3PYCA

Crystal structure of human smurf1 c2 domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
GSEFIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SMURF1
publication title Crystal structure of human SMURF1 C2 domain
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3pycA00
1WFJA 2QZQA 3W56A 4EZKA 1BYNA 1DJHA 3QAQA 4LDCA 4NS0A 1E8ZA 3QK0A 3PS6A 4OVVA 3KWUA 2WXPA 4PS8A 4URKA 4BFRA 2CHWA 3F01A 2WXKA 1DJZA 4IQHA 1E8XA 3N5AA 4EZLA 4BGDA 4PS7A 1BDYA 4FHKA 4FHJA 2A4ZA 3FBKA 3CSFA 2K45A 2WXQA 1DJWA 1RSYA 1QATA 1W15A 2X38A 3PREA 2ENPA 3KWTA 3HHMA 5G2NA 2BWQA 4QJ4B 1GMIA 4NPJA 3APFA 4XZ4A 5EDSA 2CHDA 3F04A 4IHBA 4ANWA 1DJIA 5JHBA 4XX5A 2CHXA 2NSQA 3ML8A 5JHAA 4Y1SA 2WXIA 4WAFA 3IBEA 1BCIA 4ICXA 4ANVA 4GB9A 3L9BA 3HIZA 3T8MA 3ZW3A 3NSJA 5H4ZA 3RPBA 4ICWA 3L08A 2WXFA 4QJ3B 1RLWA 1TJXA 4DNLA 2WXLA 4NPKA 2ENQA 2K3HA 3L16A 4L2YA 3TJPA 4GNKB 4HLEA 4FADA 4L23A 2Y3AA 1RH8A 2Z0UA 2CJSA 3CSTA 4L1BA 5CCGE 2B3RA 3L17A 4LCVA 1DJXA 2K4AA 3TL5A 4F1SA 1E7VA 5CCJA 4QAMB 4MJJA 4AOFA 4AJWA 3M7FB 3L4CA 4FJZA 4A55A 3FDWA 1DSYA 1E90A 2RD0A 4ANUA 4WWOA 4ANXA 4F93B 2Q0ZX 4J6IA 5CCHE 4QJ5B 5T8IA 1W16A 4L1LA 4TV3A 3L13A 4KZ0A 3W57A 2WXGA 2CM5A 3SD5A 4Y1TA 4DK5A 3ZIMA 1E7UA 1CJYA 1WFMA 2NCEA 4NP9A 4TS6A 5G55A 4KITB 3OAWA 3NZSA 3QARA 3F00A 2EP6A 3RDJA 2R83A 2Q3XA 2WXJA 3F05A 4XE0A 5H4YA 3MJWA 3DBSA 3PFQA 3IM1A 3PYCA 4HVBA 4LT7A 1E8WA 1DJYA 2JQZA 2QZ5A 4F92B 2ZKMX 3OHMB 4FJYA 2DMGA 2ENJA 3L54A 3ML9A 4TUUA 2N1TE 3GPEA 2WXRA 1HE8A 1DQVA 2CJTA 2FK9A 1E8YA 3P2BA 3QR1A 4JPSA 2K8MA 3APDA 2V4LA 3DPDA 3TWYA 3S2AA 2D8KA 3R7QA 2UZPA 4PS3A 3ZVVA 4EZJA 3ENEA 1YRKA 3JZYA 1DJGA 4V11A 1V27A 2WXHA 2YRBA 4WWNA 4F91B 4FA6A 3PRZA 2FJUB 2DMHA 1TJMA 3LJ3A 2ISDA 2WXNA 1UGKA 1UOVA 2CHZA 2A5UA 2KI6A 3QR0A 4KZCA 3R7RA 2LHAA 3APCA 4G11A 1UOWA 3NZUA 2NQ3A 3B7YA 3QJZA 4FLHA 4FULA 1K5WA 4WWPA 2CM6A 2WXMA 2YOAA 2WXOA 1QASA 3HN8A 4WEEA 5KJ7E 1A25A 4OVUA
chains in the Genus database with same CATH superfamily
3IJHA 3EJJX 2HMID 1KGJA 5E7FA 1I8KA 5AB2A 4H25B 1OOWA 1UACH 4RLDA 5K39B 4ZPVA 1T1WB 1LMIA 2ICCA 1RJCA 1QWUA 1UWYA 3LQMA 5I6NA 1L6XA 3LVEA 4TKWA 5E5LA 1JGEA 1PD0A 4Z8FH 2G3NA 4K94C 2Z31D 2JI3A 4CNIA 4KTEH 4ANWA 4HWUA 5EEUA 4JLRA 2XQYG 5CD5D 1MRDL 5FYKH 3DJTA 5E6IC 3UDWA 1KCVH 3L3IB 3AY4C 4TQHA 1S9YB 3BH8A 4PB9H 1E2VA 5IEHB 3MFFB 4OGZA 5FGRA 1UT1A 4LP5A 4S1DD 2Q6WA 4UINH 1I3RB 1KF9B 2TRYA 3F64A 4NKMB 2GITA 3IF1B 3T4YB 4PJXB 5D72L 2XQYK 4EQ3A 2EVJA 2WLLB 4U31A 3GMMA 3MV7A 3Q6FA 5BZDA 2ARJA 2Z0UA 1Q9OB 4L1BA 2G30A 1P6FA 3CSGA 3VFNA 5KS9F 4MNGB 2K4AA 1VGKB 2XFXB 2BP5M 3DI2B 2VL5B 5GS2H 2BS8A 2C3WA 5DWUL 1AZVA 4AOFA 3RE0A 1XH0A 4BH8A 3U82B 5BZXA 3CAFA 1BQHG 3QIWA 3LN4A 1JTTA 4GSDH 5JMOC 1KCUL 3CMOH 2J21A 2JKXA 2L7EA 2NY3C 4LMQE 4CW1A 2Y7QB 1LILA 3D18A 4EXKA 2V5RA 1D6VL 2XA8H 4GY4A 2X0VA 4XGZB 4U1KA 3U0TA 1RIVH 4LEEA 3G3LA 4NHUB 3VFGL 3VXRA 2Q10A 4TUJB 4L29A 4OI7A 4YHYB 3D3VD 1QFUL 2GI7A 4YGVA 5FK9A 1L9NA 3T04D 4FG4A 3KCPA 1PY9A 2OMYA 5GS1C 1U8HA 5L0QB 4KK5D 1HQ4B 4WWKA 5E1GA 3SPHA 3GBLA 2BSSB 3OKMB 1MJJA 5BV7B 5BV7H 3RYMA 4P3CH 6TAAA 5E94A 3GM8A 3VWKC 3W0WE 1CXIA 5IVXB 3NZ8B 1A6VL 1CS6A 2DLFL 4LGPB 3BO8B 4M6NL 1GYUA 1VAHA 1Z9SA 3EYSH 1N4XL 4X5QA 5LBSH 4ENEC 4MXWH 2DM3A 3OKOB 3T65A 2WXHA 4Q8BA 2IDTA 1O9ZA 2VDNH 15C8L 5JHLH 1WF5A 2OP4L 3PWUB 1SZNA 4YHZH 4HKJB 5B7FA 4JG0H 3LHAA 4L3AA 5GJSH 3TBCA 5CKAA 3ZTJH 1G7QA 2CJ3A 4LL4A 4OUUB 5E00A 3NJNA 4Y2OB 5KJ7E 1S7VB 3CC1A 3GSXB 1EDQA 4EZKA 2JI1A 4AEEA 1B0IA 4XP9H 1MG2C 2NX5B 1C7TA 3GINA 1J7VR 2Y6SD 1R9FA 1BQLH 2YMXH 3VG9C 2AABH 3ROLA 1ZA3A 2KL6A 2Z0BA 5IHLB 4OSUL 1TVHB 3KPNB 1H3TA 2EYSB 1L7IL 4PLJD 4YHOL 3WUWB 4AIZA 4MYPA 3L1GA 2Q8BH 5F6IB 1Y7VA 4GSUA 2HFEA 4K94L 4N0UB 5KSUB 2GBTA 4PVMA 1RP9A 1V55B 4HALA 2NNCA 1JHLL 1WBYA 4HUUB 1MLBB 1S7XA 4XPBL 4NXKA 2H9GA 4TSBL 5L7XH 4FP8L 4O02H 3ZKNC 1KPRB 1AS7A 2SEBA 1DQTA 5FDYA 3SGDH 3UJJL 3ZIYA 3W1ZA 1BFVH 3TJPA 1Q0XH 4IU2A 2W0FB 1PU0A 5D1XD 1P9MC 5ETUA 3QAZB 4PJ6A 4IRSB 3OKKA 1T03H 1DBKH 4Z0BL 3L4CA 5FDWA 4YQXH 4K9JA 4LLDA 4YPGA 3WJJC 3OGCB 3HBZA 1DHKA 1MKFA 3D3VE 3G5XB 4QKXB 4UM8A 5C07A 5DD1H 3MPCA 2C7FA 1AQKH 5AOLA 5FA3A 4DP5X 2AK1H 3O3BB 3N55A 1WFTA 3PDDA 3EGXB 1BECA 5DS2A 1OB1B 5TH2A 5C07E 4Z95L 2Q87A 1R46A 3GMPA 5KVEE 2QL1A 2C1PA 1JHTA 1INDL 2NY1B 4NKOA 3KXFD 4ZQKB 5GGTH 1MCNA 2CDEA 2X89A 3H7BA 4ZPTA 1F4YH 1I8IB 4LLWA 4MJIB 3BDYL 2Z64C 5JDJA 2Y5TB 4RWHA 2IEPA 5CUSL 4MHHI 3KEHA 2B8OT 3T0WA 4F5CA 3KPMA 5HVWA 3NSDA 1ORQB 1TJGH 3O4LA 2AJYL 2C4XA 4QXGH 2F8OA 1SF5A 4GW4A 4AM0A 1HXKA 4YEEA 4D0CB 1UM5L 2OZ4H 4UTCA 5I8EB 3VD9A 1D5ZA 3E8VA 4IMLA 5JIHA 4JM2A 3R4DA 4MS6A 3DJSA 3R7RA 2IIJA 1BF8A 3CN3A 4X6FB 2XCMC 1N12A 1RUKH 1ZK9A 2V6HA 4K07A 1G9EA 4JY5H 3TBWA 1AIZA 4UDUB 5DUPL 3X1FA 1V7ML 2ZCKH 5ISZD 5DJCB 3KLQA 