2YX0A 4GWEA 4RXGA 1TPEA 3UWQA 3IIVA 3KRUA 1OF6A 1CW2A 4S2CA 3SY5A 4ADTA 5C54A 3GXTA 1GTEA 4M6PA 2GQ9A 4FIQA 2WPBA 3W3OA 5I3JA 3N3MA 1W8SA 2GVJA 1JCNA 3GR8A 1Z42A 2JGYA 3EXSA 1H7OA 2GJLA 3BLEA 4QSHA 3TJLA 1VYPX 2PC4A 3HO8A 1QPNA 3UWYA 4LVAA 1XI3A 3ANYA 3L5LA 4X2RA 1TYGA 2ZFAA 1OYAA 1DVJA 2OX1A 4DO5A 3GZ3A 3W2JA 3CHVA 4N02A 1R30A 1AW2A 3UXAA 2YFNA 1Z44A 4HHPA 4O19A 4E38A 2FIQA 3DFOA 3TJXA 3TV8A 3W7JA 1YADA 3PWAA 1WBJA 2B4GA 4FX6M 1QFEA 1RVGA 2J88A 2EF9A 4YXGA 1C29A 3MI3A 5F2LA 5F2GA 4FNTA 3O1NA 2NXHA 3ZFHA 3O15A 2Z6IA 3CU2A 7TIMA 1R46A 1LRQA 3GXPA 4M6QA 3SJ3A 1IXPA 2Y62A 4WOQA 1EA0A 1WXJA 4S1FA 2VFFA 3STCA 1K7XA 3T78A 2CFFA 3U6WA 1A5CA 2WNNA 3G18A 1I2RA 5D2VA 3WK2A 3G3MA 3EWUA 4MUZA 1KFBA 2QCMA 1JRCA 3MO7A 4HKPA 4RJEA 1F74A 3N2XA 1GJPA 1K7EA 4CCEA 5IBXA 1ZAIA 1SPQA 3STEA 2W6RA 3RFAA 4JTKA 1LOQA 3HG3A 3KVJA 3LRKA 3PB0A 4N4PA 3G3DA 5AC8A 4FNSA 3FKKA 3LXAA 1R47A 4JXCA 4XBKA 3BG5A 3V75A 1LDCA 3I65A 2TSYA 3W83A 4O4WA 3QSRA 2ZRXA 3T55A 3IGSA 3P61A 3EB2A 5D04C 3W7KA 3O8AA 4TR9A 4DO6A 4K37A 1QO2A 4NQ1A 3PG8A 4ZQRA 3TMQA 2DJXA 1NAL1 2NX9A 5KMYA 1HO4A 3UZ5A 3UD6A 1O60A 2OMAA 5EY5A 3UWWA 1PHWA 4W9TA 2ZYFA 4UTKA 1TPUA 3GB6A 2Y7EA 2B7NA 5DBTA 1SW7A 1H61A 1SFLA 2QCGA 1KTNA 4MZ8A 3M16A 1B57A 4TIMA 5K2ZA 4NZFA 3NEVA 3TFXA 3TAOA 3NM1A 1VYSX 4IGHA 1K8YA 1O94A 3FJLA 4Y9AA 2NV2A 4GXMA 1WYIA 4NJGA 4DPQA 4ZQPA 2ATMA 2OT1A 3NG3A 3DHFA 2TYSA 5I3FA 1GVFA 3TW6A 1AL7A 1F05A 1W5NA 4Q33A 2XFWA 5CGQA 2QCDA 1B4EA 4QAIA 1FBAA 1L9WA 3A23A 2Z0IA 4O1CA 3S1XA 2G97A 3CC1A 3W7GA 2LLEA 3O6DA 5D09A 1U83A 4JR5A 3B06A 3SSJA 3DZ1A 3VKJA 2FPTA 4LY8A 3IRDA 3RU6A 3E9AA 4RV8A 5FF2A 5FEZA 5LGZA 2BXVA 2JKPA 3S5NA 1YTDA 3AO0A 1VGAA 2ZRUA 4CLMA 1H7XA 4RZ4A 1B4KA 4K6AA 1I45A 4NUWA 4GJ1A 3M6YA 1I2OA 2ZA1A 3QYQA 1R2SA 4MZ1A 1M7PA 4X22A 2TPSA 3KVMA 4LVFA 2CW6A 1UBSA 3A21A 1PCKA 2WSRA 4XBSA 5ABTA 4RLIA 1ME7A 4OHQA 2CZ5A 2GQAA 5DCDA 1WV2A 2PE4A 1TV7A 1N7KA 5DXXA 1FQ0A 4LS0A 1GG1A 3DAQA 3M43A 4IMCA 2Y89A 3LCWA 3HBLA 1ALDA 1FCBA 4JY8A 2E6AA 4N4QA 3QF0A 3GXNA 5DY3A 4CQ8A 4FX8A 1ZAHA 3FIGA 3W1AA 1Z48A 3L0GA 5F1UA 2Y88A 1LBMA 3U2OA 2R91A 4Q4KA 3W7MA 2G95A 3LBCA 3LLFA 4RKAA 1FWSA 4PFMA 2HTMA 1BTMA 5HUPA 5I3GA 4HNUA 3HF3A 5CG7A 1H5YA 1QWGA 2TMDA 3CT7A 2J27A 4O17A 1B9BA 5E93A 4GNJA 2C19A 1KM4A 2ZTJA 2CZFA 3W75A 3LGEA 3QQ0A 3DFTA 3PBWA 5F4WA 5HJLA 2WSQA 2Q8LA 1F7BA 1KM0A 3H55A 1UASA 1L6WA 2H90A 3BGJA 3LRLA 1TPDA 3DFNA 3P67A 4UTLA 1Q6LA 3C52A 3HG2A 1J2WA 4UTWC 2DJLA 2Q3OA 4ICNA 2I1OA 1SSGA 2EKCA 4I7UA 1JULA 4EF8A 1X8FA 1JRBA 4HIBA 2QJGA 1S5TA 4MVAA 1FCVA 5HMSA 4JYEA 1OABA 2VFEA 3JRKA 4L4LA 5G5IA 3QH2A 5CZTA 2FQIA 3QMSA 4Z1DA 2D73A 4Y8FA 1Q3NA 2GVGA 3TIMA 3W22A 4YL2A 4MJZA 4UR8A 5D02A 4IMGA 2A6LA 4AB4A 5G2IA 2WNQA 3HPSA 1TO3A 3HG5A 4YWIA 4Y90A 3PB2A 4JTTA 3S8HA 4YCOA 1RV8A 5BW6A 4DF2A 2YSWA 3P60A 4JY9A 4LOCA 1WDWA 1LCOA 2XN1A 4MYAA 3GR7A 3B0PA 1KTBA 2C1HA 2CLHA 3NYZA 3UPBA 3GKAA 3MBDA 4AF0B 4XTDA 4E2BA 1I8JA 1YDVA 2C13A 3WK1A 4JGDA 3W1MA 1NVMA 3W2UA 3DHDA 3BVJA 3R2GA 2QKFA 1ZAJA 5LNUA 1HO1A 2FDSA 4LWWA 5DBUA 4QQ3A 1VRDA 4O14A 1G4SA 6ALDA 3Q94A 3USBA 4GUHA 1KV8A 3E12A 3UY7A 3YPIA 5C2XA 1DQXA 4O1DA 4JDYA 3O06A 4E2DA 3ZWTA 1FWWA 3I68A 1XUZA 4LTSA 4AXKA 2Z1BA 3N14A 3W7PA 2PRLA 1EIXA 3QFEA 2UV8G 1PVNA 2V82A 1XBZA 4TX9A 3EWWA 2YGYA 4M7TA 3W7DA 5LNWA 1G4TA 5LZLA 3TMLA 3U8GA 2A85A 3TQKA 1TV5A 3GAKA 2ZA3A 1OX6A 4LUJA 1KLZA 1TSIA 4ADUA 3MI6A 1R2RA 4IOTA 4M19A 3ZS4A 1KM3A 4L4MA 1W56A 3QM3A 1KW1A 3P62A 1HUVA 4K8EA 1KFKA 4NJJA 3BARA 1LLWA 3TH6A 2Q8ZA 4Q32A 3IGUA 4JX6A 1OFDA 3C2FA 4LC6A 3TC7A 4GC4A 1A50A 5F2MA 3M9YA 4MY1A 1VLWA 2YFOA 3TK7A 4PTNA 2FTPA 3QJAA 4FNRA 2C14A 4AHQA 3W76A 2E1DA 4CNPA 1TTQA 4ZL1A 1IIHA 1W5PA 4MZYA 5AC7A 1W5QA 1DHPA 1GEQA 1A5AA 1HFBA 3OVQA 5LHEA 1X6UA 5FF4A 3W7HA 3ABQA 4GE8A 3M1ZA 3I7SA 1AW5A 5EA9A 3EWBX 1HTIA 4PL1A 3HGJA 3LHWA 5HINA 3GDMA 2A1YA 4HPXA 1WBHA 4UC5A 3IIZA 1FUYA 1WA3A 1XBVA 5HR6A 3EKZA 3IIOA 4ADSA 5GVJA 5DLCA 4DELA 3S42A 4O15A 1TJRA 3NNTA 2YPIA 1SQ7A 1WAUA 3FYOA 4OU1A 5BMXA 2R8WA 4M5PA 2OJPA 2X1RA 1THFD 5D2YA 3LCFA 5G4EA 1EX5A 3PG9A 3P84A 5CPOA 4N9DA 5HR7A 4JDBA 4JTGA 2V0TA 1VYRA 2VC6A 3HG4A 1KFCA 3FEMA 1XCFA 3LRMA 3WK3A 3W1PA 3LERA 4O13A 3HB9A 2VEMA 4CNOA 1SZFA 5FF7A 3RF9A 1YXCA 3FJ6A 