3PY3A

Crystal structure of phosphorylated p38alpha map kinase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
357
structure length
355
Chain Sequence
GSHMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mitogen-activated Protein Kinase (MAPK) Phosphatase 3-mediated Cross-talk between MAPKs ERK2 and p38{alpha}.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 112
structure length 355
sequence length 357
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3py3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3py3A01
3R73A 4IVAA 3MFTA 5JMSA 3VS7A 1YOJA 2HXQA 2BAQA 4X2GA 1JLUE 3LXKA 4GT4A 4IW0A 3C4WA 3LM5A 1TKIA 3PE2A 3QYWA 5JQ5A 4UXLA 5BUEA 3O7LD 3P7CA 1NW1A 3UO5A 3Q96A 4FC0A 4FTLA 4YTFA 3NCZA 4G31A 2PE1A 3BE2A 4GL9A 4U45A 4AU8A 3PVBA 4E4XA 3QTZA 2YDIA 3NVKI 2ERKA 3OD6X 4BI0A 3NZ0A 3GCVA 3F82A 4D2SA 4DTAA 4EYMA 2QG5A 4JIKA 2BTRA 4ERKA 5EOLA 4EL9A 3CEKA 2JDRA 3HEGA 1U46A 3PJ2A 4IZAA 5A6OA 2AC5A 3PZEA 2G2HA 4V04A 3DLSA 1K2PA 3T8OA 1M7QA 2XEYA 2CLXA 4G3EA 2IVUA 5HBJA 3CD8A 3VF8A 2XCHA 4L3LA 1CSNA 2YN8A 3ZSGA 2V5QA 4DINA 5A4QA 4CG9A 2YISA 3UDBA 1G3NA 3OMVA 3PVWA 3ENMA 3QGYA 2O65A 4FG7A 4FV3A 4U3YA 4IB0A 4QMOA 2PVNA 4XP0A 1BKXA 3UOLA 1H26A 3R7VA 4JR3A 1WBNA 4FNXA 4MKCA 4Y8DA 3Q4UA 5IQCA 3HV4A 4QMMA 3UPZA 4K6ZA 4WA9A 1H27A 4JJRA 2W0JA 3RVGA 3UIBA 1KOAA 2PWLA 4FYOA 4IAKA 4W4VA 3QC9A 4BKYA 1H1SA 3KKVA 3ULZA 1YHSA 4M13A 4M12A 1KE7A 4QYGA 4ZSEA 3VBXA 5ANOA 2XMYA 4PPBA 3P9JA 5IF1A 3E7OA 4GT3A 2YHVA 3AXWA 3R2YA 3D9VA 4EOLA 2X7OA 4TT7A 4F1OA 2E9VA 3PPZA 5FP5A 1J1CA 3QXPA 3ORMA 2DWBA 1RQQA 5IG1A 5H9BA 3ZSIA 2PVMA 2GS7A 5FTOA 1HCKA 4MVFA 2IVTA 4JQ8A 5E8SA 3CGOA 5C01A 5M55A 4LMUA 4ZLOA 4DFBA 1MQ4A 3MTFA 3VO3A 5D9HA 1PKGA 1YXUA 5EKNA 1Q62A 3QFVA 5AM7A 3V5TA 2WMUA 3E3PA 2YLEA 1QPEA 3MB6A 3QTQA 2W5BA 4ZS0A 4BYIA 4FSYA 3FI2A 3QCYA 5EM5A 4OTPA 5FEDA 5D7VA 2YIYA 2R3MA 4XG2A 4FK3A 3ZRMA 2DS1A 5HVYA 3AMBA 1E1XA 4HNFA 3RP9A 4YC3A 2ITPA 2IZSA 2XNNA 3OY3A 4G6OA 4DTBA 1H4LA 1XH4A 2P2HA 4BGQA 4FKIA 3QTSA 1YKRA 4QP7A 4FL3A 5ANGA 1XWSA 4C35A 5LARA 4Y5HA 4CFNA 1LR4A 4MBLA 1MRVA 4GH2A 1MP8A 4TW9A 4OAVB 4AZWA 5J5TA 1V0OA 2WEVA 2XBAA 4FIGA 2I7QA 1V0BA 3OEZA 3RPOA 4PL3A 2ZDTA 3C4FA 4EH7A 4YJSA 3RNIA 3PIXA 4E4LA 3QTRA 3OS3A 4XG3A 3NLBA 5HG8A 3GGFA 1PXKA 4O27B 1JWHA 2F2CB 2QLQA 4BIBA 4N6YA 1JOWB 3NUPA 5TE0A 1ZAOA 2HELA 5I5ZA 4DCAA 3ZU7A 3DAEA 4PDPA 4FSNA 1AGWA 4F64A 3R7OA 4EYJA 5CANA 5IEXA 3DJ7A 1NVRA 3QTXA 4U8ZA 1YQJA 4U40A 4Y5QA 4F7NA 2VWUA 4N6ZA 4O0RA 4WKQA 3QGWA 4EHEA 2VO3A 4P5QA 5AP3A 3ROYA 5HVJA 4YJNA 2R3RA 4MXOA 3TZ7A 4CVAA 4D28A 2XK7A 3W2RA 4G3GA 3DQWA 3ZBFA 2UZBA 4FOCA 4O22A 4P90A 3GCPA 3UQGA 5A9UA 4IDTA 1OL1A 4F09A 2BRMA 2XP2A 3I7BA 3DKCA 3QD0A 4NCTA 2PZ5A 2YERA 5CF5A 4TNDA 3L8PA 5HLWA 4XG9A 4FNZA 4C37A 1YW2A 4YZBA 4D4YA 1OIQA 2R2PA 3HV5A 3IS5A 5EDRA 4ASZA 4GYGA 4K8AA 4C4IA 1JKSA 2PVJA 3NR9A 3OOMA 4NK9A 2Z7RA 3QRKA 3WZUA 3U6IA 3KRLA 4R3PA 4KIKB 5A6NA 1L3RE 3PPJA 4GVAA 3R7UA 4B99A 3OHTA 4FTQA 4BCFA 5BVDA 4KINA 4UYAA 1OGUA 4HOKA 1XH9A 5EW3A 3KRJA 3WIGA 3VIDA 5AA8A 2NPQA 3KXXA 2JFMA 4RG0A 3TJDA 3FZOA 3DJ5A 2VTAA 3UJGA 4ZZMA 4AA0A 3F66A 1OPLA 3V6RA 2RL5A 3QZHA 5K4JA 1KOBA 1UWJA 4RJ8A 2HY0A 3D7TA 3FKNA 3MGYA 1YOMA 2UZDA 3OEFX 2WMVA 3ZUUA 2R0UA 3PP0A 5DNRA 2WMXA 3WBLA 4D5KA 4MK0A 4RIWA 4RFYA 3TEIA 5E8WA 5H2UA 3QX2A 4QYEA 3DV3A 1YDSE 4TZRA 2ZV2A 4QD6A 4C8BA 3SG8A 3R9OA 1GOLA 1Q8UA 4XOZA 1PMVA 4FIJA 4WNPA 3U4UA 4ZSGA 3RM7A 3LFNA 4AGWA 2QOIA 3NYNA 3UVPA 2EXMA 1H8FA 4EBWA 4O7LA 3HP5A 1OKZA 2XJ0A 4JX3A 3TNIA 2ITNA 3ORXA 4W9XA 4NKSA 5C8KA 3HAVA 2H8HA 1OL2A 3MH3A 5KZ0A 3RAHA 1UKIA 3GCSA 4UWBA 2W99B 3L9NA 2WPAA 3BE9A 4CSVA 3Q2JA 2JLDA 2WQBA 4IFGA 4MXXA 4GK3A 2VO6A 2JBOA 3BBWA 4R3CA 5AADA 2EXCX 5KHXA 4TRLA 2FSTX 2PVRA 2C5OA 3AQVA 4QYHA 3IW4A 3HDNA 4E8AA 4F7JA 3BZ3A 4N70A 4V0GB 3RNYA 3UG2A 2JGZA 3FPQA 1OUYA 1M7NA 4IQ6A 3DZOA 4EUUA 4A4LA 3BRBA 3BLHA 2F7ZE 4MWIA 2LGCA 5CVHA 4YTCA 4ASDA 4BN1A 3QLFA 2I6LA 5HOAA 2RKUA 2YZLA 2ITUA 5I9UA 1FVRA 4RVTA 3ODZX 3ORIA 3SDJA 5IQDA 1H24A 4J98A 3Q3BA 4UY9A 2BILB 2WMAA 5JFSA 5DA3A 4C4FA 4F99A 1Q8TA 1ZLTA 3H9RA 5M4CA 2Y9QA 3SAYA 1A48A 1YDTE 3NAXA 3NWWA 2VWIA 4WSQA 4I1ZA 1OL5A 4RIXB 3RMFA 1QCFA 4XG4A 2QR7A 3A2CA 4LGHA 3F3ZA 1REJA 3O51A 5EM8A 5J95A 5IA5A 4QYFA 2J5FA 4FKTA 3RPVA 3A99A 4I94A 4EOKA 3NMUF 1FOTA 3GP0A 4GFGA 3PUPA 2ITOA 5F94A 2UVZA 4AXAA 4I5HA 1UNGA 1U4DA 5DEWA 5HTBA 3IPHA 3Q60A 1P5EA 2QOBA 1VJYA 4MBJA 4BTKA 1XR1A 2REIA 4Z7GA 4BR3A 2CMWA 4L3JA 1H1RA 3O2MA 3IDPA 4JDKA 3O7LB 4YHFA 2R3QA 5CYIA 3IK3A 3ZLWA 3ZMMA 3FXWA 2X8DA 4X2KA 4TL0A 4R8QA 3NSZA 5CSHA 3P08A 3K3IA 2GHMA 2YIWA 4RT7A 2G2IA 4HZSA 3FPMA 4UEUA 4ZMFA 2GS6A 1UVRA 1Q24A 1R0PA 3G6HA 5A54A 1XJDA 3HECA 2HENA 2OZOA 3O23A 4L43A 1UWHA 3EL7A 4RZVA 4Z9LA 3DZQA 2C1AA 3TG1A 3FZRA 3DKGA 2B9IA 3Q6WA 4AZSA 4M66A 5ETCA 3TUCA 5KO1A 4CFFA 3D83A 5FGKA 1FQ1B 4NM7A 2BROA 1YXXA 1Q3WA 2BZIB 2E9OA 3UYTA 5KBQA 5J1VA 4FKRA 4IB3A 4LG4A 4X2NA 4YPSA 4BI1A 3UNJA 3CSVA 2OJIA 5L6OA 4UV0A 2JEDA 5HU3A 4GW8A 3H10A 3UIMA 4CKIA 5HO7A 3LOKA 2WIHA 1PXNA 3OCBA 3PXZA 4LV8A 5BQ0A 3CY2A 3OT3A 4AZFA 