3PY2A

Structure of c126s mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVSFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the role of the fully conserved Cys126 in triosephosphate isomerase by site-specific mutagenesis--distal effects on dimer stability.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3py2A00
4ZQCA 4UTKA 1AMKA 1L6SA 3EKZA 3LTSA 4MJZA 4ZQMA 1HO4A 2CU0A 5I3KA 1I2NA 1IXPA 3O15A 2NUYA 2Y6ZA 4FF7A 4IXHA 2QDHA 3G1VA 3W75A 1FCVA 3SR7A 2FPTA 2C6QA 2CFFA 1QWGA 3OVRA 1LRQA 4EF9A 4KWVA 3B8DA 5C5YA 1GVQA 1RQEA 4FNPA 1ZALA 4K36A 3Q37A 4O10A 2TSYA 4UTTC 1TPWA 1FCBA 3T78A 1PS9A 3B06A 3BPWA 3C2EA 3C0JA 3BGGA 4X22A 5D05A 2ATMA 1SO4A 4ML9A 3HPXA 5CGQA 2E6AA 1T99A 1W5OA 4UTHA 3FS2A 3IEBA 3ANYA 2E68A 2GPTA 3CEUA 3WK1A 4AHOA 3JR2A 1HFBA 4NQ1A 2R94A 4WX2A 4NNAA 4JY9A 1TB3A 3DFNA 1GOXA 3VFLA 3NNTA 1VCVA 2I1OA 4UFIA 3EWBX 1W3IA 5AOUA 3PC0A 1U5JA 2VXNA 4LC6A 4CQAA 2A7PA 4AWSA 3QMSA 4JXCA 4JGDA 3W7PA 5DN1A 3B03A 3PBVA 2WO5A 1ICQA 4GUJA 4FNSA 4X2RA 1TYGA 4GUIA 3WK3A 1ICSA 1S5WA 3EWXA 4IUOA 4JTSA 4WOZA 3YPIA 4PL1A 2FPYA 3QH2A 4NXKA 1VC4A 2ZZ1A 4WD0A 1YXYA 3RMJA 5FEXA 2P1FA 2F84A 1WXJA 4A3UA 3SGZA 1OX6A 1XI3A 2W79A 5DXXA 2XFWA 1B4KA 2V8ZA 2OT0A 2VEMA 3WK0A 3QYQA 4AEOA 3WJYA 3OVPA 1W5NA 2OCZA 5EY5A 3UWYA 3BW3A 3GNDA 3TUUA 3C61A 3W2UA 3IGUA 1YPIA 4XBSA 1SW3A 2QDGA 4K37A 3BV4A 5AHIA 4OWGA 2ISWA 2XN1A 3NZRA 3HPSA 3SFKA 1ME9A 3MMTA 2NX9A 1BEUA 1FQ0A 2QR6A 1VPXA 1OFDA 3W74A 2YXGA 4MVAA 1LORA 3NQDA 3NL5A 4POCA 4M7SA 4PH6A 1JQVA 1A5AA 3NQ7A 3QF0A 5K4ZA 3GLCA 4R34A 1V5XA 1ME8A 3UXAA 3FA5A 2C1HA 3LB0A 3F4NA 5G2WA 3GK0A 4NJKA 3I65A 3VE9A 3A9IA 1GVOA 1TRDA 2V9DA 3M1ZA 3G0XA 4IGHA 1S3HA 1CW2A 4JTLA 3TKFA 2O7QA 3E12A 3LV6A 3P7YA 1NEYA 4ADTA 1X1OA 1FDJA 4GBUA 3TMLA 3M0ZA 3F4WA 3M16A 3C52A 4O53A 1NFBA 3IIXA 4UFLA 5CZJA 3LCHA 3PS7A 3AO0A 1LBMA 1JCXA 5L6UA 1KM6A 3W72A 5FF4A 4JYFA 3NPXA 4ZQPA 5EMUA 4XKYB 3GR8A 2CLLA 3C2RA 1LLZA 4IMEA 3W1LA 3QMTA 2ZZ3A 4ORIA 1JVNA 3HPZA 2Z2UA 3K30A 1F76A 2WJZA 1KBJA 2ZZ7A 3KOFA 3UWVA 1TPEA 2E6YA 3PUDA 1OX5A 1OX4A 1R2TA 2NWRA 4JTHA 1XC4A 4JTGA 4XQ6A 3NO5A 2CZ5A 3NM1A 2C18A 3W73A 1XBXA 4R7JA 5AHNA 5HWNA 1D3GA 1G4TA 1WDWA 5A8GA 1YXCA 4LC8A 4IMFA 5AYZA 3TU9A 5H91A 3LRMA 1E51A 4O57A 1GZGA 4ICNA 1W5MA 3QSTA 3W7KA 2OT1A 3BGJA 1SU5A 5D2VA 3TSDA 5KMYA 4FX8A 1FDYA 4IMCA 2DZTA 3TAKA 3M5YA 1DKWA 3MYPA 5F1UA 4MIMA 3GAYA 3SIZA 3NGJA 1KA9F 4HSOA 4MJMA 1DQXA 5U7SA 3VNDA 5HR6A 4N9EA 3RNDA 3LCIA 2QCLA 1UUOA 4PTNA 3S1WA 1QO2A 1C9DA 1OK4A 1TTJA 5SWUA 3Q94A 1GEQA 2WKJA 2NXIA 1HTIA 1Q6QA 3T7VA 4CNOA 1H51A 2A85A 3G1AA 4LTSA 2Y63A 4HT3A 3C56A 2LLEA 3MUXA 2YCEA 3TK7A 3TIMA 2NLIA 3I7RA 3SZ8A 4QQ3A 1WQ5A 3DENA 2A5HA 3H54A 1VR6A 1RQBA 3TR2A 1HUVA 1F73A 4Z1BA 4AHQA 3H53A 1H7XA 3W22A 1AW5A 2TYSA 4WJEA 4I7WA 1G6CA 4P61A 2W6RA 5HUOA 5BMWA 3T4CA 1LOQA 1DBTA 3U8GA 1N7KA 3LLFA 3W3OA 2C15A 3TE9A 1A53A 3STCA 3W84A 4KWWA 3UWQA 1I2PA 1GVFA 3A5FA 4LUJA 1TPVA 5TBOA 2ZRUA 4O14A 4X9SA 3EWYA 2E77A 5AC7A 5LNRA 1VYSX 4I9AA 3DAQA 2CW6A 3EX2A 4DF0A 4O0ZA 3BVJA 3PSWA 4LY8A 3R12A 3NQ8A 4DF2A 2QJIA 2ZA2A 1OVDA 1H60A 3MP3A 2Q3RA 4PODA 5KINA 3F03K 4YCPA 1QAPA 4UFHA 3RU6A 4HNTA 1QFEA 3E49A 1FUYA 3LHUA 1BKSA 3LERA 5KITA 4DQWA 2QCFA 2PRLA 5BW6A 2H3BA 4HNUA 2VC6A 4O1DA 3NQ2A 1LOSA 4IPIA 3M5VA 3MO7A 1K7EA 4LV9A 4LS2A 4FO4A 4HPXA 3I7QA 3T55A 2PC4A 1YDNA 3KVKA 4WQ6A 2WSQA 3LRLA 3N73A 3IGXA 1SFJA 1ADOA 3P67A 3R2GA 3HB9A 1XXXA 2OJPA 1M6JA 3MHUA 4AWTA 1PCKA 1EIXA 1GG0A 4O11A 2QCCA 5AFDA 1KFKA 1QOQA 2QCMA 3FIGA 2DJLA 1W0MA 1PV8A 1H5YA 3VI2A 3P8IA 5CPNA 1BTMA 3VE7A 4O4VA 3HF3A 3NPWA 1LYXA 1WBJA 1XFBA 3UY7A 3EX4A 4GRSA 3ZWSA 2V2CA 1SO3A 3LI1A 2E1DA 3HGOA 2A1YA 4QAIA 3ABQA 1H1YA 1W37A 3IIPA 1EWEA 1VGAA 1LTDA 4JTKA 4JNMA 4NXSA 4Q4KA 3W1PA 3E0IA 5LZLA 3TMQA 4Y90A 1QDSA 3TSMA 3MP4A 3KAOA 3OEXA 3L0GA 4W9TA 3TROA 5FESA 2EGZA 1P0NA 3QPYA 3W9ZA 3S0CA 4HKPA 1SQ7A 2CZEA 3WK2A 3P5ZA 4EWND 3S6DA 5E1QA 3L5AA 1KFLA 3O07A 3IRDA 1H7PA 5BRBA 4RXGA 3DFQA 4U4MA 1W54A 1PCWA 3A24A 4M6PA 3P80A 2YGYA 4OE7A 2JKPA 4RJEA 1QCWA 1L2UA 1O60A 1M7PA 1KM1A 1RD5A 5FEWA 3M41A 4RKAA 2C0AA 3GAKA 1TPUA 4K7YA 2VFEA 1X8FA 2TRSA 3B0UX 4CCCA 1FY6A 1O4UA 2ZRXA 3IVTA 2G95A 2Z6IA 5D2XA 1FCQA 1JCLA 4M6VA 5HINA 1KTNA 5D03A 4CQ9A 3PB0A 1C29A 5DCEA 2QUTA 5LNWA 2FIQA 3UYCA 2RKXA 1OFQA 1DHPA 3G24A 3W7OA 4ZZ9A 1D9EA 2E5CA 5D2WA 5EYWA 3TW7A 3QW4B 5IM51 3G1YA 2F7FA 3TXVA 3UY8A 3FYPA 3ABRA 4GC4A 4LV4A 1SZNA 3CT7A 3HG2A 5AYXA 4Y96A 4N9CA 1F7BA 3LCGA 2HSAA 3LXAA 5D33A 3TH6A 3BG3A 4GE8A 4M6QA 1PHQA 3CIWA 5K7JA 4DO5A 3N9RA 2FTPA 1KM5A 5D38A 3T44A 3NPVA 5K9DA 4KFPA 3L67A 4J9JA 2VEKA 3S8HA 2R91A 3NQEA 4XKYA 3NQAA 1OF8A 3NR0A 5IBXC 3LXCA 1DORA 1WOBA 5LGZA 5LNUA 4TIMA 3A5VA 4LOCA 1W8SA 1SSDA 2Y61A 3P84A 1KTBA 4BWLA 2QUUA 2CZFA 2FFCA 1H7WA 4AXKA 1K8XA 3DFPA 3NA8A 1MEHA 1TREA 4LWWA 1SO6A 4OHQA 1P0KA 4GUHA 3PVFA 1H7RA 4O1CA 3LCLA 1F6PA 3FKKA 1JCNA 4XZ9A 4NJJA 1ZCOA 3PUOA 3ELFA 1LZOA 2YYUA 2J88A 4KFNA 1VHNA 2A6NA 2ZYFA 5HULA 3TAOA 3FKRA 2A21A 1KM2A 1S5VA 3IIOA 3LRKA 4FHAA 4QNWA 4FNTA 4BI6A 3LTYA 2RDTA 5D30A 