3RK8A 4Z1CA 3GNNA 1W0MA 3NPVA 1VS1A 3ATYA 1YPFA 4IJBA 3GVGA 1H50A 3A5VA 1FDZA 1TPWA 5KITA 5CPLA 3ABRA 2QUTA 5DXYA 1TQJA 3P82A 4Z0JA 2ISWA 3PSVA 3C56A 1OG0A 4O10A 5SWUA 1OYCA 1UUOA 1DORA 3NR0A 3NQ7A 2JBMA 3BV4A 3MP4A 1G7UA 5HWNA 3GDRA 4RX0A 4AH7A 4O8RA 5EPDA 2BX7A 4UMBA 3W85A 3KRZA 4U4MA 4TMBA 4UTTC 3N9RA 1QAPA 5A5WA 3TU9A 1VHNA 2DORA 3I7QA 5KZDA 3H53A 1O5KA 3W2NA 2H8XA 5DN1A 1LZOA 1E51A 3WK0A 1FDYA 3LHUA 3DBPA 3BLFA 2A2IA 3HQ1A 3W7QA 3EX2A 1L6SA 2O7QA 3TNOA 3MUXA 4UXDA 2Z2UA 3CIWA 1QPOA 3W1RA 4IMEA 1O4UA 1NSJA 3M0ZA 4M6VA 3M7WA 5K9XA 3NL5A 4GFSA 1DQWA 5D2XA 1LROA 1TMHA 4IWWA 2QF7A 2HS6A 1DV7A 3EEGA 2E09A 4JTIA 5FESA 3W1NA 2GVLA 1JCMP 3W7OA 2ZZ1A 3MBFA 2V9DA 1MZHA 1JQXA 3QSTA 4IX2A 1V7YA 3L68A 3DH7A 1EPXA 3TFCA 3WJXA 2ABAA 5H91A 4Z08A 3LM7A 4KWWA 3QZEA 1OHLA 3NQ2A 1B3OA 4NJHA 2ATSA 2X1SA 3W7LA 1GVOA 1LRNA 3TCEA 4KKXA 3FYPA 4LUIA 4O16A 1IF2A 2VXNA 2GJNA 2I14A 3BK0A 4MKNA 4LS1A 1VHCA 4O11A 1IGSA 4LT9A 4LRSA 4AF0A 4ORMA 4O4VA 3ABSA 2I9EA 1VLIA 1F73A 4N9EA 2Y63A 3LI1A 2RDWA 2X1UA 4QM1A 5CPMA 4LS2A 3NQ8A 4LVDA 3G8RA 3HPXA 2WJZA 2C15A 2OZ0A 5D30A 1YTEA 2CWNA 4R34A 4TO8A 3T7VA 1G4PA 3A5FA 4K38A 3HGSA 1FXPA 3KVKA 2YZRA 1QNVA 4CQAA 5C5YA 3PY2A 1G6CA 1K8ZA 2Y70A 2ISSA 3LTPA 2CLFA 5AHIA 5F1VA 2Y7DA 1EWDA 5BRBA 3G1YA 1YYAA 5L9FA 3PUDA 4JIPA 4CQ9A 4DF0A 2NV1A 4EWND 3LCGA 3TQ0A 2ZZ6A 5IBXC 1R2TA 2J24A 2NUYA 2RFGA 1S3HA 3E02A 2ZRVA 2NZLA 5AYYA 4JTLA 2RKXA 1LBLA 1RQHA 3NPUA 1LTDA 4HN4A 3M5YA 1K8XA 1LORA 4XKYB 3W2MA 4BFAA 4KFOA 1EP1A 1F6KA 3JR2A 1KM5A 5D37A 1I2PA 3QEZA 4NNCA 1VH7A 4JX4A 4AWUA 3OHIA 2E5DA 3IVUA 3TA6A 3UWUA 3MYOA 1VZWA 1JJKA 1EEPA 5D33A 1WQ5A 1XKYA 3MJYA 1BWKA 4G1KA 1KA9F 2V30A 1SR9A 3HOJA 1PCWA 4TMCA 2ZDRA 1TQXA 4I7VA 4WXZA 4DQWA 2NWSA 5KZEA 4X3ZA 1KLYA 3UPWA 4K7VA 4MY8A 1JVNA 1ZENA 1I2QA 1ZJIA 4AAJA 3QQ1A 1P0KA 2GOUA 2G5WA 2J9ZA 2JKAA 3Q58A 4JIQA 1JQVA 3DU0A 5I3IA 3TDFA 4MY9A 1W5MA 4RR4A 3GX9A 5BMWA 4WD0A 1LLZA 5LKYA 3DKJA 2A4AA 2A7RA 4UUIA 4PCFA 4IUOA 2CLOA 2ZZ5A 2CLIA 4CNNA 3BO9A 4WOZA 1OK4A 1ME9A 3TW7A 1G7VA 2C18A 3HGOA 5FF3A 4BWLC 2C16A 3M5ZA 2YW3A 3I7RA 5G2WA 3C2VA 2VFGA 4AVFA 5DCEA 4IX0A 4N9BA 4Y96A 1C9DA 4GRSA 3NL2A 4UFJA 3NQAA 4OV4A 1GG0A 4Z0SA 2Z6JA 5U4NA 1IXOA 3TKFA 3NPWA 1SUXA 3DFPA 4CCDA 3KAOA 3G24A 5K9CA 2QCEA 2NWRA 3P80A 1FX6A 3L2IA 3S1UA 3SI9A 2V2HA 3PUEA 2DZVA 2FB3A 3GYEA 2ZRYA 4UTUA 4GUIA 3LHZA 1AG1O 4UTWA 4O53A 1HL2A 2ZRZA 3ATZA 4JTSA 1N8FA 3CEPA 4S2BA 2E5BA 5HWMA 2EPHA 3C3NA 4OV9A 4JICA 3G22A 1LRTA 4NU7A 3NL3A 5LSMA 1QR7A 1Z41A 1TTJA 1V5XA 4UFKA 2FPVA 1W31A 4X9SA 2ALDA 4O28A 1DJQA 2RDTA 5HQEA 3LHTA 5KTLA 2ZZ2A 1KBIA 1P0NA 3W88A 1EB3A 3N2MA 3LHYA 1Y0EA 1VCVA 2NX1A 3LOTA 4HNVA 2ZZ3A 2CLKA 1F5ZA 1YDNA 4UMCA 5LNVA 4AWTA 2DZPA 3GK0A 3ABOA 2QCCA 4LV9A 4TU1A 1W3TA 4PH6A 1AL8A 1QMLA 2H8ZA 1TREA 4JYDA 5HNRA 3VE9A 3O07A 1PIIA 4K7YA 4RK8A 5FEPA 4FX7A 4IPIA 4Z1AA 1GT8A 3W07A 2Y61A 3ZR4A 4WXYA 3FFSA 1N55A 3ELFA 3QMTA 2B7PA 2G96A
chains in the Genus database with same CATH superfamily
3CQKA 4F3HA 2C8NA 3W71A 1HJQA 3C8NA 3KZSA 4R85A 1RA0A 5AHNA 4XWUA 1WZMA 1V7AA 3S4TA 2ZZ7A 3DFQA 1ADSA 4JCMA 1V6XA 2WVSA 1FH9A 2QUUA 4D1JA 3E96A 4JEQA 3VKKA 3WLJA 3OP2A 3NDYA 4M24A 3M0IA 2Y8KA 2P50A 4TV6A 2QULA 2BDQA 2YR1A 2ZVIA 5HMEA 4FNPA 5DRCA 3O16A 1HZYA 2PWGA 4DXVA 1O5XA 5BOEA 1Q6DA 3QPYA 4OBRA 4D8LA 2WNZA 4RUBA 3ARSA 3WG6A 2VVSA 2IUZA 2NT0A 3W1TA 4QFUA 4JS3A 4L9YA 4NJIA 3R12A 1TZ7A 2VX4A 2PU0A 5C7VA 4MWAE 5EMYA 4PGLA 5K7JA 1IYXA 4O0ZA 1U30A 4DNHA 2WMGA 2YCLB 3WEZA 2J25A 3WH7A 2PDJA 4LUTA 3RMJA 1OX4B 5K9DA 5U7SA 1BKSA 2JKEA 4NYYA 5AB3A 1OVDA 3A12A 3MKKA 4C5ZA 8TIMA 2X1TA 2CETA 3AS3A 3WEOA 4IPNB 1DJZA 1NEYA 1S5VA 1KC7A 5IRPA 1E5JA 3MC5A 3VC6A 2ISVA 4EKJA 3WQ8A 2VUNA 1S38A 4V1YA 2XINA 3K5XA 5F2IA 5C6MA 1SSDA 2OYLA 1DOSA 3KHJA 1F76A 3SN0A 1SZGA 3R6IA 2PGWA 1GUVA 4DI8A 2CHNA 4F9DA 3RR4A 5LYRA 3VOFA 2NT1A 4FLSA 1GQNA 3NJ3A 2WC3A 2XN2A 5A2AA 1PZ1A 2ONEA 4RXFA 4RPQA 4D6JA 4P2VA 3MMDA 3FSTA 4RZ6A 4UOJA 2V2CA 2OSXA 2YCJA 1H0IA 3BTNA 3B3DA 5BU6A 1GZGA 1EX1A 3UERA 3FYYA 1LM1A 2ODOA 5CXPA 4ASTA 4DAIA 3SIZA 1BYAA 5AFDA 4MJMA 3WSUA 4QIUA 5FJIA 3GXIA 2ZC8A 3MZNA 5CBIA 3SCVA 1ICQA 3MVTA 1DJNA 3WDJA 3LBMA 2WNWA 3EDEA 4A8LA 4EX4A 5FJUA 2XPKA 4ZO9A 1NWUA 1YNPA 4ERGA 