3FQSA 1YWNA 3ODYX 3QQFA 2VWXA 3U6JA 3LXNA 4L01A 1VZOA 4D1ZA 3C0HA 5JFWA 5BYZA 4QRCA 4L68A 5AJQA 2PYWA 4D55A 3OXIA 5IA3A 3CBLA 3VC4A 3QYZA 5CSWA 2WTKB 3HV7A 1XHAA 2VTIA 4GSBA 4MQ2A 5AAGA 1JQHA 4YBJA 2O0UA 3QRIA 4TY1A 3BQRA 4F63A 3P79A 4MXCA 3AG9A 1KE9A 3AMYA 3UE4A 4C4HA 4Z16A 2YJRA 3MDYA 4HYSA 4PDYA 3CQWA 3UOHA 3VBVA 2BIYA 5EKOA 3HX4A 3I5ZA 5HZNA 3RCJA 1PHKA 2WMQA 2W1IA 5JZNA 3KMUA 5CEIA 3G90X 4XV2A 5AP7A 4EKKA 2BFXA 2PMOX 3DBEA 2H96A 3TN8A 4IH8A 2XM9A 3KRWA 5GINE 3ZDIA 3LMGA 3GCQA 2CSNA 3GC0A 2CJMA 1IA8A 3FI3A 4B9DA 5KNJA 4O7NA 1CTPE 2FO0A 2W4OA 5JGDA 1JVPP 2H6DA 5AV0A 4DGNA 3RK7A 3RK5A 1GJOA 2Y0AA 1LPUA 4I0SA 4JVGA 4CT1A 5IPJA 2WTKC 4H1JA 3T3VA 3RHXA 4IANA 4RWIA 4EZ5A 5C26A 3VF9A 2QR8A 4NTTA 4PTCA 4FTOA 3QQKA 3F3UA 3QCXA 5BPYA 3F5XA 4U9AA 3ZLSA 3E8EA 3FBVA 3OZ6A 5ETFA 2X8EA 2YDJA 4J96A 4R7HA 4EQUA 5BVOA 1UA2A 5CQUA 2FUMA 3Q4TA 4AN3A 4RIXA 2BHHA 3GOPA 5F95A 3C51A 5BVNA 5ACKA 2WTVA 3LFEA 2ZV9A 5HICA 5FM2A 2C3KA 2PVKA 1JSTA 2B9HA 3R9NA 1K9AA 3OP5A 4M67A 5BMMA 4BHNA 4RIYB 2G01A 4N57A 2J0MB 4GCJA 3WZDA 5E4HA 3QF9A 3SXSA 4ZY4A 4GIIA 4B4LA 4EZ3A 3F9NA 5M09A 3E93A 4O7YA 5CI7A 5BUJA 3DNEA 4AW1A 3IW6A 5GHVA 3RGFA 4L42A 4DAWA 2YWVA 4U0IA 1ERKA 2BR1A 4BICA 2PULA 1TQPA 3VBQA 4B8MA 3KF4A 4ID7A 2R7IA 3OC1A 3BV2A 5CVFA 2WTJA 1X8BA 4R77A 3JS2A 1GZ8A 2XK3A 4DE4A 2OFVA 4JDIA 3KULB 4JG6A 3LLAA 1FGKA 5E1EA 5CZHA 2ZB0A 3QZGA 5EI2A 4B6LA 3MH1A 4IX4A 5AR7A 4MX9A 4D1SA 4DF3A 3TNPC 4IM0A 1V0PA 3VS0A 4DITA 4CYIA 3DQXA 1URWA 5KX8A 3EN4A 5L6WL 4AT3A 2YM3A 1IAHA 3IOKA 1OM1A 2B52A 2B7AA 3LFSA 4NIFB 3PSCA 2NP8A 4FT5A 2FSLX 5H8GA 3BX5A 1JKTA 4BDHA 2I0HA 2NNWB 4XV3A 3Q9ZA 3LFFA 4FV6A 2XRUA 4CMOA 4Q9ZA 4D2TA 1OZ1A 3W55A 1QMZA 3KN6A 4EWQA 5J9YA 5AA9A 5I0BA 4EK5A 4MEDA 4UALA 2E9UA 1RJBA 2VTQA 2BZKB 3Q32A 4NWMA 4CMUA 1YI3A 3BEAA 3TTJA 4CG8A 5IU2A 4GIHA 5HIBA 1BL7A 4YO4A 3PJ3A 2UW5A 4O2PA 2PUPA 5JK3A 4JQ7A 3TZMA 1PXIA 4IHPA 5BYYA 3LLTA 2CKQA 4I6HA 3EQPA 1UU3A 4U41A 4J1RA 2PZIA 3UC4A 3KCKA 3SA0A 2J5EA 5IQEA 3IG7A 5AR3A 3PXYA 3R9RA 2BHEA 5C1QB 3R83A 2UVYA 2ZAZA 5B0XA 3ZFMA 4E5AX 4RA4A 3FKLA 2QO7A 4PTEA 1W82A 3NNXA 4J52A 3PRIA 5L2WA 4C34A 2IW6A 2CLQA 3W1FA 2KULA 4AP7A 3ZM4A 3FMHA 3KRRA 5TF9A 3SXRA 3SW7A 2W1ZA 1Y6BA 2OZAA 5EDPA 5HVKA 5DVRA 4YLKA 2BMCA 4NKAA 3EHAA 4GUEA 2AYPA 3OWPA 4ZXTA 4XBRA 4YP8A 1GY3A 4R6VA 3VJNA 5LVMA 4OTIA 1G8AA 5AX3A 4CZUA 3F6XA 4PPAA 4R1VA 4QPMA 5HG7A 4J99A 5IQGA 1OITA 3P7AA 3GCUA 4YUQA 5GJFA 2UZWE 2BDFA 3DK7A 2WMWA 5LXMA 4QTAA 2W4JA 5CXHA 2UW6A 2B1PA 5HIDA 4XLVA 2R4BA 4CMTA 4JBQA 3RHKA 1TQIA 5JFXA 1ATPE 5DWRA 5GZAA 3G15A 5M07A 3QQUA 5IA0A 3BU6A 5BVKA 4KS8A 4FTNA 2GQGA 3P86A 3HVCA 3MY5A 5J87A 2GS2A 4X2FA 3MH2A 4XNEA 4FG9A 3D2KA 4Z3VA 2WTDA 1YI4A 3FL5A 2ZDUA 5A14A 4FTIA 3V5WA 3EB0A 1G5SA 5IQHA 3LFDA 4KABA 3QKLA 4F9BA 3GU7A 2BFYA 2WEIA 3T9IA 1H1QA 4JT3A 3C4XA 4EI4A 3F2RA 3TNQB 2B9JA 2YDKA 4QTCA 5HI2A 2Y4IC 4FSWA 4GG7A 3LKMA 4KNBA 2JKKA 3AGLA 2Y7JA 3QUDA 5KZIA 3RZFA 3D5WA 2H9VA 4BTJA 3M2WA 4EKLA 2AUHA 2ZMCA 4E6DA 3BEGA 1MRYA 3EFLA 4GRBA 4OT6A 4YZ9A 3VS3A 3HZTA 3TTIA 4NT4A 3ORZA 4E20A 2QOQA 5FEQA 3ZHPC 3MWUA 5C8NA 1J7UA 3LXLA 5EHOA 4M3QA 5HG9A 2XNPA 2RG5A 4EH2A 1T45A 4YC8A 2GNGA 4FTMA 2QURA 4H39A 1OECA 4QMUA 3BLRA 5HNGA 2GHGA 5CF4A 3R8VA 2Y4IB 2GMXA 3REPA 5JQ8A 3R04A 2V0DA 2X7FA 5CX9A 2WOTA 2P3GX 4BKZA 4F1TA 3EQRA 3R71A 5CAOA 2J0LA 3ERKA 5GIOE 3FL4A 4NL0A 3R7EA 3CJFA 4MD9E 4YHTA 5AEPA 4G9CA 4PDOA 4IZYA 2DYLA 2GNFA 3QWKA 3KXGA 2GNJA 2X2LA 3CE3A 5D7AA 2BRGA 3RI1A 1ND4A 2G1TA 3MSSA 3HMMA 1SYKA 2VWYA 4FKWA 5ANJA 4GMYA 4OAUC 4HPUE 3TXOA 4WRGA 4EH9A 3I6WA 2ITZA 4DEEA 2J90A 2HZNA 3E3BX 3PVGA 2IPXA 3W8LA 4YTIA 3PY0A 3W33A 3NUSA 3ZUVA 2HWPA 2J7TA 3EFJA 4D1XA 4UMRA 5BNJA 3FLZA 4I6QA 2YM7A 4Y85A 3T9TA 4OBPA 2VUWA 2C6DA 4YSJA 3BYSA 4O83A 3ENHA 4C3PA 4Z55A 4FV4A 2UW3A 2JD5A 4FKPA 3PIZA 3WYYA 4EH5A 5IUIA 3EQIA 2C5VA 4YTHA 3FHRA 3WI6A 2WQOA 3UMXA 4DH8A 3I5NA 3WZEA 4RX8A 2XRWA 4I4EA 3SV0A 4WSYA 1ZMUA 4CRLA 1W84A 3V5JA 4ZSJA 3OG7A 4DEHA 3T3UA 3NW5A 3ZRKA 4U43A 2EUFB 3M11A 2BAKA 4BCKA 3U8WA 3WE8A 2WU7A 2ITYA 2VNYA 2WGJA 3R02A 2HXLA 4ANNA 2UV2A 3FE3A 2EVAA 1IG1A 1JKLA 3D5UA 3PP1A 1M14A 3POOA 4TWCA 5HLNA 1O9UA 2J2IB 2IVSA 4HYIA 5HCXA 4D5HA 5L4QA 3COHA 3DS6A 5AM6A 4KKGA 1LEWA 5DBXA 4NTSA 3WF9A 4R78A 4GS6A 4IBMA 3BHHA 5D1JA 2SRCA 2FH9A 4MXAA 3RAIA 1VYZA 2OXDA 2F7XE 5CEKA 4CTBA 1LP4A 4LQMA 4RLKA 3LMHA 4QMTA 2ZM4A 3WE4A 3C5IA 2BKKA 3DBFA 3MY0A 1J91A 3NNWA 5TO8A 2W7XA 2VWWA 5AUTA 3GU6A 3UOKA 5HIEA 4TYGA 4UZDA 4DG2E 4NZWB 1UU8A 4IDVA 1BL6A 1KUTA 1BMKA 3FXXA 2R3OA 3VUHA 5KKRB 2X81A 4XG7A 4UN0C 3C0IA 4W4YA 4TPTA 4FTUA 4O2ZA 3ZBXA 3SC1A 1IRKA 4HCTA 1SVHA 4PP7A 1BI8A 2GCDA 4IADA 2VTSA 2RGPA 4Q9SA 3PA4A 2OI4X 3G2FA 4N0SA 3VVHA 3D2IA 4O82A 2WHBA 3R22A 1APME 3EJ1A 4BWPA 4EK6A 5CEMA 5K4IA 4AGCA 4BZNA 3Q9YA 3LW0A 3NX8A 4FEQA 4E3CA 3MFSA 1OL6A 5DG5A 3BYMA 4Q5HA 2C30A 4S33A 4FV2A 4FKLA 1MUOA 3BKBA 5H8EA 4TWOA 2XKFA 2PUUA 4RJ4A 4QMWA 4V05A 4TYHB 4BDKA 4EORA 1XBCA 2PVLA 3ZC6A 2XJ2A 3QUPA 2JDVA 2YA9A 4DT9A 1PXLA 4LGDA 4I41A 2JITA 3ID6C 4RVKA 3PJ8A 1G8SA 3WF5A 3ATSA 4YZMA 3RKBA 4UZHA 