1JP5A 1WFUA 3IU3B 1V10A 5KZCB 3NK3A 1OSPH 5CFAA 4G6KH 4H0LC 2QHRH 2NY2D 5C3TA 4UV7H 1NCDL 1H0DB 3DMMA 2ZAGA 4P2QB 2ZJSH 1FAIH 4YDKL 1IAII 1MPAH 4MA1C 1WLHA 5D71L 4WV1B 2FQDA 5D93B 3IAQA 1YNTF 2GAZB 3LXAA 1UXLA 4V2CB 3HMWH 4K8RH 5KBNC 2EJ1A 1RJZB 3LZNA 4JAMB 3RPIA 5D1XE 3V5DA 1OTUC 3G5WA 1KDIA 1ZPLA 1ZTXL 4CU7A 3ELAT 4PQXA 5I1IL 2Z6FA 3LNIA 1NFDB 4DZ8B 3P11H 2XKNB 3EJCA 3P30L 1SF3A 4L8SC 3IXTB 1X5XA 3RJOA 5IEHA 1HDMB 1OHZA 3HS0C 1IAKB 1FO0B 2YO3A 2HT2D 3UTSB 3FONA 2F6AA 2V7NB 5HHPB 1NEPA 4JRXA 4PJXA 4I9WD 1DUZA 1E6OH 2BCKB 4HIEB 4P2RB 3DJZA 1VFBB 2CH8A 1YC7A 1C08B 3SDAB 4RBPH 1VFAA 4XWOD 4J6RH 2ZKWA 4JRXE 3X11B 1DQLL 3L6FA 1SN5A 5AAWA 3OAZH 5CZVL 1HAUA 4QCIB 3L2NA 5C0AB 4KY1L 1WFMA 1JERA 5IQ9A 2A74A 5E6ID 4UBDD 3QUHA 1ODAA 3QNYA 1ED3B 3F7LA 4DUWA 4B41A 2WUBL 3U4EB 5T5NF 4DVRL 2Y7QA 1QUNB 2YPVL 4JL2A 4LCUB 2R27A 3LN5B 3Q1EA 4NHUA 1UD5A 4TUJA 3UJIH 3I3DA 3TM6A 3TJEL 5FCUL 3GUTA 1G4RA 1D5XA 4J3OF 4LHJB 3DX9B 4EE2A 3RKPA 4XNUH 4BM7A 2K6YA 2EH8H 3OKMA 3FRUB 5K93A 5ID1A 2AERT 3IJ7A 1N59B 4OF3A 4OGXL 1GGCL 3ZL1A 1YNLL 4TYUA 3BHBA 5ISZE 4PG9A 4DWHA 3BO8A 4OIIH 3SE8H 2FJUB 3ARFD 2NY3D 2XVLA 2NYKA 2IDQA 2NR6A 1CLZL 3BAEH 3WTUA 2VM3A 3OKOA 3RL2B 1MLCB 1SY6A 3C60C 5TDOB 5TE6L 1AY1L 4ODWB 4X6EA 4ESKA 4F8OA 3HB3D 4ISVA 3ZE0B 2YA2A 2R8SH 3S5LB 5E1AB 5JYMA 3H53A 3PWUA 2PYEB 3FO1A 5I0VA 2B08A 4CSZA 4GW5B 5B39B 2G2RB 3PQYD 2NLJA 3BEVB 4HFUH 2VM4A 4OUUA 2BMKA 3HNSL 2JKIS 4Y2OA 1SNRA 5DK3A 5ADPL 3JVFC 5DJZA 5JW4R 3FTUA 1F6FB 1FZOB 1DJZA 4APQC 2NX5A 3VWKD 4HIQA 3ZDYF 3VYOA 1G84A 4OLUH 1NCWL 4NQTA 2ODHA 4W4OC 2MWCA 3STZB 4EQ2A 2P8PA 3UAEA 1TVHA 2EYSA 3GSNL 2BNRB 1NJ9B 4YL4A 4KVCL 3HE7C 3HC4H 2HT4C 5EZPA 5KSUA 4BSJA 2HKHH 2GJZA 1FVDB 4N8CH 4I9WE 4HUWB 4FYQA 7FABH 1J9QA 5IW6A 1EUUA 5DMIH 2ATPB 2CXGA 3INUL 2RFXA 3QGVA 4GQ9H 3AY4A 2DKUA 3D39A 4OFKA 1SXAA 4N8VB 5T1LB 4BFOA 4KTDH 1S9VB 5JOFB 4IBSA 4R3SB 3NPZB 2MQGA 3JTTB 4KQ4L 1MCWM 1Z3GH 4JFDA 3D39E 1UJ3C 1UM4L 2Y7NA 1UYWH 3ATDA 4BQ9A 3QFJD 2DWEB 2EDWA 5BOZG 5I1KL 1D9KB 4GLRI 3U2IA 1ZLWH 1KPUA 4Y9GA 4TL4A 1VLXA 4AJYV 2DYSB 3ESNA 3G5XA 4YUEL 1L0QA 4RGMC 3VFVB 2F54D 1JZ6A 4G1MB 1IEAB 2DQEH 3REWA 5I6MA 5I1CH 2DD8L 2J2ZB 4W9HC 4UT9A 4FDWA 4OGQC 4F2ME 3KLHC 1J9SA 3FT3A 4YMPA 3CFDB 4UTAL 1KWKA 1UATA 4M3KB 2FWUA 3D0LB 1JPTH 5A16B 3P0YL 2G5BB 1OM3H 3QIBC 3RZCB 2HTLD 3OJDA 1DQJB 3B43A 3DC0A 4N0YL 5GS1A 3LVTA 1UA6L 3O6FC 1P5UC 3D48R 3FU5A 5GRVL 4LLMA 2YJQA 4OJFH 2QQLH 3KW7A 1ORQA 3GSVB 3CLFL 1MF2H 4WHDA 3PQYE 4OZHE 1WCBB 1JV2B 1FSKC 1OQOA 1QWNA 2DMHA 3NUKA 1U6AL 3QSKB 5AW1B 1A5FH 3ATEA 2W9EL 1A64A 4XWGH 4XC3L 1VZGA 2EDBA 1SMAA 1HSAB 1IGYB 1EEYA 3JT0A 2C3VB 3A23A 3DTDA 5HPOA 2W81C 4X6FA 1AQMA 5C3LD 5J11C 4E42B 3HOGA 2WQAA 4ZODA 3P4NB 5L2KB 4N8UA 4HGWA 3FAWA 4EIGB 3JVGC 1DVQA 4HIIA 5DJCA 4PFEA 5L6YH 1IQWL 5B7MA 3WFCL 5HVHC 4M3HA 1B3JA 1KCSL 1H0DA 1YUHA 4P2QA 3V0GA 3MRKA 4APQB 4D9LH 1KDJA 1FYTB 1I9IH 3NVQA 4KO7A 4ZMTA 3ULSA 4KY2A 1MWAA 4ZXBB 1CL7H 4NHCH 2BP0B 2RMNA 3FB7B 2BHFA 4OZFG 1YEEL 2GAZA 1U8OB 3QPXH 4NPYB 3K71B 2J73A 3HE7B 5LDSA 1UWGH 2NT0A 1OZTG 1HL4A 3ARSA 4JAMA 4WHYG 4Z5RB 2WOBA 2R69L 2GBAA 4GKSB 2PO6B 4HLEA 1NFDA 4L3ED 3C5ZB 3VM5A 1ZV9A 3DGGB 4XMPH 3V0AC 3FQYA 3D4YA 1HDMA 4IGBD 1XD1A 1FO0A 2IADA 4OB5H 3ZUNC 1WGVA 3JUZA 2V7NA 2F54E 4OM0H 5AKTA 1QBBA 1ML0A 4GRLD 2WLHA 5GIRB 4HIEA 3TV3L 4P2RA 2L0DA 1P9MA 1VFBA 4P8QA 4UANA 4GMTL 1QNIA 2C7UA 3EOAA 3D34A 3AACA 1RZJL 1KLFA 2PXYC 1BM3H 1NBYB 1NIFA 3JV6B 3X11A 4XR8C 5KANI 3QNZA 5AVRB 3V0VB 1ASQA 3MLZH 1WAAA 2OL3B 3CVIH 3QQNA 3R06B 2VJ8A 4QCIA 2VXUH 3TVMC 2QTEA 3OPZH 1FVEB 2W1NA 4AUUA 9CGTA 2D4DA 3OAYK 4NQQA 1OLLA 4PJXF 2WKOA 4NO2B 3U4EA 2ITEA 2JJTC 4HW6A 1WAAE 5GGSB 3LN5A 2DMGA 4B50A 1F4WL 3DRQB 1WDAA 1UXWA 2EZ0C 3AG1B 3PNWA 4NQDD 1EA9C 4G5AA 3QCTH 4G3YH 4N0FA 3KM2A 1FLRL 1E6JL 2ZIDA 4GXVL 4LVOC 3VI4B 3NSFA 4M48H 1S78C 3ETTA 2N3JA 4PJFA 4NAMA 1GY2A 4ZX6A 1FSKB 3GSUA 2K7QA 5F1KC 2CCVA 6FABL 4TNGA 1W72A 2MPAL 1L9TA 1YUKB 4KKAC 4TQEL 5HYEA 1HXMA 1OSZA 1OCCB 3LPGA 2ZWLT 2X1XR 5TDOA 1AH1A 4PJFE 1ET8A 4P5MA 5GGQH 3WS3A 1TSHA 5D6CA 1TXKA 2O5YH 2WUCH 5FO7B 4UT6A 3UEZA 4ZQTA 4J3VA 2G2RA 5EWIL 5EU7E 4QTFA 1CGYA 4YDJB 2OSYA 4A39A 3MJ7B 3O0LA 5IVXF 3ARRA 1F02I 5E2UH 3WFEL 1ADWA 4JHVA 4ZFZB 3S3PA 5I6XB 1A9EB 1S5IL 2PWEA 1SPDA 2BVTA 1WZ1H 3OHXC 3PREA 4PYGA 5GS0C 5JMRA 1NMBL 1RULH 5CJBA 3FU6A 3D87B 2FJFA 2XBDA 3DV4A 4K9EL 1HKLH 4OCRH 4BZ2L 2CRZA 3MBED 5I30H 3K2UH 4XN7A 3FQXA 2XWDA 1P2CB 3LV3B 1URZA 1TZGL 3RKDC 2E75C 4MNQB 3X1EA 5AVVB 3WFHB 5I1HL 2BNRA 3N9GL 4CAGA 4D3CH 2WPGA 2QKIC 2EXYC 2DQTL 3MSPA 3FYIB 3GSNA 1WAPA 3G5ZB 2WNGA 4O5LH 5HVFB 4HUWA 3WSQL 3B2MA 5D7SH 3ZDXB 3HLKA 4PCSA 4YSRA 4LVNB 5F9OH 4KH2A 1X5JA 4OKVB 2C9AA 4L8SA 5E9NA 4MJJA 2OYKA 1E42A 1M71A 2IQ9L 3D6GA 3JWOH 3CH8A 2JXMB 