4O1BA 1XFBA 4Y6GA 5HNUA 4U31A 3T8QA 2REQA 3VOHA 2O92A 3B8WA 4O1AA 2VX5A 3NQFA 3B04A 4OBTA 4RW5A 2YDSA 4A4AA 3N9SA 5D38A 5IM51 2HMCA 4L9ZA 3B4YA 4W7WA 1E71M 4CU8A 2VX7A 2J8FA 3WD1A 4J7RA 2WANA 1RXOB 5HJXA 3U4FA 1B31A 2QS8A 4PC8A 4B5VA 2W66A 2Y7FA 1QCWA 2O9TA 4YN5A 2J77A 3NQ6A 4FXSA 4YLWA 1DYSA 5D4YA 4J3TA 1XYFA 2ZZ4A 3ARTA 4K8HA 1P7TB 1QBAA 1GVQA 2Y1HA 1KXVA 3HGRA 1ECEA 5D2TA 3T0TA 3A22A 1BF2A 4I7WA 1BEUA 1U33A 5HATA 2Q8XA 2AL2A 5BRPA 2EXOA 1RA5A 2RDUA 4DJED 2CPUA 1TCDA 5LIKX 2VQUA 3P74A 4GQ0A 4CQDA 5AN7A 3TSDA 1UUMA 2XIJA 3OG3A 2OT0A 3TNBA 2Q3RA 2O9OA 3V0TA 4C65A 1D7KA 5IXEA 1YDOA 3SGUA 1LWJA 3VGBA 2PBOA 2VZTA 1JNEA 2JIWA 1GGOA 2PDXA 2BTMA 4L6HA 3MUZ1 1F3WA 1QNSA 3B03A 4OWGA 4UNLA 4PL2A 1OFBA 3BH4A 5DMYA 4FF7A 4CEUC 4EIVA 4DUWA 1IWBA 5C55A 1LLOA 3SZ8A 3F5LA 3AALA 1E9LA 1SYTA 8XIMA 2X30A 2YDAA 3TYUA 3S9YA 1XLKA 1QO5A 1LJYA 1WDSA 2Z1SA 2YOCA 4HA0A 4B5SA 3FNDA 5G2HA 3KOFA 3RHGA 3KP1A 1LBFA 2GOKA 2QCFA 3O7UA 3F1QA 4CEXC 3LV6A 5FI8A 2E77A 4DZHA 4YS1A 4GXWA 1ICPA 2P3ZA 2XN0A 5BOOA 2YCLA 5AYZA 3W82A 1W1ZA 4MADA 4O54A 4A21A 4F0RA 1XDLA 2GZXA 2ZE0A 1OX4A 3TTQA 4JKKA 2W62A 2WYSA 4RDVA 4UFHA 2H6RA 2E68A 3AMDA 1K7FA 1Q6QA 2OZTA 1JCXA 3KLLA 4RPPA 3UFYA 3F2DA 1N8WA 4O52A 1L6YA 3S1WA 4L56A 1LL7A 4Q4SA 4GUJA 3JS3A 1VEMA 3SSZA 3NDOA 4HPJA 5T26A 1J0HA 1T41A 2HRWA 4F4RA 2ZBTA 4IFOA 1EF2A 4MUPA 3A4AA 4BK9A 3W4RA 4QISA 4IUGA 2YW4A 2DW6A 3P3BA 3L4YA 2CZVA 2PRMA 4Y8EA 5D9MA 1M6JA 2Z28A 3Q4DA 1EQCA 9RUBA 6XIMA 1EJWC 4PMUA 4S3GA 2YLLA 3QW3A 1JCJA 3WY1A 1MQQA 1W32A 4KWVA 2PGRA 1SO5A 3TJIA 3TVAA 5A8GA 3MUY1 2ZUTA 3SAZA 4AY8A 4NX0A 1M65A 1D9EA 4ML4A 1PXGA 4O1EA 4OFCA 4QRNA 3L4VA 4ICCX 4S23A 1E6PA 1AQMA 4FK9A 3P5YA 2J62A 4J3VA 3S1GA 4MWAD 4P8XA 2DVTA 3N6QA 2I5IA 3JVAA 3LLDA 2F8QA 5IHSA 3CM4A 3UXDA 3H4WA 1U5JA 3W87A 1NF0A 1SU5A 6REQB 1FA2A 1F4AA 1REQB 4OGZA 4UZUA 5LIXX 1AD4A 2CLEA 2F7FA 1RUSA 4FP1A 7ODCA 2DW7A 4AEEA 1LYXA 2DSKA 3N13A 4AUBA 5A8QA 2VGFA 4CD4A 3N4FA 1ZNNA 3LSBA 3DXIA 3OGSA 2KZHA 2BGSA 1LUCB 5FEXA 3TX9A 1DHKA 3STGA 2ZADA 4MLJA 5HNTA 2HBXA 2VFDA 2RGLA 4LAKA 2A0NA 3LY0A 3MV11 4ZSUA 2GUUA 2CLLA 3LTSA 2WCGA 4TV5A 4QGCA 1H0GA 1K02A 3E49A 1OC6A 3L65A 3K2GA 2QV5A 4A22A 3KX6A 2QJIA 1LOSA 4IP5A 3EA3A 2QCHA 4P8VA 1R3YA 2GWGA 1RR2A 1UA3A 4PN2A 3CLWA 4LCSA 2HSAA 2GQ8A 3S1VA 4H9UA 2WZHA 4US5A 2HNHA 1NARA 4F8XA 4J3UA 3W7NA 3IUIA 5LA0A 1TMQA 1OD0A 3KLKA 3UG3A 2FZMA 1JXKA 3QKZA 3S5SA 4K39A 5XIMA 1EP3A 3WO8A 1W9VA 3B8TA 4LNYA 2PF0A 3AZRA 2BODX 1WE5A 1XLLA 4WJ8A 5H6HA 1Z32X 4E3TA 2ZUMA 2CBUA 3IAQA 1PL9A 4EXAA 2PAJA 1H5VA 1VFMA 5CSYA 1GVSA 1M53A 1QPQA 1GOIA 1XIIA 4HCDA 3DI0A 1X7FA 1XR2A 2PRHA 2PURA 2PPGA 4XZIA 2V38A 3FN9A 2D0GA 3GXDA 2E9LA 3DHPA 4MF4A 5FEWA 3VGDA 3VPLA 3UXKA 1TTIA 4BJHA 4UMAA 4S3FA 1AW1A 2E4TA 2XFFA 4JL2A 1O66A 5FSEC 2XH7A 5A94A 3WQPA 2CHRA 3BG9A 3S0CA 4W5ZA 3LDVA 2ACRA 2DU2A 4M6UA 5EBUA 1LWIA 4LVGA 3W2LA 3ABXA 3H22A 3AIQA 3BPWA 3HV9A 1J96A 4C6FA 1LL4A 3T4CA 1GW9A 2XIBA 4AIBA 1PKMA 2DZUA 2HCVA 4L9XA 4JN6A 5LA2A 4HA1A 2D1ZA 2BOGX 4FPSA 1V02E 4NT0A 3ARUA 3EWCA 5A6LA 4C7FA 4IFKB 1H11A 2V2DA 1SW3A 5LHFA 3UGVA 1IEIA 1SZEA 1YEYA 2DT1A 5AOUA 2OSWA 1E56A 3WD2A 3LLXA 1TWWA 3N2CA 3NQMA 3VOJA 4MNKA 3ID7A 3UWZA 4V1XA 4XD5A 3O6YX 4NNAA 2BXZA 5EBAA 3EDDA 2EAWA 2FMOA 1WB0A 4N0RA 4QDPA 5BXTA 4GI8A 2C3ZA 5CGMA 5E0FA 4DJDD 1ODUA 3HPFA 4BI5A 5JIPA 1P4CA 1KBKA 4K36A 2CZDA 3KRSA 1TIMA 2VELA 2V5BA 3ES8A 5CPTA 3REQB 4KIEA 4ZVJA 1EC8A 4R7JA 3QV9A 4H04A 3B0UX 3GR4A 4DWSA 1OGBA 4PUJA 5EYWA 2XGZA 1YW1A 4AD4A 3K30A 3UA4A 2GJXA 4C7DA 3W1UA 4P5UA 5LGXA 3KRBA 3OBKA 3GKFA 5I7GA 3LCXA 1JZ8A 3G1DA 2MUCA 3EEZA 1Q13A 4N9CA 2YX0A 4QROA 1JZ5A 6REQA 4GWEA 3CIVA 3UWQA 1F9CA 3KRUA 1ISXA 1REQA 3CQIA 1CW2A 4AIUA 3CT2A 1TWIA 2PFHA 4FIQA 2WPBA 5I6SA 2R6OA 3BMXA 1Z42A 3DHUA 2JGYA 3SO7A 2BVYA 4KGJA 4AD1A 3R43A 1ZLPA 1H7OA 4LYKA 1VYPX 2PC4A 4CN1A 1EJUC 1LUCA 1XI3A 2ZIDA 3ANYA 1TYGA 4BQ3A 1S2WA 2BY2A 2PUZA 3FA3A 4W4QA 2WBGA 3CHVA 2OLSA 2DSVA 2YFNA 2OTDA 3VIHA 4W84A 4O19A 1NJJA 3BICA 6ENLA 2EEXA 4G1NA 2FIQA 3DFOA 3W7JA 1PDYA 4H6RA 1H41A 4AC1X 3PWAA 4RE4A 3LQGA 2CEQA 1UH4A 2PODA 3BMVA 2CITA 1TG7A 4IL0A 3MI3A 1VJSA 3O1NA 2NXHA 2IKHA 3U57A 3BCJA 1R46A 4NP7A 3GXPA 3TTOA 4WOQA 1CXFA 4S1FA 3M0YA 4LAUA 3UT0A 2EKGA 