3DA6A 4D4VA 4I93A 4U5JA 4ZTNA 4G3CA 4H36A 2C4GA 5GZ9A 1JSVA 4FEWA 4QMPA 3O8UA 3NNVA 3ORTA 3PA5A 1SNXA 4FNWA 3QRTA 2PVYA 3HMOA 1KV1A 2XZSA 4FZDB 1VYWA 3UIUA 4F9YA 3OXTA 4K2RA 3PJCA 3IGGA 5IUHA 3ZSHA 4B7TA 2R3GA 3HAMA 4IZ7A 3TKUA 3VBYA 4TYHA 2JDOA 3SW4A 2JKQA 5CY3A 5B2MA 3S4QA 2C6OA 1GAGA 3HA8A 4IJ9A 4XX9A 3PXRA 3JR1A 4DFYA 3KN5A 3P0MA 3BHYA 4YLLA 1CKIA 3SXFA 1WMKA 3OT8A 4O0UA 5CS6A 3QA8A 4BCQA 5AR5A 4EOQA 2VTOA 4I0TA 3MY1A 3MH0A 4UB7A 3BCEA 4PDSA 5HX6A 3ZXTA 4IAAA 5DI1A 4LUDA 3G6GA 1O6LA 3DK6A 1ZARA 2QO2A 2YFXA 3BPRA 4YR8A 5EDQA 4FVPA 2B9FA 4YU2A 3EQFA 3CTQA 3Q52A 3OF0A 2F57A 4YC6A 2UW7A 4L45A 2NRYA 2RSVA 1R3CA 4FKVA 2QO9A 5HD7A 3U9CA 2OJ9A 2PMNX 1PXJA 1PMEA 4FSZA 3AD6A 4D4RA 2H34A 2UZLA 5EHLA 3TL8A 2RIOA 1UU7A 5IZFA 1SVEA 4XP2A 1J7LA 3PLAE 3VW8A 5KMMA 2JDTA 1Q41A 4ZSAA 5ITAA 5JN2A 3BGZA 2CKEA 4FKQA 2EU9A 4FODA 4BBEA 3LZBA 5A4EA 4RGJA 4P7EA 5CVGA 4FTJA 3NYXA 4IWDA 3OBGA 4IAIA 4MQ1A 5F20A 3UO6A 3QCSA 1WBSA 4LI5A 4RMZA 4IX3A 4K77A 4M14A 4NM5A 3P7BA 5AX9A 4A06A 3KC3A 4IAYA 2A27A 3ZLXA 2PZRA 2GFCA 3OTVA 3QQLA 5LMAA 3UVRA 4F0IA 5J8IA 3NDMA 3R63A 2LAVA 4HVDA 3ELJA 5FDXA 4R7BA 4H1MA 3ZYAA 3CS9A 3MN3A 2ZV8A 5IA2A 5HO8A 5FQDC 1WFCA 2XNEA 3OWLA 1SNUA 3W18A 1ZOHA 3GUBA 4X3FC 4FV1A 3SKCA 4WO5A 5AUVA 4LFIA 5A4LA 4I6BA 4O84A 4HYUA 2YM4A 3RBWA 5CXZA 4K1BA 4BC6A 3HLLA 3R8ZA 2ERZE 2YCQA 4KSPA 4M84A 3EYGA 3FAAA 4UWCA 4IX5A 4L00A 4YJOA 5T68A 3VBWA 4LOQA 3AC2A 3PXFA 5AV2A 5L2QA 3COIA 3O17A 4AN2A 4M0YA 4WBOA 2CGUA 4F1MA 4DTKA 4L53A 3V01A 2ZM1A 5CEOA 4I21A 3U51A 1AQ1A 4A7CA 1OBDA 3A7JA 1O6YA 1Z9XA 2GHLA 3H4JA 4QQ5A 4ALVA 2DQ7X 2QOCA 4ZTQA 4R7IA 1S9IA 4F6WA 4C58A 4ZS4A 2JKOA 3E62A 4FL1A 4EOSA 3EFKA 4KKHA 3I0QA 4GK4A 4JOAA 5HU9A 4JG7A 2J4ZA 3VS6A 3M1SA 4OTFA 2J51A 4XCUA 5AIRA 3HUCA 2J9MA 2XK8A 4K18A 4AW5A 4HVSA 4UX9A 2XNGA 4MNEB 5HORA 1Y8YA 4HNIA 2OH4A 3LFQA 3LCKA 5IH4A 4ZTSA 3O0GA 4NFMA 2F9GA 4G2FA 5F4NA 5AR2A 3EWHA 3GNIB 4E6AA 4PL4A 2ITWA 2OF4A 4K9YA 1RW8A 4F7LA 3NYOA 4FIEA 4IB5A 1U54A 3W32A 4LYNA 3SD0A 4YJUA 3G0EA 5HE1A 3ZZWA 3OBJA 4J8MA 3BQCA 3MIAA 5EM7A 5M08A 3EQGA 4AUAA 3O8PA 4IC8A 2GDOA 3LHJA 4JQEA 4DGLC 4ZZNA 2BRHA 4CFVA 4IE9A 5F9EA 2ZOQA 3MFRA 5DN3A 3O71A 5JKGA 1ZWSA 3MVMA 1HOWA 1SMHA 5FTGA 2VTHA 2YEXA 4O1OA 3VRYA 2PZPA 2WTIA 1R0EA 5J1WA 4BDAA 3NYVA 2FSMX 3C0GA 4G3DA 4ANMA 3CR0A 4LM5A 4NIFA 1W7HA 2XUUA 2IN6A 1PKDA 3CTJA 3FLWA 3VS1A 2YLFA 3PXKA 4PV0A 4MYGA 3LIJA 1H25A 4I24A 5IDPA 4AE9A 3IGOA 3DK3A 3EN6A 3N9XA 3D7ZA 2YAKA 3ACJA 3MV5A 3ET7A 3NUUA 4FTAA 3FXZA 4AZVA 3KREA 4GG5A 2UZTA 2X4ZA 4JRVA 3S2PA 4C36A 2PE2A 3LCDA 3SX9A 4WNOA 4F6UA 2W1EA 3FY2A 4G5JA 5ANDA 3OY1A 5AP1A 2IW8A 4DLIA 5CU4A 3R9HA 3DTCA 2X2MA 4G6LA 5AP2A 4I23A 2Z02A 2ONLC 4RPVA 5BMSA 5HD4A 3WF6A 4YNOA 4FIFA 1WVWA 2QD9A 3HRFA 2QOKA 4BDDA 3BLQA 1XO2B 2VNWA 3AC8A 2HY81 2PY3A 3R1YA 5I9VA 1DI8A 2VN9A 3NUAA 2J0JA 2E9NA 3B8RA 4MAOA 5B2KA 1PRYA 3RM6A 5CENA 5IA1A 3LQ5A 4IAZA 4HYHA 2WMBA 4C0TA 2C5XA 5LVOA 2IG7A 3D5VA 3AT4A 2XK9A 2YACA 3UMWA 2J50A 4MD8E 2OF2A 4QP1A 5HKMA 1I09A 4RBLA 5CT0A 3UODA 2CGVA 3ETAA 2EWAA 3F7ZA 3LJ2A 2OJGA 3Q5ZA 5M44A 1UU9A 5CSPA 2BTSA 3KMMA 2PK9A 3V8WA 5CU3A 4AW0A 2A2AA 3FLSA 3I4BA 3Q04A 5DT3A 5I9YA 3TUBA 2C6MA 1YXSA 2XNBA 3AC1A 3GVUA 2A19B 5BVEA 4UMUA 4C3FA 2UVXA 4M69A 2BZJA 2JIIA 3QA0A 2VWVA 4ZJVA 4APPA 5J9ZA 3UO4A 1OB3A 3HYHA 3NNUA 2YIXA 4QPAA 1QL6A 4F6SA 4L6QA 5DIAA 5DLSA 3QC4A 5HE0A 3GEQA 2OKRA 4OBQA 5HE2A 4JI9A 5K0KA 4C2VA 4EUTA 3ZS5A 5CF6A 3L9LA 4FV5A 4IM2A 4RX7A 5EM6A 2WB8A 4E7WA 1E9HA 4WG4A 4JS8A 4EBVA 4AG8A 2W4KA 4NSTA 1K3AA 4FSTA 3DBQA 2VX1A 3QL8A 3OCTA 3ULIA 3QBNA 4KSQA 4BY9E 2VWBA 4AZEA 3LQ3A 3G0FA 4TYIA 3FDNA 3WZJA 4C4EA 5CZIA 1SZMA 5HG5A 3GU4A 4KWPA 4AZTA 3VNTA 1YXVA 2WAJA 4P5ZA 2WMRA 2C0TA 3IO7A 4JBVA 3GC8A 4KIQA 4ZTHA 2R9SA 2ETKA 4FV7A 1XBBA 4RC3A 4DGOA 5ICPA 3P4KA 4TWPA 3VN9A 5J7BA 2FSOX 4ANQA 3LCSA 1PF8A 3P1AA 3WF7A 1YWVA 4OTHA 3BYUA 5FLFA 4YJRA 3OVVA 3W10A 3EKKA 2QQ7A 2X0GA 2WD1A 3LJ1A 3KB7A 2V62A 5AIKA 2P4IA 1OKYA 2OWBA 1YVJA 3BHUA 5I3OA 4BIEA 5D41A 4ZMEA 3EQHA 4RC2A 4E26A 2PVHA 4ZY5A 5IQFA 4U6RA 4QP4A 1NVSA 2XM8A 2CHLA 5EH0A 4FVQA 1PMNA 3QHWA 5GIPE 1V1KA 3FMLA 4PMSA 1ZYDA 3S3IA 1OI9A 3E8DA 4XG8A 3VWAA 4UBAA 4YHJA 3R01A 4O7VA 2R3NA 2B0QA 3PYYA 4R5SA 3AD4A 3KULA 3PXQA 1M2PA 3DJ6A 3U54A 4LOPA 4PMMA 2PVFA 4H58A 3KXZA 4O0SA 4QTEA 1T46A 4BBMA 4G5PA 2PTKA 3D94A 3OOGA 3RWPA 2ETMA 5HNIX 4WRSA 4AX8A 4J8NA 4XV9A 4GVJA 4A07A 2CCIA 3MESA 3EZVA 3GFWA 3O50A 4Y83A 4ACGA 4DG0E 4ZTMA 2IVVA 3R9DA 2UZVA 3BV3A 3QD4A 4RWJA 3UC3A 4E73A 4EC9A 4GV1A 4HGSA 3RAWA 3FZ1A 3ZLYA 1Q3DA 3OWJA 4AW2A 5HCYA 2Y6MA 3HUBA 3I7CA 5IMEA 3CPCA 3UVQA 4O7ZA 5K3YA 4A4XA 4OTGA 3F5GA 3QD2B 3MPAA 4S2ZA 3UPXA 3D14A 3FQHA 5DH3A 5T6KA 3H9FA 4X3FA 2J0KA 4FEXA 5FDPA 4YGAA 3NIEA 2OK1A 5C27A 3FMNA 4C57A 2YCRA 1KE8A 3ALNA 5FG8A 5AUUA 1A06A 3ZCLA 5B7VA 3FMJA 4RX5A 4NEUA 2JAVA 4XP3A 4O7WA 2XIYA 4X6QC 4GJ2A 2E9PA 2YZAA 5A3XA 5IH5A 1WBWA 3ITZA 3MVJA 1OPKA 3PIYA 3PVUA 4U81A 2CDZA 4HVHA 2C5YA 4FTTA 4XJ0A 2IW9A 4AA5A 4DGMA 5KMKA 3F3WA 5BVWA 2EXEA 2CPKE 2GTNA 3TKIA 1PJKA 1Q4LA 2W1FA 3C4ZA 3EIDA 5IKWA 4GT5A 