4N8VA 3HS0A 4KO9A 3D5OF 3NACH 1LTXA 3B9EA 4R3SA 4XVTL 2FZ3B 1BAFH 5HDQL 4N9GB 1EJOH 5D7LD 3ABMB 4N5ED 4YZWA 2L7QA 3SGEH 1EIBA 3H55A 1YEIH 2AEQL 4OJEH 2QV2A 1S7SB 5DUJA 2JK5A 3L9EA 4HWBA 2Y4SA 2HRHA 5CS7A 2A38A 2VDQB 3EG9B 1MAMH 3RDJA 3ZRFC 2YRZA 4JO3H 5EIIG 3L3JB 3WY2A 1VENA 4G1MA 1IEAA 4NQDE 5JW5B 2W0LA 2NXYC 4FKEA 5HPMB 3VAEA 1NBCA 3I02A 2KZWA 2ZKHL 5C7XH 2AC0A 2VZ1A 1LQBC 4NXSA 4CVXA 1RZPA 4ZO8A 3N85H 3PHQB 2PUQT 4ABWA 2HJLA 4Q14A 3S3BB 1VCAA 3BH9B 3RVWD 3GJEA 3O9WC 2H0EA 3NDZE 3ZTNL 4ZD3H 2DQJL 2BW4A 4HGKC 5MEPA 5HHMB 3X2QB 4QRRB 2R2BA 4Y19B 4PJ8C 1INEH 3MKKA 4MCMA 5ACMA 5HYSG 3NEOA 3QZWA 5E8DL 1G7LB 1KXVC 4IRJC 1DYZA 4CDGC 5JQIB 3B8SA 3MMEA 3QA3A 4UIKL 1QBMH 5LJYH 3TO4B 4W68A 5EU5B 2YOCA 3VJ6A 5FUCC 4DEUA 2DQIL 3TN0C 3WKPA 2WXOA 4JKWA 5A6LA 2A9MH 3Q05A 2Q2EB 3L7FB 3MLYH 1TFHA 3MRGA 1KYFA 1IGYA 1DJHA 1WFIA 3ILQC 3VXNA 3C60A 4M7LT 4WEBH 1ZE3H 1E4XL 4PRBA 4Q52A 3DTXB 5DQJA 2DW5A 2MPVA 3P4NA 1HH9A 1GC1H 2X6CA 4WUUA 5BUPA 1DP0A 2HLAB 5IIEA 1PYWB 1N0LB 2YJLA 1BP3B 2RR3A 1NFAA 3D4GA 3IRPX 3O6FD 5CBEB 4BRVA 4U1MA 4ATTA 5DYFA 4XCFL 5JQ6H 2CKBH 3LKPA 4XP6L 4AIOA 5DD3L 1M56B 4APQA 4F8QA 1IL1B 1VEMA 4JG9A 1KN2L 3G6JB 5D8JL 5I0YA 1S5HA 1E5YA 2YK1H 4HK3J 1OP5H 2HLFC 4W4OA 1HNYA 4LHUB 2BP0A 3LZPA 3U36A 5MENA 3FB7A 4QTIH 4AE1A 5J06A 1DVSA 3MBXL 4D2NA 4M7JH 3L16A 3HE7A 4XVUC 5F1IB 1IM9D 3LB6C 3OB0H 3WO3B 1H6UA 5TQ0H 3O3DB 5MENE 3EH4B 4GKSA 4IJ3C 2NW3A 2F58H 2AZUA 1HQRA 1R5WB 2R69A 2YSSB 4GUQA 3UAJD 3AGWA 5KTEH 4OCXL 5C0CB 3RIFF 3RWFB 1AZZC 3HC0B 3MTXA 4OLYH 5C0EB 5AAMC 2IH9A 2I26N 5E5MB 4JZJC 3FT2B 3O2VH 2CM5A 3H4HA 4Q4IA 4OZGB 4URTB 1TQUA 5GIRA 5HI5C 5EDXA 4X5WB 4LRIC 2QMKA 2ZKYA 1IC4H 4W81A 1I3GL 1GXEA 2X05A 2EACA 5JLZB 2NY6B 1UJ3A 1Q72H 1JXDA 1NFDF 1YAZA 2XVKA 3MOBH 3VU1A 1A8ZA 1QZNA 4XCEB 4LPYA 1PJ9A 3IMBA 1KY7A 2LW3A 2OL3A 3R06A 1NCCH 4B9GA 4DSYA 5KSVB 1ACYH 2X3AA 3EO9L 5DD5L 1JMZA 3S35L 4FJYA 1KENH 3D05A 1NCJA 1BF2A 3QNXA 3II3A 3TWCH 3I6LD 1XCWA 5D4QA 1L9OA 1IU1A 3RWDA 1WIUA 3QUMH 2HP4A 2EIZB 3FSVA 1RXLA 4YBLB 4WI7A 3WTXA 2YD7A 4OLWL 3PHSA 3QIBA 1NC2B 3KR3H 4DKFL 3T1FA 4BFIB 1XR8A 4LU5H 4LPVA 1LO4L 1MRFL 4KZCA 1JGIA 3MRHA 3QQ3A 3ULVC 1P5UA 3VI4A 4PW3A 3B7YA 1JUFB 1J88A 3O6KH 1R24B 1MCRA 4U2ZA 1TCRB 4WKXA 2E7HA 2O26U 2BSRA 3BKYL 4QUOA 2XOTA 3KPSB 5T1KA 5LCVH 3N1PC 1FGNH 2BFVL 3QG6B 3U6XS 3VXUB 3VXMD 4EZLA 4NQSB 2EZ0D 2J6EH 2PW1B 4I0CC 5JXAL 5B38G 2N56A 4G6ML 1RPQA 3NJJA 3CVDA 4CADB 2VMDA 5EA0L 3TEZA 3O2DL 3JVGA 1A9EA 2X2JA 5ID0B 5LG6A 4FZEH 3IBOA 3OXRB 4QHMB 3MACL 3J7HA 4AZ8B 3ZW3A 1AFVL 3ZE0F 1KB3A 1XGZA 1CDJA 1HYSC 1P2CA 2GUOA 4MNQA 4BZ2A 3WFHA 3B3IB 3GB7B 4ES9A 3HW7A 1KXQE 1HESA 4XMKH 2E86A 4UB0L 3TL5A 1GKOA 4OFYD 3WIHH 3EBAA 2LABA 3FCTB 2IPUG 2I32A 4XMVA 3TYFA 4AXWB 3T3ME 4NGHH 4A66A 2CZNA 1CUOA 2Q76B 3SCMC 2EC8A 2YAQA 1CFNB 1QWHA 4D8PA 1GZQB 3RNQB 1H8LA 2OJ1A 3FT9A 5JR1L 1Q90A 5GGVL 4W9JC 4UQ3B 3GXIA 2HG5A 4KHXH 3TBTA 2FZ3A 2VABA 3U1PA 3MR9B 4YLBA 3I6LE 3WHXA 1EO5A 2EILB 3LRHA 2AEIT 3OC8A 5DRWA 5I76B 4D0DA 2VDMH 1AKJB 2EXYD 5H4YA 3SO3C 4NQVA 4KXAA 1R34A 3BZFB 3QDGB 3GI9L 2PXYA 4TSAL 4WZ9A 1DJYA 3U6RB 3EG9A 3L3JA 2E0PA 4HS6B 3TVMA 2JELH 5C0FB 5HPMA 1J5OL 1MFEL 1H6FA 2VZVA 3H9SD 4PS3A 1OGAB 5H94A 3ZVVA 4Q9RL 4W1TA 2H6PB 4K15A 5BPPA 4DGWC 5D5ME 2OQJB 3BH9A 4FFYA 2OR9L 2WVVA 3VXOB 3CE1A 3H9HA 1DBJH 2BVUA 3FU0A 5HHVL 4LCWD 4Y8AA 5F96L 5INCB 3VFMB 1AQHA 3UBXI 3X3GH 3QJZA 1FC1A 3A6BL 1CURA 3D25B 3VXME 2GCYB 4M5ZL 5AW2B 4LIQH 1H8NA 2IPTH 4F9PC 2OS7A 2PPEA 4N22A 3KWUA 1EVTC 3CQQA 3K6SB 2D3VA 4IEFA 1FQ9C 3NIFB 3BAKA 5LQBL 1GJWA 3BE1L 2A6KB 4PTTA 3CHSA 1KIQB 4CC4C 1YYCA 1NM9A 2YA1A 4A6YL 5AOMA 4QHPA 2MEJB 5CILL 4Y88A 4M8VA 3MRRB 3A67H 1JYVA 1C8QA 5CBEA 3CGTA 1IGTA 3QJRB 4OTXL 3GRGA 3OHXA 5ESAA 5EOCJ 3H54A 3L08A 5D7IB 1IL1A 4MBOA 4O2FB 3HE6B 3OSKA 3FB6A 5J4MA 3WMPA 1E5UI 4DP0X 4G6JH 1FE8H 1XCQA 3D4ZA 3GXUB 3UYRH 2HTKC 2XC8A 3JWDC 3LAFA 1FDLH 2VLJA 4I77H 1MIMH 1NMAL 1ZV2A 2Y06L 5C9JB 1AQDB 2QKIA 4QRTB 5HD8C 2KT6A 3JWNC 2BOLA 4U0RC 1FJ1B 3L4WA 3NIGE 4H8VA 1W0WA 3BFQG 1WWBX 5F0MB 5I15H 1RUQH 4CKQA 4GAJH 1JRHI 4XTRD 2MCMA 4L0ZA 2VDKB 1QUPA 2XI9A 4YO0B 3HZMB 5EZOH 5EF1A 2ZCHH 4DKEH 3J27A 3FT2A 4ZMVA 3DOIA 2WLYA 4TS6A 3QT2A 3LTVA 3LPPA 3RX9A 2J12B 2W94A 2LU5A 3AXHA 3SDCD 2OMXB 4WSJA 1DBBL 3ZKXC 2X4UB 4NBXB 4LT7A 2QZ5A 4XCEA 3BZDA 3STLB 3QUXC 4Z23A 3LB6D 3E1F1 3L54A 4M1DH 1JCVA 2R56L 1RZKH 1NUDA 1FI8C 3QUZB 5DJYB 12E8H 4LBAA 4FA7B 2WTRB 1DQVA 1U4FA 4BH7B 4LCWE 3NPSC 3GEFA 2W65B 4NZTL 4KMTH 3RDTB 5J6SA 3NJXA 2R4RL 2JJVA 4J4PD 4DN3H 43CAB 5IHZB 5JPNC 3EBGA 4JFXA 4MXVE 5DUBA 2EIZA 1SRDA 3CZEA 4JUTA 5LO7A 5AD0A 3AVEA 5BRQA 4TF4A 3VRJA 1VCBC 2NSMA 3GXFA 1AO7B 3AS1A 1XGPB 1Q4NX 2FLMA 1NC2A 1K5NB 3O9WA 4P5KB 5DJ8A 4BFIA 2QDWA 5E4EB 5CAYB 4IBQA 1KYAA 1QRND 5DQDH 