1H50A 1A5CA 3KVLA 1KFEA 2DZUA 2Q8LA 1U83A 2PRHA 3PSVA 3TQVA 4JEQA 3BLFA 3L68A 1IGSA 1ZHAA 3MI2A 4K7VA 3W7GA 3E02A 3JRKA 1KV8A 1Z41A 2YSWA 3L2IA 2X1RA 3Q58A 4LNYA 2ZRZA 1VRDA 3S1UA 4AVFA 3GDMA 2G5WA 4BWLC 3CIXA 4JR5A 1YLVA 5FF0A 4O1AA 1TJRA 2ZZ4A 3TQKA 4GFSA 3CU2A 3O05A 2GUUA 5L9FA 1GPWA 3EWZA 5BNKA 1H7OA 1KFBA 3HGJA 5CZSA 3W2LA 3DU0A 3LTPA 2VKZG 1HO1A 3HMJG 4UTTA 2QCEA 2NX3A 5TIMA 3IV3A 3QSRA 3SGUA 1EA0A 4O17A 4ORMA 2Z1BA 1ZAIA 3B04A 1JUKA 2GQ8A 4JD4A 3M6YA 3TC7A 2R8WA 4BR1A 4BI7A 1J4EA 2C16A 4O19A 1ML1A 3QMRA 4IX2A 5EKYA 4P2VA 1W56A 2Q8ZA 2A4AA 3P5YA 3G22A 4CNPA 3W7HA 4HHPA 3LGEA 1JCYA 1KM3A 3ATYA 1R47A 2A0NA 5AC8A 1GVSA 4S2BA 2AQWA 1TQXA 3HGRA 1CI1A 2XN2A 1KV5A 3B0PA 3NXFA 4AF0A 4LS0A 4LVAA 3O6CA 4K6AA 3G1HA 2FLIA 3BW4A 3KFTA 4JYDA 3EX1A 4HIBA 3S5OA 5J5DA 1LLWA 5BMXA 2RHGA 4UUIA 3W87A 4A2RA 4PFMA 3CHVA 3LHWA 3W7LA 2P0OA 1G7UA 2V82A 4QITA 5G1TA 3KVJA 1ZNNA 3UWZA 3PAJA 2P10A 3LOTA 1MEIA 1H63A 2ZRWA 4DPQA 2QCGA 2QJGA 1XUZA 1Z48A 2GVLA 2BXVA 3FJ6A 3W1TA 3GKAA 1PL9A 2QCHA 3M7WA 1OFBA 5K4XA 3LXBA 3EWWA 5J5RA 1KFCA 2CZDA 3P8JA 4CCDA 2ZZ5A 5TQLA 3NG3A 5CSRA 1RZMA 3KHJA 4MZ1A 4NU7A 3P74A 1TPB1 5CZ0A 3O1NA 2WPBA 3PBYA 3LHVA 4K39A 5HWJA 4YWIA 3A21A 3CEPA 1JUEA 4H3DA 5F1VA 5DCDA 1VCFA 2B7NA 2OMAA 3MYOA 4DEFA 2V30A 4WXZA 1TCDA 3W1RA 1B57A 3PG8A 5AHFA 3QZEA 5D09A 3QC3A 1CX9A 3G1FA 3L65A 1LP6A 4L4LA 2WSYA 5LSMA 2ZRVA 3I6RA 3UXDA 3MBFA 1NF0A 1WAUA 2ZRYA 5F2LA 4KFOA 3DKJA 1IXQA 3MJYA 2ALDA 2NV2A 2C3ZA 3LHTA 3CWNA 1DJQA 4YLWA 3W2JA 3QEZA 3N9SA 5LNVA 1GYLA 1RR2A 1YTDA 4JY8A 5LKYA 1XL9A 1RVGA 4FEZA 2E5DA 2CLEA 3IVSA 1AG1O 1UASA 3NL2A 3M47A 4IMGA 5G5IA 4UNKA 1F5ZA 3KRZA 4ADUA 3DHFA 4Q32A 4JTFA 5F2GA 4HN4A 3THAA 4WUIA 1OJXA 4O50A 3W83A 3TW6A 4AHPA 4AH7A 5AYYA 6TIMA 3CLMA 3LLDA 4E2BA 1AL7A 4NJGA 3RK8A 3LDVA 3WJSA 3DFTA 1LRTA 5HJLA 3NQCA 1H7NA 1OFRA 2YYTA 3DKLA 3BO9A 3LI0A 2B7OA 4RCXA 3W88A 1SZGA 3MHGA 1ZAJA 1EPXA 1OG0A 3FYOA 3W7JA 5FF7A 3ZWTA 3NZ1A 5IBXA 1R2RA 1X6UA 4N02A 5I3GA 2NXHA 3MHFA 2C14A 1TV7A 4AMAA 1EX5A 1SR9A 3NDOA 3TDFA 3CPRA 2CLOA 4XWUA 3LBCA 2FDSA 5FEZA 2YW3A 3DXIA 2JKEA 2V81A 3GDKA 4OQVA 3W23A 4UFKA 3W7DA 4MY9A 3HGSA 3UWUA 4L4MA 1Y0EA 2FQIA 3NQFA 1RQHA 2IQTA 4OBTA 1XM3A 2Y62A 1TV5A 3HG5A 3QJAA 2H8XA 2Z0IA 1OFAA 5F2IA 5KSWA 1QPQA 1VYRA 2ZA1A 5EA9A 1AW1A 2Y88A 3O6YX 1KM0A 2YX0A 2R14A 1IXOA 1WBHA 1MO0A 4EIVA 2OX1A 1SZEA 4UCGA 2EF9A 3BW2A 4OV9A 4YCOA 2GVGA 1O5XA 2AGKA 2E6FA 2VEPA 2BSLA 1IF2A 3HIJA 4N4QA 3FFSA 2PURA 5D02A 3PBWA 2E5BA 3PUEA 4RZ4A 2QF7A 1VZWA 2V5LA 3NPUA 4WOQA 3ZS4A 1EUNA 1PHWA 3W1UA 3P81A 1K02A 2ZDRA 4JX5A 3GKFA 4O52A 2YW4A 4MYAA 1OK6A 1HL2A 5DY2A 2VFIA 1XDLA 5K2ZA 4O54A 4TMCA 1A5SA 3HQ1A 1G7VA 3R13A 3E9AA 3BARA 1ZY9A 4IXXA 4RV8A 1Q45A 3W85A 1DOSA 3N2MA 4NUWA 1JJKA 1W3TA 3NQVA 1XKYA 1FWRA 3CB8A 3TX9A 1LDCA 3MI3A 4TX9A 2J9XA 3NVTA 1Z44A 3L0NA 4N4PA 4TR9A 3TCEA 3C6CA 1XDMA 4O4WA 2BTMA 1B3OA 4MOZA 1FBAA 3EX6A 5H2ZA 4E0CA 4I7UA 4NZJA 3T40A 2WOQA 1P5BA 4BK9A 3W7MA 2WQPA 2QAPA 3UZ5A 3HO8A 4PA8A 5C2XA 5I3FA 3RLVA 5I3JA 3BG5A 2B7PA 5AN7A 1TMHA 4Z1AA 4DF1A 3UQNA 1N55A 2DZVA 3ATZA 3SW6A 3BLIA 1T8XA 3QM3A 1OYCA 1FCUA 4JDBA 5D04C 1SPQA 4NNBA 3D0CA 4LU0A 2G97A 1GVRA 1F74A 5HQEA 2H3DA 2A2IA 1TTPA 1KFJA 2DZXA 5DBUA 3TJLA 2DU2A 4WZHA 3RF9A 1KW1A 1RV8A 3ABSA 4MYXA 4UMAA 3N14A 4UTIA 2J9ZA 2YFOA 3DFOA 3N19B 1DL3A 3KVMA 1YYAA 1VCGA 3W2NA 5HMSA 4JDYA 2JK2A 1QMLA 1X1ZA 4BF9A 4ZVJA 1FWTA 3PB2A 2V5BA 3L0KA 3ZFHA 1EP3A 1FDZA 4FB7A 1NF7A 2GVJA 1SFLA 2ZTKA 1GYNA 2JGQA 3M9YA 6ALDA 1DJNA 1GWJA 3W1QA 4MY1A 3GXNA 4K38A 4LVBA 1K03A 3ZR4A 5DY3A 1P4CA 5KZMA 3P60A 3L21A 3S1VA 3GNNA 4JTTA 3Q2DA 3U2OA 7TIMA 3EEGA 1R46A 3NQMA 2QKFA 3C2VA 2NV1A 4OV4A 5DBTA 5MHBA 1Q6RA 1FXQA 4RZ6A 4A22A 4AWUA 4R53A 3UWWA 4RR4A 4G1KA 3DH7A 4Z1DA 2CLMA 3MI6A 4NX0A 2DP3A 1TPFA 2FPVA 4NZFA 3SJ3A 4FIQA 1B4EA 5C54A 2QEZA 4PL2A 1GTHA 1F2JA 4JIQA 3B05A 1N8FA 3S42A 4MFEA 2X1UA 1G69A 4DELA 3QQ1A 1LRNA 1QO5A 1R2SA 3FEMA 1GG1A 4LVDA 2GJNA 3W07A 5U4NA 4B5NA 1LBLA 4GUFA 1JR1A 4K8EA 1AL8A 3UZJA 1IIGA 2BLEA 3CWOX 1ME7A 3STGA 1TRIA 4MKNA 3PF3A 2Y7FA 3WFAA 1P1XA 4N9BA 3OG3A 3W7EA 1J2WA 2CLFA 4JICA 1LROA 3LHYA 2RDUA 4HNVA 5CKSA 3W7NA 4DPPA 1GTEA 5BOOA 1DVJA 2H6RA 3CM4A 3L9CA 1FWNA 4FX7A 1JRCA 1NAL1 5HWMA 4CLMA 1OX4B 4JYEA 2DZWA 5FF3A 3G1SA 1WV2A 3U6WA 4RK8A 5D2TA 5G2HA 4JTJA 4QJ1A 4ZQNA 2Y85A 2G96A 1K8YA 3DBPA 3GIYA 3QFEA 1K7XA 4YL2A 2AAMA 3W7RA 4CNNA 3UPBA 1SO5A 2E09A 3EXSA 3OBKA 3W76A 4WY0F 2V2DA 1B9BA 1LBFA 5I3HA 1VYPX 2H8ZA 2YDAA 3W1XA 2BWGA 5LHEA 2ZA3A 2EHHA 1OFPA 4LRTA 4XUGA 5CPOA 1ONRA 3B4UA 1GT8A 5CZTA 3O6DA 1I2QA 2DZPA 5CG7A 5CPLA 1I2OA 8TIMA 4IMDA 1L6WA 4FNQA 1ALDA 4EOUA 2WNNA 5KZDA 1MZHA 2X30A 3R5EA 1KLZA 1K3UA 3R8RA 4M5PA 1QPRA 5G2IA 2PCQA 5CPMA 4WXYA 5C55A 2ZZ2A 3G1DA 3OA3A 4H4IA 1L9WA 3GZ3A 3W7CA 4YMZA 4HSNA 2GQ9A 4E2DA 3N34A 5F4WA 2X2GA 3QPZA 1VLWA 4U28A 1EB3A 3M44A 3VKJA 2EAWA 3FOKA 3I7SA 4N6FA 1MXSA 3F1QA 1HG3A 2RFGA 4UTJA 3TJXA 3JS3A 4IWWA 1BWKA 4JN6A 1G67A 3GVGA 4O1BA 4ONVA 4N2YA 1ZJIA 2A6LA 4H6KA 4AB4A 3QW3A 1OFOA 3G1XA 2ISVA 2NUXA 4DBEA 2Q3OA 2B7QA 4QM1A 