5FXQA 2VAGA 2O8YA 3RJCA 5KBRA 4J7BA 3U4WA 2CKOA 1XBAA 3PWYA 3N4TA 5AR8A 2IJMA 4CCUA 3GQIA 3R1QA 4LMNA 4EK4A 3FLQA 3PY1A 4M8TA 5EHYA 3OXZA 3Q9WA 4BL1A 1PW2A 3F3VA 4EQCA 3GENA 5CU0A 5EW8A 1WCCA 5E8UA 4EH4A 4O86A 2V7AA 4IZ5A 5EI8A 3CCNA 2W5HA 3OROA 2HIWA 2UW0A 1YRPA 4FT7A 4Y73A 3E5AA 4DA5A 2WNTA 3COKA 5C4LA 2VRXA 3I0OA 5E8TA 5LMBA 5M57A 1M2QA 5FRIA 1RDQE 4BB4A 2XIRA 3LJ0A 3E7VA 1H0VA 5HX8A 2HZIA 3GBZA 2AC3A 2CCHA 3DKOA 3SGCA 2BDWA 3TT0A 2ITXA 2R3IA 3D7TB 1DAYA 1QPCA 2E2BA 4M68A 4XHKB 4USEA 5CLPA 1ZYSA 4RIOA 5CNOA 3NUYA 2FA2A 3RZBA 2FB8A 3V5PA 4CGAA 4X3JA 4F9WA 4BTFA 3R7GA 4PMPA 2WIPA 4H3BA 4FV9A 2OIQA 5CAQA 3AC3A 5DRBA 5L8LA 2PU8A 1ZOEA 1PXOA 3FY0A 1REKA 2Y8OA 4KS7A 4CTCA 5KUPA 1CMKE 3DU8A 2HZ4A 5FP6A 3C4EA 3VQUA 2XNMA 4C38A 3D4QA 3R0TA 1H08A 3DDQA 3VS4A 5BYLA 4W9WA 1FPUA 5ANEA 4K33A 1E1VA 1OKWA 4RA5A 5CNNA 4PY1A 3RPSA 1OPJA 4AAAA 4OUCA 3OCSA 5IEYA 1JPAA 3ZO4A 4DLJA 4JL9A 4XS2A 5CAUA 3A8XA 3FC2A 4RFMA 1EH4A 1RE8A 2F49A 2X2KA 2QLUA 5JGAA 5LOHA 2BCJA 3A8WA 3R6XA 4U79A 2WKMA 2ACXA 3QUEA 3E88A 3HMNA 1NXKA 3HMPA 3MFUA 2ITVA 4KIPA 2HCKA 3R8LA 3P23A 3ZOSA 4EK8A 2R3FA 3B8QA 4RJ6A 5CT7A 1WBVA 3PTGA 4DH5A 3UZTA 4ITHA 4BCMA 1P2AA 3H9OA 2QHNA 4DFZE 1CM8A 3D5XA 3FMMA 4WG5A 1Q8WA 2J6MA 4CZYB 4YSMA 2XS0A 3BYVA 3A4OX 3S0OA 5GZ8A 5IA4A 5EQYA 3FKOA 4G1WA 2YM6A 3TV4A 4YMJA 5AMNA 2XK4A 4DC2A 4Z7HA 4ENXA 1ZRZA 1Q8YA 4O0TA 2XK6A 4QT1A 3DOGA 4BCPA 2GNLA 3W2OA 2ZVAA 3S95A 5LWNA 2NRUA 3PY3A 3QTWA 4M15A 4MWHA 4QMLA 2BALA 4L7FA 4CXAA 2WQMA 3MW1A 3CIKA 2G15A 2O63A 4YLJA 3E63A 5B2LA 4CLJA 2WZJA 3IKAA 4BGGA 2WFYA 2Z7QA 5J7HA 1Q8ZA 2C3IB 4QMXA 3UP2A 4FTRA 1KV2A 3CQEA 4LL0A 2OU7A 4BBFA 3UYSA 4DH3A 3RAKA 2XYNA 2WTCA 4FA2A 1YDRE 3NAYA 1AD5A 3CKWA 5AWMA 3UG1A 1WVYA 4MHAA 4BWXA 4ZLZA 5IUGA 5FXSA 5CALA 5I9XA 4EZ7A 2YITA 4KBKA 5EG3A 4DEBA 4EH8A 1Q99A 2Z7LA 3IQ7A 4BCGA 3R8PA 1CKPA 3NIZA 2JDSA 4F7SA 5J5SA 1O6KA 4W8EA 1JBPE 1VR2A 2WXVA 4KIOA 4PRJA 3IW8A 5BVFA 5AFVA 4WNMA 5E9EA 2B55A 3DY7A 5HHWA 3II5A 3OWKA 3TIYA 3QTUA 2XYUA 4CV8A 4DFUA 5I9WA 4JRNA 4EEVA 3ROCA 4CCBA 3FI8A 2G2FA 4LRMA 2IWIA 3R7IA 3VS2A 4LUEA 3HL7A 4USDA 3DBCA 4BDBA 4BHZA 3VHKA 3C4CA 3I1AA 2QCSA 4I3ZA 5L2IA 5CQWA 1Y8GA 3DBDA 5DRDA 3FMDA 5HCZA 3MI9A 1XH8A 5CEQA 5DMZA 4BZOA 2JIVA 3D15A 4NUSA 2PPQA 2XKDA 3G9NA 4ZSLA 2Q83A 3JVRA 5J79A 3F7WA 4C4GA 1BUHA 1UNHA 2WOUA 2HW7A 2J0IA 2R3HA 3QU0A 4X21A 4ARKA 1J7IA 4PUZA 3A61A 4XG6A 3OFMA 3R1NA 3Q2MA 3QRJA 2WQEA 4RJ3A 3C9WA 3UGCA 5JEBA 4LV5A 5AV1A 5E90A 2QG7A 3L9PA 1Y91A 3C13A 2OH0E 3EQBA 5I4NA 1WBTA 4EOMA 1KE6A 3SOAA 4FL2A 4RX9A 5EQEA 4F0GA 2P2IA 5EW9A 4ZZOA 2OIDA 3VUGA 4ERWA 3E92A 4FX3A 4R3RA 2XKCA 1H28A 4MF1A 5C4KA 4F4PA 2OJJA 4II5A 3I6UA 4D2PA 4QMQA 3JYAA 3LFCA 1BYGA 2W06A 1U59A 1H00A 1H07A 1ZOGA 4C02A 3QQGA 1IR3A 2WTWA 3BI6A 1ZY4A 3KGAA 3CTHA 4D9TA 4BDGA 3KEXA 4W4XA 1PYEA 1M17A 4AT4A 3MJ1A 4O81A 2V7OA 4EOOA 5JSMA 4CNHA 4AF3A 3QZFA 4J53A 3D0EA 3UZRA 5EYDA 1SM2A 4NYEA 4ANLA 3COMA 5L6PA 2QOFA 1WVXA 3N4VA 4OTQA 3SG9A 4GUBA 5IEVA 4MD7E 5IH6A 3KK8A 2Q0BA 4NFNA 2DUVA 3RK9A 3SOCA 5EFQA 2XIZA 2F2UA 4GYIA 4F0FA 5LCJA 3O96A 3VUKA 2QHMA 5IQIA 3W16A 3V3VA 5JRSA 2B54A 5AV3A 5LVPA 5GJGA 3RTPA 3V5LA 3O8TA 4PP9A 4FZAB 1STCE 5AAFA 1ZZ2A 3WF8A 4M97A 2CNUA 2UZOA 4ALWA 2B53A 3ANRA 2F4JA 4G6NA 2XJ1A 4LL5A 1F5QA 4FKSA 4EH6A 4GFMA 2X9EA 3V8TA 1DAWA 5HNBA 3VUIA 4OTDA 3BU5A 1LUFA 4QP3A 4QMNA 3KQ7A 3H3CA 1ZYJA 4PQNA 2X6DA 4GU6A 4CLIA 5AAEA 2W1GA 3EL8A 3BHTA 3GXLA 1NY3A 4CFMA 4FKUA 3FUPA 3FLNC 1H0WA 3DXQA 4FZ6A 5G6VA 4O0YA 3TM0A 3QQJA 4FR4A 1A9UA 2GNIA 2YAAA 2VTMA 4FMQA 5G1XA 3TACA 2Z2WA 3PPKA 2XKEA 4TWNA 4HVGA 3BELA 2QKWB 2W9ZB 5FD2A 4RWLA 4BF2A 2OFUA 4O6LA 4C7TA 3GU5A 5CAVA 1XH5A 4PL5A 2Y4PA 2ZB1A 3C1XA 3JVSA 4J71A 3ZONA 5BUIA 1IAJA 3Q6UA 4ORKA 4CFWA 5KMIA 2IZRA 2WMTA 4FT3A 4AE6A 4BWKA 4OTWA 3JY9A 3OUKA 3W8QA 3RALA 4KD1A 4FIHA 3EN7A 3HGKA 2VZ6A 5HGIA 2QOOA 3F2NA 4NW6A 3MIYA 4W4WA 4X2JA 4BCJA 4ACMA 3PJ1A 4KUJA 4XV1A 4ZJJA 3MBLA 5LVNA 4O0VA 3F2AA 5H3QA 3WYXA 4G34A 5DYJA 1U54B 4G16A 1B38A 4AOJA 4S32A 4ASEA 2ONLA 4IXPA 3HKOA 3DFCB 4QOXA 4ANBA 3ANQA 1S9JA 4OW8A 5DR2A 4EC8A 1OVEA 2Z60A 1YWRA 3DFAA 4U42A 3QWJA 4V01A 2QONA 3RCDA 3IDCA 5HTIA 5KMNA 3GU8A 1KE5A 2ITTA 1H01A 4AWIA 5DHJA 4JAIA 2VGOA 2ESMA 5E8VA 5FEEA 2CNVA 4C59A 2XB7A 4AGUA 4HZRA 5IQAA 4D2RA 2W9FB 4QNYA 5DR6A 3TJCA 1H1PA 4FICA 2RF9A 2ZYBA 5AP6A 3TV7A 4YJTA 1Y6AA 3DXNA 3R1SA 4E5BA 4BTMA 4FYNA 5LWMA 4EJ7A 4O96A 4ZAUA 3BGPA 4RC4A 5H8BA 4G9RA 3PE1A 2XF0A 4PTGA 1BI7A 4JLCA 4YZDA 3UOJA 3BIZA 4X0MA 5M06A 3C7QA 5M4UA 1P4OA 2FVDA 4IWPA 2PHKA 2R5TA 3PLSA 4I0RA 5AP0A 4ZK5A 4E6QA 4E6CA 5LVLA 1BX6A 4M7IA 4JX7A 3QHRA 3UNKA 4IJPA 3OTUA 4IFCA 3KF7A 4R5YA 3HMIA 3QX4A 3TDWA 2GQRA 4D58A 3DB6A 3TI1A 1ZYCA 5LQFA 3FV8A 3ORPA 2BVAA 3AOXA 4O6EA 4WG3A 2OICA 2ZM3A 4XEYA 3ZFYA 4BI2A 5K9IA 4EH3A 1UV5A 3BBTB 3JY0A 1NA7A 2O64A 4QYYA 5AV4A 1IA9A 4NJ3A 1TQMA 3IW5A 4QTBA 3L1SA 4EHZA 3KVXA 3QQHA 3LAUA 4TN6A 5BX0A 2JIUA 3BU3A 3KY2A 4YJQA 4MXZA 2GQSA 2WO6A 4TYEA 4UXQA 4Y46A 4DG3E 2X7GA 3ZEWA 4BDIA 2CNQA 2Y6OA 3CXWA 4DYMA 4MNFA 4WHZA 4D9UA 4IEBA 4I20A 5A4TA 3LFBA 5KKRC 2WU6A 