4PJ8A 2ARWA 4GKZA 4AIXA 2JI2A 5TQ2L 1JUFA 2WQ8A 1KB5A 4IRJA 4KXZI 3QAQA 1BJ1H 4RFOH 1A4KB 5AZUA 5JIDA 3G6DL 5DEZA 2DTSA 3MRMA 1JRHL 5EH1A 1N2RB 2XY2A 3TN0A 2LE9A 1JWSA 4FQIH 3RFZB 5F3HA 3FBKA 3NESA 4XRCA 2JB6B 1ZA6B 3KPSA 5JW4M 1BYOA 5E9DD 3S3CB 1JPSH 1F2XK 3N91A 5LNEA 3ZKQD 1PF3A 5FUCE 3UTTB 4WJKB 5IESL 2XZAL 3VI4F 2Z91B 1LE5A 2J44A 4LSRL 1IGJA 1EANA 1K9TA 1MFMA 1YEFH 2VXQH 3V9EA 3C8HA 1JZGA 3SY0B 4HOZA 4J28A 5LNGA 4G8GD 1J87A 5FGSA 5JNYB 1YYML 5JIQA 1IX2A 1QP1A 2E9IA 4I5BB 4ACPA 4WI0B 2ZUXA 4R97C 3TBBA 1HNFA 5HJ3B 3LKOB 3ULVE 4U1GC 3VG0L 1ZS8B 2ZXCA 4NNXA 1SM3H 3FUIA 3NAAL 5FFGA 1E7VA 3MYJA 2W5PA 4M4RB 4ZTOH 1LEIA 3L3HB 2L3BA 3I6KB 2EYTA 5DS8B 5FGCB 3IETB 4OCYL 2IWGA 1BZQK 3GLDA 5LWYL 2NQDA 1V8HA 2XKUA 3KS0H 3EYUH 3H3PL 1CFNA 4Q2ZB 3GZQA 4JO1L 2NW2A 1NEZB 3BIKA 4FQCL 5AAMA 4M5TA 3IJEB 4LFHG 1XCTA 5BS0B 4UQ3A 1DEEA 3DYOA 1HYSD 3FTWA 3X1GA 4ONGL 4ODVL 1F3JA 3LNDA 5CSBA 4E5XB 2ZWSA 3RJDA 1YNKH 3MR9A 4ORZC 3ZDXF 4LRIA 4JJ5B 4D8OA 1T0MA 1GVIA 1OF2B 5FX3A 4RMWA 2KMWA 3U6RA 2ZCLH 4P2YA 3Q3GA 3WTSA 4U4IA 3PV6B 4KKCC 1TUPA 4HJGB 3VXQA 1R19A 3IRZA 3ISWA 5HHOD 1MEXH 3BPNC 5AALA 1MH5B 1GGYA 3IGFA 2WD0A 3NRPA 4HK3N 5DSCA 1IKFL 1W0VA 1I7UA 1QRNE 3PWLA 3NG5A 4AGPA 1MCPL 5AVWB 2DS4A 3WEMA 1OWRM 1EK3A 3Q8EA 1P5VA 2N0KA 3PPSA 4B5EA 4GBXC 5KN5B 1WFNA 3ZBMA 1KYOJ 3CZGA 4QRSB 3F6IA 3KEDA 4KUZL 4H0GA 3NZUA 5KAQG 4LZKA 3RVUD 2FSDA 4ZX3A 1EMTH 1I3VA 2H2PC 3UROR 1TJIL 4NZUL 1M4KA 1OAXL 4H40A 4HU8A 5KVEH 4I48A 5INCA 3B5TA 4GT7A 2JB5H 4RX4D 2EVFA 5E9DE 3DHPA 4KZDH 2C9SA 2GCYA 1NPJA 3ARXA 1MUJB 1QBLH 4KOBA 2XQYA 3MCKB 4NJ9L 3ILDA 4AYDC 5L2JB 3R0MA 3OVUB 3CSFA 5CEXA 4PBXA 4G8GE 4MJ2A 4WWID 3K6SA 3LNFA 4FAAB 5IOKA 5IQ7H 1TLMA 2A6KA 1BLNB 1TZHB 2CUAA 3EYOB 3GMLA 4JPIB 5AYQA 5H37G 3GBDA 1A7RL 3DHMA 4BK4A 4XPTH 4XMWA 4XO5A 1KG0A 5I0DA 1ZJBA 3HRZB 2GEEA 3KG5A 2Y36H 3CTTA 2F18A 1PDKB 3US1A 4YLQT 3GS0A 3IN0A 2J8UB 4G5ZH 4BHUI 2AMGA 1A22B 1BQHA 2FD6L 1OAKH 3BH4A 4QXVA 3C8KB 3HC3H 3LS4H 3WTVA 4IMKC 2A9NH 3OM3B 1E40A 3EOYG 4FLOA 2PF6A 4YFDB 3D2TA 1W6WA 4DKAA 1BFSA 4R5VA 4DP8X 2A7BA 4HAGA 4DTGH 2RD0A 2YKLH 1R3IL 1JSYA 1T2QL 1DLHB 5J1AB 5L9DH 1FJ1A 5EBLA 1SBSL 5ITBL 2X9YA 4M61B 1HL5A 5EEYA 5CLYA 3N1QC 1R0AH 3CZNA 1KIRB 3V8CA 5I9QC 3G6JF 1DE4B 2V5YA 4ODTL 2OR8A 2LAAA 1ZOXA 3SCMA 3LQZB 3CSYA 2P42B 1RZ7L 3TF4A 3MRDB 3BLKA 5IJBC 4Z7VE 1EGJA 1IRAY 3RBGA 5CU5A 4KRPB 4KX9A 2WINB 4XNXL 5HHOE 4IBWA 2BP8A 2MQ3A 1FZMB 4WNQB 1MHEA 3C8DA 2NPLX 2APWA 4Z7NE 2CK2A 2OMXA 1UT2A 5C0IB 3POCA 1TZOA 2X4UA 2RGSA 4NM4L 4A7UA 4JRLA 4KZEL 2IC2A 1MRDH 3PWJA 2WOYA 4XPGL 5J6GB 5IFAL 4WW2B 2EINB 2LU4A 2XT1B 5DLML 3DURB 4E9QA 2VWEC 3HPJA 4OUOA 2QT6A 3MRNA 1NDGB 3B37A 2FAUA 4ZMQA 3EXJA 4OZGF 1WT5C 3UH8A 2PPCA 1F45A 3KXFB 1RFDL 4N2MA 3BJLA 1GPOL 4ABVA 5D72H 2FL5B 4PBVC 3WLWC 4PV9A 5DR5L 3GJFA 4WWPA 1B4TA 2IQAB 2MSPA 4JDZB 4X6DA 1I1AC 3TBYB 4GXUN 4EJ1C 2YXMA 4XI5C 1I7TA 5DWUH 4W9GC 4Z3EA 1JZEA 4LSDA 3IJSB 4RGNC 3WJLA 4BE5A 4BUQA 4XVJL 4BZ1A 4PB0L 3MV01 4BYHA 1PW3A 3AG2B 3EUUA 4TN9A 5E2TL 4MKTA 1KCUH 1A4KA 1WC7B 2ZNXA 4A04A 3CFEA 4JFYA 2AQ3A 1P4BL 3C5XA 2EDYA 5IP4A 1R3KB 2Q3AA 4ADGA 4F9PA 1PG7X 1D6VH 5ECJE 3VQ2C 3RFZA 4K5OA 2BM3A 4KO5A 4XXWC 4Z3HA 1N19A 3GBML 1IMHC 1QFUH 3A22A 4R96A 5ISZB 4MAYD 2YD6A 2A9BA 4FMFA 2Z91A 2L4OA 3O6LL 5E5UB 3ZDZE 4IRZA 1BD2B 4Y4FC 2BJML 5AVXB 5I8KL 5DZVA 1AJ7L 4OV5A 4LPCA 2NY2B 2WXFA 1OAQH 4FEIA 5E08L 3VD0A 4DN4L 2K9UA 3TCLA 2DM2A 3KPRD 1JZJA 1RVFL 1HILA 1A6VH 4M6NH 2PP7A 1QQDA 3S5YA 3ZDWA 4X6BB 4NOFA 5IVNA 1N4XH 3V0WL 4J2XA 4X50A 4NLHA 5EZLA 4I5BA 3VGAC 4IS6A 3TH2T 3UPAA 3FRPB 15C8H 3V95A 4ANXA 5SWZB 2XTLA 2FBOJ 1TTGA 1BV8A 3IDUA 3E80A 3L3HA 5FB8A 3C08L 3MLXH 5DS8A 3OC5A 3R8QA 7TAAA 2Y07L 3IETA 5I18H 2I9LB 3AXLB 1HHIB 2UX7A 2O6PA 1R47A 1KJ3L 4JHWH 3V4PL 2C9XA 4OFQA 4IBYA 3SE9L 1NFIB 4IJTA 2G75B 4Q2ZA 3MUJA 1IC7H 3P9LB 1NEZA 1U3HC 4U1JB 5GRWA 2QV4A 4OSUH 5BS0A 5C8JB 4E9VA 1JWMB 2XWBA 3ECVA 1L7IH 2XJLA 4YHOH 5JDSB 2IMMA 5AVZB 2Z1PA 4E9WA 4EF3A 4K94H 4GI8A 2UWEE 1QSZA 4RMRA 2Y23A 1NCBL 3GKZA 1JHLH 5D1ZI 4XPBH 3DHUA 5K9KB 4GKOA 4C58B 3QUXA 5CP3A 3EO0B 3PV6A 1T1ZA 1LWJA 3EXLA 2IAND 4TSBH 1EXGA 4FP8H 4F91B 1N10A 4Y5VB 4F24A 3Q9PA 1H3PL 2A5UA 3L3GB 4AT6B 2JKJA 4G8EB 1MW3A 1MHHB 5JPNA 2IGFL 4HUMB 3CZFB 2JWYA 4PJAB 1ZXQA 2EEAA 3GT6A 4WQOA 1U42A 3MX0B 4PJDA 2UYLA 2LTQB 4CC0A 4Z0BH 5F7MC 2ZOLA 4F2MB 2DAVA 1I1AB 2NY4D 2WZ6A 4UMGA 4WHCA 4Y5XB 3TPKA 1U8LA 3BYTA 3TCTA 4K73A 9PCYA 1X9UA 4BGDA 4POZC 3GM0A 1U8KB 3IMUA 5F1SA 3ARFB 4KKCD 2ZG2A 3BWSA 3PJSB 2R0KL 2IH1B 2OX5B 3UGXA 3MCKA 2X38A 1F41A 4N24A 3S3DB 5FYJL 3HB3B 3IPBA 4Z95H 4BEIA 3SGJC 1BBJA 4UIMA 5E70A 3S4SB 1CT8B 1INDH 2Y9RT 2Q86A 4EIBA 1QEWB 3PQYB 3OV6A 3EYOA 1BLNA 1TZHA 3CUPA 2BXZA 4O51B 1J0KA 1IVLA 3P73B 4ICWA 5E9AA 1P7QA 3BDYH 4XAKD 