1JCJA 1H61A 4LW7A 1UJPA 3SSJA 1TJPA 1ZENA 3HG3A 4DO6A 4C1KA 1F05A 4ZQOA 5LHFA 3FLUA 1FWSA 2YPIA 3S9YA 2GJLA 3R89A 4S2CA 3LM7A 4M7TA 1DV7A 2ZFAA 5K9XA 2FJKA 1VHCA 3M5XA 1YXDA 2EKCA 4Y8FA 5G4WA 3IGSA 3C2OA 3EX3A 2CLKA 2I14A 4A21A 3VCRA 4PC8A 3GDRA 2JKAA 3PG9A 3OVQA 1BWLA 3BLEA 4WY0B 1EEPA 4GUGA 1Q3NA 1JCMP 3W2MA 1YTEA 3W1NA 3EWUA 3M5ZA 4A2SA 2W0UA 4X3ZA 3GDTA 3A23A 3PWAA 5AC6A 2VOMA 3EKLA 3G0SA 3SI9A 3MBDA 2RH9A 1NVMA 3WJWA 3S5ZA 1JULA 3C2FA 5FI8A 2YR1A 2A7RA 1G4SA 4O13A 4O16A 1IXNA 2Y70A 2BZNA 4UTUA 2RDWA 5K9CA 3V1PA 3P62A 2UV8G 1OYBA 5AHLA 4RLIA 2XN0A 2ZBTA 2ISSA 3USBA 4NT0A 3S1XA 4QISA 3CC1A 1FX6A 4QIUA 1TPDA 3SY5A 3L5LA 2J9YA 3LCXA 3QRHA 4EF8A 2V2HA 2TMDA 4JTEA 3G3DA 3O63A 2ZQ0A 4O8RA 3W7IA 4O15A 4PEKA 3AJXA 1W5QA 3IVUA 4FNRA 4Y9AA 1KM4A 2H90A 4O18A 2ABBA 5F4XA 3EXTA 1KBIA 3PBUA 5LNSA 1QPOA 4JS3A 3L66A 4LUIA 1K8ZA 4BI5A 4N6EA 3NL6A 2HMCA 1YPFA 2OZ0A 4OT7A 3DI0A 4JTUA 4D2JA 3C8FA 1A50A 1TV8A 4MPQA 3V75A 2Z6JA 4FX6M 2Y89A 4LVGA 3W7QA 3UPWA 3W1AA 4ZL1A 2HS8A 2QUVA 1QR7A 3HOJA 3NOEA 4RX0A 3TFXA 1UBSA 4AAJA 1OFEA 4GNJA 1Z42A 1WOAA 5G4EA 1TPC1 2VFGA 4CCEA 2PE4A 3P82A 2TPSA 4IQLA 3MP5A 2Y7DA 4UR8A 2FB2A 1TPH1 1QNVA 4RXFA 2D73A 5EL1A 3DHDA 5KTLA 5C6MA 3G8EA 1GJPA 4N9DA 3LV5A 5HR7A 2QCDA 3HBLA 4JIPA 4MFDA 3HJZA 1WX0A 1SUXA 3N2XA 2DJXA 4IPJA 4FXSA 3NL3A 1C8VA 3WJZA 4C1LA 3LCFA 4RZ5A 1ZFJA 2NXGA 2FB3A 1L6YA 2EPHA 4GXMA 1W5PA 2Y7GA 3M43A 4IJBA 1EUAA 1IIHA 5ABTA 3A22A 4YXGA 5LGXA 1RPXA 3W71A 5E0KA 1KTCA 4UIOA 4LT9A 3GX9A 3I68A 4QSHA 3NYZA 4JX6A 1W1ZA 2QJHA 2V0TA 2DORA 4Z08A 2PRMA 4DBDA 3TV8A 4ZMGA 3GB6A 4TMBA 4UNLA 4NJIA 1GQNA 4Z1CA 3NM3A 2X1SA 2J24A 3RLUA 4QNEA 1ZAHA 3INPA 3THQA 3MWAA 2YZRA 5GVJA 2CLIA 3W70A 3TQ0A 3LX9A 3UNDA 2BX7A 4UR7A 1MSSA 1SSGA 1O95A 2HTMA 5AHMA 1I45A 3IIVA 2ABAA 1JQXA 5HUPA 3O06A 3CTLA 4HPJA 1JRBA 5CSSA 2J6XA 1Q6LA 1XBZA 1YDVA 1O5KA 2C19A 1TO3A 3BK0A 4ZQRA 3L5MA 2JGYA 3KRSA 1I2RA 4MUZA 4MZ8A 1T96A 1H1ZA 2NWSA 5K3VA 1PIIA 3B0VC 3NAVA 3C3NA 3STFA 3W2KA 1AW2A 1FXPA 1H62A 3KXQA 3P61A 1XCFA 2QAFA 1XBVA 3GXTA 2X1TA 3O8AA 1PVNA 1EP2A 3C4UA 2VENA 3G18A 4MLRA 4S1FA 2WNQA 1YADA 2Y7EA 1WYIA 1NSJA 4FIRA 1K7FA 4FXRA 5DELA 2CWNA 1Q6OA 5DXYA 5F4SA 1MEWA 1DQWA 1G4EA 4NNCA 2VEIA 3UD6A 3TSBA 3DGRA 4MZYA 4UTMA 1WA3A 1F6KA 4UTWC 1JUBA 1UB3A 1UUMA 3LBMA 1LCOA 1FWWA 3NQGA 4OGZA 5D32A 3SECA 1R30A 2C13A 1W3NA 2DZSA 1VH7A 3WJXA 4XBKA 1YTKA 3PR2A 2YFNA 3O16A 4FNUA 5EPDA 3TA6A 2GOUA 2WSRA 4AF0B 4CQ8A 1TTQA 3TNOA 1I8JA 4NVTA 2HS6A 2NX1A 2VFFA 3TXZA 3OHIA 3QQ0A 1QPNA 4K8HA 3TFCA 4PCFA 4E38A 2I9EA 2QCDB 3NEVA 1J5TA 4A29A 2ZTJA 4NJHA 4UFJA 3RFAA 1QOPA 2VFHA 3IIZA 5HNRA 4KKXA 3GXPA 2B0MA 1S5TA 1TIMA 3TC6A 3PM6A 4DO4A 1THFD 3STEA 4LS1A 3KX6A 5E93A 3S5YA 3EB2A 1LOLA 2WV8A 3HG4A 1TQJA 5EBUA 4Z0SA 1T0OA 4UXDA 2GQAA 3DZ1A 1OYAA 4JTIA 3OIXA 3CQ0A 2JBMA 3EXRA 1SW7A 1O94A 1YDOA 1KLYA 4GWEA 5DCBA 5D37A 2NZLA 4UTWA 4LVFA 4TO8A 3E96A 1VJIA 4O28A 4XTDA 4XTIA 4BFAA 3H55A 1M7OA 3LCWA 1OABA 3W1MA 2E6DA 1I4NA 4DXVA 2B4GA 4O0KA 5D2YA 5FF2A 1OHLA 4OU1A 4HNNA 1X7FA 2X16A 3KRUA 4EVZA 5G1YA 4ALDA 4UMCA 2J27A 2VELA 1EP1A 1PE1A 5A5WA 5F2MA 4JX4A 3MW7A 4TU1A 1A5BA 4MY8A 1XUUA 3PULA 1VS1A 2ZCGA 4Z0JA 3FJLA 4ADSA 4M19A 3DFSA 1XBYA 4UTLA 2VFDA 1UCWA 3GYEA 5AB3A 2WNZA 1VLIA 4Y6GA 1V7YA 1W31A 2ATSA 1AK5A 1VQTA 3DI1A 3S5NA 2ZZ6A 4IOTA 4GJ1A 5FEPA 5I3IA 4IX0A 3G0UA 1SW0A 3BG9A 4UMBA 3W6YA 5KZEA 2NUWA 4O12A 5AHEA 4UFMA 3NQ6A 1EWDA 3G8RA 4UC5A 3PY2A 3GDLA 1SZFA 1TTIA 4WY0A 3ABOA 2O7SA 1LM1A 3G3MA 1M5WA 4R33A 3GR7A 4LRSA 1ICPA 3N3MA 1TSIA 3W86A 1G4PA 5DLCA 2A7NA 2QCNA 4NX5A 4Q33A 4I7VA 1OF6A 3LHZA 2CLHA 1D3HA 2KZHA 4MLJA 5T26A
chains in the Genus database with same CATH superfamily
2HPMA 4MB3A 4UTKA 3EKZA 2BDQA 3AMGA 5CBIA 1IXPA 4RZBA 3UZZA 2BV9A 3LN3A 2RDXA 3H7RA 4XUYA 3NO1A 3G1VA 1NIUA 5AC4A 2C6QA 3N9KA 4C6FA 1LRQA 2G4FA 4FNPA 4K36A 4QRNA 1HKIA 1U22A 1UKTA 1E6PA 1TPWA 3B06A 1GONA 3C2EA 2Y5JA 1S1PA 1KBLA 5A8MA 3V0TA 4NILA 1E9IA 2GSHA 1T99A 3WBAA 1HX0A 3CEUA 3FVDA 4MJ4A 4PZVA 1HFBA 4WX2A 4ZGYA 3VFLA 1TB3A 3DFNA 1GOXA 1PTDA 2F9RA 4GIEA 3VD3A 4A3YA 3M0MA 4ENLA 1U5JA 1GCYA 4I90A 4JXCA 4JGDA 1UROA 2G3IA 1VIWA 1ICQA 1TWDA 4GUIA 2AMGA 1UWSA 3EWXA 4IUOA 4WOZA 4PL1A 4B3ZA 2Z2BA 1XYZA 3WQPA 3QH2A 1QHPA 3H21A 2AQVA 1M7XA 4LAUA 3RMJA 4PBFA 5FEXA 2F84A 2BNJA 3SGZA 1PJ9A 1XI3A 2QVHA 2VGIA 2W79A 1BVNP 2YL8A 2V8ZA 4GQBA 3QYQA 1YQ2A 1BFNA 4ZB2A 3C61A 2YBVA 3W2UA 3IGUA 1CB2A 3LUTA 3MMDA 2BVDA 4LNCA 2PZ0A 2ISWA 3K2GA 3HPSA 1ME9A 3K1DA 2BBFA 1VPXA 3W74A 2PGFA 4FP1A 4MVAA 1LORA 1VJSA 1HN1A 4KT2A 4POCA 2OODA 1JQVA 2Q6ZA 1A5AA 2QDEA 3NQ7A 3ZSTA 4HNCA 3WL0A 4LGXA 3RHGA 1CENA 3FA5A 5B7ZA 3LB0A 1XIDA 5G2WA 2NQ9A 3A9BA 3RM9A 3T0TA 1AH4A 5A3HA 2V9DA 2Q01A 3A13A 4NL1A 4JTLA 2YOCA 2O7QA 2ZUMA 4H00A 1WKFA 1KR0A 1X1OA 3AIEA 1CEOA 1G0CA 3VOFA 2ZE0A 3M16A 2X0HA 4GC3A 3G2GA 2VHLA 3IJ7A 1XLMA 2OWXA 3AUJA 2OFJA 3BOFA 2IPGA 3F5KA 3WEZA 6XIAA 3L7RA 4XKYB 4HZ6A 1VRXA 3HA1A 3PBMA 2ZXQA 2VUYA 3S2NA 3MU7A 1R3RA 2Z2UA 3K30A 5CPQA 4AU0A 2ZVIA 3KOFA 5CPTA 2KAUC 1F07A 3T8LA 3OGRA 2CZ5A 1XBXA 2O92A 