2C68A 3SVVA 4F70A 3VUMA 4ANSA 5E91A 4ALUA 4O7TA 4F9CA 4IWOA 4HVIA 5LMKA 1GIJA 4RVMA 2CN5A 4AT5A 3FMEA 4RWKA 2A4LA 1P14A 2JFLA 3JPVA 2BIKB 2Z7SA 4S34A 5ANKA 1B6CB 3VS5A 3BYOA 3I81A 4FGBA 2OJFE 3KL8A 3KVWA 3ZEPA 3TNHA 3NUXA 3FLYA 4ANOA 1XH7A 5CASA 3NW6A 3AT3A 3VBTA 3FJQE 5JZJA 4FKOA 4EOIA 4IIRA 2UZUE 4J97A 2YCSA 2Z8CA 4D0WA 4GJ3A 4AA4A 4KBAA 4WOVA 1W98A 4CEGA 1ZZLA 2C1BA 4FV0A 4CD0A 4JNWA 3CLYA 1FMOE 2BZHB 3JXWA 5JGBA 3HV3A 3AC4A 5FM3A 3WZKA 3EKNA 1GZKA 4A9RA 4FTCA 4YO6A 2IO6A 2QOLA 4ZEGA 2R3KA 2ZMDA 5TKDA 3UQCA 1TVOA 1KSWA 2YM8A 3M42A 4S30A 4F9AA 3K5UA 2OW3A 3EYHA 5L8KA 2XVDA 2A1AB 4L46A 4CKJA 3KXMA 4M69B 3SLSA 3NUNA 4WIHA 4EHVA 1W83A 3C50A 3ZRLA 1Z57A 5F1ZA 4N4SA 3BWFA 4RRVA 5GNKA 3GOKA 2BRNA 5CAPA 1FINA 4XRLA 1NVQA 3FEGA 2X6EA 4FI1A 5IISA 2PSQA 3QLGA 3AT2A 3THBA 4BDJA 3NPCA 4FV8A 3K54A 4I92A 4O38A 2X9FA 4JDHA 4QO9A 4P2KA 3OUNB 3B2TA 4UYNA 1XKKA 4XOYA 1Q61A 5CTPA 5ANIA 5EK7A 3DGKA 5DOSA 2R3PA 4KBCA 1L8TA 5TT7A 3L8SA 1M52A 3MA6A 4DFXE 4FKJA 3E8CA 2IZTA 4HGLA 3G5DA 1HCLA 5DE2A 4KRDA 3R8MA 4OBOA 4D0XA 4YJVA 1YXTA 4UMTA 5CSXA 3CD3A 4YNEA 4QP2A 4DHFA 1MQBA 3LCTA 1J1BA 3U87A 3ATTA 3KXHA 4TYJA 3MVHA 1I44A 4FTKA 2PZYA 4RIWB 3BGQA 5AP4A 3VHEA 5L2SA 4IMYA 5CU2A 5C03A 2C6LA 5JT2A 4BIDA 4NH1A 3FZPA 3QKMA 3UTOA 1MRUA 5EI6A 2OZAB 4HW7A 3LCOA 1PYXA 4QMSA 4V0GA 3UBDA 2I0YA 5HO6A 4KAOA 2ZV7A 3NW7A 2GSFA 4CKRA 5JH6A 1OBGA 3NCGA 4H3PA 3LM0A 2CGXA 4IVCA 5KMJA 2HW6A 3AGMA 5CSVA 5EYCA 4YJPA 4CYJA 3L8XA 2QKRA 4QNAA 3QRUA 2OIBA 4PNIA 3KXNA 1OKVA 3QAME 4FT9A 5AR4A 2PUNA 2VWZA 3F61A 3F69A 3N51A 3Q4ZA 2EB3A 4WUNA 4CFXA 3KCFA 2YIRA 4HGEA 2BPMA 4O7RA 3FZTA 1OMWA 2O2UA 4JDJA 3BHVA 4PNKA 4B8LA 1NT2A 5FBNC 3EMGA 5CU6A 5DFPA 4F65A 3UQFA 3EH9A 3I79A 2RFSA 3K2LA 4IACA 4AFEA 1SVGA 4X7QA 2XCKA 5M51A 3GQLA 4PWNA 4XH6A 3IW7A 2FGIA 3PG3A 3A60A 2W5AA 4WD5A 4UMQA 4X3FB 2O3PA 3P5KA 1M2RA 3V04A 3W2PA 4HGTA 2C47A 4JR7A 3L9MA 3E8NA 1GIHA 4TKSA 3ORLA 3A7HA 4FSMA 2QU5A 5K5NA 4L9IA 4O1PA 2PMIA 4BKJA 4A9YA 5DR9A 4PX6A 4PPCA 5HBEA 1CDKA 4LRKA 4QMZA 2P0CA 2PE0A 2ETRA 4HCUA 4WUAA 4Y95A 3OW3A 4ZTRA 4QP8A 2VX3A 2X1NA 5HLPA 3KRXA 4RVLA 5EYMA 2I0EA 4D2VA 2RFDA 3DDPA 5E8YA 4MBIA 3U6HA 5LJJA 1JKKA 2GTMA 2VTJA 5E8ZA 4RSSA 5IQBA 1PXMA 1ZMWA 2PMLX 3UZPA 3VW6A 2I40A 3CC6A 3W2QA 4GU9A 4L7SA 3V8SA 3A62A 4QPSA 3FYKX 3UNZA 3HRCA 3TUDA 4EQMA 5E92A 2HOGA 2W05A 4YPDA 3CQUA 4IB1A 5CI6A 4D4SA 5M53A 4CT2A 4I4FA 4QP9A 3C5UA 3ZXZA 2CGWA 1CKJA 4KKEA 3RPRA 2UW9A 4O91A 4DFNA 3DB8A 3TZ8A 3ALOA 2VV9A 4FVRA 2HK5A 1WZYA 5DT0A 3VUDA 4BDFA 4FGRA 3ZM9A 2RFNA 1GNGA 3EQDA 4U44A 3SQQA 3F88A 4DEAA 3NVMB 3PSBA 1PMUA 3EZRA 2HWOA 5AUYA 1LEZA 4WNKA 2C3LA 4A9TA 4AN9A 3EOCA 3MYGA 5TR6A 3CP9A 2R0IA 3DNDA 3G33A 3I60A 2C6TA 4ACCA 4L44A 4ACHA 4RJ5A 1U5QA 3R7YA 5L3AA 2QC6A 2VTTA 3LQ8A 5KHWA 1OUKA 3FWQA 5L8JA 3AD5A 4PMTA 4HPTE 5CWZA 4C2WA 4JG8A 2PL0A 3DT1A 4ZTLA 5M56A 1YI6A 4MF0A 2UW4A 5KE0A 4BYJA 5CF8A 4GFOA 3IECA 3EFWA 3AMAA 4HJOA 1WBPA 3Q9XA 4O21A 4OTRA 4AOTA 4L3PA 4ONAA 1DS5A 3HDMA 3DXPA 4ZOGA 3UP7A 1GIIA 1IASA 3MTLA 3QKKA 4TNBA 3QXOA 4RQKA 2C6EA 2BUJA 2PUIA 3TZ9A 3LMIA 5KCVA 1UNLA 3LVPA 3E87A 4MH7A 3NGAA 3Q5IA 4IVBA 3RWQA 4KA3A 4LGGA 3DAKA 5C9CA 1XH6A 4Q5EA 4IVDA 2QNJA 5I3RA 4E4MA 3R8UA 3ACKA 5D10A 4XLIA 2W1HA 4FSQA 2G9XA 3WIKA 4BZDA 5I9ZA 4C62A 5ACBC 3HNGA 3H30A 4KIKA 4XMOA 1PXPA 4XUFA 3WOWA 3HA6A 3PDTA 4XYFA 1W0XC 4A9SA 3TCPA 3LPBA 2X39A 3MS9A 5FBOA 4BCNA 3LE6A 5D12A 3A7GA 4MNEA 4YZNA 3MA3A 3PWDA 2I1MA 3LXPA 3MPTA 2V55A 4FKGA 2C3JA 4DH7A 5DGZA 2C5NA 2JKMA 4AACA 3MB7A 4ITIA 1JAMA 4FE2A 3R00A 4G17A 4U97A 2VTNA 2NO3A 3MJ2A 2HZ0A 3L8VA 3K5VA 4L52A 1WAKA 2A0CX 2VTRA 3TV6A 4DBNA 2C69A 3FI4A 2GFSA 3KFAA 2GPHA 3VRZA 4EHGA 4RIYA 3QCQA 5FUTA 4Y72A 4AS0A 3SRVB 4C61A 2C0OA 4NJDA 4ITJA 4C33A 2VO0A 5LMKC 5K0XA 4O7SA 2RFEA 2YWPA 2BKZA 2QU6A 1R1WA 3ZDUA 3W2SA 4ENYA 1R78A 2OO8X 3DLZA 3Q53A 4IM3A 3WARA 3FYJX 4L67A 4FEUA 4RLLA 2OG8A 4MCVA 2YABA 4I5MA 4XBUA 4CRSA 4IWQA 2OGVA 2YM5A 2GNHA 4BRXA 2QOHA 3R21A 4GEOA 2VU3A 3G51A 4RQVA 5C8MA 2FYSA 3U55A 3R30A 3ORNA 5KMLA 2XA4A 3VUTA 3WILA 1UKHA 4F08A 1H1WA 2VO7A 2CN8A 3POZA 3GB2A 3A7FA 4IX6A 3TIZA 2X8IA 4Q2AA 3VJOA 4MXYA 5KMOA 2O5KA 4GKHA 3S00A 4LOOA 5HE3A 4E93A 2XH5A 3FSKA 4AFJA 4H05A 4FUYA 2BDJA 1P4FA 4LRJA 5A46A 5L2TA 2OXXA 4EOJA 3FHIA 2XIKA 4YBKA 4UWYA 1JSUA 3EN5A 4OGRA 2X4FA 1ZY5A 4J95A 3KA0A 2I0VA 4C3RA 1ZMVA 1FGIA 3FC1X 3CKXA 3R28A 3RINA 3ZUTA 4FEVA 3BWJA 3W2CA 5CEPA 2UZNA 1WBOA 3HV6A 2ITQA 4NCTC 2R7BA 1Y57A 3A4PA 3OW4A 2C6KA 4JBOA 4L8MA 5T3QA 4AQCA 4BCOA 1J3HA 3FZSA 3JUHA 3DPKA 4IAFA 2P33A 5JFVA 4FZ7A 1Q97A 4BCIA 1F0QA 5HTCA 1YHVA 4OR5A 3F5UA 5DT4A 4EONA 1Z5MA 5EOBA 3P78A 4BDEA 3GC9A 4FBXA 1PY5A 3ZZEA 3DAJA 4CZTA 3GFEA 2R3JA 4ZIMA 4EK3A 4QQTA 1OIYA 2OLCA 4RJ7A 4QMVA 4FOBA 4JXFA 4TTHB 3U9NA 3K3JA 3VAPA 2JBPA 3VULA 5M4FA 3RPYA 2W1DA 3NRMA 4U7ZA 4FF8A 4IC7A 4FSRA 2QVSE 4FSUA 4K11A 5AUZA 4FK6A 4BVUA 4ZJIA 4C4JA 5M4IA 3ZO1A 4GKIA 5TOZA 3IDBA 5EYKA 4USFA 1YOLA 2C6IA 2WQNA 3HRBA 5FWKK 1DI9A 2JC6A 3DKFA 2Q0NA 4XRJA 2YCFA 3IONA 3QD3A 4A9UA 5HEZA 4DH1A 1W8CA 4NM0A 1IEPA 1YHWA 4DEIA 3KU2A 1FBNA 