2DM7A 5CUSH 1MFVA 4RMVA 5J57B 4P5TC 4XBEL 1SFHA 1DN2A 1YN6B 2R1WA 3JV4B 1OF0A 2VW4A 2LV4A 2AJYH 3LKSB 4YDZA 1CD1B 2J8UA 2X1QA 4HHAA 1MW2A 2VR3A 4CBZA 2B59B 3NIFF 4DF9A 3AWEA 3WO4B 1AYRA 3C8KA 1A6AB 1UM5H 1PBYA 4GIPD 5IMLB 1JPEA 1ID2A 1QBAA 1G7HA 4JL1A 5SWSD 4PJ7E 3EDJA 2BSCA 3X14B 4U6HB 4TNVK 2ITFA 3DRTA 5ANMB 4HOWA 3TH4T 1JZ7A 4QYAA 2FSEB 1RUPH 2V8MA 5D7IF 1IARB 1CVRA 1YMHB 3REVB 2JVUA 4IOFC 3K81A 2QGEA 4W6YB 5SX5H 4JCWA 3VFRB 1NCDH 1U91A 1X5IA 3PG2A 2H4EA 4H5SB 2CK0L 3UJTL 4LEOA 1ITBB 5A2KH 2BVQA 1FG2B 3VI3B 5I16A 4PIBA 5D71H 3QFJB 4LKCB 5EO1B 4PJGB 3M8OL 4CKVX 4F3FB 2AQ2A 4H8PA 3EF4A 1A47A 1CFSB 4XBMA 2D4FA 5K33A 2A4EA 5C0IA 4HBQA 1B2WL 4HEPG 1QPPA 4D94A 3C5JA 2YBRB 4QTHB 4B7IA 1IV8A 2F54B 3AQZA 4R2GC 4C56A 2R0ZH 2OW6A 3E8UH 3WE1A 4J3UA 5CP7A 3P30H 3FOLB 3PXLA 1P84K 3FSOA 1S7WA 4ELMB 1FN4A 2NY0C 3T0BA 1J10A 5EUOA 5C09D 2A6JA 5FS5A 5L8KB 3O4OC 4ZMOA 3S3SA 2R29L 3GC3A 4HIHA 3S9DB 2YEZB 4GBXA 3MCYA 4OCSL 1CG9B 1PLBA 1MFAL 5EUOE 4LPTA 4O4YL 2QADC 4Z7OB 3H6AA 1DQLH 2BC4B 4BFNA 5CZVH 4HHWA 3IDXL 1NM4A 4DK6A 4MDIA 2VM9A 4S0TD 3QXAB 1CMOA 3Q8CA 4NUJA 5HGDB 2EIEA 5G2NA 5IR1A 2OMZA 2VW7A 4XAKE 4U05A 1NCUA 2WUBH 4DVRH 2PPAA 3KBPA 2OK0L 2VO8A 3QO0A 2YPVH 4TQPA 1IEBA 1XGRB 1K8DB 3FU7B 1E3XA 2Z7UA 5J12C 2J3SA 3NOIA 1FZJA 5D7EA 4MCYB 4WO0A 3TJEH 4UTBL 5FCUH 2H3KA 4HKBB 3QCVL 4RH4A 4KJPC 1CC3A 4B3EA 2P5EA 2UVFA 4AYEC 4LB8A 3PWPA 1BD2A 2ENQA 4BXSV 2BNQA 4JPWL 3ECQA 1WZMA 4RESB 1SJVA 1U2HA 5CIPA 2AV1A 5SWSE 4OGXH 1YNLH 2P5EE 2FATL 3PWPE 4AGNA 1N5AB 4Q0XL 2GFBB 2BNQE 3EF7A 4JKKA 2IVFC 4N2DA 3IKCB 4PJ5D 4JFOA 3V0JA 3TIEB 1CLZH 1KXTA 4TV3A 2AEPL 3WV0A 3FRPA 1AY1H 5TGBB 3F7VA 5FYJD 1J9CT 1Q0EA 4IMKA 5SWZA 2PPFA 3DOHA 2EDQA 3NEEA 3DUSA 3R18A 1JS4A 4XCYA 3B9KD 4L3EB 1EQWA 3HNSH 3QQ4B 5DMKA 3LCYA 2X4PB 5ADPH 5K9QI 4IGBB 3QULA 3VTAA 1KEML 3GSOA 2UXFA 1NAMA 2VQTA 5F7HA 1NFIA 2XPGA 3GBNL 2G75A 2J72A 3J8F7 3P9LA 1L0XA 3MZTA 4GRLB 1NCWH 5IEKB 3MJ9L 3QEQD 4UQ2A 5I1GL 5IHWA 5JIIA 1BG1A 3FUHA 3WY1A 4JZOB 1NGWB 3CSPA 3GSNH 3O8XC 5DZJA 4KVCH 2JKWA 5K69A 2KS0A 4QLRA 3OWRA 4BCYA 1JIBA 3K74B 3BSHA 5C09E 3TBVB 4MX7A 4V11A 1CK0L 1QSEA 1OK0A 5GSRB 4OFPA 3V0FA 5DMGC 4MXQC 3Q7JA 2W92A 4LASH 1L5GB 4G8FB 3V6ZB 3EKCA 1HI6B 3INUH 2Y5QA 1UOWA 5EZJA 2CM6A 2ROXA 2WXMA 3L3GA 5AWNL 4AQEB 4AT6A 4U1HB 1ZGLA 1WT5A 4G8EA 4JW3A 1MHHA 2YPKA 2CMRL 1XT5A 3CZFA 4F33B 1OTSC 5D2NC 1UM4H 5B7EA 1FIEA 1ULVA 2I07A 2O4EA 3MX0A 4HWBH 3FQUB 3HFFA 1CFTB 3B6SA 1I1AA 4OZFA 4X9HA 4IOIB 4LLYB 2K78A 2YUVA 2IAMC 4HEMA 1UG9A 1CBJA 1U8KA 2GKIA 4LPUA 4HUVA 2IH1A 2OX5A 2DD8H 4A7GA 6PAZA 4HJEA 2PLTA 1ETB1 1PFCA 4UTAH 2X3CA 3GTTA 3KYOA 4RGNE 3S4SA 1CT8A 4L9LC 3P0YH 4XXWA 5FUOL 1JK9A 1DQQB 2WXLA 2X9ZA 3DDGA 5E0FA 3P73A 4K3DL 4N0YH 2IG2L 4I3RH 4XH2A 1AAJA 2NSXA 1UA6H 1TEGA 3CSTA 2FEDC 5K9OA 2BSDA 5FYJE 4Y4FA 4EDWL 3KD4A 4XNMB 2X4NA 5B3JF 3MBEB 1YEKH 2JFCA 3FOMB 4POZD 5IF0B 1U6AH 1ACZA 1GSMA 3BUDA 4DETA 2YRLA 3ZT6A 1ROWA 2J25A 4TOYH 2W9EH 1QLFA 2BP3A 2APTA 4E41D 4XC3H 3MNMA 5B1JA 1RURL 4HCRA 1AD0A 2VC2L 2HJFB 4N0CD 2NUPB 4HUXA 1HZLA 2ZOOA 4ZUVB 2GIMA 3RZWA 4U6HA 3KPQB 3D07A 2DQHL 4X4XB 4EEEA 2PABA 4ECNA 2FSEA 4RMSA 4GLRH 2J8UF 3SIKA 2J71A 1IQWH 1UA3A 2H1XA 1YMHA 4X9IA 3DOSB 5J7CC 4P9HC 4HT1H 1KCSH 2CLZB 5GISL 2H7WA 3EDEA 4OF8A 3UP1A 3EZ8A 3SBQA 1UWFA 4L8BB 4FKHA 3QEUA 1SYVA 4WVRA 1UD4A 4P05A 4YC2B 5D7LB 1U3HA 2K8MA 2Y7MA 4L3CA 3VI3A 5BQ7B 2XBZA 3K1DA 4R26L 4R7NB 5IB4B 4GO8A 4LKCA 4PJGA 3UL4A 1QVOB 2IDUA 4GJTB 1YEEH 1NOLA 2VQ1A 3O8XB 1CFSA 2XKSA 4L8DB 4FQHA 1IC5L 4HH9B 3QFGA 3QR2A 1WGOA 2YBRA 4QTHA 1YN7B 2R69H 2QLYA 3LJ3A 2ARJQ 1UCTA 3HHSB 3IFOB 4RAUB 1OT4A 2A3TA 1E50A 2K3TA 3FOLA 4GPVA 4I4WA 1JJUA 3HG1A 2F8VA 3HAEB 3SPIA 3CG8A 3D9AH 3KGSA 1XAKA 8FABB 3QXTA 3VQLA 4OVUA 1E9QB 4L48A 2DV6A 1WK0A 1NQBA 2CLVA 5IMMB 3MLPA 2VAAB 4LGRB 2D7NA 3MRCA 4GMTH 4X8XA 4M6AA 1SJHB 5EN2A 1IEHA 3BKCL 3BOVA 3GBEA 4WW2F 1KB9K 1RZJH 5KUMA 2HRPH 3RWEB 3UYPB 3Q5TA 5EIVA 3SD2A 1CF8L 3ARDC 3DIVA 1WUNT 4G6FD 4BIKA 1MJUL 4NN5C 5TPWL 3WFBL 5EB9A 1M9WA 3NJMA 4ZG1A 4BFFA 1GH7A 1OT1A 3WIAA 1XGRA 1NL0L 1ZSHA 3PJLA 2BNUA 3CHOA 1F4WH 3FU7A 1KJVB 3SGJA 4Z7QB 2AK4D 4I1PA 1PY0A 1Z9LA 1M7XA 2ESVB 5F8QC 4DP4X 2DZEA 4ODXA 4E41E 1YYLL 1W9XA 1JFHA 1FLRH 1TQBC 5EU3B 5IFJA 1ND0B 1E6JH 3LMJL 4R90H 3ARBC 1HHHB 4GXVH 1Z3RA 4KXBA 1AP2A 2ENYA 4FQXD 4P5TA 3L7EA 3T0EC 4NQXB 1GJUA 4UU9A 4MZ3A 2GFBA 1RPUA 2TRHA 3VB9A 1JVOA 2I9TA 4ZYKB 4NNPL 2A6IB 6FABH 3TIEA 5IFHL 4QWWC 2F53D 4TQEH 2WWMD 4JN1H 3PL6D 4B95C 4KK9D 1ZT1B 2PWGA 1IM3A 1Q38A 4FFWD 3LRSA 1DN0B 5EWIH 4QHNB 3I9GL 3VSUA 3QQ4A 3KH4A 1E9OB 3WFEH 2AHIA 4YDNA 2QGBA 3RIAF 3UGUA 2OFQA 4F27A 5DO2C 1NMBH 1DTUA 1K3IA 5HYSA 1NTDA 3HS8A 4K9EH 4BZ2H 5G5DB 1MJ8L 5IK3A 5KBKA 1TZGH 1JZ3A 5E8PB 2AQNA 4G43B 1A3RL 3OAUL 5I1HH 3N9GH 