1PTAA 3IACA 1W1IE 3W01A 4AZCB 4MSSA 5HMFA 4LC8A 2UY3A 2GK1A 4PUEA 2PTZA 4O57A 1GZGA 2ODOA 3W7KA 3BGJA 3WMBA 1M65A 4F8XA 4ERAA 5HNUA 3LEPA 1BVWA 3AXXA 3UT0A 5GNYA 3DUGA 2WZTA 4R9OA 1GOWA 3BE7A 1PKYA 5CAKA 2BOEX 4ZEPA 5HR6A 4UQAA 1Q6GA 1UUOA 4H9XA 3NZGA 4PTNA 3S1WA 3C0QA 1DEDA 1ZBCA 3N17A 2GUBA 2DT1A 1KRMA 4NZ5A 2NXIA 2GYIA 3N12A 5A8OA 1C3FA 3G1AA 1V02A 3TTSA 3CS2A 3C56A 3WX7A 2YCEA 1JAKA 3ITYA 4K8GA 4OOUA 4QQ3A 3ARSA 4PMYA 3VGHA 1HVQA 1X1NA 2NQ5A 1VR6A 3MS8A 2W62A 1HUVA 4AW7A 3K4AA 4Z1BA 1ZQ5A 1UR8A 1A47A 3VIGA 1TA3A 3F5LA 1ODZA 3ZT5A 3TTEA 1G6CA 1LOQA 2Q71A 4Z42C 2QULA 3LLFA 1K6WA 3P0WA 4GI9A 4YHGA 1ZGDA 3STCA 3GG0A 5D9PA 1GVFA 1DTUA 5TBOA 1AD1A 4O14A 3EWYA 3PJXA 3PJWA 2CW6A 4DF0A 3BVJA 3NQ8A 4DF2A 1OVDA 3LMYA 4J5NA 2VGFA 4Y9PA 1QAPA 4XK2A 5LA0A 3C8NA 4UFHA 4JIHA 4JTCA 3UBPC 3T2QA 2QCFA 2PB1A 1PDYA 1TZZA 3MV11 1R87A 4IGNA 3NQ2A 2Z24A 1VFFA 3BWWA 4FO4A 3I7QA 1JDCA 2QXWA 1RLCL 2WSQA 4ZTXA 4DJED 1ADOA 1ZP3A 5ABHA 5JVLA 3HB9A 1XXXA 1RY8A 2ZICA 4AWTA 1PCKA 1EIXA 3N6JA 3NQBA 4O11A 5AFDA 3BURA 1UZ1A 1KFKA 1J0YA 2DJLA 1NDZA 1PV8A 3CMGA 2PTXA 3AYVA 1JIBA 2EQDA 5CPNA 3V5OA 4E3TA 4A35A 2PDNA 1LYXA 3VGFA 1OIFA 1V7AA 4IGSA 3E5PA 1DWAM 1V03A 4GRSA 1TUFA 3TWAA 4DBSA 2FZBA 4Q4KA 4YWSA 3E0IA 1QDSA 4KCWA 3OEXA 3L0GA 1AD4A 4P8VA 5FESA 2O4QA 5HMEA 1J9YA 4YU1A 2E3ZA 3EOLA 3W9ZA 5HBFA 3ARXA 3QZAA 2CZEA 2EEXA 4J2PA 4CU7A 5E1QA 3L5AA 1KFLA 3A3HA 3O07A 1PUDA 1HJQA 2DSUA 3OODA 5AECA 3R58A 3UCDA 3S83A 1JD9A 3CLWA 3QTPA 4LCRA 2J13A 2YGYA 3CIVA 4MTVA 3N2OA 4ZO7A 3S2LA 1GUVA 1W9PA 2JKPA 3L12A 2XIBA 4RJEA 1G94A 1KM1A 2CBJA 3M41A 4RKAA 2C0AA 4JFTA 3AZRA 3UW6A 5FJOA 4CNUA 4AYSA 3PPCA 3NCOA 2FJUB 2ZRXA 5FJTA 1E6ZA 1FCQA 2CBUA 3CYVA 4M6VA 5ECVA 3KBSA 4CQ9A 4R88A 3PB0A 5A2CA 1C29A 5M03A 1OFQA 3GW3A 5I00A 4Q8WA 3W82A 3C0SA 2WZMA 1B9ZA 2CLPA 2E5CA 1NDWA 2EG8A 1V3JA 3TW7A 3TXVA 2PDFA 3SCUA 4GC4A 1HQTA 3DYPA 4P7NA 3CT7A 3HG2A 5I5RA 1F7BA 3LCGA 2HSAA 5D33A 3TH6A 3BG3A 1P0EA 4BHYA 1IEXA 4PULA 3BLPX 3N9RA 4GJJA 1KM5A 3PK7A 1V3IA 3WL1A 3L67A 2ACQA 4S39A 5HOSA 4XKYA 1OF8A 3NR0A 1GKQA 3VNIA 1XP3A 1DJWA 1EJXC 1OM0A 2AL2A 2XWEA 2J66A 4TX8A 4AXKA 1RBAA 1K8XA 2X0YA 1TREA 3W26A 4GA8A 4GUHA 3U4AA 4GXWA 4O1CA 1JCNA 1RJQA 1KXTA 1FKWA 1LZOA 2J88A 4KFNA 2DW6A 1FKXA 3ZIZA 4KCUA 2A21A 3CL7A 1C8QA 4FNTA 3W27A 3LTYA 1KCKA 4TV5A 4W93A 3BJTA 1H50A 2PWDA 3KVLA 2PGRA 1KFEA 2ANUA 1DWHM 3RMEA 1E6RA 1U83A 4W87A 3TQVA 3PSVA 3UETA 3BLFA 1V77A 1IGSA 1J2BA 3QQWA 1ZBVA 3VPLA 2ALRA 1MYRA 4AY1A 4AG0A 5A8NA 3DEQA 3S1UA 1TWSA 2ZXBA 3GDMA 4JR5A 1YLVA 5FF0A 3BQ6A 3CL6A 1WB0A 3O05A 4QLLA 5L9FA 1FWAC 2WCGA 1H7OA 1KFBA 3HGJA 5CZSA 3LTPA 1HO1A 4S3AA 1P1MA 2E0PA 4ES4A 3LM3A 4XO6A 3MUZ1 2PU0A 1CXIA 3IUDA 5TIMA 3IV3A 3N13A 3SGUA 4RV3A 4O17A 3SEPA 2D20A 2PBGA 2Z1BA 4JD4A 3WDQA 3TC7A 1XLJA 4HNOA 4BR1A 3VABA 4LF2A 3OPSA 1F9CA 1UWQA 4PUWA 1ISXA 1ML1A 3KM8A 1VP5A 3O0FA 4YJ5A 5A6TC 2WC7A 3PNZA 1W56A 3H22A 4S3CA 5DT7A 4NAEA 2A4AA 4H8UA 3P5YA 4P7RA 1V3LA 4OVXA 3LGEA 3BQ5A 2A0NA 4XKMA 1BSLA 1KV5A 3B0PA 3KBNA 4FR6A 4AF0A 3BTNA 3H26A 3WY1A 1XF0A 3H2OA 3WD3A 3S5OA 3VOHA 2EPMX 5J5DA 1LLWA 4UUIA 1TG7A 3LHWA 5AVNA 1FHDA 4Q8OA 1G7UA 2J7FA 4QITA 5G1TA 2DSWA 3KVJA 1FP9A 3LOTA 1MEIA 1H63A 3PBGA 1LUCB 1EC7A 1Z48A 5IDIA 4DAIA 2EPKX 2GVLA 3FJ6A 4QTGA 5EMKA 3FGCA 2CWXA 4HMEA 3EWWA 4ZTYA 5CC5A 5J5RA 1QW8A 4RNFA 2ADAA 3VDCA 1H5VA 4CCDA 4DJEC 1TWWA 4GABA 1ZU8A 2NT1A 1K77A 4QG9A 1HVXA 1Q13A 1WZAA 3MWCA 5JBFA 1AH3A 4XZHA 3AXMA 4K39A 5HWJA 1TJ1A 2BVYA 2YLAA 3VM5A 3CO4A 2HZGA 3OOQA 3GWQA 4L6HA 3MYOA 2BXZA 1QT1A 4WXZA 1B57A 2XM2A 3PG8A 3UR7A 1EF2A 4QHRA 2DUXA 1E5NA 1XLBA 2ZRVA 3EWDA 3UXDA 2WMKA 1W32A 1ADDA 2ZRYA 3ARRA 1TR9A 1FH8A 3EPNA 5F2LA 1KFWA 2ALDA 2C3ZA 1VEPA 1ZBKA 3EPMA 3MCOA 4WCJA 1RALA 1S1RA 5LKYA 1RVGA 3K46A 2CLEA 4QDWA 4RDZA 4BEQA 3NO3A 3M47A 3HQOA 3TNBA 4O1EA 2PF8A 4JTFA 1IEIA 2PDJA 4AH7A 3WH7A 6TAAA 4KPLA 3A4JA 2G3MA 3LLDA 1V6TA 4L4OA 3AISA 4NJGA 3SBFA 4NG3A 1VFHA 4PCPA 3W00A 3LA4A 1OFRA 1S2VA 4QE5A 1PWMA 2J6VA 2B7OA 4I6VA 1KCLA 1EPXA 3ZT7A 3ZWTA 3F2BA 3DFHA 5BXSA 4PMOA 1R2RA 1UD4A 4DZAA 2NXHA 3MHFA 5CBJA 2FMOA 1TV7A 4D6GA 7ODCA 2HVNA 3AUOA 4AMAA 2E25A 1X98A 1DIOA 3HZ3A 1CT5A 1Q65A 4H9MA 3OZPA 2V81A 3GDKA 2Q8XA 2IQDA 4OQVA 3W7DA 2J8TA 1KRCC 3R94A 1JXJA 2IQTA 2NQLA 4OBTA 5BWAA 1HKVA 3KEHA 3P14A 2Y62A 4Z2KA 4C7FA 1TV5A 3OGVA 1X97A 2ZA1A 3EOUA 5A69A 4W8BA 3MSRA 3ZR5A 3F5JA 1IXOA 1WBHA 2OX1A 1VBRA 5I2UA 4FS9A 2AGKA 3VDAA 3FFSA 4K2SA 2PURA 2E5BA 4U5KA 1JAEA 2QF7A 1VZWA 1EUNA 4XV0A 2DSVA 2XYLA 2ZDRA 4JX5A 3GKFA 4O52A 2YW4A 1OK6A 3K8KA 1OIMA 3TR9A 2OU4A 2DZAA 3R11A 5AVHA 3HV9A 4TMCA 4GZEA 4GY7A 3LSBA 3HQ1A 4GIYA 3UR2A 3MKKA 1ZY9A 1XLKA 3VKKA 1HL8A 3W85A 4GCXA 1M04A 5C9ZA 4FAMA 5EU9A 1DOSA 1OB0A 4Z2LA 4NUWA 3K1GA 1JJKA 2VZOA 1FWRA 4X61A 4MWAA 5GJNA 1LDCA 3D47A 3MI3A 4ROPA 2J9XA 1XIMA 1V79A 4JTRA 3L0NA 4N4PA 2CKSA 3C2YA 1RA0A 3II1A 4MOZA 5H2ZA 4D71A 1SZRA 2PLKA 4D6IA 2WOQA 3W7MA 4R9XA 2WQPA 1HGYA 3HO8A 2XGIA 5I3JA 3IARA 2B7PA 5CBBA 1TMHA 3UQNA 1N55A 3ATZA 2PEVA 4PUKA 3BLIA 4FOJA 4JDBA 3WLRA 3A4XA 4RE2A 4I8DA 