3Q4CA 5A4CA 3V51A 3ZH8A 4I22A 5ETIA 3FSFA 3ORKA 3TNWA 1R39A 1FMKA 4JAJA 3H0ZA 2B4SB 2BAJA 2HAKA 5E1SA 2C0IA 4FT0A 4AGDA 4EWHA 5EQPA 3TDVA 3UIXA 4O0WA 3ZO2A 3ZO3A 2VGPA 1JNKA 4B0GA 4E4NA 3TKHA 3CPBA 3F3TA 4PF4A 1F3MC 4FG8A 1OL7A 3SRVA 4BCHA 4D2WA 5HQ0A 1OIUA 2XEZA 1FVVA 3GT8A 4GK2A 4I5CA 3EN9A 4NW5A 4QTDA 2OSCA 4S31A 4TXCA 5AUXA 4I5PA 4O0XA 1URCA 4DT8A 1QPJA 2R3LA 4FUXA 5ETAA 2W1CA 4WBBB 2OXYA 3QALE 2RG6A 5DEYA 4U3ZA 3V5QA 5K5XA 4A4OA 4ZLYA 3QZIA 4CQGA 2UUEA 4KB8A 4QMYA 4DEGA 3ZTXA 4QP6A 2YJSA 3H0YA 4BGHA 3F5PA 3E64A 4FNYA 2VX0A 4RFZA 4W8DA 3TWJA 4R1YA 1OIRA 5DPVA 1KWPA 5LCKA 4E1ZA 1Q5KA 2KTYA 5IDNA 3PRFA 3NEWA 3SHEA 4CV9A 2R64A 2XNOA 3PA3A 2VTPA 3CJGA 4JBPA 3FMKA 4U80A 4CQEA 2P55A 3MPMA 5J9LA 3OCGA 5D11A 3CY3A 3IOPA 2UW8A 5IMXA 4K0YA 3VQHA 4DCEA 3R2BA 3LFAA 4ZY6A 4FIIA 5HBHA 1ZXEA 3ZC5A 2CKPA 1GZOA 3G9LX 4BFMA 4CFUA 2QODA 3MVLA 4X6RA 4P4CA 2WMSA 2GU8A 4NM3A 3B2WA 4DBXA 4DN5A 1GZNA 3GI3A 4G3FA 4I6FA 4DFLA 2V22A 5JRQA 3KMWA 2UZEA 2VD5A 4KRCA 2WELA 4RZWA 4E5WA 4ZP5A 2VTLA 3PSDA 2IZUA 4M0ZA 5AP5A 4FZFB 4DEDA 2HYYA 2EB2A 4AOIA 4UMPA 1BLXA 3GC7A 3S1HA 3PFQA 1QPDA 4HCVA 2XIXA 4JIAA 3A7IA 3CGFA 5AUWA 3QTIA 4NU1A 5E7RA 3N4UA 3HP2A 4H3QA 2JAMA 3KK9A 2YIQA 3FQEA 4QQJA 5HESA 4ASXA 3ZFXA 4OT5A 2BRBA 2ZJWA 4YURA 1B39A 2W96B 2XBJA 4BDCA 4YZCA 4WT6A 1U5RA 4OLIA 3PG1A 4ACDA 4QQCA 1DM2A 3DTWA 4EOPA 5FXRA 3AC5A 2W17A 1VEBA 1ZYLA 3V6SA 3EQCA 1FVTA 2QI8A 4DGGA 4EJNA 3NS9A 5GJDA 2OBJA 2F7EE 3PZHA 5E8XA 5FTQA 4APCA 4MTAA 3DCVA 1XQZA
chains in the Genus database with same CATH superfamily
3R73A 4IVAA 3MFTA 5JMSA 3VS7A 1YOJA 2HXQA 2BAQA 4X2GA 1JLUE 3LXKA 4GT4A 4IW0A 3C4WA 3LM5A 1TKIA 3PE2A 3QYWA 5JQ5A 4UXLA 5BUEA 3O7LD 3P7CA 1NW1A 3UO5A 3Q96A 4FC0A 4FTLA 4YTFA 3NCZA 4G31A 2PE1A 3BE2A 4GL9A 4U45A 4AU8A 3PVBA 4E4XA 3QTZA 2YDIA 3NVKI 2ERKA 3OD6X 4BI0A 3NZ0A 3GCVA 3F82A 4D2SA 4DTAA 4EYMA 2QG5A 4JIKA 2BTRA 4ERKA 5EOLA 4EL9A 3CEKA 2JDRA 3HEGA 1U46A 3PJ2A 4IZAA 2IEWA 5A6OA 2AC5A 3PZEA 2G2HA 4V04A 3DLSA 1K2PA 3T8OA 1M7QA 2XEYA 2CLXA 4G3EA 2IVUA 5HBJA 3CD8A 3VF8A 2XCHA 4L3LA 1CSNA 2YN8A 3ZSGA 2V5QA 4DINA 5A4QA 4DDIA 4CG9A 2YISA 3UDBA 1G3NA 3OMVA 3PVWA 3ENMA 3QGYA 2O65A 4FG7A 4FV3A 4U3YA 4IB0A 4QMOA 2PVNA 4XP0A 1BKXA 3UOLA 1H26A 3R7VA 4JR3A 1WBNA 4FNXA 4MKCA 4Y8DA 3Q4UA 5IQCA 3HV4A 4QMMA 3UPZA 4K6ZA 4WA9A 1H27A 4JJRA 2W0JA 3RVGA 3UIBA 1KOAA 2PWLA 4FYOA 4IAKA 4W4VA 3QC9A 4BKYA 1H1SA 3KKVA 3ULZA 1YHSA 4M13A 4M12A 1KE7A 4QYGA 4ZSEA 3VBXA 5ANOA 2XMYA 4PPBA 3P9JA 5IF1A 3E7OA 4GT3A 2YHVA 3AXWA 3W0MA 3R2YA 3D9VA 4EOLA 2X7OA 4TT7A 4F1OA 2E9VA 3PPZA 5FP5A 1J1CA 3QXPA 3ORMA 2DWBA 1RQQA 5IG1A 5H9BA 3ZSIA 2PVMA 2GS7A 5FTOA 1HCKA 4MVFA 2IVTA 4JQ8A 5E8SA 3CGOA 5C01A 5M55A 4LMUA 4ZLOA 4DFBA 1MQ4A 3MTFA 3VO3A 5D9HA 1PKGA 1YXUA 5EKNA 1Q62A 3QFVA 5AM7A 3V5TA 2WMUA 3E3PA 2YLEA 1QPEA 3MB6A 3QTQA 2W5BA 4ZS0A 4BYIA 4FSYA 3FI2A 3QCYA 5EM5A 4OTPA 5FEDA 5D7VA 2YIYA 3KIOC 2R3MA 4XG2A 4FK3A 3ZRMA 2DS1A 2XAMA 5HVYA 3AMBA 1E1XA 4HNFA 3RP9A 4YC3A 2ITPA 2IZSA 2XNNA 3OY3A 4G6OA 4DTBA 1H4LA 1XH4A 2P2HA 4BGQA 4FKIA 3QTSA 1YKRA 4QP7A 4FL3A 5ANGA 1XWSA 4C35A 5LARA 4Y5HA 4CFNA 1LR4A 4MBLA 1MRVA 4GH2A 1MP8A 4TW9A 4O4CA 4OAVB 4AZWA 5J5TA 1V0OA 2WEVA 2XBAA 4FIGA 2I7QA 1V0BA 3OEZA 3RPOA 4PL3A 2ZDTA 3C4FA 4EH7A 4YJSA 3RNIA 3PIXA 4E4LA 3QTRA 3OS3A 4XG3A 3NLBA 5HG8A 3GGFA 1PXKA 4O27B 1JWHA 2F2CB 2QLQA 4BIBA 4N6YA 1JOWB 3NUPA 5TE0A 1ZAOA 2HELA 5I5ZA 4LDTA 3ZU7A 3DAEA 4PDPA 4DCAA 4FSNA 1AGWA 4F64A 3R7OA 4EYJA 2AQXA 5CANA 5IEXA 4BJJA 3DJ7A 1NVRA 3QTXA 4U8ZA 1YQJA 4U40A 4Y5QA 4F7NA 2VWUA 4N6ZA 4O0RA 4WKQA 3QGWA 4EHEA 2VO3A 4P5QA 5AP3A 3ROYA 5HVJA 4YJNA 2R3RA 4MXOA 3TZ7A 4CVAA 4D28A 2XK7A 3W2RA 4G3GA 3DQWA 3ZBFA 2UZBA 4FOCA 4O22A 4P90A 3GCPA 3UQGA 5A9UA 4IDTA 1OL1A 4F09A 2BRMA 2XP2A 3I7BA 3DKCA 3QD0A 4NCTA 2PZ5A 2YERA 5CF5A 4TNDA 3L8PA 5HLWA 4XG9A 4FNZA 4C37A 1YW2A 4YZBA 4D4YA 1OIQA 2R2PA 3HV5A 3IS5A 5EDRA 4ASZA 4GYGA 4K8AA 4C4IA 1JKSA 2PVJA 3NR9A 3OOMA 4NK9A 2Z7RA 3BL7A 3QRKA 3WZUA 3U6IA 3KRLA 4R3PA 4KIKB 5A6NA 1L3RE 3PPJA 4GVAA 3R7UA 4B99A 3OHTA 4FTQA 4BCFA 5BVDA 4KINA 4UYAA 1OGUA 4HOKA 1XH9A 5EW3A 3KRJA 3WIGA 3VIDA 5AA8A 2NPQA 3KXXA 2JFMA 4RG0A 3TJDA 3FZOA 3DJ5A 2VTAA 3UJGA 4ZZMA 4AA0A 3F66A 1OPLA 3V6RA 2RL5A 3QZHA 5K4JA 1KOBA 1UWJA 4RJ8A 2HY0A 3D7TA 3FKNA 3MGYA 1YOMA 2UZDA 3OEFX 2WMVA 3ZUUA 2R0UA 3PP0A 5DNRA 2WMXA 3WBLA 4D5KA 4MK0A 4RIWA 4RFYA 3TEIA 5E8WA 5H2UA 3QX2A 4QYEA 3DV3A 1YDSE 4TZRA 2ZV2A 4QD6A 4C8BA 3SG8A 3R9OA 1GOLA 1Q8UA 4XOZA 1PMVA 4FIJA 4WNPA 3U4UA 4ZSGA 3RM7A 3LFNA 4AGWA 2QOIA 3NYNA 3UVPA 2EXMA 1H8FA 4EBWA 4O7LA 3HP5A 1OKZA 2XJ0A 4JX3A 3TNIA 2ITNA 3ORXA 4W9XA 4NKSA 5C8KA 3HAVA 2H8HA 1OL2A 3MH3A 5KZ0A 3RAHA 1UKIA 3GCSA 4UWBA 2W99B 3L9NA 2WPAA 3BE9A 4CSVA 3Q2JA 2JLDA 2WQBA 4IFGA 4MXXA 4GK3A 2VO6A 2JBOA 3BBWA 4R3CA 5AADA 2EXCX 5KHXA 4TRLA 1OGYA 2FSTX 2PVRA 2C5OA 3AQVA 4QYHA 3IW4A 3HDNA 4E8AA 4F7JA 3BZ3A 4N70A 4V0GB 3RNYA 3UG2A 2JGZA 3FPQA 1OUYA 1M7NA 4IQ6A 3DZOA 4EUUA 4A4LA 3BRBA 3BLHA 2F7ZE 4MWIA 2LGCA 5CVHA 4YTCA 4ASDA 4BN1A 3QLFA 2I6LA 5HOAA 2RKUA 2YZLA 3PUFC 2ITUA 5I9UA 1FVRA 4RVTA 3ODZX 