5MHSE 2QR0B 2W91A 4FA6A 1CVSC 4OLZH 2DQTH 1QOKA 4NBZB 4TM9A 5D70L 3TBVA 3NN8A 3GDBA 1XSIA 1JI1A 1D3CA 2P47B 5I8CB 5GSRA 2EXWD 2DI8A 1HT6A 2KQMA 3WSQH 2NQ3A 4Z7UA 1Z5LB 1YY9D 3UIZA 1OV8A 2YXVA 2OMWB 1AG0A 5HJBA 4GAFB 5D1QD 1HI6A 3V6ZA 4M43L 1QEXA 1HWHB 4Y4KC 2WAHA 2FWLB 3B5HA 4UOJA 5E8NB 2IQ9H 3K2KA 2FO1A 1P0SE 3ISRA 4Y4HC 4Z7UE 5DI8B 3ULUC 2BVPB 1BQ5A 2OKMA 2JKSA 2VRKA 4URKA 1Z5YD 3B3BA 2B3IA 2KPWA 2FJGB 3P2TA 4XVTH 1ZLEA 5HDQH 4F33A 4FEMA 5CZRA 1RL1A 3BKML 2D9CA 2AEQH 2V2TB 1SMDA 3LN9A 1Y1DA 2BK8A 2BLFA 5A7EA 2AK4E 2WXIA 3W82A 1LO5B 5D5MB 3DVNB 1UACL 4MXQD 4F7CB 2VR4A 4N2CA 1BF5A 2IH3B 4EVNB 4FTVA 4LCYB 3VB8A 4PJAF 2ZKHH 4MASA 1FG9C 2EH7L 2MJWA 5CNHA 1A8JH 5BMFL 1PX4A 2JJUA 3K8LA 3T77B 4LOUC 3LKQB 4FTVE 4CSPA 1NAKL 4ZAKD 4AM0Q 1QW8A 3DYMA 3ZTNH 1L3WA 3U1SL 3VXPA 2DQJH 2NY5L 2F53E 3ZHLA 1Z2KA 5F1NA 1SLVA 3MGTB 3JTSB 1G0DA 5E8DH 5AUMB 3BPLB 1IBFA 2YPLB 1TLKA 2CCWA 2AI0L 1NEUA 3FOMA 3OKEB 1ESOA 2DQIH 2V7HB 4XN5A 4ODSL 5CO1A 5LXGL 1H9DA 5DUML 4AV4A 1UZ6F 2NNFA 1ETJA 5EC1A 3LZRA 1QA9B 5K59E 3MUHL 4DO5A 2HJFA 1ET5A 1E4XH 3BSZA 2WXJA 4ZUVA 7PAZA 1N0XL 4AZUA 5H2BB 5A6IA 1UC6A 4H2AA 4FE9A 4F92B 1UASA 5E8OA 5C6WH 3IS1X 2ZOKB 5F7WC 2XA8L 2UX6A 1KFAH 3GHBL 1SN2A 4XCFH 5EEXA 4TUOB 4YDIL 2N7BA 3LS5L 3X13B 4XP6H 2ZUYA 3QQXA 3M1BB 5DD3H 3HBQA 5AL0A 1KJ2A 3E2HC 3GFUA 3NIGB 4AITA 1KN2H 5D8JH 1YRKA 2DQCL 1SOQA 2F5AL 3G04B 4ZFOL 4TTDC 4WW1B 4HKZA 3UEQA 3MBXH 3O8XA 4L8DA 3SGDI 3UACA 4ZI8A 4DP6X 1VESA 3LEXB 1CE6B 2ATAA 3UZEC 3V4VL 1QI3A 5FIEA 4UAOC 3HHSA 3IFOA 4G42A 4P3WA 4CMHB 3CDCA 4AWJC 4MXWL 1UD3A 4PJIE 4IKJA 5HGAA 1Z9OA 2BVEA 5INDB 3VI3F 1OO2A 4OCXH 5CINL 5DD6B 1KPVB 2EEXA 2GC4C 3KE0A 4A2EA 2UY7B 3H9SB 4PJGF 2CHWA 3S7GA 4PRPD 2H3NB 4I2XE 3RU8L 3ZXAC 4PGJA 2VXVL 1O7DE 5ALBH 4JN2B 1J0YA 4GKLA 4LCWB 3SODB 2GJPA 1I3GH 2EUWA 2AQRA 3P4OB 4CILA 4KGLA 5D2NA 4XP9L 4RGOL 3R8BB 1A9BA 1RHFA 2TAAA 4FF9A 4L8CB 1BA9A 4P04A 5T5NG 4WI9A 4ELMF 5I24A 4HDIA 4MQ7A 4NO0A 1AGDA 2UUDH 2WBKA 3NSJA 1TKWA 5I71C 3D7PA 4I0PD 1JGDA 2IAMA 2ROYA 3H3KA 3PHOB 5DD5H 3S35H 3RUGE 3BC9A 5ICZA 3WFDL 1M6OB 4PJ9D 4J3OG 4QO1B 5EU6D 1XF4B 4N6RA 4YBHA 4H1LG 2V8LA 3VWJC 2WBJC 1CLCA 2KPNA 4GUPA 1RUAL 4Z7OF 4L9LA 4GFXA 4JFZL 3VRIA 4YVNA 4OLWH 2ESVA 5EFIB 1LEKB 1IB5A 4DKFH 1H8OA 2Z9TA 2W59A 4PRID 1LO4H 1KB5H 1ND0A 1QI4A 4LQFL 4PJBB 3OKNB 1HHHA 1Q0XL 2QMJA 3OLGA 3UTPD 1JG9A 3SGKC 3PGDB 3WEOA 4TLKA 3MAWA 1NPUA 1LK3L 1BXUA 5DXWA 3ARDD 2UV3A 1CXKA 3P77B 3OTTA 3AREC 1PG7W 5A2JH 3IU4L 1N3NA 4ZUTA 2A6IA 3WYRA 2PYFB 1OE1A 3DNKA 1JFQL 5KYXB 4B9KC 3BKYH 4ZTEA 2BFVH 4PTUB 2HKFL 2O5NA 3IDMA 2DPKA 2XTJD 4KI5D 4QGYA 4K3JL 4S1SL 4ONHB 5JXAH 4NSKA 3PP3H 5ACZB 4QHNA 2WM0A 3SQBB 3IRCA 3GIVA 4G6MH 4F7EB 1A65A 2N1TE 2NXZC 2P5WD 5EA0H 3O2DH 4N20A 4XMLL 1D5IL 4P4KC 1JYNA 2VLRD 3ARBD 4FS0A 3BP7B 4MA7L 2HFFB 4HWNA 4UQAA 3MACH 4DPRA 5D7KD 2AJXL 2VN6A 3T0ED 4JFPB 1AFVH 4IHOB 2DJUA 4KKBC 4UOW0 2W0PA 3PU7A 4MS8C 3NIDE 3SDCB 3ATBA 3E2HB 4G43A 1RZ8B 2Z65C 1R3HB 1TETL 3GXMA 5GS2D 2AEWA 4GI9A 5KSBE 1JOIA 2WWOA 2AQTA 4UB0H 2E7MA 1ZLDA 4YK4C 3MLRL 1SLXA 3TT3L 5KJRL 1JZDC 4RVBA 1KY6A 4HIXL 5J3HC 1Z5LA 2AV7B 3TNMB 1DR9A 3ME0A 4B9IA 3QWOA 4TVPE 5DC9B 1TNMA 3BPCB 2V3DA 4NQED 2NYYC 4LBEB 5JR1H 1F86A 5FHAL 2BVPA 4JY5L 1PKQE 1QATA 5CF3A 2BWQA 5ICUA 3HI1B 1BJ1J 4MJ5A 3ZZLA 4M7LL 2W80C 1CDHA 1FNEA 5JHAA 4HUKB 5E2VL 1QRNB 3QJUB 3G7TA 4F15B 2XTSA 5EUKB 2OMBA 5C08B 3A21A 2AJZB 3GI9H 4TSAH 5I23A 1HHJA 4YSUA 4F80A 5I66A 1WPCA 2ZWYA 4F7CA 4BKSC 4YHKL 5ESQB 5F7KC 3WNMA 1HFUA 4NPKA 3S36X 4EVNA 1A6UL 2P7TA 3MUUA 4GFTB 4PP1C 4Y4KD 3QVAA 3RGHA 5DRZB 1J5OH 1MFEH 5MI0C 4IK7A 2FIRT 5E9DB 3UTPE 5HYIA 2XG4B 4Y4HD 5GS3A 3HNVL 1KYDA 1E65A 4FNTA 3S35X 3SDXB 4Q9RH 3EJUA 3DX2A 2WBJB 3T77A 2APFA 3LKQA 1NC4A 1B6UA 3P11L 5HHVH 5F96H 4KZ0A 4G8GB 3DETC 4LCCB 1AQ8A 3JTSA 3VD5A 1ES0B 3A6BH 3QDJB 4IM8A 5KW9L 4KI5E 5AW4B 1KBWA 4M5ZH 2YPLA 5KSAC 5ICXB 4KKZA 2WB1A 3A4AA 2ICWA 4KITB 1JZIA 3LH2H 4DIXA 1E4WL 2V7HA 4KNUA 4HS8L 3NSCA 4J6RL 4Z0XB 3DGCR 1QFPA 2E4TA 2VLRE 4ELDA 3H3BC 1YMMB 5D7KE 2AXGB 2ZUQC 4JCMA 2G2NA 1XH1A 2O5ZL 3T0EE 5LQBH 3BE1H 2LU7A 1NBVL 1NWPA 4K2UL 5IROA 4RFEB 3MV8D 4G9FD 2QTVA 1GYWA 5L8JB 1MELA 5H2BA 4OIBA 4A6YH 1HS6A 4G7YL 4EDXB 3ARGD 3ZHNA 3PXJA 3IMSA 5CILH 2XQBL 2YGQA 2ZOKA 3R7QA 4ZMLA 2EDOA 4NC0B 4AYFA 2ZX7A 4OTXH 4B3VA 5FA4A 3X13A 4AL8C 1AMYA 2X3BA 3M1BA 3CVHA 1T1YB 5G4MA 4XNUL 5D6DC 1AGFB 3EJPA 3H2QA 4OCWL 4NQEE 4WW1A 3T4AB 1G9ML 3ALWA 3OJMB 4Q56A 2G9HB 5CZKA 3VTTA 3CV5A 2CO4A 1NMAH 2Y06H 3CK0L 5EPMB 1CYGA 3WN6A 3MREA 3QJFB 1TZIA 4LSTL 4OBSA 4Y16B 2EICA 3C87A 3SE8L 4AEIL 5C0BD 2PTUA 1MVUB 4OVVA 4DERA 3NFNA 1F0LA 3KPLB 4N2EA 1FIGL 3UBXB 3B2PA 5C71A 1K4DB 2NDFA 1EGJH 1KPVA 4UM9A 5DD6A 1BVKB 3IDJB 4WJ5A 4HJIA 3TZVC 3W5NA 5IBLC 1KEGL 2H3NA 5F6HI 2IALA 