4NNBA 4UOJA 2ZX9A 1GVRA 4D72A 4M6UA 1JL8A 3GW0A 3PZIA 1JNDA 3R10A 2A2IA 1KFJA 3TN5A 3SY8A 1I0BA 2BGNE 1CECA 1FFRA 3KP1A 1A3XA 1MUCA 4AD0A 3KCLA 2J9ZA 3N19B 3IANA 4D6HA 2VOTA 3RX2A 3KWXA 4RDWA 2J7CA 4JDYA 3WQ5A 1I6NA 3U7VA 1HGWA 1VFOA 3APTA 3ZSSA 1QMLA 1X1ZA 2PWGA 4BF9A 3OVGA 3SCRA 4GHRA 2V5BA 4FB7A 4DUVA 1GYNA 1LQAA 3M9YA 4XVDA 4QGCA 2QUNA 4UB9A 4NYYA 3VUPA 5HPOA 2JF6A 3ZR4A 4Q8NA 3U2ZA 3NQMA 4G1NA 3C2VA 3CZJA 1VB9A 5DBTA 1FXQA 1Z3NA 4RZ6A 1UMLA 5A1AA 2ISFA 4G1KA 2CLMA 1LQ2A 4DUWA 1TPFA 3SJ3A 3UZWA 4H41A 1F2JA 1S2TA 1B3VA 3B05A 1N8FA 1AJ2A 1E1EA 1EDTA 1C92A 2W9MA 5JH1A 4ACZB 1J93A 3QR0A 3V5CA 1JPDX 4GUFA 3QV7A 3AIBA 3UZJA 5I6SA 3WFAA 4MWAB 4NKCA 4N9BA 3RX4A 1OZQA 1Q85A 2RGMA 1OCQA 4YPJA 2VZVA 3LHYA 2RDUA 2W91A 1LWIA 4HNVA 4DPPA 5BOOA 3ES8A 4IUGA 3L9CA 4HZMA 3GVRA 3QV9A 3GZAA 5IOBA 3U6WA 5G2HA 2OO6A 1ZJAA 4JTJA 4ZQNA 3IJQA 1YRRA 2KX9A 1VBJA 3EDDA 2QMKA 2QGHA 1T5AA 2Q09A 3DBPA 3OZYA 3GIYA 4RNJA 5JQ9A 3QFEA 1K7XA 3W7RA 3QV8A 3UPBA 1H4PA 3EXSA 5BWFA 3OBKA 1E0XA 3MVIA 5FA5A 1LBFA 1TVLA 2FGBA 5I3HA 4E8GA 2WVTA 1VYPX 2YDAA 2BWGA 1MRAA 2ZA3A 3NOYA 3M0XA 2EHHA 1OFPA 1I75A 3WQCA 3B4UA 5CZTA 5CG7A 3L2MA 8TIMA 3C86A 3S46A 1L6WA 3U5YA 1HJWA 4PSRA 1MZHA 1Q2RA 1QPRA 2Q02A 2PCQA 5CPMA 4WXYA 2ZZ2A 4ZO8A 4H4IA 3B9DA 4W8AA 3O7UA 4H6EA 4F48A 5BXRA 4Q8TA 5F4WA 3KHDA 4U28A 3LYEA 4GYFA 1EB3A 3IRSA 3VKJA 4GJIA 3MSDA 3UP8A 3JS3A 4IWWA 1HKJA 1BWKA 3GVGA 4HCHA 3CZEA 1Q8JA 5I0DA 1GZJA 3BAWA 1V6XA 3ARZA 3QW3A 3GFYA 1D2KA 1OFOA 2CXEA 3G1XA 3WD1A 2VDIA 4XO7A 4JFVA 4LW7A 5A8PA 2WVVA 2A3LA 1ZENA 1F05A 4L65A 3WBEA 1FWSA 2YPIA 3O2LA 2GJLA 4S2CA 2VCAA 8XIAA 1GW1A 3WH6A 1DJIA 2NV9A 1YXDA 2CLKA 2ESCA 3MKVA 1H11A 2NSXA 2D1ZA 1L0PA 2OZ3A 1KKRA 4MNJA 3PG9A 5BU6A 1YNQA 5LIKX 3W1NA 4L5ZA 4GVGA 4GO8A 4IP5A 2FYMA 1P7TB 5FL0A 3KBMA 4EANA 2W0UA 2G41A 4M80A 3GDTA 4F0MA 3WSUA 3OZOA 5AC6A 2VOMA 1NVMA 1IHIA 3H4GA 2X41A 4OUIA 1PB0A 3WF2A 1MNZA 3FX4A 4QP0A 4UTUA 2GQ3A 3MPGA 4XZMX 5AHLA 4RLIA 3TW9A 1XRFA 2ISSA 3USBA 1C8YA 4NT0A 3S1XA 1O1HA 3SY5A 3L5LA 2FFIA 1F4HA 3STPA 4JZ5A 4EF8A 3O63A 3BAKA 2DVUA 3EOEA 3AJXA 1FWHC 1W5QA 4JQAA 4K1WA 3RO8A 4MDPA 4L56A 3EXTA 1VIZA 5LNSA 3G5EA 4FZIA 4DY1A 1K8ZA 1HIZA 3O3RA 2CPUA 4KS0A 3DI0A 1IQ8A 2GK1B 4QJ4B 2Z6JA 4PTDA 7TAAA 3IS4A 2BVWA 3NZPA 3W1AA 1QR7A 1RSCA 1UR9A 4AAJA 1WOAA 3ISIX 1TPC1 2VFGA 3CAKA 4LJ3A 1EX1A 3MP5A 5B7YA 1MZRA 1A5NC 3OZMA 1TPH1 4RXFA 3USZA 3ANUA 5C6MA 3LV5A 5HR7A 3PPFA 3N6QA 1UYQA 1JI2A 3CGTA 2QF8A 4CU6A 1SVDA 4ROQA 2NXGA 2FB3A 4R7WA 4XB3A 3EDEA 4YXGA 1KR1A 4GG9A 1AQ0A 3JVAA 4AXNA 1FWFC 4X60A 2E8YA 4QSHA 4H01A 4KIEA 5GNZA 3GB6A 1JPKA 4TMBA 4UNLA 3WQGA 4Q4MA 3HV8A 1E6QM 3INPA 2Z28A 3RR1A 3SUTA 1M41A 5GVJA 4NAEB 3W70A 3WH9A 1UHVA 3MV01 1UMYA 4EPKA 1WUFA 2XFYA 3U7BA 3WQ6A 2ABAA 5HUPA 3R8HA 4AD2A 4CVWA 3UXKA 1JRBA 4XD4A 1XBZA 1YDVA 4HOWA 1TO3A 3UESA 3L5MA 2IUZA 4M51A 3KRSA 1ISWA 1I2RA 2F2KA 1EJSC 1T96A 1QASA 3B0VC 3E0VA 1WKEA 1AW2A 1FXPA 3URNA 2VDGA 3AS2A 4EACA 4C6QA 2X1TA 1PVNA 1R8LA 3UVIA 1EP2A 1YADA 4A3HA 1K7FA 5DELA 4KQNA 5DXYA 1DQWA 4FXJA 1DJXA 1BQGA 2PDBA 3R0UA 5IRPA 3BAIA 1E4IA 2VDHA 3TYCA 1FWWA 2B81A 3WLKX 3MKCA 4E6MA 4IPNB 4E2OA 4MB4A 1A4LA 4IHCA 2WSRA 4AF0B 1TTQA 3QGAC 4ACYA 1GQJA 1Z89A 4QLKA 3QKEA 2XPKA 3T9PA 1QPNA 4K8HA 2I9EA 2IKIA 4LFYA 1J5TA 1V6VA 2XFFA 4L4PA 2VFHA 5HNRA 3GXPA 4Y7EA 4B2DD 3TC6A 3EYPA 4DO4A 1YNPA 1DWFM 3EB3A 2ZKMX 3STEA 5E93A 4FXFA 2VYOA 3MQTA 1DPMA 5EMJA 1IGWA 4A05A 1LOLA 5FACA 2WV8A 3HG4A 3OTRA 4NAFB 2DGAA 2EO7A 4UTFA 3U0HA 7A3HA 1AQMA 1DTNA 2V3EA 4HGXA 1XLGA 1O94A 5E6YA 2NZLA 4UTWA 4LVFA 1P43A 1TWIA 4UQEA 3KCOA 3EKGA 1V93A 3LENA 1HXJA 1RJRA 3H55A 4W85A 1SYTA 3GBEA 4HPGA 2B4GA 4FR1A 3M07A 2R1NA 2JALA 4AD4A 2X16A 5G1YA 4HU0A 4C5YA 1EP1A 1PE1A 2OZTA 5F2MA 4WGXA 2VZUA 5XINA 3MW7A 1A5LC 3I4EA 3RJYA 4Z0JA 1VS1A 3L23A 4M19A 5AZ0A 3GYEA 2E8ZA 3URBA 1W31A 1UD5A 1VQTA 3DI1A 1IEVA 4GJ1A 1OBAA 2GL5A 3WF0A 1SW0A 4S23A 3BG9A 1NOFA 4V1XA 3VZXA 5I07A 3G8RA 4UC5A 5FJRA 6XIMA 5I77A 1QUMA 2UY4A 3TN4A 3QY8A 4DIAA 1NDYA 1T8QA 1LM1A 1M5WA 2G50A 2J8GA 1RD6A 3NURA 1MDLA 5J04A 1ZCCA 3DG7A 2OVLA 1OF6A 2W5FA 2CLHA 4FPSA 1D3HA 4GISA 4C6MA 5T26A 4Y9MA 3MVTA 4KESA 4LSBA 3MMWA 1E43A 3FJNA 1YE4A 3LPOA 1Y5WA 1I2NA 1O66A 3SM0A 2NUYA 3GTIA 4EP8C 2OLSA 4IXHA 2QDHA 4ZOAA 2PDIA 4C6EA 3TN6A 3ARTA 2ISDA 3W75A 1CGWA 2XSXA 4KWVA 3B8DA 1ISYA 3W6LA 1RQEA 1ZALA 5D8ZA 4HU4A 3BGAA 1PS9A 4PMDA 2VMFA 3BPWA 3C0JA 4E2VA 1NP2A 2ATMA 1QJWA 2BHUA 1SO4A 4ML9A 4LB4A 5CGQA 4DXKA 1XIGA 2CHOA 3MANA 2QJMA 3IEBA 3GC4A 1VFLA 3ANYA 3WK1A 4E4FA 1XH1A 5A6BD 1RUSA 3A3WA 3IJIA 3JR2A 3NEHA 4NNAA 2ZE3A 5BRQA 3NNTA 3PZ9A 1VCVA 1UC5A 4WJXA 2PWVA 4X2PA 1V3HA 1BG4A 3EWBX 1W3IA 5AOUA 3CT2A 3NVDA 2VXNA 2WCSA 2A7PA 4PMUA 2YCLB 3UG3A 2HPIA 4PB3A 2V63A 4DUXA 4GUJA 4FNSA 1VF8A 4Q4QA 4X2RA 4OZOA 3TA9A 1TYGA 1UD2A 3WK3A 1VFSA 5FOOA 3DHUA 1IV8A 4GACA 2FPYA 2CERA 3GTHA 1BYDA 4NXKA 1VC4A 2ZZ1A 4WD0A 1YXYA 3OG2A 2P1FA 4A3UA 3K4WA 1WZKA 3AU2A 1YE6A 3CAQA 4X0VA 1B4KA 3WJYA 3QR3A 3OVPA 5EY5A 2CIPA 3BW3A 4I8YA 5RUBA 4NYUA 1YPIA 2CHNA 1W1YA 1UP3A 3BV4A 3A6OA 