3ORIA 3SDJA 5IQDA 1H24A 4J98A 3Q3BA 4UY9A 2BILB 2WMAA 5JFSA 5DA3A 4C4FA 4F99A 1Q8TA 1ZLTA 3H9RA 5M4CA 2Y9QA 3SAYA 1A48A 1YDTE 3NAXA 3NWWA 2VWIA 4WSQA 4I1ZA 1OL5A 4RIXB 3RMFA 1QCFA 4XG4A 2QR7A 3A2CA 4LGHA 3F3ZA 1REJA 3O51A 5EM8A 5J95A 5IA5A 4QYFA 2J5FA 4FKTA 3RPVA 3A99A 4I94A 4EOKA 3NMUF 1FOTA 3GP0A 4GFGA 3PUPA 2ITOA 5F94A 2UVZA 4AXAA 4I5HA 1UNGA 1U4DA 1W2DA 5DEWA 5HTBA 3IPHA 3Q60A 1P5EA 2QOBA 1VJYA 4MBJA 4BTKA 1XR1A 2REIA 4Z7GA 4BR3A 2CMWA 4L3JA 1H1RA 3O2MA 3IDPA 4JDKA 3O7LB 4YHFA 2R3QA 5CYIA 3IK3A 3ZLWA 3ZMMA 3FXWA 2X8DA 4X2KA 4TL0A 4R8QA 3NSZA 5CSHA 3P08A 3K3IA 2GHMA 2YIWA 4RT7A 3W0QA 2G2IA 4HZSA 3FPMA 4UEUA 4ZMFA 2GS6A 1UVRA 1Q24A 1R0PA 3G6HA 5A54A 4FJVA 1XJDA 3HECA 2HENA 2OZOA 3O23A 4L43A 1UWHA 3EL7A 4RZVA 4Z9LA 3DZQA 2C1AA 3TG1A 3FZRA 3DKGA 2B9IA 3Q6WA 4AZSA 4M66A 5ETCA 3TUCA 5KO1A 4CFFA 3D83A 5FGKA 1FQ1B 4NM7A 2BROA 1YXXA 1Q3WA 2BZIB 2E9OA 3UYTA 5KBQA 5J1VA 4FKRA 4IB3A 4LG4A 4X2NA 4YPSA 4BI1A 3UNJA 3CSVA 2OJIA 5L6OA 4UV0A 2JEDA 5HU3A 4GW8A 3H10A 3UIMA 4CKIA 5HO7A 3LOKA 2WIHA 1PXNA 3OCBA 3PXZA 4LV8A 5BQ0A 3CY2A 3OT3A 4AZFA 3FQSA 1YWNA 3ODYX 3QQFA 2VWXA 3U6JA 3LXNA 4L01A 1VZOA 4D1ZA 3C0HA 5JFWA 5BYZA 4QRCA 4L68A 5AJQA 2PYWA 4D55A 3OXIA 5IA3A 3CBLA 3VC4A 3QYZA 5CSWA 2WTKB 3HV7A 1XHAA 2VTIA 4GSBA 4MQ2A 5AAGA 1JQHA 4YBJA 2O0UA 3QRIA 4TY1A 3BQRA 4F63A 3P79A 4MXCA 3AG9A 1KE9A 3AMYA 3UE4A 4C4HA 4Z16A 2YJRA 3MDYA 4HYSA 4PDYA 3CQWA 3UOHA 3VBVA 2BIYA 5EKOA 3HX4A 3I5ZA 5HZNA 3RCJA 1PHKA 2WMQA 2W1IA 5JZNA 3KMUA 5CEIA 3G90X 4XV2A 5AP7A 4EKKA 2BFXA 2PMOX 3DBEA 2H96A 3TN8A 4IH8A 2XM9A 3KRWA 5GINE 3ZDIA 3LMGA 3GCQA 2CSNA 3GC0A 2CJMA 1IA8A 3FI3A 4B9DA 5KNJA 4O7NA 1CTPE 2FO0A 2W4OA 5JGDA 1JVPP 2H6DA 5AV0A 4DGNA 3RK7A 3RK5A 1GJOA 2Y0AA 1LPUA 4I0SA 4JVGA 4CT1A 5IPJA 2WTKC 4H1JA 3T3VA 3RHXA 4IANA 4RWIA 4EZ5A 5C26A 3VF9A 2QR8A 4NTTA 4PTCA 4FTOA 3QQKA 3F3UA 3QCXA 5BPYA 3F5XA 4F78A 4U9AA 3ZLSA 3E8EA 3FBVA 3OZ6A 5ETFA 2X8EA 2YDJA 4J96A 4R7HA 4EQUA 5BVOA 1UA2A 5CQUA 2FUMA 3Q4TA 4AN3A 4RIXA 2BHHA 3GOPA 5F95A 3C51A 5BVNA 5ACKA 2WTVA 3LFEA 2ZV9A 5HICA 5FM2A 2C3KA 2PVKA 1JSTA 2B9HA 3R9NA 1K9AA 3OP5A 4M67A 5BMMA 4BHNA 4RIYB 2G01A 4N57A 2J0MB 4GCJA 3WZDA 5E4HA 3QF9A 3SXSA 4ZY4A 4GIIA 4B4LA 4EZ3A 3F9NA 5M09A 3E93A 4O7YA 5CI7A 5BUJA 3DNEA 4AW1A 3IW6A 5GHVA 3RGFA 4L42A 4DAWA 2YWVA 4U0IA 1ERKA 4FRFA 2BR1A 4BICA 2PULA 1TQPA 3VBQA 4B8MA 3KF4A 4ID7A 2R7IA 3OC1A 3BV2A 5CVFA 2WTJA 1X8BA 4R77A 3JS2A 1GZ8A 2XK3A 4DE4A 2OFVA 4JDIA 3KULB 4JG6A 3LLAA 1FGKA 5E1EA 5CZHA 2ZB0A 3QZGA 5EI2A 4B6LA 3MH1A 4IX4A 5AR7A 4MX9A 4D1SA 4DF3A 3TNPC 4IM0A 1V0PA 3VS0A 4DITA 4CYIA 3DQXA 1URWA 5KX8A 3EN4A 5L6WL 4AT3A 2YM3A 1IAHA 3IOKA 4DHZA 1OM1A 2B52A 2B7AA 3LFSA 4NIFB 3PSCA 2NP8A 4FT5A 2FSLX 5H8GA 3BX5A 1JKTA 4BDHA 2I0HA 2NNWB 4XV3A 3Q9ZA 3LFFA 4FV6A 2XRUA 4CMOA 4Q9ZA 4D2TA 1OZ1A 3W55A 1QMZA 3KN6A 4EWQA 5J9YA 5AA9A 5I0BA 4EK5A 4MEDA 4UALA 2E9UA 1RJBA 2VTQA 2BZKB 3Q32A 4NWMA 4CMUA 1YI3A 3BEAA 3TTJA 4CG8A 5IU2A 4GIHA 5HIBA 1BL7A 4YO4A 3PJ3A 2UW5A 4O2PA 2PUPA 5JK3A 4JQ7A 3TZMA 1PXIA 4IHPA 5BYYA 3LLTA 2CKQA 4I6HA 3EQPA 1UU3A 4U41A 4J1RA 2PZIA 3UC4A 3KCKA 3SA0A 2J5EA 1G8KA 5IQEA 3IG7A 5AR3A 3PXYA 3R9RA 2BHEA 5C1QB 3R83A 2UVYA 2ZAZA 5B0XA 3ZFMA 4E5AX 4RA4A 3FKLA 2QO7A 4PTEA 1W82A 3NNXA 4J52A 3PRIA 5L2WA 4C34A 2IW6A 2CLQA 3W1FA 2KULA 4AP7A 3ZM4A 3FMHA 3KRRA 5TF9A 3SXRA 3SW7A 2W1ZA 1Y6BA 2OZAA 5EDPA 5HVKA 5DVRA 4YLKA 2BMCA 4NKAA 3EHAA 4GUEA 2AYPA 3OWPA 4ZXTA 4XBRA 4YP8A 1GY3A 4R6VA 3VJNA 5LVMA 4OTIA 1G8AA 4QDVA 5AX3A 4CZUA 3F6XA 4PPAA 4R1VA 4QPMA 5HG7A 4J99A 5IQGA 1OITA 3P7AA 3GCUA 4YUQA 5GJFA 2UZWE 2BDFA 3DK7A 2WMWA 5LXMA 4QTAA 2W4JA 5CXHA 2UW6A 2B1PA 5HIDA 4XLVA 2R4BA 4CMTA 4JBQA 3RHKA 1TQIA 5JFXA 1ATPE 5DWRA 5GZAA 3G15A 5M07A 3QQUA 5IA0A 3BU6A 5BVKA 4KS8A 4FTNA 2GQGA 3P86A 3HVCA 3MY5A 5J87A 2GS2A 4X2FA 3MH2A 4XNEA 4FG9A 3D2KA 4Z3VA 2WTDA 1YI4A 3FL5A 2ZDUA 5A14A 4FTIA 3V5WA 3EB0A 1G5SA 5IQHA 3LFDA 4KABA 3QKLA 4F9BA 3GU7A 2BFYA 2WEIA 3T9IA 1H1QA 4JT3A 3C4XA 4EI4A 3F2RA 3TNQB 2B9JA 2YDKA 4QTCA 5HI2A 2Y4IC 4FSWA 4GG7A 3LKMA 4KNBA 2JKKA 3AGLA 2Y7JA 3QUDA 5KZIA 3RZFA 3D5WA 2H9VA 4BTJA 3M2WA 4EKLA 2AUHA 2ZMCA 4E6DA 3BEGA 1MRYA 3EFLA 4GRBA 4OT6A 4YZ9A 3VS3A 3HZTA 3TTIA 4NT4A 3ORZA 4E20A 2QOQA 5FEQA 3ZHPC 3MWUA 5C8NA 1J7UA 3LXLA 5EHOA 4M3QA 5HG9A 2XNPA 2RG5A 4EH2A 1T45A 4YC8A 2GNGA 4FTMA 2QURA 4H39A 1OECA 4QMUA 3BLRA 5HNGA 2GHGA 5CF4A 3R8VA 2Y4IB 2GMXA 3REPA 5JQ8A 3R04A 3AKKA 2V0DA 2X7FA 5CX9A 2WOTA 2P3GX 4BKZA 4F1TA 3EQRA 3R71A 5CAOA 2J0LA 3ERKA 5GIOE 3FL4A 4NL0A 3R7EA 3CJFA 4MD9E 4YHTA 5AEPA 4G9CA 4PDOA 4I6LA 4IZYA 2DYLA 2GNFA 3QWKA 3KXGA 2GNJA 2X2LA 3CE3A 5D7AA 2BRGA 3RI1A 1ND4A 2G1TA 3MSSA 3HMMA 1SYKA 2VWYA 4FKWA 5ANJA 4GMYA 4OAUC 4HPUE 3TXOA 4WRGA 4EH9A 3I6WA 2ITZA 4DEEA 2J90A 2HZNA 3E3BX 3PVGA 2IPXA 3W8LA 4YTIA 3PY0A 3W33A 3NUSA 3ZUVA 2HWPA 2J7TA 3EFJA 4D1XA 4UMRA 5BNJA 3FLZA 4I6QA 2YM7A 4Y85A 3T9TA 4OBPA 2VUWA 2C6DA 4YSJA 3BYSA 4O83A 3ENHA 4C3PA 4Z55A 4FV4A 2UW3A 2JD5A 4FKPA 3PIZA 3WYYA 4EH5A 5IUIA 3EQIA 2C5VA 4YTHA 3FHRA 3WI6A 2WQOA 3UMXA 4DH8A 3I5NA 3WZEA 4RX8A 2XRWA 4I4EA 3SV0A 4WSYA 