2CFFA 5KETA 2Z4GA 1A5CA 2HISA 2W5FA 3WK2A 4D6FA 2BHYA 3FW6A 4C1NB 2J8TA 2D3LA 4ZFCA 2YA0A 3W81A 4CCEA 1ZAIA 1EEXA 2W6RA 4JTKA 1LOQA 2PB1A 4EPKA 1HJWA 2D22A 5AC8A 3LXAA 1R47A 3B9NA 5GNXA 3V75A 3AS2A 3VD7A 2W92A 5FA5A 2G4JA 5IHRA 1E0WA 4UCFA 4EPBC 2F9RA 5GJMA 4O4WA 2ZRXA 4CU7A 3EB2A 5D04C 2VZVA 4TR9A 3EOSA 4NQ1A 4DYKA 2GSHA 3DC0A 2NX9A 4JFUA 1HO4A 4MAVA 3GQYA 3NUKA 5AC5A 2ZYFA 3QR1A 1UKQA 1H61A 4LCRA 1QNQA 4AZIA 2VR5A 5M3WA 2NW0A 1AQFA 3NM1A 1TZ9A 4H8NA 1O94A 3KM8A 3WNNA 3QZ6A 1HVQA 2CC0A 9XIMA 1IGWA 2ATMA 4IFKA 1SFTA 1HP4A 4X0NA 3EB4A 1I6NA 1B4EA 2Z0IA 3BAXA 4O1CA 3NWRA 1X38A 3W7GA 4I9TA 3SCWA 1TWSA 5D09A 3B06A 3DZ1A 4LY8A 4QR6A 4RV8A 1C93A 5LGZA 2JKPA 4CLMA 2ZRUA 1QK2A 4E4UA 4GI6A 1NDZA 5C7HA 1IT8A 3KVMA 3A21A 2WSRA 1QNRA 3QGAC 1ME7A 2FZBA 3WQCA 1IR1A 1OGGA 3VMPA 3DAQA 4QE4A 3ES7A 3KZPA 3QY7A 3HBLA 1ALDA 4N4QA 3QF0A 2VWTA 4YTRA 1IZJA 1MUCA 1E1EA 1ZAHA 1ZL1A 3REQA 3SUWA 3L0GA 3S2MA 3VVGA 3WLSA 5DMLA 1XLHA 4MNMA 3LLFA 1WXZA 4RKAA 3W01A 4MB5A 1AJZA 2QIWA 1KR1A 1ADDA 4MTVA 3QGVA 1BTMA 3ZLFA 5CG7A 4J3SA 2TMDA 2FVMA 2PI6A 2C19A 3URBA 5A6TC 3OGVA 3PBWA 3S46A 4CKQA 1F7BA 3GHSA 1ESWA 3H55A 1L6WA 3WQEA 3W38A 1JYNA 4AX7A 1OBAA 4DXKA 2H90A 3U7VA 2PWFA 2P3EA 1SR0A 1BYCA 4HN8A 4IIFA 5DEZA 5ENLA 4UTWC 4XIMA 4LEFA 2DJLA 3V7PA 4D6CA 4ICNA 3UG5A 4AU0A 5BXPA 1L0PA 4TOQA 1JRBA 1S5TA 1XRFA 3KTCA 4MVAA 5I23A 4L4LA 1XLBA 3XIMA 1VENA 3STPA 3OW1A 3NIYA 4Y9NA 2D73A 3H6OA 4ZODA 2QIIA 5AECA 2O4QA 4YL2A 4IMGA 5CGTA 5G2IA 2WNQA 4GH3A 2IPFA 4BQ5A 3S8HA 3J7HA 5BW6A 2QMKA 4L61A 9CGTA 3P60A 5I5RA 1UUQA 1XV8A 1LCOA 1WUEA 3GR7A 4HOWA 3HQOA 3IJ9A 3MBDA 4AF0B 4E2BA 3S2JA 5TF0A 2C13A 3W1MA 2QKFA 1HO1A 4ZXOA 4LWWA 5DBUA 1VRDA 3Q94A 4C1NA 1Q2RA 3E12A 3UY7A 6A3HA 5A8OA 3WBYA 3ZWTA 5FJPA 3NOYA 4I6VA 3M0XA 5M2FX 2PRLA 1PX4A 2V82A 5HJYA 4NSBA 1OT1A 3MSGA 4C6KA 3GAKA 3HZ3A 4PTXA 1P6BA 4FOUA 1KM3A 1W56A 3CNYA 1KW1A 3P62A 1NH6A 1HUVA 3ZIZA 1OEPA 3TH6A 3KW3A 1PJ9A 4JX6A 1M7JA 4IISA 1SVDA 1Y5VA 2HJPA 3WBAA 1E43A 3CHCA 4DZ5A 2CKSA 3AQUA 1UPMB 1HKJA 1Y7VA 1MI3A 4MY1A 4D1IA 2VRQA 3DUGA 3TK7A 4PTNA 2YDRA 4FNRA 4AIOA 3W76A 2NVCA 3THDA 1B90A 1EXPA 1W5PA 4MG4A 4MZYA 1W5QA 5AC4A 3Q67A 4CD8A 1GEQA 1A5AA 5TAOA 1X6UA 1NFPA 3GVWA 4KBXA 3ITLA 4PEEA 3NDZA 1UR1A 1HTIA 1S2UA 1A5OC 4NRRA 1JPHA 4AYGA 4HPXA 1RBOB 4E8DA 1JZ7A 4GG9A 4PMQA 2EQDA 5JVLA 3W0KA 1W2PA 4GINA 3CB3A 4O15A 2YPIA 1WAUA 3FYOA 4OU1A 2PTZA 4D71A 1R3WA 3P0WA 2WWDA 3UU0A 3VFCA 1EX5A 3P84A 3AI0A 1KGWA 4GCXA 3W1PA 3C2YA 4Y9PA 1QXLA 4PUWA 1NY1A 3HB9A 2VEMA 3WD3A 1XDJA 3VGHA 4HU8A 3PZGA 3N15A 3CZGA 1Q6FA 5CJMA 1UP2A 5LIYX 2WVTA 2G4FA 4KRUA 3A5VA 1UG6A 2WSPA 1V51A 2QUTA 3PANA 5DXYA 2PP0A 3RU8X 3V35A 3RLGA 4HA3A 4XV0A 4H8HA 3WLRA 4O10A 5SWUA 4C6OA 1XLGA 1IEVA 4XO7A 1J0ZA 2YLAA 2ACUA 1G7UA 5HWNA 3GDRA 4YTQA 3IK2A 4UMBA 3UZZA 4V2XA 3KRZA 2VEFA 4PMNA 2V5KA 1E72M 3CL7A 1O5KA 3W2NA 4GC3A 2W4XA 3DBPA 3WN6A 2Z25A 2A2IA 3KUMA 4NYUA 2GUYA 3EX2A 2O7QA 3A3XA 3N3TA 3E2VA 3MUXA 2J74A 2Z2UA 4URIA 3W1RA 4A8RA 2RGMA 3CHEA 2WJEA 2ADAA 4M6VA 3M7WA 1V3MA 3L4TA 5K9XA 1LROA 4HYVA 3BL3A 3RO6A 1BG4A 2HS6A 3K8MA 1UR4A 4OJYA 2GVLA 3NZQA 3WD4A 3MBFA 1W2VA 4US5D 1ZBWA 4PMZA 1JQXA 3QSTA 1HJUA 4IX2A 1BYDA 4AIEA 3DH7A 1W6TA 1EPXA 3H12A 3TFCA 3WJXA 4O8AA 1FKWA 1XYCA 3VIIA 4CCZA 4ACZB 1RAKA 3C5QA 1OHLA 2OEKA 1B3OA 4NJHA 2ZX5A 4F79A 3AICA 4QEEA 3D47A 4Y9OA 3CASA 4JIHA 4O16A 2ZUVA 2OWWA 1Q6GA 4JNZA 2VEGA 2GJNA 2VXNA 1R86A 2I14A 1WZAA 3BK0A 4O11A 4YTSA 4AF0A 3ABSA 2FZNA 1F73A 2RDWA 4JCLA 1W3KA 5JMUA 3ZSTA 2VTFA 2YKKA 3ANUA 3NQ8A 5MKGB 4ZFMA 2WJZA 3ALFA 3PZIA 4PBEA 2ZKMX 4WR3A 4TO8A 1G4PA 3U2CA 2PWDA 1FXPA 3HGSA 2YZRA 4CU6A 1QNVA 4KWSA 1ITQA 5C5YA 1G6CA 3LTPA 1WZLA 2CLFA 2ISSA 2V5DA 3UXLA 3OPSA 3MDUA 5BRBA 1PWMA 3S2LA 4JIPA 3GNXA 4YTTA 3AOFA 2OZ3A 1UD5A 2ISFA 3LCGA 3WCZA 1R2TA 2J24A 1NDYA 4Z1YA 2RFGA 1S3HA 5FAGA 5ABFB 3TYDA 2WHKA 3E02A 2NZLA 2IXUA 3IRSA 4JTLA 2RKXA 1LBLA 3NPUA 1G5AA 2JFEX 2GJPA 1GOWA 3M5YA 1LORA 2A79A 4C6LA 3PAOA 5CZKA 3JR2A 1JPKA 2OXNA 3GHRA 3C86A 4JX4A 3OHIA 1QTWA 4MB3A 2BGQA 3G6LA 4REQB 2ZUSA 2PDMA 3MYOA 2IKJA 1JJKA 4XZMX 5D33A 3MJYA 1UR8A 3RPDA 4TMCA 4IH3A 4WXZA 2DT3A 5KZEA 4ZO8A 4MY8A 1JVNA 4AAJA 2DSZA 3TZFA 1J79A 1D3CA 4L4PA 4CVWA 2J9ZA 1J6OA 3GWQA 1PYFA 