2XN1A 3SFKA 3H2NA 4WKHA 1FQ0A 2QR6A 1OFDA 2ZXDA 5DX7A 2DIEA 1UIOA 2GSEA 2ZX6A 2JEQA 5K4ZA 3WMSA 1B3ZA 4RPQA 3BOLA 1ME8A 3UXAA 3WUBA 2C1HA 3BICA 3F4NA 3I65A 2Y4SA 4QR6A 3VE9A 1DJZA 1GVOA 3DECA 3G0XA 4IGHA 1S3HA 3EA3A 4L80A 3FNDA 3P7YA 1NEYA 2OYMA 4ADTA 3MB9A 4X63A 3TMLA 2XGZA 4IQJA 5E70A 2WC4A 2HXTA 5JBDA 4UFLA 5CZJA 3LCHA 3SAZA 3KBWA 3A4AA 3PTMA 1LBMA 1JCXA 2NQJA 4ZQPA 3QY6A 1HKKA 3GR8A 3W4RA 5C2GA 1RH9A 3JZUA 5CXPA 1NFPA 4IMEA 5G4HC 1JVNA 3NJ3A 1WZMA 2O55A 1F76A 1C90A 3UWVA 4RE0A 2E6YA 3PUDA 3PZTA 4F9DA 1OSEA 2NWRA 2WLYA 3NM1A 1K1DA 3FAXA 1GVYA 1G4TA 1WDWA 2YBUA 3WQDA 2BOGX 3SURA 1H0GA 1B2YA 4Q4OA 4REQA 1R3QA 2ON3A 1SU5A 3TSDA 3KTSA 1FDYA 2DZTA 2D0HA 4ZOBA 2VL4A 1DKWA 4JFWA 4W7VA 4MIMA 5F1UA 4W84A 3K5XA 4HN8A 4DN1A 1KA9F 3ORWA 1DQXA 5U7SA 2POTA 7PTDA 2VM8A 3ERPA 1SM9A 5HMDA 2QCLA 4IIEA 2AKZA 1C9DA 5SWUA 4JNZA 1GEQA 2YB4A 4S3JA 2WKJA 1HTIA 1N8IA 1Q6QA 1XYMA 4PRWA 1H51A 2A85A 1IR1A 3MUXA 3ONCA 4QLJA 3ITLA 3TK7A 3S4TA 4QROA 3TIMA 3SZ8A 3WLNA 2VR5A 3H54A 1D8CA 4S3DA 4B5WA 1IWBA 1QWKA 1RQBA 4KWUA 1F73A 1CZ1A 1K8CA 1J6PA 3H53A 4A3QA 1SJBA 3VIFA 1AW5A 8RUCA 4I7WA 4P61A 4MDOA 1CLXA 3IUHA 3T4CA 3I3DA 1NU5A 1N7KA 3L4TA 2ZUTA 3W3OA 1A53A 4KWWA 2VZTA 4BKNA 3WZ0E 3LSCA 2HRWA 1BQCA 5AC7A 1VYSX 2QYGA 3AXHA 4I9AA 2WWCA 3R12A 1QNPA 2ZA2A 1M3UA 1C7SA 2Q3RA 4WK9A 4XVEA 4YCPA 4TVDA 1BTCA 4F0LA 3RU6A 4HNTA 1FUYA 2F6KA 1B3WA 3LERA 1UQZA 2P88A 3KL3A 1RAKA 4GNKB 1D7KA 5BW6A 1Q6CA 3GR4A 5ABEA 1UWTA 2OGJA 4GX8A 5AKQA 1LOSA 5LIXX 1CXFA 2IPWA 4IPIA 1SFSA 4R85A 3AMKA 4LV9A 4JTQA 1EXPA 4LS2A 2CESA 3L4ZA 2PC4A 2PDLA 1YDNA 4GYPA 4GY1A 2AKMA 3P67A 3R2GA 1S38A 3LQGA 2OJPA 1M6JA 1IR2A 1F8MA 1GG0A 2QCCA 4JFUA 4MG4A 3H2AA 2WZIA 3DYOA 4DWSB 3H7UA 3CPGA 4W8LA 3VE7A 2XVKA 1M68A 1XFBA 4HVXA 2QIIA 4DWDA 1W1B1 4HJWA 4QJ3B 4NSBA 2E1DA 1RXOB 1EWEA 1VGAA 3BANA 4BA0A 1UOKA 1SJAA 5KZ6A 8CGTA 4GKLA 1W3JA 1F3EA 4LBUA 3TSMA 3B8UA 2G3JA 2PP0A 3VKDA 3KAOA 4C6JA 1DWJM 1IE7C 1XS2A 5LIYX 1QK2A 4XZLX 3QN3A 4HKPA 5JH2A 3MCMA 2JF7A 3P5ZA 2WZHA 3S6DA 1IT0A 1H7PA 2PFHA 2CXGA 1DXFA 1W54A 4JN8A 1PCWA 1AH0A 2J8FA 5T9CE 1QNQA 4S38A 3QHMA 4TTGA 2O9OA 4OE7A 1RD5A 1L2UA 4OUEA 2WHJA 2ZUVA 1TPUA 4K7YA 2VFEA 3EOSA 5ABFB 5A6SA 3IVTA 4UOZA 2G95A 3A4WA 2Z6IA 3H2MA 3QZ6A 4HA0A 5D2XA 4TXEA 1MXDA 1GOQA 5HINA 5D03A 2XVNA 1W2VA 5DCEA 1B90A 2QUTA 4FOUA 5LNWA 3P93A 3UYCA 2RKXA 3G24A 4CNSA 4ZZ9A 4FI4A 2O56A 5D2WA 3W38A 3F4VA 3G1YA 2F7FA 1Z69A 4XAPA 5H8UA 1P6CA 3VVGA 5HDRA 1W1VA 3CUXA 4IIHA 3LXAA 4TX6A 1WDDA 2D3LA 1Q66A 4DO5A 4LYKA 1XKJA 2FTPA 3URQA 5D38A 1UKOA 3NPVA 3M0YA 4RDVA 2VEKA 2O9TA 3NQEA 3NQAA 4GGBA 5IBXC 2X42A 2YXXA 1JD7A 1MI3A 2Y61A 3PTQA 2CZFA 2GGEA 1B3YA 1OD8A 3GFXA 4M56A 4LWWA 3KCJA 4AYGA 1F6PA 2DW7A 3KW3A 3PUOA 4RE3A 3AALA 4Q8UA 1EGVA 2ZDSA 3ICJA 2WANA 1PEZA 2P3EA 5HULA 1IT7A 4HZ7A 2D22A 1BVZA 1UR0A 1Z32X 2Q8LA 2PRHA 4U3CA 3BMVA 4JEQA 3W7GA 1Z41A 1EZWA 1N2VA 2GDQA 3PJTA 5I02A 2OEKA 1Q4WA 4DJFC 3ALGA 4J3WA 3GNPA 3O9NA 3GG8A 1VRDA 3LQLA 4PEEA 1NDVA 2A3AA 2XSBA 4O1AA 1TJRA 2ZZ4A 2GUUA 3MO4A 1XYAA 3EWZA 5BNKA 3WCZA 4PYSA 2VKZG 4UTTA 2QCEA 3CNYA 3VIHA 3FEQA 3BH4A 3QSRA 4G7EB 4P8XA 3AICA 1YBQA 3HURA 4ORMA 1UP2A 2FTWA 3B04A 2R8WA 1DYSA 5E5CA 1CDGA 4CQDA 4BI7A 1J4EA 5TD4A 2C16A 4O19A 3U4FA 3AIVA 4LYPA 2XJ7A 4HA4A 3UEQA 3VDBA 3QMRA 1FWGC 3WLLA 2Q8ZA 5EMLA 2BXYA 4LAZA 4C6DA 5DMNA 1R7OA 4HHPA 1JCYA 2OSYA 4OOZA 5H8PA 3RXZA 3MTWA 3HGRA 3VTRA 1EGZA 2DVTA 4GYPC 3GHRA 4YTUA 4LVAA 3CV2A 3FSTA 2WAGA 2FLIA 3BW4A 3KFTA 2SFPA 1EDQA 3CUIA 1C7TA 4EPEC 2VWSA 4QS5A 3W6MA 1X7IA 3RCMA 5BMXA 2QT3A 4S3KA 3W87A 3TJIA 4A2RA 3SN1A 3QLLA 2V82A 3U48A 3EA1A 1VEMA 3GHUA 3UWZA 3PAJA 2P10A 1V3MA 4HYRA 1EQPA 2QCGA 1XUZA 3V3WA 2BXVA 3W1TA 1NP0A 2QCHA 3M7WA 3T4WA 3LXBA 1A5KC 3WN6A 1RBLA 3NG3A 1JCTA 1JDFA 4OFCA 5CSRA 4IIDA 3OBAA 4NU7A 3B9EA 1TPB1 3AHTA 2PDMA 2HBVA 4HTYA 3CEPA 4GD0A 5DCDA 1DWIM 3OU8A 1SMAA 3SCPA 3CV1A 2OMAA 3VOCA 1NELA 6CGTA 1TCDA 3W1RA 5AHFA 2UBPC 3OQEA 1CX9A 2INZA 4L4LA 1ITUA 1EOMA 3AIUA 1EFZA 3I6RA 1H09A 3LK6A 1S5MA 1EL3A 1NF0A 5IHSA 3AFBA 3DKJA 1ITXA 2WB5A 1TV2A 2VWTA 4PTWA 4YLWA 3W2JA 5LNVA 3DFYA 1YTDA 4JY8A 3WYZA 1E4LA 3RR4A 2E5DA 4HHMA 2W63A 1HP4A 2HNHA 3SN4A 4C1NB 2PODA 3N2TA 2ICSA 4ADUA 5EMYA 3VGGA 5F2GA 1F61A 3THAA 3KOZA 4WUIA 1OJXA 4CVUA 3TW6A 3DYMA 1JPMA 1EJTC 1LG1A 4K68A 1JFXA 6TIMA 4INFA 5C9UA 2PC8A 3CLMA 1LLOA 3GNXA 3WJSA 3EGJA 4W89A 3DFTA 1S3TC 1V8EA 1LRTA 3E1F1 2RJHA 5HQLA 2YYTA 3TYDA 2GSJA 4I3GA 3BO9A 4EX4A 4E4UA 4RCXA 1L8NA 2J7BA 1ZAJA 5EB8A 2OWCA 2CEQA 3NZ1A 5FIPA 4TOQA 3T1GA 1X6UA 4N02A 1GK8A 3VCNA 1SR9A 3TDFA 3CPRA 2CLOA 3LBCA 1KCXA 2X7WA 2PP1A 5FEZA 4JTDA 2JKEA 3W23A 1TJ2A 3N29A 3WQOA 1TWZA 3UWUA 2P8BA 3CWHA 1Y0EA 4B9YA 1RQHA 6A3HA 4XZWA 3DN5A 1Q6DA 3M0IA 5FAGA 3MUAA 1AZ2A 4HYVA 3R8GA 3EDFA 3UVAA 1AW1A 2Y88A 3ARVA 3LU2A 3S47A 4UQBA 5I7GA 1KM0A 4U31A 3KBJA 4DI9A 3MDUA 3LG3A 3OHMB 4EIVA 1MO0A 1SZEA 2J7GA 1CGXA 3BW2A 2GVGA 4Q7NA 2BSLA 1IF2A 3VDGA 4GQ0A 2D24A 3PBWA 4NASA 3PUEA 4RZ4A 4WOQA 2DIKA 3W1UA 1O7AA 3GO2A 4AWEA 3GVVA 1HL2A 1OINA 2X7VA 3VFCA 1MXGA 2DT0A 5K2ZA 3DC8A 