1ZMUA 4CRLA 1W84A 3V5JA 4ZSJA 3OG7A 4DEHA 3T3UA 3NW5A 3ZRKA 4U43A 2EUFB 3M11A 2BAKA 4BCKA 3U8WA 3WE8A 2WU7A 2ITYA 2VNYA 2WGJA 3R02A 2HXLA 4ANNA 2UV2A 2AEGA 3FE3A 2EVAA 1IG1A 1JKLA 3D5UA 3PP1A 1M14A 3POOA 4TWCA 5HLNA 1O9UA 2J2IB 2IVSA 4HYIA 5HCXA 4D5HA 5L4QA 3COHA 3DS6A 5AM6A 4KKGA 1LEWA 5DBXA 4NTSA 3WF9A 4R78A 4GS6A 4IBMA 3BHHA 5D1JA 2SRCA 2FH9A 4MXAA 3RAIA 1VYZA 2OXDA 2F7XE 5CEKA 4CTBA 1LP4A 4LQMA 4RLKA 3LMHA 4QMTA 2ZM4A 3WE4A 3C5IA 2BKKA 3DBFA 3MY0A 1J91A 3NNWA 5TO8A 2W7XA 2VWWA 5AUTA 3GU6A 3UOKA 5HIEA 4TYGA 4UZDA 4DG2E 4NZWB 1UU8A 4IDVA 1BL6A 1KUTA 1BMKA 3FXXA 2R3OA 3VUHA 5KKRB 2X81A 4XG7A 4UN0C 3C0IA 4W4YA 4TPTA 4FTUA 4O2ZA 3ZBXA 3SC1A 1IRKA 4HCTA 1SVHA 4PP7A 1BI8A 2GCDA 4IADA 2VTSA 2RGPA 4Q9SA 3PA4A 2OI4X 3UDSA 3G2FA 4N0SA 3VVHA 3D2IA 4O82A 2WHBA 3R22A 1APME 3EJ1A 4BWPA 4EK6A 5CEMA 5K4IA 4AGCA 4BZNA 3Q9YA 3LW0A 3NX8A 4FEQA 4E3CA 3MFSA 1OL6A 5DG5A 3BYMA 4Q5HA 2C30A 4S33A 4FV2A 4FKLA 1MUOA 3BKBA 5H8EA 4TWOA 2XKFA 2PUUA 4RJ4A 4QMWA 4V05A 4TYHB 4BDKA 4EORA 4DHJA 1XBCA 2PVLA 3ZC6A 2XJ2A 3QUPA 2JDVA 2YA9A 1ST4A 4DT9A 1PXLA 4LGDA 4I41A 2JITA 3ID6C 4RVKA 3PJ8A 1G8SA 3WF5A 3ATSA 4YZMA 3RKBA 4UZHA 3DA6A 4D4VA 4I93A 4U5JA 4ZTNA 4G3CA 4H36A 2C4GA 5GZ9A 1JSVA 4FEWA 4QMPA 3O8UA 3NNVA 3ORTA 3PA5A 1SNXA 4FNWA 3QRTA 2PVYA 3HMOA 1KV1A 2XZSA 4FZDB 1VYWA 3UIUA 4F9YA 3OXTA 4K2RA 3PJCA 3IGGA 5IUHA 3ZSHA 4B7TA 2R3GA 3HAMA 4IZ7A 3TKUA 3VBYA 4AXDA 4TYHA 2JDOA 1TZDA 3SW4A 2JKQA 5CY3A 5B2MA 3S4QA 2C6OA 1GAGA 3HA8A 4IJ9A 4XX9A 3PXRA 3JR1A 4DFYA 3KN5A 3P0MA 3BHYA 4YLLA 1CKIA 3SXFA 1WMKA 3OT8A 4O0UA 5CS6A 3QA8A 4BCQA 5AR5A 4EOQA 2VTOA 4I0TA 3MY1A 3MH0A 4UB7A 3BCEA 4PDSA 5HX6A 3ZXTA 4IAAA 5DI1A 4LUDA 3G6GA 1O6LA 3DK6A 1ZARA 2QO2A 2YFXA 3BPRA 4YR8A 5EDQA 4FVPA 2B9FA 4YU2A 3EQFA 3CTQA 3Q52A 3OF0A 2F57A 4YC6A 2UW7A 4L45A 2NRYA 2RSVA 1R3CA 4FKVA 2QO9A 5HD7A 3U9CA 2OJ9A 2PMNX 1PXJA 1PMEA 4FSZA 3PFYA 3AD6A 4D4RA 2H34A 2UZLA 5EHLA 3TL8A 2RIOA 1UU7A 5IZFA 1SVEA 4XP2A 1J7LA 3PLAE 3VW8A 5KMMA 2JDTA 1Q41A 4ZSAA 5ITAA 5JN2A 3BGZA 2CKEA 4FKQA 2EU9A 4FODA 3TYKA 4BBEA 3LZBA 5A4EA 4RGJA 4P7EA 5CVGA 3ML1A 4FTJA 3NYXA 4IWDA 3OBGA 4IAIA 4MQ1A 5F20A 3UO6A 3QCSA 1WBSA 4LI5A 4RMZA 4IX3A 4K77A 4M14A 4NM5A 3P7BA 5AX9A 4A06A 3KC3A 4IAYA 2A27A 3ZLXA 2PZRA 2GFCA 3OTVA 3QQLA 5LMAA 3UVRA 4F0IA 5J8IA 3NDMA 3R63A 2LAVA 4HVDA 3W0OA 3ELJA 5FDXA 4R7BA 4H1MA 3ZYAA 3CS9A 3MN3A 2ZV8A 5IA2A 5HO8A 5FQDC 1WFCA 2XNEA 3OWLA 1SNUA 3W18A 1ZOHA 3GUBA 4X3FC 4FV1A 3SKCA 4WO5A 5AUVA 4LFIA 5A4LA 4I6BA 4O84A 4HYUA 2YM4A 3RBWA 5CXZA 4K1BA 4BC6A 3HLLA 3R8ZA 2ERZE 2YCQA 4KSPA 4M84A 3EYGA 3FAAA 4UWCA 4IX5A 4L00A 4YJOA 5T68A 3VBWA 4LOQA 3AC2A 3PXFA 5AV2A 5L2QA 3COIA 3O17A 4AN2A 4M0YA 4WBOA 2CGUA 4F1MA 4DTKA 4L53A 3V01A 2ZM1A 5CEOA 4I21A 3U51A 1AQ1A 4A7CA 1OBDA 3A7JA 1O6YA 1Z9XA 2GHLA 3H4JA 4QQ5A 4ALVA 3UDZA 2DQ7X 2QOCA 4ZTQA 4R7IA 1S9IA 4F6WA 4C58A 4ZS4A 2JKOA 3E62A 4FL1A 4EOSA 3EFKA 4KKHA 3I0QA 4GK4A 4JOAA 5HU9A 4JG7A 2J4ZA 3VS6A 3M1SA 4OTFA 2J51A 4XCUA 5AIRA 3HUCA 2J9MA 2XK8A 4K18A 4AW5A 4HVSA 4UX9A 2XNGA 4MNEB 5HORA 1Y8YA 4HNIA 2OH4A 3LFQA 3LCKA 5IH4A 4ZTSA 3O0GA 4NFMA 2F9GA 4G2FA 5F4NA 5AR2A 3EWHA 3GNIB 4E6AA 4PL4A 2ITWA 2OF4A 4K9YA 1TFFA 1RW8A 4F7LA 3NYOA 4FIEA 4IB5A 2XALA 1U54A 3W32A 4LYNA 3SD0A 4YJUA 3G0EA 5HE1A 3ZZWA 3OBJA 4J8MA 3BQCA 3MIAA 5EM7A 5M08A 3EQGA 4AUAA 3O8PA 4IC8A 2GDOA 4O4EA 3LHJA 4JQEA 4DGLC 4ZZNA 2BRHA 4CFVA 4IE9A 5F9EA 2ZOQA 3MFRA 5DN3A 3O71A 5JKGA 1ZWSA 3MVMA 1HOWA 1SMHA 5FTGA 2VTHA 2YEXA 4O1OA 3VRYA 2PZPA 3W0SA 2WTIA 1R0EA 5J1WA 4BDAA 3NYVA 2FSMX 3C0GA 4G3DA 4ANMA 3CR0A 4LM5A 4NIFA 1W7HA 2XUUA 2IN6A 1PKDA 3CTJA 3FLWA 3VS1A 2YLFA 3PXKA 4PV0A 4MYGA 3LIJA 1H25A 4I24A 5IDPA 4AE9A 3IGOA 3DK3A 3EN6A 3N9XA 3D7ZA 2YAKA 3ACJA 3MV5A 3ET7A 3NUUA 4FTAA 3FXZA 4AZVA 3KREA 4GG5A 2UZTA 2X4ZA 4JRVA 3S2PA 4C36A 2PE2A 3LCDA 3SX9A 4WNOA 4F6UA 2W1EA 3FY2A 4G5JA 5ANDA 3OY1A 5AP1A 2IW8A 4DLIA 5CU4A 3R9HA 3DTCA 2X2MA 4G6LA 5AP2A 4I23A 2Z02A 2ONLC 4RPVA 5BMSA 5HD4A 3WF6A 4YNOA 4FIFA 1WVWA 2QD9A 3HRFA 2QOKA 4BDDA 3BLQA 1XO2B 2VNWA 3AC8A 2HY81 2PY3A 3R1YA 5I9VA 1DI8A 2VN9A 3NUAA 2J0JA 2E9NA 3B8RA 4MAOA 5B2KA 1PRYA 3RM6A 5CENA 5IA1A 3LQ5A 4IAZA 4HYHA 2WMBA 4C0TA 2C5XA 5LVOA 2IG7A 3D5VA 3AT4A 2XK9A 2YACA 3UMWA 3VONA 2J50A 4MD8E 2OF2A 4QP1A 5HKMA 1I09A 4RBLA 5CT0A 3UODA 2CGVA 3ETAA 2EWAA 3F7ZA 3LJ2A 2OJGA 3Q5ZA 5M44A 1UU9A 5CSPA 2BTSA 3KMMA 2PK9A 3V8WA 5CU3A 4AW0A 2A2AA 3FLSA 3I4BA 3Q04A 5DT3A 5I9YA 3TUBA 2C6MA 1YXSA 2XNBA 3AC1A 3GVUA 2A19B 5BVEA 4UMUA 4C3FA 2UVXA 4M69A 2BZJA 2JIIA 3QA0A 2VWVA 4ZJVA 4APPA 5J9ZA 3UO4A 1OB3A 3HYHA 3NNUA 2YIXA 4QPAA 1QL6A 4F6SA 4L6QA 5DIAA 5DLSA 3QC4A 5HE0A 3GEQA 2OKRA 4OBQA 5HE2A 4JI9A 5K0KA 4C2VA 4EUTA 3ZS5A 5CF6A 3L9LA 4FV5A 4IM2A 4RX7A 5EM6A 2WB8A 4E7WA 1E9HA 4WG4A 4JS8A 4EBVA 4AG8A 2W4KA 4NSTA 1K3AA 4FSTA 3DBQA 4QDEA 2VX1A 3QL8A 3OCTA 3ULIA 3QBNA 4KSQA 4BY9E 2VWBA 4AZEA 3LQ3A 3G0FA 4TYIA 3FDNA 3WZJA 4C4EA 5CZIA 1SZMA 5HG5A 3GU4A 4KWPA 4AZTA 3VNTA 1YXVA 2WAJA 4P5ZA 2WMRA 2C0TA 3IO7A 4JBVA 3GC8A 4KIQA 4ZTHA 2R9SA 2ETKA 4FV7A 1XBBA 4RC3A 4DGOA 5ICPA 3P4KA 4TWPA 3VN9A 5J7BA 2FSOX