4GY7A 4WVXA 1XX1A 2JQXA 1W5MA 3GX9A 1V3LA 5LKYA 4WD0A 3CAQA 1NQ6A 3DKJA 3H4XA 2E8ZA 2A7RA 4PCFA 2CLOA 4LEQA 4AISA 1C90A 1FRBA 1OZQA 4D72A 1TUXA 1CXEA 3TW7A 4I3GA 2C18A 1C92A 5DRIA 1W1YA 3GDBA 2C16A 2YW3A 5GJPA 2DT2A 3C0QA 3C2VA 3BQ5A 5I00A 4Y96A 2VWSA 1J11A 3NSMA 1B2YA 4OV4A 5U4NA 1SUXA 5C71A 3KAOA 3KL0A 2OODA 4WDTA 3L2IA 4J3WA 2GK1A 2DZVA 4DWSD 1KCZA 3LHZA 1AG1O 3CBWA 1ZJBA 1YKWA 4GD0A 1HL2A 2ZRZA 2FJUB 4LANA 2I5QA 1M03A 2I17A 1VPQA 1KBLA 2ZUNA 1ITXA 2EPHA 4JICA 1LRTA 1N8IA 3IUDA 4JIEA 1TTJA 2E25A 2WK2A 4X9SA 3AIWA 4FLQA 5HQEA 3LHTA 1GOMA 1TX2A 2ZZ2A 1KXQA 4H6EA 1S2CA 3KOWA 3N2MA 4HMDA 1Y0EA 1VCVA 4TXEA 3LOTA 4HU3A 2ZZ3A 1OY0A 5LNVA 4ZA0A 2PLCA 1F07A 4RNFA 4CNTA 2ACSA 4LBSA 4H7CA 2A3EA 2YZ5A 3B8SA 4UQ9A 4Q8OA 3VE9A 3O07A 3VTRA 5FEPA 4FX7A 4Z1AA 3QOKA 5C2CA 2WQDA 3FFSA 1N55A 1OADA 3QMTA 2B7PA 5XIAA 4GY0A 2ISDA 2G96A 1U5VA 3TOYA 2WCAA 3C3UA 4BS0A 4L64A 2BV9A 4LH8A 3ZT7A 3WJSA 1BTCA 1K4GA 2O9RA 1SGJA 3KBMA 2Q02A 4FR1A 4QBXA 1ZJHA 1PV8A 4EANA 2AKZA 4LYQA 1PIGA 2HS8A 1T99A 1V6YA 1MEWA 1XLCA 3RCNA 2G50A 4XD4A 3LCHA 3V3WA 5JH1A 1KTCA 1UA7A 1XFCA 2X40A 2P5NA 5CSRA 1TPVA 3PBGA 1UIPA 2F2KA 1VPXA 4QLJA 3M5XA 3PBMA 3MP3A 1CZ1A 1FWNA 2Y5SA 4NIRA 4ZMGA 2WMHA 3VU2A 4GYFA 2ZVRA 1K03A 2FGLA 1ZCOA 4R7OA 4O18A 4KFNA 3RM4A 2YL9A 3MB9A 2V63A 4JTEA 2V5LA 3LZ5A 4C6BA 3KFTA 3SFKA 5MKGA 1VFFA 4MNJA 2E3ZA 2VR4A 3N2OA 2QDEA 4B5NA 2ZC1A 1W3IA 3L0NA 3D3FA 3WLIA 1TE1A 1N82A 4HNCA 3SQMA 1H60A 4LQ1A 4UBPC 3AWOA 1OQFA 3EWZA 2WJDA 1FFQA 3PHAA 4QNWA 1Q7QA 4WY0B 3TAKA 4WX2A 3ICJA 3TR2A 1EC7A 2AQOA 3CQ0A 4A3QA 1R3QA 2FJKA 2XTKA 5ABFA 5DMNA 4G9PA 4OUIA 5CC5A 2IQTA 4GYPA 3MMTA 3CEUA 3ZJ8A 3LD5A 1ITCA 3F03K 4DJFA 3UA3A 3VDBA 3NEHA 3PVFA 4GXPA 3CB8A 4GISA 1MQRA 4REQA 2OKOA 3GY1A 4IQDA 2D2GA 2WBKA 2WCSA 2J66A 2PDHA 3N34A 4MFDA 3CLMA 1GPWA 2OYMA 3TLQA 4KRTA 4WIWA 1WOAA 3RRAA 3MSYA 4DUOA 1MWOA 1J4EA 2V69A 1XSJA 3MTWA 2QYGA 2DEPA 5F4XA 2UZ9A 4DX3A 2ZXBA 3LPOA 1R0MA 2VRJA 2QEZA 5F4SA 4YWSA 2VOMA 3VNDA 3G0UA 4E3VA 3L12A 3DYMA 3SW6A 2YXGA 3M47A 3S47A 2V5JA 3ITXA 3ZJ6A 3L66A 5A6SA 3G8EA 4UQDA 2D2JA 4Z17A 5C8BB 3LNMA 1Q2SA 3PBUA 3VCRA 3USZA 5HPOA 3BLLA 5AHLA 3UJSA 1VCFA 2Y8UA 1J18A 1UWSA 4GQRA 3I6RA 4J5NA 1VR6A 1O7AA 4YHEA 2X42A 3N04A 1EOKA 2OWXA 1WKFA 3HPAA 3VI2A 3ZVIA 4A3YA 3PS7A 3ITTA 4KCWA 4L7ZA 1FY6A 2C1GA 4PRWA 3SN1A 1QPRA 3S6OA 1A5SA 3KOZA 3L2MA 4UFMA 4XBJA 1D3HA 3VM5A 1XIGA 3PM6A 1UKTA 4PODA 4NXKA 3MWAA 4WUIA 1FHDA 3G0XA 3RPMA 1QASA 4ORIA 1BXBA 2IKIA 4D8AA 4DVOA 5G1TA 4ZOCA 3SCUA 1MYRA 1XLEA 3WF2A 7A3HA 3ERPA 1XIDA 2HVNA 4RE3A 1B3WA 3NVTA 1X1ZA 3BW4A 4NVTA 5E0CA 4HVXA 4KFPA 1CX9A 4O57A 3TC6A 3N4AA 3S2NA 3KTXA 1UR9A 1EYWA 2NVDA 1DWIM 1UWTA 2DQWA 4P8WA 2CLMA 4H6KA 3KDOA 3LX9A 3AIUA 1A3XA 1EGZA 2R1NA 2D23A 3ABZA 3TE9A 4E4PA 4PCTA 3T44A 1WCGA 1I4NA 3BUVA 1K9DA 3QFWA 3P7YA 3AZSA 3R0DA 4BF5A 4QDMA 4JN8A 4LU0A 4DBEA 3F4CA 3GDLA 1D8WA 3BMWA 3AHXA 3GC5A 1PTAA 2GVYA 1QT1A 3CTLA 4CN6A 5AYBA 2V81A 5KZMA 2XZ7A 3ARZA 2ZXQA 4HQVA 3TXVA 4GBDA 3P93A 4HTYA 1JGIA 3A4WA 4JQ2A 1NFBA 4H9VA 3M4HA 2R1PA 3MHFA 1EQPA 3KXQA 3UBPC 2WV8A 1FP9A 3H54A 1EDGA 1Y5XA 1O5RA 1OB0A 2FFIA 3ITVA 1KCXA 3W7IA 1HG3A 2E5CA 4HSNA 4H19A 2C71A 2WKJA 1DWGM 1BHGA 3O3RA 4DXXA 2DZTA 2JF6A 1O1ZA 4QEHA 3ZT5A 4XQ6A 1P6WA 1XQLA 3GAYA 4XX6A 4A29A 2DVXA 1P1XA 1H1YA 3FJNA 3VD5A 2XIQA 2QUMA 2YB4A 3DERA 1YPXA 3MHUA 3PK7A 3AUOA 3AJXA 3SUUA 3V18A 3P8JA 1H1ZA 3TTEA 3KTSA 4WY0A 1BVNP 4YMZA 4QITA 1H63A 4ILSA 1W1B1 2CXEA 3HPZA 1XICA 5TD4A 2EPKX 3GHUA 4HT3A 1GEHA 1BWLA 1TPFA 2XH4A 3U3HA 4BWLA 4L1GA 3EXTA 3GXFA 4JHMA 5CKSA 1MO0A 3A9IA 3L4ZA 2QLYA 3H2OA 3Q37A 5D9PA 1B54A 1KCLA 1FHUA 1YHTA 4I90A 4XAGA 2MNRA 2Y7GA 4QSFA 5J5RA 1C8YA 4UTJA 3TYBA 1E3ZA 1V6TA 1W37A 1MSSA 4FAMA 2VL4A 3BZGA 3ZWSA 2Y0FA 1DL3A 2ZCGA 1XP3A 1IT7A 4ZCWA 3AU2A 3FGCB 1EYEA 5XINA 1GOOA 1T8XA 3LXBA 5DMMA 1X6LA 5ABHA 3RITA 2WVVB 3QW4B 4UTIA 4N6FA 1UH2A 2AKMA 1JUEA 2QXWA 1XW8A 1G9HA 2IS7A 1YXYA 2OU4A 3NURA 3ZJKA 3SCTA 4HNOA 1R6WA 4LV4A 3UR2A 5HULA 1VAHA 3UJ2A 3QR0A 1OFPA 3W9ZA 3SQSA 2V3FA 3VNYA 2R94A 1QW7A 4KWOA 2Z1VA 1DTNA 4FSAA 1VJIA 4FHAA 3THAA 1XG4A 2WOQA 4JTJA 2POZA 1OD8A 1WUFA 1YLVA 3PUGA 3LHVA 4OZOA 3W1XA 4Z2KA 1OFOA 1T0OA 1AVAA 4Y2WA 1R5YA 5DX7A 3PPFA 1WDDA 4QS5A 4BI6A 4FOJA 