4Y2NA 3L5XL 4K3HA 3Q8BA 5BZWA 2Z35B 3MO1B 3LRKA 3OG4B 2D7MA 4I0KA 4OJAA 2Y3NA 1LP9A 3GIZL 1DBBH 1O75A 2HLEB 3QS2A 3BGMA 4L8CA 3AQDA 4B6ZA 5SV4A 4ANKA 4AQAB 4Z3TA 3ZX1A 2JH2A 2YS4A 2R56H 4JO2H 4XOEA 1R1CA 5HYJD 3ZKSD 1LP9E 1JGVL 2NTFA 5HHQA 1XH2A 2E8ZA 4YE0A 1TVDA 3MA7A 2R4RH 2WSPA 1XH3A 3HPLA 3DXAD 5MI0B 3OZLA 4FJZA 4YR6B 3RTQC 3ULAB 2HB0A 1U8NB 1XF2B 3TLRA 1OAUL 2R2HB 1WBZA 4RWYH 4NCC2 4FXKC 1S7UB 1U2YA 4K5LA 3F12B 4PJBA 2Q7YB 4YSCA 5EU4B 3OX8B 5TQ2H 1Y6NR 3M6DA 4KTDL 1UUSA 4P06A 3MV8E 4G9FE 4GMSL 3QORD 3SKOA 3G6DH 4P23C 2DMKA 3P77A 1JRHH 3ZDZB 1J5IA 1XO8A 4Z7QF 2E7DA 2O6FA 2ZTBA 4FFZA 1F3DJ 2PYFA 4FQQB 4JFQB 3QJHA 1IKNC 3PAZA 1EAQA 3NRFA 4F20A 1CZ8H 2PP9A 1EX0A 2D7TL 4IRZH 3V7AG 3EYFB 1SLWA 3UG5A 3U4BL 3E6FB 2J8HA 4ONHA 1Y6MR 2XZAH 1OGTA 5IESH 2Z7WA 3SQBA 3W9DA 2UZPA 5C0JB 1P7BA 1TTAA 4PHXA 1KYOK 1II4E 5DJ0B 4F37F 2Z1KA 4NI3A 2B1HL 4FG6D 5M95B 1P7KB 4WO4C 4ZS6C 3PGFL 5EBMB 1OM3L 1JZ2A 5C0BE 4X5RA 4LF3B 3IJYB 1O7VA 5JORA 3VG0H 1CYWA 2MKWA 3EHBC 2VDRL 2OJEA 3NAAH 1R3HA 5HP5A 3EZJB 3IXAA 3RA7L 2LQRA 3ZE2E 1UQSB 2WXPA 3WUWG 3F01A 4OCYH 3UZEA 1KACB 3G6AB 3LKNB 4JRYD 4NRXB 2DQDL 1NKRA 2AV7A 4OY9A 3TNMA 2V33A 3DIFB 1M7IA 2YQ2A 1UOLA 1XVSA 4PJEB 4ZUUB 3BPCA 3H3PH 4IDJL 3TFKC 1I82A 4JO1H 4DPBX 3GMOA 1GCYA 1XL6A 2OV0A 5FHBL 2VIRA 4MCNA 4FQCH 4KXZH 2BVOA 3IFPB 4PGCB 3KMDA 1KSRA 3UTOA 5GQBA 2JF1A 5IG7A 4KKBD 4DEPB 3ERXA 3A47A 5A2LH 3BWUF 4MS8D 5I5IA 4Q58C 1PZBA 3QO1A 3HI1A 4ODVH 4ONGH 3KM1A 4UILL 5GGRA 4LPWA 4KQ3H 5CMAB 3BAIA 3ES6B 3RPBA 3BUYB 2WTPA 5EUKA 4XX1G 1VFUA 3N42B 4AI7A 3DXAE 1I85A 5C08A 3P02A 4NQCD 4ZTPL 1CDUA 3ZHDA 5T5FL 2FO4B 2WJ5A 3ZO9A 1I8LC 2VKXA 1VZIA 5ESQA 3RI5F 1FL5A 1MNUL 4X4YB 2D3NA 4L1SA 1IBZA 1IKFH 3QPXL 5DRZA 1MCPH 4GRMA 3BPOC 1H5BC 3SDDD 1HK6A 4A1RA 4MAYB 4LK4A 1J8HB 2K70A 5CCHE 3SDXA 2H6UA 1MDAA 4RNRB 5TDPB 3VWJA 2WBJA 3IMTA 4HK0B 4OT1L 3RB5A 1SLUA 4NDMA 4OF7A 3V52L 3BGFB 1BQRA 1UUNA 3O0RL 4PV8A 2OAAA 2ICEC 2MQCA 5E56A 4I18B 1UZ8B 1OAXH 4NZUH 5D5MF 2H32B 2RJMA 5C0DB 4P46C 3F2LA 3L95B 4M8QB 4Z3FA 4ORGB 2XN9A 4FXKB 4GG6E 2FH6A 3KPRB 5EEVA 4YFEA 3QDJA 1ECZA 2CAKA 4P3DA 5D2LA 3F7QA 4PWHA 3GWJA 3AAZB 2Q3XA 1Q1PA 2XDHA 3NSYA 3SGKA 5ICXA 5CJ5A 4M93B 2XN9E 3WFZA 2HN7B 4OI8A 3SJVD 3AREA 3CFJA 5IOPA 2X4QA 4Z0XA 2ENJA 3ARUA 2FX7L 5D2LE 2VMFA 2WXRA 4HAKA 4JFFD 3O41A 1YMMA 3OR7B 1HCVA 2A83B 3D2UD 1EAPA 3EJYD 5GRJL 1T3FB 3U0PB 4OD3H 3SE6A 3M07A 4LLUA 2DWDB 3MLSH 1SJXA 5TK4A 4AX3A 3HEIB 7PCYA 5FO8B 3IGAB 4MD0B 2MQ0A 3K1KC 1B0GB 3F65A 3D69A 1MCHA 4PJ7B 3VGHA 4P4KA 4DVBA 4JPVL 2DQUL 4PY8J 5KSAD 4H4NA 3QRBA 2YEVB 4WO4B 3GXDA 2FD6H 4JRYE 5HGBB 3W5MA 4H88L 1A14L 2AKRB 1J11A 4GO6B 3U7WL 3F3HA 4HJUA 4FLRA 1O5DT 1VADB 2G9HA 1TYJA 4M48L 1R3IH 4B5ZA 1T2QH 4PD4K 3RVVD 5EPMA 1G9HA 3CX5J 3KGTA 1XIWB 1Y6KR 2GTZB 4O2CA 2BSEA 3GZOA 2IANB 1SBSH 4Y16A 3T8VA 5ITBH 2BHZA 3DV6A 4FHKA 3FB8B 1UFUA 1MVUA 1X4YA 3KPLA 3NIGF 4QOKD 1K4DA 5F9WB 4ODTH 3SGEI 4XZ4A 5M7QA 4HC1A 4UWQB 1LNUB 3F8UB 3PXHA 3IDJA 3RIFK 5ABZA 2ED8A 2NSQA 5JXED 1RZ7H 4NQCE 3ZQXA 4H8UA 1AC6A 3BVXA 2ATKB 1S7RA 1D5MB 4XNXH 3GMRB 1PPIA 2ITDB 2Z35A 3MO1A 3FNKA 4RFNC 1WBXA 3SPCA 5BO1L 1GOFA 4QY8A 4NM4H 4KZEH 3AW5A 4YHML 1RI8A 5I17A 3WE6B 2C4FT 5GGUB 5IFAH 1FNAA 3BP5A 4TNFA 5DTFB 3RY6C 4QT5B 4V1DD 1WD8A 1E90A 4YSSA 1RFDH 3PV7A 1GPOH 4U1NA 1T20B 4BINA 4OCNC 4C83B 1CXEA 1C12B 4N5UA 4YR6A 5DR5H 5D7SL 4MMXB 3FBQA 4RBPK 1M2OA 1U8NA 4Z7WE 3HMXA 1XF2A 1J1PL 4M7ZB 3BI9X 3SJVE 3LRLA 4AVKA 2OCJA 1O6SB 4JFFE 1HTYA 3F12A 4GRWB 4GRWH 5BUGA 1HEHC 4XVJH 1NGYA 2J1WA 5E2TH 3C6LC 3UZVA 1YPZA 5HHNB 5FW8A 1RZIB 2GK0B 3GGWB 3WAKA 5KSAA 2QQQA 4S1QH 1T4WA 1P4BH 1CDBA 2HVJB 3WLBB 1RK0B 4OD1L 3VXSA 4FQQA 2GTWB 2YGPA 2D0GA 1LJMA 1YPZE 2YLKA 1JVKA 3EUDA 3GBMH 4AY0A 4FNRA 4XCNB 3RTQD 3CVBA 3EYFA 4JNXA 2PR9A 2FCBA 2VITB 4PJBF 3E6FA 4HUNB 1XB3A 3O6LH 4QF1B 5CIPH 5B8CC 4F8TA 2D31B 5I8KH 2BJMH 1AJ7H 2V0AA 3ZKMD 1FNHA 5D1ZC 5C0JA 5E08H 1A7NL 3S5LG 3T2NL 3ZGIA 2P52A 1KJMB 4DN4H 4EI5D 2XUWA 2KI6A 3QR0A 3N85L 5B39G 1S8DB 1EEQA 1RVFH 3ZU8A 1P6AB 1HIML 3AXIA 5EBMA 4PRHD 1GGUA 3BVNA 3LXBA 4QXTB 3V0WH 5FEBA 4ZD3L 3Q2NA 2ADGA 3MRFA 1JNJA 2DBLL 3IJYA 3EGDB 3U7YL 1HYRC 1OAYH 4QOKE 3T6ZA 4KJWD 4CVUA 5D6DA 1AXSB 1E8ZA 1TO4A 1HWGB 2GJRA 2OMTB 4DP2X 1KBPA 2CR6A 4D0BB 4NIKB 4PREA 4MA3B 5KOVC 2DYPD 3C08H 2AMUA 2Y07H 1ZT4B 3P9MA 1BIIA 4X4ME 1RSYA 3CFBB 3LKNA 3AS0A 3G6AA 1XGTA 2HX8A 1KJ3H 2FYVA 3ATFA 2QPDB 5GSVA 3DIFA 3V4PH 3MNWB 3V4PB 3LYRA 1J8RA 3SE9H 4PJEA 1KIUB 1H6EA 2DLEA 2Z92B 4GYBA 3CCHA 4F7KA 5JOPE 1BCIA 2JIXB 2ZG1A 2WWKO 4QYOA 5C97A 4QRPD 3VRLE 5ELIA 3TZVA 2CGRL 4AG4L 4OLVL 2MNUA 4TSCH 5CMAA 3EHBD 4DNLA 4WGKA 4UF7C 4N8VG 4DEWA 5DJXB 1DCEA 3GHEL 1NCBH 2JQAA 1EVUA 1CR9H 3V5KA 3GSRB 2ZYSA 1N70A 2D7QA 3RHWF 4M7KL 4Y1AB 4X4YA 1H3PH 3MRQB 5I28A 