4YTRA 4UNIA 2WMHA 4WVXA 4B2DA 5DEZA 1E6XM 1K70A 3GH5A 4US5D 4EXQA 3PWGA 1M03A 4XIAA 4WDUA 3MUY1 3NQVA 2ZOXA 4J4KA 1XKYA 3W24A 3CB8A 3BC9A 3TX9A 3LY0A 4TR9A 4O4WA 2BTMA 3EX6A 1EBHA 5DMYA 4E0CA 4E4PA 5CAHA 4UR9A 4FOKA 4F0RA 4DM1A 4PA8A 5C2XA 3B9OA 1Y7VA 4L9YA 5AN7A 4Z1AA 4DF1A 4GNVA 5H1WA 3UZYA 1KC7A 1FCUA 4F66A 5D04C 3Q65A 1XWYA 4MWAC 2Z2AA 2V3GA 2G97A 5DRCA 5HQEA 4XBJA 2O9RA 4RDYA 2BP1A 4PR4A 3NUKA 2DU2A 4WZHA 3TJLA 2VTFA 1XG4A 3ABSA 4DHGA 4M1BA 4UMAA 3TLLA 1GVEA 4B9ZA 1TR1A 3KVMA 4PFHA 3W2NA 2OKOA 2J25A 3BCJA 1EOKA 1NWTA 3H2CA 3T0AA 1FDZA 1SFLA 3V0SA 2ZTKA 2O9PA 4Q8MA 6ALDA 4EPDC 2XWDA 3W1QA 3OW1A 4K38A 4LVBA 1OGSA 2QW5A 5DY3A 2WVUA 4LH8A 1A5OC 2QVNA 3U5UA 3F4DA 4AWUA 4RR4A 4NX0A 3B8IA 4AC7C 1B0IA 3FYYA 3VNZA 1QK0A 4NZFA 5C54A 1GTHA 3E5BA 5H6HA 1ZS2A 3M0KA 3M0VA 4L1GA 3QQ1A 3QBUA 3VGDA 1R2SA 2FZMA 2YL5A 3VYLA 2ACSA 2GVEA 3I4KA 2PAJA 2GJNA 3L4YA 4R27A 1LBLA 1ZLPA 4IJCA 1G1YA 4FSAA 1IIGA 3CWOX 3TQPA 3EB4A 3LD5A 3HPAA 1TMQA 4MKNA 3BLDA 4DYEA 4E8DA 1ZJHA 1W91A 1P1XA 2XH7A 2R9RA 1MW3A 4US6A 2WLZA 4MADA 3SJNA 1UR3M 2CLFA 4JICA 4OECA 3VUSA 3WLHA 4DUOA 3TYUA 3GQYA 3CZKA 3W7NA 1DVJA 4FX7A 1JRCA 5HWMA 3N18A 3ENLA 3DDMA 3G1SA 2EJ1A 4D6EA 1WV2A 5C7HA 2DEPA 5D2TA 2YDSA 1UPPA 7REQA 4KW2A 3IK2A 1QI2A 3WNMA 4OTKA 3EPOA 5D9NA 2C91A 3V4BA 3AMDA 3W76A 1PPIA 4WY0F 3PNUA 1HKWA 2EG7A 3CB3A 3OIHA 4JKKA 3WLSA 3SCNA 3T42A 1DJYA 3EMQA 3W1XA 4EKJA 1UKQA 3VNYA 3VD5A 1A0DA 1ONRA 3LMZA 3DG6A 4NY2A 1I2QA 1I2OA 2PDXA 2D2JA 1F4AA 4E3VA 1XSJA 2WNNA 2X30A 3MMUA 3R8RA 1K3UA 2X8RA 4S3BA 5C55A 2EPOA 4H19A 1L9WA 1Q7ZA 2TODA 2D2GA 4YMZA 4BF5A 3N34A 2X2GA 4JHZA 5T91A 2CKRA 4G9PA 2G3NA 1MXSA 1AFSA 1M7JA 3K8LA 1UH2A 2ZX5A 4O1BA 1R5YA 4KGLA 1PDZA 3TTOA 1ZJIA 2A6LA 3N6HA 4H6KA 3BLOA 1E73M 1YPXA 2YLLA 2B7QA 5C70A 1A5MC 3CZGA 3SSJA 1TJPA 3HG3A 1POJA 4EK7A 1XLAA 3K4DA 2VR2A 1ZPTA 3LM7A 4Z17A 1J01A 4HHLA 4M7TA 2ZFAA 2FJKA 5T9BG 3M5XA 5G4WA 2I14A 2W66A 2OTDA 5M5DA 3GDRA 4XISA 1EQCA 1G9HA 3GXIA 2JKAA 6ENLA 4NF7A 4FA3A 1BWLA 3BLEA 3RRAA 5IDZA 1HJXA 4GUGA 2QJNA 2YCJA 3RLHA 3M6DA 4A2SA 1EH9A 4PBGA 3WIJA 2HCVA 3A23A 3PWAA 4LAOA 3MBDA 3P6LA 1QPKA 2DV0A 1GJUA 3KRBA 3P3BA 3C2FA 5FD0A 2YR1A 5IFTA 1G4SA 4O16A 3W29A 4KEZA 4DAFA 5K9CA 3V1PA 4HYWA 4S3EA 2WPGA 2PGEA 2XN0A 1L8PA 2ZBTA 1SMDA 4QISA 4EXBA 4QIUA 1CXHA 2OEJA 1XIHA 1R0MA 2HE8A 1CWYA 3WH5A 2TMDA 3T2PA 1R3YA 3G3DA 3W7IA 3PPHA 3NYDA 4O15A 4PEKA 2INFA 3ITOA 9XIMA 5FSEC 4Y9AA 2H90A 2GGJA 3QYSA 2OOGA 2ABBA 3ANVA 5F4XA 2JEPA 4DJFA 3WF1A 4MNKA 4QXIA 3NL6A 4M1RA 2FZDA 1JDAA 5AYIA 2WMJA 5FJPA 4D2JA 3ONBA 1Y65A 3XINA 3W7QA 5DRIA 3UPWA 4ZL1A 3KL5A 4E5TA 4DRSA 3D6NA 1TFVA 1LG2A 4AFYA 1UJQA 4JBRA 1UBSA 1CGVA 4J3UA 4C91A 4J27A 5GJMA 4B5TA 1KBKA 3B0YA 4C6CA 2PLMA 3IJ6A 1PZ2A 4CCEA 4IQLA 2Y7DA 3AS1A 4IL2A 2F38A 1QNVA 2D73A 5EL1A 1K9EA 1JI1A 3G8EA 4N9DA 2WHKA 3AHYA 1WX0A 3N2XA 3NL3A 1C8VA 1W1TA 4RZ5A 1DIKA 1L6YA 4GXMA 5ABTA 3A22A 4RPPA 4DZ5A 4JHOA 5E09A 3W71A 4V33A 2E9LA 2WK2A 4YTQA 1W1ZA 3SUVA 2QJHA 4LF1A 2V0TA 1GOOA 5G1MA 2PRMA 4G6CA 2PA6A 5C71A 1ISVA 4NJIA 4IQDA 1C8XA 2J24A 1ZAHA 2OX4A 4F2BA 2D3NA 1OC7A 2XZ7A 4HQVA 3VZZA 4AC1X 3UNDA 2CHRA 3FXYA 1PZ3A 3B9AA 1KXVA 1MW2A 3C5QA 1JQXA 2VC9A 1EYEA 3CTLA 4HPJA 2J75A 4ACZA 5FL1A 3PFMA 4PMQA 5BXTA 2IXVA 2O4MA 3BK0A 4ZQRA 1XGDA 2BB0A 3D3AA 2ZXAA 3S2CA 2NWSA 2VJXA 1PIIA 1ZZMA 5A2BA 3CQIA 2FVMA 3TYBA 1IZCA 5A2AA 2PF0A 3KXQA 3P61A 2PCEA 2QAFA 3QOKA 2VGBA 1RCXB 2XUCA 3OLDA 3O8AA 1L6FA 4S3FA 4OBSA 4C7GA 4KF1A 2VENA 1XFCA 3ZJ7A 4MLRA 4RE4A 3VU2A 1KB3A 3KE0A 4AVOA 1NSJA 4FXRA 2CWNA 3OGSA 1MEWA 1G4EA 1Y5VA 4GX9A 2QDDA 4IFKA 2VEIA 2PDKA 3UD6A 5A6BA 3DGRA 1NOWA 5HNTA 4GIAA 4IL0A 3KTCA 1JUBA 3L4WA 1UB3A 1UUMA 3LBMA 3SUSA 3NQGA 3SECA 2C13A 3GNRA 3WLIA 1W3NA 1VH7A 4B91A 1YTKA 3PR2A 2YFNA 3O16A 4FNUA 3TA6A 1QI0A 4CQ8A 2BASA 4NVTA 1V6WA 4LXFA 2WBGA 2HS6A 3FHQA 1KQYA 2NX1A 3OHIA 3CUFA 3SRDA 1QI3A 3NEVA 2ZTJA 1PO9A 2FZ8A 3JZEA 4LUSA 1TUXA 1GVIA 4G2DA 3SIMA 1TIMA 3AJ7A 1R9XA 1THFD 1E5JA 3OA5A 1RBOB 4CQBA 3CUHA 3KX6A 3B0XA 2WZEA 3SDOA 4Q4PA 2QQ6A 1TQJA 5EBUA 4KEUA 3UWEA 3OQ8A 5DANA 4Z0SA 1T0OA 4UXDA 1H3GA 4A8IA 1XYLA 4JTIA 3OIXA 3CHFA 3CQ0A 1VPYA 4GWEA 1HNYA 2OO0A 4QX4A 4AVNA 4TO8A 2ZUNA 3E96A 1VJIA 4YIWA 1HP5A 4I5UA 4XTIA 1OABA 2E6DA 1HKMA 1I4NA 4DXVA 3AQUA 1GHSA 1XIFA 1OHLA 4OU1A 4C6IA 3BXWA 1U1JA 4FLQA 4EVZA 3G6LA 4JX4A 4TU1A 1XYBA 1XUUA 5E9XA 3NXLA 4U2YA 2ZCGA 4NZ4A 3DFSA 1XBYA 2ONEA 2UY5A 4UTLA 1CXLA 4B3LA 2WNZA 1DWGM 4KMQA 4Y6GA 3TONA 1V7YA 1XYCA 2ATSA 3S5NA 3DHPA 2ZZ6A 3ITVA 5FEPA 5I3IA 4IX0A 2FVKA 1JZ5A 3EMZA 1EJ7L 4QEEA 4UMBA 1JFHA 3UJ2A 3WUEA 2NUWA 4YNGA 4JCMA 1A5UA 5AHEA 4B3KA 2XINA 4UFMA 1GW9A 3CYJA 1EWDA 3KP0A 2FHBA 3GDLA 4BQ4A 4I5XA 4WY0A 2W67A 2CZVA 3AHXA 1J0JA 4R33A 4YVPA 3ZR6A 5BU9A 4LRSA 1J11A 2OGYA 4W4QA 2Z00A 4NX5A 4Y9NA 2V3DA 3VOJA 2CYGA 4MLJA 1F3WA 2DIJA 3MUIA 3CJPA 4HPNA 4Q8QA 4BZYA 1AMKA 3N15A 1L6SA 3LTSA 3Q67A 2CU0A 5I3KA 4NI8A 2Y6ZA 3AWOA 3E2VA 3WF3A 4GKTA 1AMYA 1QNOA 6REQA 2CFFA 2IW0A 1QWGA 3GFZA 4NZ3A 4L64A 5C5YA 1GVQA 4MF4A 2V69A 3Q37A 7XIMA 4O10A 2TSYA 1ESWA 3UXLA 1FCBA 