1V8EA 4WY0F 1AH0A 3GC2A 3WJYA 2G3FA 5I3HA 1XBYA 2X2GA 5D05A 3PAJA 4ZOBA 3UYCA 4UTFA 1DEDA 3AAMA 5EMMA 3H2AA 3GBEA 4DF1A 3H2NA 3SECA 1F6PA 4DJEC 3N29A 3NGJA 3H70A 4IG2B 3NXFA 3DECA 3INPA 3O05A 3OIHA 1E40A 3V4BA 4LRTA 1HJXA 3G1AA 3OEXA 3CWNA 4OT7A 1YMYA 4BR1A 4GKLA 1UOZA 3WNPA 3IVTA 2YYTA 1EBGA 1IWAA 3A64A 2C7FA 5AHFA 2NXIA 3N2TA 2QDDA 1YBQA 4C6IA 1JZ2A 1IHIA 1AMYA 3MYPA 3URAA 3KHDA 1C91A 1GQJA 2XIOA 5LIWX 2BWGA 1GVRA 1X7IA 4GFIA 4S3EA 3CZJA 2VMFA 4WQ6A 6PTDA 5TIMA 3IARA 2Z7KA 5JIWA 3DFHA 3WQ6A 5CZSA 1VBUA 3I6EA 3QTGA 3BSMA 1Q45A 3UQNA 5JBFA 2XGBA 1A53A 5AHEA 2V67A 1C8XA 5C9ZA 3L21A 4C6NA 2FHBA 2C0AA 1C8QA 1GK8A 1A3HA 3KBSA 2QUVA 2JGQA 3BSGA 4J28A 5BWFA 4EVZA 3GLCA 3OHMB 1GTHA 1J93A 4RDZA 3QRHA 4H2CA 4BQ4A 3PJXA 1ECQA 2FYMA 2F84A 4GUFA 4JBRA 1DJYA 3WFAA 4WZHA 4KWUA 2VZUA 3RJXA 4LVBA 1UR2A 3KWSA 3E0IA 3MI2A 3M44A 4Z2GA 1KFJA 1E6XM 1F3TA 3GHTA 2QCDB 4OE7A 3T2PA 1ZHAA 1XSKA 5CZ0A 4GBUA 2YCEA 2OCZA 2PDWA 1PZ3A 5CPNA 4QLKA 4X9YA 3GFYA 3SY1A 2AAMA 1TWZA 3HMCA 4AHOA 3KCOA 1OIFA 2HWGA 2IQDA 2OEJA 5D8WA 2QMJA 3LGGA 3B8UA 3NQDA 1XLAA 3AFBA 4L80A 4N2YA 4AZCB 1MXSA 3LS9A 5I24A 1KFEA 2WHLA 5G4WA 1QU4A 1YPIA 4YYCA 2Y5EA 3EMCA 4GUGA 1R85A 1E0TA 4XUYA 1O1HA 3OA3A 2BSLA 3GXMA 4KPLA 2FZ9A 4LUYA 3WLQA 1BGAA 4A05A 3W73A 3LXCA 2RJHA 4IQLA 4GIEA 3WMCA 3KL5A 1WKEA 2EJAA 4QP0A 1RK6A 5ABEA 1KFLA 3W1LA 3O0KA 3V16A 2Z2AA 1WNOA 2VRKA 1P43A 3IV3A 3GDKA 3QGKC 3QZAA 5G4HC 1OFRA 4R53A 4BI7A 3FGCA 1EWEA 1ZY9A 3A3HA 3M0MA 1RBAA 4MWAC 4CUCA 3VE7A 4E8CA 4ZQOA 2HV5A 1B0IA 1SO3A 3VZZA 1V3JA 4OVXA 1TPEA 3T0DA 3IIVA 4M8UA 3SY5A 5C54A 2DDXA 3GXTA 1B3ZA 3E5BA 5CQ1A 4M6PA 2GQ9A 1E9ZB 3KOYA 1JZ4A 3IV8A 2X1IA 2ZX7A 3R0KA 4DUVA 1BG9A 1CB2A 3SCPA 4F0MA 3VZXA 1F8MA 2GJLA 3AIBA 3NQBA 2VGGA 3HO8A 1QPNA 1R87A 3UWYA 4LVAA 1TVPA 2MANA 3VIKA 1GKRA 4X2RA 5I3DA 1V3KA 1DE6A 1EHNA 3T8LA 1DVJA 3TYZA 2OX1A 2GGHA 3GZ3A 1E4NA 4HHPA 2P53A 5EMJA 4L6OA 4LY4A 3GNRA 4E38A 5JQ9A 1XYMA 3TV8A 4AD0A 4XAFA 4ICMA 3QHMA 5M1TA 5EU9A 4FX6M 1EDTA 1GVYA 3OBAA 1RVGA 5M5DA 3PTKA 3WEMA 2WM0A 5F2LA 5F2GA 3OU8A 1Q4NX 1HQTA 1NP0A 2C1IA 3O15A 4KETA 3CU2A 4D6DA 3PPCA 2QPUA 2Y62A 1WXJA 3RMEA 4DLMA 2VFFA 1D8CA 3T78A 3BQ6A 3G3MA 3RN6A 3GUGA 4FXJA 2QPSA 4TX8A 4HKPA 3N2XA 1AODA 1GJPA 1K7EA 1CT5A 4B15A 5C0QA 7ENLA 1SPQA 2RUSA 4B5TA 1ZB5A 3SURA 2DZBA 2EG7A 2Z2BA 3APTA 1POKA 1UD4A 4HMCA 2OYKA 2WAGA 3CZKA 2V68A 2TSYA 3MUAA 4AX6A 2W91A 3T55A 1X1NA 3IGSA 3P61A 3RILA 3O8AA 1UD2A 2WKLA 4DO6A 3GTXA 3TMQA 2PTYA 2PGFA 5A8PA 1OM0A 1O60A 1WO2A 1PHWA 4W9TA 1ZGDA 2ZX8A 4UTKA 1TPUA 3GB6A 3TYAA 2B7NA 4EACA 3BOXA 1V03A 4WSHA 2X41A 4QE1A 2DIJA 3CAVA 1KTNA 4MZ8A 5I09A 3AZTA 4IM4A 4PRTA 3WLKX 4I5UA 1FWHC 3DEQA 1J0YA 3KP0A 3NEVA 2PCEA 1RCOB 1VYSX 1K8YA 3FJLA 4Y9AA 1S39A 4DPQA 1E9YB 3PNZA 5A8MA 3E0WA 5EFFA 1W5NA 4TTUA 3FJ4A 5CC7A 4Q33A 2QCDA 4DJFD 4X60A 1KGXA 1JL8A 1L9WA 3WIJA 3E1F1 1BQCA 3CPGA 3TOPA 1FOBA 3O6DA 4H9XA 1M1BA 2FPTA 3WDRA 4GHRA 3IACA 3AIRA 3RU6A 3E9AA 4FI4A 3S5NA 1VGAA 1ZP3A 2CBIA 5KEZA 4WSJA 3M6DA 1I45A 4NUWA 5HBFA 1R2SA 4MZ1A 1M7PA 4LVFA 1UBSA 1ZBVA 5ABTA 4AZCA 3RM8A 4J35A 4MSSA 3NCOA 5IFTA 2GQAA 5DCDA 3F7JA 1JXJA 2PE4A 1TV7A 4DJDC 2VOTA 3IPWA 4CVUA 3M43A 1A0CA 1VPYA 1XH2A 2Y89A 5JBDA 4HGXA 4OOZA 3LCWA 1BSIA 5CPSA 3GXNA 3GS6A 4CQ8A 4I5RA 3HU7A 2W61A 3W1AA 2EO7A 1WXYA 1GHRA 2Y88A 2R91A 3E0LA 1NTHA 1CGUA 4PB5A 5TNVA 4NASA 4L1XA 4PFMA 4S39A 1Q7ZA 5E9XA 4HNUA 3HF3A 4V15A 4O17A 1B9BA 1ITUA 4IIBA 5E93A 4GNJA 3KDNA 4IIDA 3RPTA 3W75A 3LGEA 3DFTA 1VFSA 5DT5A 3SRHA 1XINA 2VDHA 2O4MA 2BVDA 3LRLA 1TPDA 2DH2A 4P8UA 1Q6LA 2HVOA 1J2WA 4PSRA 4ATLA 3MY9A 3CZLA 4AZ5A 4BQ2A 4XVEA 5AZ0A 1JULA 1DJIA 1X8FA 4WKHA 3CMFA 2PC8A 1FCVA 5HMSA 1OABA 2VFEA 2ZX9A 1XH0A 4IFRA 5CZTA 4RNJA 3QMSA 4XKMA 4LAOA 3EA1A 2EPLX 4UR8A 5D02A 4AB4A 2A6LA 3MCNA 3KBVA 3CUIA 4GJJA 4Y90A 5E5CA 4LF1A 4MAZA 4DF2A 1Z7AA 1UOKA 4LOCA 4MYAA 3QV8A 1JG9A 3K1DA 3CMGA 4TTGA 3CYVA 2CLHA 2J7FA 4LBRA 1UMYA 4XTDA 1I8JA 1NU5A 1SM9A 2PLMA 2I7GA 3LBOA 1YNYA 3WK1A 2HVMA 3OZOA 4RV3A 3DHDA 5I03A 3BVJA 2FDSA 2PTXA 4QCFA 4O14A 6ALDA 2BBFA 3MANA 1KV8A 3EOEA 3THUA 4ES4A 4E2DA 1Q7MA 3KL3A 3EAUA 4AXKA 4J3XA 3V0SA 3SCNA 4HYRA 2XISA 5A6KA 4DLFA 2UV8G 4AWEA 1XBZA 4MPKA 4M7TA 1NQKA 4GGBA 1IWPA 4JEJA 2A85A 1BD0A 1TV5A 1OX6A 4LUJA 3O0FA 4ADUA 3MI6A 5FKYA 4M19A 4L4MA 2VUYA 3AXXA 3MPGA 1PBGA 3OODA 4K8EA 1KFKA 4XAYA 1MUWA 3RAOA 1LLWA 2DSUA 4RDWA 2Q8ZA 1GOKA 3RGTA 1Y5WA 3CYJA 4GC4A 3M0JA 1RBLA 1VLWA 4KEZA 2CLPA 1N2VA 2YFOA 4EWJA 2XZ9A 3ZR6A 1MFUA 3SIMA 1QNPA 1W9UA 1BWVA 2EJ1A 4ZL1A 4M1BA 1QHOA 3W6MA 3OVQA 2GDUA 5LHEA 1KKRA 3N1AA 1X96A 3ABQA 1QRQA 4GE8A 1DWHM 2C79A 4ZE4A 3EWBX 1VIZA 5GQBA 4PL1A 3K46A 1XRVA 2GSJA 3GG8A 2A1YA 5BCAA 2XH2A 4B3LA 3IIZA 1FUYA 5HR6A 4HZ8A 4ADSA 5GVJA 5F7UA 5T9BG 3S42A 1LG2A 4HK5A 1TJRA 3ZJ7A 1SQ7A 4M82A 5BMXA 2R8WA 3VDAA 1VFLA 2PDQA 3AROA 2YDQA 5D2YA 3LCFA 2QZRA 3PG9A 4AYSA 3JUGA 4ZTYA 3ZQ9A 3DX5A 2V0TA 1GNXA 1VYRA 2EPNA 3KWXA 1DJWA 3ONBA 5H8PA 3VMOA 1KFCA 3FEMA 3LRMA 1KR0A 3LERA 1VP5A 1V0MA 4O13A 4HCLA 5FACA 3VNLA 5FF7A 3RF9A 3RK8A 4Q4PA 4Z1CA 3GNNA 1Z6KA 1OWQA 1XH1A 1VS1A 2CBJA 3NPVA 4IJBA 3GVGA 2E28A 1FDZA 1K9FA 1S2AA 1TPWA 5KITA 1QVBA 4BZYA 3NSNA 1TR1A 5EMKA 3AUJA 3P82A 1UWIA 3OBEA 1YIXA 3PSVA 8RUCA 1FWBC 1V0KA 3WQWA 3TEVA 3NR0A 3OO2A 3ZO9A 3AXKA 3T0AA 4IMAA 2VVNA 4RX0A 3F2BA 4O8RA 3W85A 3ZR5A 1DXIA 4U4MA 3N9RA 4RE2A 1QAPA 2E1WA 5A5WA 4HHMA 1J0JA 1MMFA 1ISZA 5DN1A 2AAAA 1K77A 3WK0A 4H7ZA 1FDYA 3LHUA 3BLFA 1J9YA 3W7QA 4B5UA 3TNOA 4Q3MA 1ZP4A 4IMEA 2BASA 1JDFA 4AY7A 4HJWA 3SCQA 3NL5A 1DQWA 5D2XA 4GX9A 4IWWA 1DV7A 2E09A 2IPJA 5FESA 1QI5A 4XZNX 3TONA 3W7OA 3UYIA 3HJEA 2YXOA 1AH3A 1MZHA 5FCZA 3S3GA 1OIMA 1V7YA 4HPNA 4HK7A 5H91A 4JHZA 3U48A 4Z08A 3OVGA 4LSBA 2ATSA 1DIEA 1MW0A 2V5CA 3W7LA 4L65A 5FSDC 1BXCA 1LRNA 4AZ6A 4KKXA 1JPIA 1IF2A 4KS0A 2NQZA 3MWCA 3FDKA 4LT9A 4G7EB 4ORMA 3OOQA 4O4VA 1VLIA 1HKIA 5BXRA 2Y63A 2A3BA 2Z1XA 4QM1A 5CPMA 1J2BA 3R79A 4XVDA 3HPXA 1XLIA 1XYZA 2GGIA 4R34A 5A2BA 3NFUA 3T7VA 3A5FA 4K38A 4P7LA 2VC9A 3FHAA 3KVKA 4WDWA 3BAYA 4CQAA 1S3TC 2Y70A 1GZJA 2PP1A 5AHIA 5F1VA 3GC4A 4R27A 3PUDA 1A4LA 3U4AA 4CQ9A 1V6WA 4DF0A 4NZCA 1UR0A 2NV1A 3WD0A 4EWND 2ZZ6A 4YVVA 2Q71A 4XZBA 4B5WA 3B9DA 4WLCA 2HE8A 2ZRVA 2QW5A 3GG0A 4NZ3A 1QI0A 3WENA 3KS5A 3WQDA 1GW1A 3K1GA 4XKYB 3W2MA 4BFAA 5C9UA 4KFOA 3GFXA 4JTQA 4M29A 3HQNA 1I2PA 3D3AA 3I6TA 3QEZA 3CQJA 4NNCA 5JUVA 1KGUA 1OCNA 1H49A 3L4WA 2FVLA 3CH9A 1GJWA 4GI9A 4IIEA 2HPMA 1YE6A 4G1KA 3SRFA 2A3CA 4B4HA 4EPDC 2NWSA 4NZ4A 1CB7B 1ZENA 1Q8JA 3QQ1A 3CHDA 3VIMA 3Q58A 3BJTA 5I3IA 1RCQA 4MY9A 1QHPA 1YRRA 2A4AA 1J01A 3GH4A 4C5YA 2ZZ5A 1ZBCA 1H09A 3WZ0E 4CNNA 2VT0A 3SDOA 3CMJA 1ISVA 2VCAA 1E70M 4E4FA 5FF3A 1JD7A 1NOWA 5B80A 4DN1A 3PTQA 2VFGA 4WDUA 2IXVA 2PBGA 5DCEA 3BDKA 2DGAA 4GRSA 3T6CA 3WYZA 1V08A 3JW7A 4CD6A 3ONCA 1GG0A 3NPWA 5CAHA 5K9CA 1TCMA 3P80A 1DQUA 1FX6A 2X0SA 4O1FA 3RG6A 3W25A 2FB3A 3BJFA 3GYEA 1XCXA 4UTUA 3L23A 1QBBA 1SZRA 4ATWA 1JZ3A 2HDJA 3DFYA 1KWKA 1US3A 2OOGA 1HJVA 4JTSA 3CEPA 1IT0A 4W87A 1KXHA 2EBNA 2E5BA 5HWMA 3C3NA 1C7SA 3G22A 1K9EA 4NHVA 1RALA 1FWFC 4QJ5B 3DIPA 1XD0A 5D9NA 1A0DA 1W1A1 2FPVA 2XIIA 2YCKX 4O28A 3GG7A 1DJGA 2VC5A 3PZVA 4BCEA 2NSXA 1K1DA 3W88A 1QHZA 4FA3A 3PFRA 4NI3A 3H23A 5CJNA 3UP8A 1XCWA 2CLKA 1F5ZA 3GK0A 3QLLA 2WC7A 1AL8A 1QMLA 1XIFA 5REQB 4K7YA 1P7TA 4IPIA 4JFTA 1GT8A 4E2OA 3W07A 3ZR4A 4QQUA 2O55A 2ANUA 1O68A 1XIMA 2CBVA 3SB0A 2GJRA 4ZQMA 4HNLA 4ZE5A 1W5OA 1S5WA 2VENA 4GH1A 1U1HA 3TROA 4HU0A 1OFAA 4JIIX 2NXGA 1ZZMA 2GGEA 4HHLA 5AHMA 2WZMA 1RLCL 3UR7A 3IAPA 3NO5A 5D9OA 2P0OA 2BOEX 3F4NA 4R3UA 3I3DA 3W84A 2J7BA 4UQEA 1WAWA 6TAAA 2ZA2A 4HNTA 2AL1A 3CV7A 1JPMA 6TIMA 1CXHA 4K1WA 1XIBA 3AMLA 1E1CB 1J6PA 3GIYA 3KVLA 1G67A 3ENLA 3TXZA 2XWDA 2X09A 4KT2A 2WO5A 4N6EA 2VEPA 4G7EA 1LQ0A 3VD9A 3LEPA 1PTGA 3VFLA 5DELA 3CZ8A 4M81A 2RH9A 2AQWA 3PBVA 4ZQCA 3OVRA 4IGMA 5DO8A 4PBFA 1DIOA 3UZWA 2BOFX 1BKHA 3W2KA 1H62A 2NUWA 5KINA 3W28A 4BF9A 4LJ3A 1SJAA 3UY8A 1R3SA 2QVNA 3P81A 3G1SA 1CTNA 2HROA 3P8IA 3COTA 4JTCA 1M04A 5H2ZA 2P8CA 1VBHA 2J6XA 4F0HA 3WJZA 1E73M 5FF0A 2XVPA 5H1WA 2Y5JA 4DO7A 4IHCA 3M46A 1G4EA 4DBDA 2QDHA 1EO7A 1OFEA 4EPEC 1FWIC 3NZGA 4O50A 3KCLA 1KV5A 2AGKA 3RX3A 3S6DA 4AVOA 3O6CA 1EDQA 4AQLA 3G0SA 3TC3A 4EAYA 1VFTA 3EX4A 2E6DA 1BQGA 4XKYA 3VK5A 4H1ZA 2OSYA 4UWMA 3LQLA 4LYPA 3CAWA 5HAOA 1KCKA 4EXBA 1CLXA 3PC0A 3PTMA 4ALDA 1JUBA 2OB3A 3NM3A 2FGZA 3FLUA 3BANA 3R10A 1RPKA 2NX3A 1T40A 1UROA 3TQVA 4ML9A 3F4WA 1E0XA 2ZQ0A 1LWHA 2D0HA 1AH4A 5A6BA 1FWRA 4MMWA 4EF9A 