4A8NA 3WQEA 3VA8A 1E6NA 4ZBCA 5A94A 3BGGA 1Z8AA 4Z1YA 5JMUA 1IYXA 3HPXA 3W81A 4IIBA 1PX3A 2V3FA 4UTHA 4AIEA 1WO2A 1WDSA 1RP9A 2XIMA 2I56A 2CCRA 4ZR8A 1JG9A 2R94A 4CNTA 4CD8A 3H23A 1EC9A 2C1GA 2ZUUA 4UFIA 3GVWA 2BS9A 4HNLA 4WEVX 3THDA 1OEPA 1BGGA 3ITTA 4LC6A 4AWSA 3QMSA 1NM9A 3W7PA 3PTDA 3PBVA 2VNCA 2WO5A 3CAWA 3L4VA 2QPSA 1S2WA 1W9VA 4NRSA 1S5WA 4JTSA 1KXQA 1G5AA 3N2CA 4XSLA 3G1RA 1SJDA 3TLQA 1J5SA 1O1ZA 2ZX8A 1UH3A 2BY3A 4B16A 1VFMA 2XVPA 2XFWA 3WK0A 4W7WA 4AEOA 1XIJA 2DDXA 3N4AA 1W5NA 3UWYA 3TUUA 4U3AA 3AS3A 1A80A 3WDHA 3RCNA 2CBIA 5A6MA 4XBSA 1ECQA 2QDGA 1FVPA 2J79A 4GBDA 5CJ5A 1VFTA 2NX9A 3MMTA 1ZBWA 4CD5A 1J12A 3IJDA 2YXGA 2J78A 4M7SA 1O12A 4Q4RA 2ACUA 2GUYA 1LWHA 4A3RA 4R34A 1V5XA 3EA2A 3ZXWA 1VEOA 2E9BA 2V67A 3CHDA 3GK0A 4NJKA 3N4EA 4CEXC 3A9IA 2E7FA 1TRDA 1UWUA 3M1ZA 4DZIA 1F3TA 5IHRA 1CW2A 1GZ1A 1EIBA 3TKFA 1HW6A 5DFAA 3WD4A 3FN9A 3BAJA 1FDJA 2YL9A 1R86A 3M0ZA 1XD0A 3MCNA 3V7PA 3VILA 4O53A 1QRQA 3PS7A 1KRAC 3AO0A 4YYCA 3W72A 3CK5A 1MW1A 4JYFA 3CMJA 2MNRA 5EMUA 3B9NA 1UKSA 2CLLA 2XU2A 4H7CA 3U3HA 1LLZA 3W1LA 3QMTA 2ZZ3A 4K3ZA 4ORIA 2INEA 2WJZA 2ZZ7A 5I03A 2D2OA 1OX4A 1R2TA 4J1OA 1XC4A 3KOXA 4JTGA 3NO5A 4GIRA 2C18A 1CLVA 4HU3A 4R7JA 5AHNA 1FP8A 1GGOA 5HWNA 5C2CA 2OYKA 3SFWA 1YXCA 2VVSA 3RM8A 4AZ7A 4IMFA 5AYZA 3HN3A 5H91A 4JN7A 4DNMA 1W9DM 3OYXA 3FXGA 4XZNX 1U33A 4I9MA 2OT1A 2QPUA 3POCA 5KMYA 3OLEA 5BROA 4IMCA 3TAKA 3M5YA 4A6GA 1XLCA 3GAYA 4GXPA 3NGJA 3B8WA 2I5QA 4G7FA 1RY0A 4W7UA 3AXIA 2JFEX 4N9EA 3RNDA 3VNMA 1KKOA 5JIPA 3MA8A 1OK4A 1TTJA 3Q94A 3H8AA 5A95A 4DYJA 5CZKA 4AEFA 1GOMA 4Z2HA 3GBDA 4H8VA 1YBQB 4L9XA 4LTSA 2Y63A 2LLEA 4H2CA 3VOIA 3RILA 2NLIA 3I7RA 2W27A 1KWKA 1WQ5A 3M4HA 3UCQA 4C65A 3SCTA 2XIQA 4HD5A 4LEQA 3W22A 4DO7A 5BOEA 2RUSA 4WJEA 1J96A 2Z1VA 1EJWC 1BRLB 3ARPA 3U8GA 4ML4A 2C15A 3AHZA 2YB1A 1I2PA 3DG3A 1E70M 3IUIA 1TPVA 3CV6A 2ZRUA 5LNRA 2PP3A 5D4YA 4O0ZA 3H6OA 3GNOA 2QJIA 3S5SA 3M0JA 3MP3A 2YDQA 4PODA 3WD2A 3F03K 3KZPA 1K9FA 4WRHA 3F2DA 2PDQA 1QFEA 4US5A 3LHUA 1IEQA 1RA5A 1BKSA 4MGGA 1KO0A 4DQWA 4M8UA 5KITA 1MQPA 4AX6A 1ISZA 4H7ZA 1A0CA 4O1DA 4GZIA 2HK1A 2V5JA 4LY4A 3M5VA 1WXZA 3VX0A 1K7EA 4HPXA 4Y8EA 3XIMA 3KVKA 3LRLA 3N73A 1SFJA 4GLEA 2WMIA 1X6NA 2IXUA 4EWJA 4JIEA 5DT5A 2DUZA 3VIMA 4U33A 3FIGA 1ITCA 1W0MA 2VD9A 1H5YA 3VI2A 4WGHA 4P7LA 3T2OA 4GQQA 4PTXA 4O4VA 1LWJA 4H6QA 4IM4A 1WBJA 3PN8A 3UY7A 7CGTA 1W9UA 3NDYA 2Z26A 3ZWSA 2V2CA 1SO3A 2FVLA 1IZKA 4QAIA 3ABQA 2I5GA 3VDHA 3WLJA 3IIPA 3IJ8A 1LTDA 4JNMA 4NXSA 4O1FA 1XPYA 2QUMA 5LZLA 3MP4A 1Y8BA 4W9TA 3HFTA 3QY7A 4PBEA 4DWSD 3T07A 1P0NA 1BGAA 3QPYA 1VENA 3S0CA 4HK5A 1SQ7A 1QVBA 3UG8A 3WK2A 3UA4A 1BG9A 4EWND 2QPXA 4I9JA 3UU0A 4GY0A 5BCAA 3IRDA 5BRBA 4RXGA 3L4XA 4PSPA 4U4MA 3ARWA 4M6PA 3P80A 2I16A 1J0HA 1AJ0A 1O60A 1M7PA 4C6LA 4U2ZA 1IWAA 1E72M 3RUBL 3WNOA 1JZ3A 3ALFA 1XGZA 2TRSA 3RM4A 1FY6A 1O4UA 2PTYA 3URAA 3RCYA 1CGTA 1KTNA 1O5RA 2FIQA 4HP5A 1C91A 1J6OA 4JTAA 3WFZA 2OPJA 3GU2A 2W61A 5EYWA 2ZUSA 5HK4A 2BGQA 4GVHA 3QW4B 3UXIA 3PANA 5CJMA 1XH0A 3UY8A 3ABRA 1KBBA 1SZNA 4GYKA 5C9WA 1CGYA 4EXAA 5AYXA 3AOFA 4Y96A 4N9CA 3VD4A 3VMPA 5LA2A 3TYAA 1OD0A 1PHQA 3CIWA 4LPCA 2XDFA 3T44A 2F61A 4KFPA 4ZCWA 1YEYA 4J9JA 1MW0A 2R91A 4H6RA 1DORA 3H4XA 1WOBA 1W8SA 1FWIC 2PDWA 3ZVIA 1H7WA 3NA8A 1MEHA 2C7FA 1SO6A 4OHQA 4KCTA 3PVFA 2JIEA 1H7RA 5I23A 4MNMA 1GKRA 3FKKA 1W3LA 3S1GA 6PTDA 4XZIA 1ZCOA 3R0DA 3ELFA 4V15A 4EPBC 4C6OA 2YYUA 4WDWA 4EAMA 1VHNA 3PTKA 4KWOA 2Y2WA 3TAOA 3FKRA 3T05A 1S5VA 4FHAA 5GQBA 3RX3A 5D30A 2JIWA 1S2UA 2GJXA 5CC6A 1A5CA 4C6NA 1OGBA 2DZUA 1DQUA 2MANA 3L68A 1ZHAA 3OLGA 3MI2A 2J74A 2WSKA 2XVGA 2YSWA 3SCWA 2X1RA 4W5UA 3CL8A 2XVLA 4FF5A 3Q58A 1OC6A 3UR5A 1JF5A 4PUNA 5HPCA 2ZRZA 4AVFA 4ZB5A 2G5WA 4BWLC 1P7TA 3WUFA 4C6PA 4PCTA 4GGHA 1OADA 3CU2A 4U10A 2WYSA 3WDRA 3EDJA 4QAWA 1ELSA 1E1FA 3DU0A 1JF6A 3MJMA 4F2UA 1E6SM 1E4MM 4PMVA 3I6EA 4J3SA 4JL2A 4D6JA 2PLJA 1EA0A 4RW5A 4A4AA 4MKSA 3AIQA 3LS9A 4HOZA 2VO5A 1I9CB 3BDKA 1OG6A 4IMAA 4KERA 1H2JA 5EBAA 1MDRA 1P0BA 4IX2A 1E3ZA 1WDPA 4P2VA 1CXKA 3R25A 1UD8A 4CNPA 3W7HA 2QNEA 3OB8A 3T8QA 3BV7A 1GVSA 3BCFA 4S2BA 1LL7A 1UH4A 4LS0A 4JKLA 1UA3A 3O6CA 5TNVA 4ZSUA 2FMNA 5HAOA 3VKBA 3KZSA 9XIAA 4WDXA 3EX1A 4PMZA 3RLGA 4FK9A 9RUBA 2VRJA 2RHGA 5JUVA 5LYRA 2I57A 1XH2A 3W7LA 2P0OA 1A3WA 3SCOA 4HJFA 2VC7A 1P48A 3B8TA 2FKPA 1ZNNA 3ZOAA 3BZGA 5CC7A 1NY1A 3JU2A 3WD0A 1GPFA 2ZRWA 4DPQA 3CHEA 4KRZA 5LIUX 5IXEA 1OFBA 1T41A 3VIOA 4Q6JA 2Y0FA 5K4XA 1TE6A 3R1ZA 4CCZA 1KFCA 2CZDA 4GZ7A 2A3BA 3P8JA 4LB3A 1G01A 1XICA 3BSMA 3PZUA 1E15A 1RZMA 4D8AA 5AC5A 4V2XA 5BXPA 3BAYA 3GC2A 3O1NA 3PBYA 2NSOA 3LHVA 4YWIA 2DPEA 4BY3A 1S5NA 1JUEA 4F4RA 4H3DA 2NQZA 1XGEA 5F1VA 1T7LA 4AY8A 1VCFA 3TYEA 1UPMB 4Q8PA 1JZ6A 2VRKA 7REQB 2Z1SA 3T81A 2QZRA 4P8UA 3VNKA 5D09A 3QC3A 3L65A 3G1FA 8A3HA 2DY3A 2WSYA 3S6TA 5EFFA 3MBFA 3D5HA 1BD0A 1PKLA 2WSPA 1V08A 1ECEA 1E0TA 2YKKA 4KFOA 1IXQA 2PDHA 2NV2A 3LHTA 3UF9A 4DB7A 1DJQA 5MF5A 1GYLA 2VVNA 1KCZA 4HK6A 1NJJA 2W4XA 3IVSA 1AG1O 3NL2A 2DH2A 4AIOA 2XIOA 4IMGA 4XAYA 1UKPA 3KRZA 3DHFA 4Q32A 4D6CA 3W83A 5A6AA