3N4EA 2TAAA 2FFCA 5CLTA 4NF7A 1LOLA 3EZ4A 1PDZA 3PJTA 1EJSC 2CCRA 4K1GA 4U5IA 1HGYA 5BOFA 3EWYA 3S2CA 3DENA 2ZRWA 2ZWZA 2J7DA 1J10A 2PDLA 1LP6A 2IW0A 1W3LA 1XM3A 2Q01A 3TN4A 1RZMA 2RJGA 3BV7A 3SCSA 5K4XA 3WNMA 2DZSA 4U10A 3GSMA 3R25A 1R3VA 3MUIA 4LNCA 4R9XA 3LB0A 3QC3A 1UH3A 2VGBA 1UKOA 3GYCA 4UTTA 1XUUA 5CAKA 1FWDC 3SR7A 5I3KA 4UQCA 3AYRA 1PHQA 2ICSA 2WHJA 5E0KA 5K4ZA 1EUNA 4HJFA 3UZJA 2E7FA 1EFZA 3LPFA 1K3UA 1FCQA 3ANVA 2QCLA 4B5XA 2G37A 2PTWA 3FS2A 4FNQA 1Z3NA 2V6AA 4DWSC 1GOQA 4JFWA 4ZB5A 2F61A 3GH7A 3CS2A 1EF3A 3XISA 1VBJA 3SBFA 5HQMA 4GQQA 3NL6A 4RE0A 4IGNA 2J79A 3B40A 4Q8MA 3L9CA 2YXXA 4U3CA 3KE0A 4NNBA 5BRQA 1KBJA 3G1HA 3AYTA 3NPXA 2PWVA 3WBXA 1MW2A 4DBWA 2QR6A 4J40A 4FEZA 3MQTA 4HD5A 4D8ZA 3VUSA 1UJPA 1SW0A 3LGDA 1KRMA 4HHHA 5REQA 3W6LA 1ZSXA 1VD6A 4MPQA 1A47A 4UIOA 1NWSA 4IXHA 1R3TA 4W7VA 2D69A 3PP7A 1FWJC 1UWRA 1MUMA 4AZGA 1CWYA 2NUXA 2AQVA 4KESA 3NQVA 1CBGA 1HL9A 4UOQA 1TV4A 3UJEA 5E70A 2DSWA 3WF1A 3HMJG 3CUGA 2WZTA 3DYPA 4W8AA 3VABA 3V1PA 3UWVA 1K6WA 5E1QA 3VZYA 4BHYA 1TE6A 3C0JA 5HWJA 2EHHA 1W3NA 2VFHA 3WNKA 1M9HA 3WQFA 4XZHA 4Q4RA 4PYSA 1JI1A 1HNYA 1OG6A 1OX5A 2PWUA 1L8PA 3JZUA 4DPPA 5HA7A 3WQOA 4EE9A 2NQLA 1H7PA 3CWOX 4W8LA 5A8NA 1DP0A 3B9OA 4KEMA 1PPIA 4X61A 4W88A 4UCGA 2PZ0A 1I0DA 2CU0A 1JF5A 1JYWA 1XPYA 3W72A 4D2JA 3RUBL 4UTMA 4EOUA 4LX4A 3CHFA 2WLZA 1IEWA 1Z9AA 2JALA 4PEKA 1W8GA 3S5ZA 2O56A 1RHCA 4WSKA 2PSNA 2P10A 4RZBA 1TVNA 1PKYA 4DYJA 1M5WA 4O12A 1IQ8A 1U2YA 3C8FA 4UTHA 1A3WA 5D32A 2VGIA 4RCXA 4GVFA 3H2CA 1W3HA 4MIMA 4MDOA 4DY1A 1JUKA 1KQYA 3AMCA 3Q2DA 6XIAA 2JF7A 4I9AA 1GJUA 5GNYA 3WLOA 4JD4A 4Q4QA 3MVIA 1W54A 2J9XA 2B0MA 1HX0A 4KCUA 2AGTA 4JTUA 4XB3A 3AS1A 1E4MM 1JCYA 3UNDA 4QNEA 3BAJA 3W7CA 4H9MA 4P61A 3W7RA 3MP5A 3ISIX 1PKNA 2YBTA 2DV0A 3F4DA 3NTYA 3RYSA 3W6YA 1R38A 3ZYZA 1PTDA 4JQAA 3QV6A 2VEKA 3EX3A 3BSHA 1KM6A 2ABBA 4HP5A 1KM1A 4X0VA 3OYXA 3AU6A 1W17A 1EZ2A 1GCYA 3VILA 4C6JA 3M0KA 2ZICA 4IIHA 1HKVA 4GA8A 2V8ZA 3P0XA 4YCPA 4C1LA 1GKQA 2BFGA 4PMOA 1VCGA 2ZWYA 1ZCCA 4AW7A 3CUXA 1W9PA 2X0YA 3DN5A 4Q22A 3N73A 1XC4A 3ZLGA 2YA2A 1VFUA 5ECVA 3ORWA 2B31A 3IVSA 5LNSA 1P1MA 3H26A 1MEHA 3SGGA 4H83A 3S5YA 3CXOA 2JK2A 4POCA 5C2GA 2J9YA 1FCUA 1CNVA 3L67A 3MKCA 4QJ3B 4MFEA 3S5OA 1ELSA 1VBRA 3WUBA 3T09A 3IJIA 4IP4A 1YXDA 4H4IA 5EB8A 4Z42C 1RLDA 1XLMA 2H3DA 4KH2A 2AL2B 1Q63A 3PBYA 3WDIA 4AVNA 5TQLA 3V5FA 2P0IA 3PWGA 3FKRA 3VKCA 1XGZA 3BZJA 2R14A 2QDGA 5FOOA 3PUOA 1ADOA 2OPJA 3B9AA 1TVLA 4UNKA 1EGMA 3F5JA 4I5XA 1BSLA 3DGBA 3PWIA 4FMVA 1OFQA 3DESA 3DYOA 3WDQA 4DIAA 2VQTA 1UMLA 4G2DA 4B16A 3BJSA 1IXNA 4W93A 2I16A 4V33A 3CO8A 3IIPA 2INFA 3T42A 2BY3A 2FZ8A 2OFJA 1BF6A 2PLJA 2X16A 1RH9A 4GYJA 3STFA 3RNDA 3PFMA 4Q8NA 1I0BA 1XXXA 3GE7A 3FDGA 4XSLA 2UY3A 5TBOA 2FB2A 4NXSA 4LF2A 2GL5A 3EKLA 2FH8A 4G5DA 4YIWA 3GD6A 1OC5A 1EHAA 2X7VA 4UR7A 3VX0A 1AQHA 3II1A 2Z26A 3W7EA 4J9JA 3TLLA 3QMRA 1AA1B 1K4HA 3POCA 2VDIA 4XSMA 2JEPA 1OJXA 3B4UA 2ESCA 4JTFA 3TSMA 5EL1A 2P1FA 2FVKA 1RQEA 1TJ2A 2WLYA 3TA9A 3FOKA 3LZ3A 1S5NA 1DKWA 3EPMA 3TUUA 4XIAA 1OC7A 3R5EA 4MJ2A 4QJ1A 1VC4A 3VGGA 4BY3A 1RQBA 3U5UA 5HOSA 4ENLA 2EGZA 3BE7A 2IPGA 1UC5A 5L6UA 4DM2A 1UC4A 6CGTA 3E2QA 1FWEC 3VNZA 2PA6A 2QJJA 1PEZA 3FAXA 2WQPA 2G3IA 1D2KA 3IJDA 1FWCC 3C0SA 4A6GA 1ONRA 4LC8A 3VIPA 3RLUA 3UJRA 4FALA 1TB3A 1OF8A 3WLTA 2INZA 4M7SA 3ITCA 3LPPA 3PF3A 1L2UA 2WZIA 1TELA 2WZEA 4HOZA 1RPXA 1TRIA 1OYBA 2CESA 2A7PA 3LCLA 4Z1BA 5C9WA 1Q6CA 3SQLA 5GPRA 4ZGYA 4DYEA 3D0CA 4PA8A 2FPYA 3NQCA 2XSAA 2XFRA 3R13A 4H9TA 5CEWA 3AXIA 1WOBA 4JOMA 1TUFA 3QBUA 4WJEA 2GQ3A 2W63A 1MVYA 3C4UA 3AIVA 3RO8A 2BHZA 3NA8A 4JTAA 4W8BA 1W1VA 3EWXA 3H2EA 1AMKA 4FXRA 1PAMA 1BLIA 4ZQNA 3WDHA 4ONVA 3DBNA 2G3MA 4IQJA 1JAKA 3QPZA 4AEFA 5D8ZA 2DPEA 1ML1A 3DI1A 2I57A 3GBDA 1GWJA 1OK6A 4B9ZA 2O9PA 4R9OA 3TWAA 4AEOA 3BW3A 3G1FA 4NZ5A 3MHGA 3WJWA 4R33A 2JE8A 4IPLA 1IIGA 2DQXA 1KFWA 1GVEA 3GW3A 3CPRA 1O95A 1WDPA 3LYEA 1R9YA 1JCLA 4KRZA 3IEBA 3BXWA 3EXRA 2E9BA 4H3DA 3L4UA 4W86A 3WUGA 3CPUA 3NZPA 4D6HA 4S3CA 1E4IA 3URQA 1YNQA 1O12A 2XU2A 3NOEA 1RP9A 3T1GA 2O0TA 3DGRA 5I0DA 2CZEA 1P48A 1V6UA 2HQAA 2VD9A 4X63A 2QAPA 5AC6A 1DPMA 2DT0A 2TRSA 1SFSA 1V02A 4EP8C 4HCHA 1UP0A 2C6QA 3VIFA 1VQTA 5CC3A 1JGMA 4RXGA 1OF6A 4S2CA 4XD3A 2BNJ