4Z76B 4M7JL 3IGLA 4TQ8A 4WTWA 4EN3C 1XEUA 2ED7A 2YAHA 1J8HA 3HUJA 1U95A 2G3ZA 4HK0A 1G5GA 1I9JL 3Q6GH 1ZLWK 5LHDA 1A4CA 3MRLA 5KTEL 2GPZA 1UZ8A 3OJ2C 4L37A 5DHYB 3HUJE 5TK2A 3SYPA 4WHYH 2ZUTA 4ORGA 4FXKA 3M17B 5IKCB 1YEGL 3FW6A 1D7BA 3GRWA 3O2VL 5JHDA 1CQKA 1ZSDB 2WO4A 3AAZA 3MLWL 4PJ5B 2R0KH 3I9PA 3SKMA 3SDXF 1N64L 5HI3D 1DDTA 4L4VB 3Q1SH 4ZFGH 4P23A 5FYJH 2ZXAA 1FHNA 4TPRL 1E4JA 3RJQB 3CFCL 4NZ8A 1YEDA 1U3JA 2D8KA 1W8NA 3OR7A 3HZ3A 3MOAL 3AMKA 1IKNA 3B9KB 4PRHE 1R3LA 3BMVA 3OAYH 4BDVB 4F2EA 2X12A 5FO9B 3U0PA 2D9QB 3T0AA 3GLEA 2DWDA 3GS7A 2NY7L 2QELA 3TWCL 2VSDA 3DI3B 3DSNB 4KNQA 5FO8A 1FL6A 3B2VL 2AJUL 4MD0A 4XBEH 3QUML 4PWFA 4XBPA 3WKYA 4AV0A 3QEQB 2CO7B 1HL8A 4WO4A 4OQTL 3NJVA 2F8IA 4BQ8A 3KR3L 1ZDSA 4W93A 2AKRA 3KGUA 3FT1A 4R7VA 3W9EB 4DKDC 4FL4C 4R83A 1T7ZA 1GS8A 5C3IA 1BFOA 3MLTB 5IJVB 1QSVA 2ZSWB 4QRPE 4D9QD 5IREA 4NJAL 1XIWA 1JZ5A 1FFNB 2GTZA 2VMEA 3KNBA 4X7SL 3L2LA 3FB5B 4XHJC 1HJBC 5DFTA 3RP1A 1DANU 1ZMYA 4MZIA 1JZ4A 4ZSOE 4DHLA 2UZYB 4AH2B 1TSRA 1Y0LB 2JCCB 1LNUA 5TDNA 3T8MA 2CK0H 3UJTH 2ZOUA 4PRAB 4X5XB 2DI7A 4GAYB 3FO0L 3N1FC 3QJSB 4GS7C 2KKQA 3GMRA 3FZUC 2ITDA 2MNWA 5F7YC 3WMSA 3EGSB 4FYRA 5H35B 1B2WH 2VNCA 1A9VA 5HGHA 2BERA 1DVXA 3QISA 3WE6A 4FRWA 5BOJA 2YD1A 5DTFA 1KTRL 1U3YA 3KYKL 3D51A 1NGPL 4BZYA 4QT5A 4ODUB 2FWOB 1I8LA 3ZY7A 3DVGA 2LAGB 1IT9L 2RAMA 4L4TD 2AQ1A 4XMKL 4RRPM 4WY7H 3K3QA 3CXHJ 4C83A 1LO0L 2FHFA 3BW9B 4BHUA 1JMXA 2R29H 1H5BA 4F7PB 4BWWA 1KGYE 3WIHL 2VR5A 2PCPA 1LEGA 3C9NA 4OCSH 1UXSA 5AG8A 3BQUD 1WISA 4MMZB 3NZSA 1MFAH 3MRIB 4KDTC 4O4YH 2JV6A 5HBBA 4ONFL 2ICEA 2X10A 2W9DL 3NQIA 4G1EB 5I26A 1KT2A 1O6SA 2CBTA 5JPMC 4JQIL 4H8WC 3KZ8A 3IDXH 1C5CL 4P46A 3FFDB 3ESOA 1JPST 4YGAB 3TPUB 3GPEA 3FTSA 4ZUSB 3CU1A 3GGWA 4E41B 5F7AA 1JZ8A 2OK0H 5CJQH 3UPCA 2WCSA 1RK0A 2XWXA 3ILPB 3PABB 1I7ZA 3T8XA 1PQZB 4Z9KB 3UDWC 2CWRA 4R5TA 2ZWNA 3DK0A 3M86A 2MTPA 4JFHD 4JREB 4KROC 4UTBH 3PPEA 2WNWA 1U8MB 3QCVH 5CR8A 3DJRA 4QF1A 1G9NC 1M53A 2R2CA 1KGCE 3D50A 4JPWH 4IBVA 4PRDA 3MJ6A 1A7QL 3N0AA 4M8RA 3ZDZF 1KJMA 5EIIB 2FATH 1L9PA 1XBRA 1S8DA 4PJHA 4Q0XH 2FECI 2K4WA 1AE6L 1E28B 1Z5HA 3EGDA 2AEPH 3VFOB 4BSWB 3AB0B 2X6UA 4J3OC 3M88A 3NCBB 1T4KB 1BDYA 1AGEA 3QIWC 3P0GB 1QD0A 3EH5B 1FLTX 4FL4B 5D96C 4QJ4B 2ENPA 5I1DB 4MA3A 4TLTA 3GMQA 1VGEH 4FTDA 3A4EA 4R7DB 5ICYB 4GAGL 2X4OA 2E7BA 2F7IA 1ZT4A 5LUMA 5DHVB 1KTKE 1L6ZA 1KEMH 3QIUD 3MNWA 2R1XB 1TQSA 3QG7L 4OH2A 5E8EA 2VO5A 3GBNH 3MN8A 4CC1A 5I75C 1KIUA 3JTBA 1EPFA 2Z92A 4ZO9A 1SUJA 4FNPA 2JIXA 2BCMA 3MJ9H 5I1GH 2MRYA 4N2FA 5BZZA 1J0ZA 4OD2B 5BXFB 1I1YB 5EOTA 5CHNA 1DVFB 5FOBA 3L9YA 2B1OA 3BGAA 4L4TE 4WENB 1NLBL 1LWHA 4YH6A 5DJXA 5FCSH 1NZRA 3NDYE 5LDUA 2BOCA 1CK0H 5E0QA 4PJEF 4G6FB 3FDWA 4NYLB 3JT2A 2FBJL 4YHNA 3KLAB 2H1LM 1V3LA 2EDHA 4M62L 5J9PB 3S96B 4PGBB 1HJCA 3I6GA 4KX8A 1AOZA 3N43B 4I85A 2IBBA 4LMQI 4Y1AA 2CLRB 3RY6A 4GSXA 4PUBL 1QR1A 5AWNH 5B22A 2W88A 2AK4B 1UWEL 3TEYA 1QSFB 1CICC 2FECL 5DRNB 4P2OD 2Y2TA 3MV9D 4YDVB 5LGYA 1I4FA 3N42F 1WAEA 1BOGB 4I88A 3TJHC 3W11C 1DL7L 2YEQA 4PWJA 3RPKA 3BZEA 1H3XA 4HMEA 3QRGL 3V5HB 1OARL 3D33A 4FQXB 1JD7A 1VEOA 4JFHE 2GSIB 3QC5X 4NZJA 4P49A 4PEEA 1G1CA 3MBWB 3FFCB 4DK3A 5M94B 4JZNB 3APDA 4NB7A 3C6LA 1G1KA 4KKPA 4WTXA 4DFHA 4E9LA 3PL6B 4BKLA 1JXKA 4L4VA 5CZXC 1T7YA 4NUPA 3RX5A 1DLFH 2BINA 1WEJL 2X2HA 2R23B 4Q6IC 1MCDA 3NGBC 4U1SB 4AJ0A 2J6WA 5FUOH 12E8L 4BDVA 2KHAA 1G9NL 2P9RA 3EOBB 4K3DH 2IG2H 5EBWA 3WXWL 4JY6A 2EEDA 4AGOA 3L4ZA 3RNKB 1MI5A 5B8CA 5KS9E 2VR6A 1U41A 3FQNA 3L3DB 4GEJA 4EDWH 3Q06A 1OCZB 4HIJB 5D1ZA 2OI9B 3SKNB 4JM4L 2Y22A 2GTQA 2FVNA 4TVUA 1I9RH 4X9FA 1MI5E 4ZMWA 3S97C 4BUHA 4K71C 2IOMA 2HA1A 3H2PA 4W4NA 3MNVA 5C0GB 4JG1H 3PDGA 1NDMB 5T3XL 3LXUX 2QVIA 4PMEA 1RURH 2LLNA 3W9EA 2VC2H 2VC2B 1N6QL 4GOSA 4NT6B 1H3UA 3CMGA 3WY4A 5ITFA 1EFXD 1KLUB 3QDMA 4C4UA 2P45B 2DQHH 1EHAA 4W9IC 2H8PB 5D96B 3PWNB 4HJ0C 4PJ7F 3HZKB 4LHUG 5D1QB 5ADOL 5K1VA 4ZK8A 2WGNB 4NN6B 1ORSA 2P80A 3P4LA 3QDME 2YA0A 4HCIA 5GISH 2J1XA 5IB3B 1Y0LA 2JCCA 3HI5L 1SXNA 3N04A 4MDJA 3U30C 4AMKH 4YLCA 4O9HL 4X5XA 4PJIB 3KPPA 2OMNA 5IW1B 4GAYA 2YGVA 3HJ0A 1MRCL 1JNHB 1LHZA 3Q48A 3QI9D 4IYKA 4NN7C 3B34A 3FQWB 4X6CE 4CVZA 3IDIB 2QHLA 4DGIL 3OB0K 4U3HA 3EGSA 1IGCL 1F1GA 1OT2A 3BQVA 1IC5H 3TA3B 5FKAB 3QUYC 3BP4B 3MV9E 5DJAB 5IT2L 5T8IA 1LQSR 4FFVC 3J2PA 1ZIAA 1AD9B 5IHUL 1YAIA 4TTGA 2P1YA 1Q1JL 1SM3L 2EIBA 4HJSA 3V0HA 3ESVF 1TPXB 2EXSA 1TVBB 3OAWA 3WY3A 1SDYA 1TCMA 2CIKB 4ZAKB 4UAHA 1C16B 4EN3A 2BSTA 3EYQD 2E5EA 2TSAA 3IWUA 4GIOA 5AYUL 5F88A 3BUPA 3RUGB 4F8NA 4MMZA 3BKCH 3RIKA 1BJ8A 4IU3B 5CD3B 4WNSA 4S0SD 5LG1A 2ZP0T 5E03A 4LNVA 1MW0A 4XZUB 4PSRA 2CO2A 5E1IA 1W80A 1HH6B 2A0LD 1CF8H 2ZXWB 4RMQA 3TPUA 4CGTA 1MJUH 3MODL 5K5YA 4BA8A 4KUCF 5TPWH 3WFBH 4F7TA 5J13B 1YNKL 5MEOA 3RGVD 1XGUB 5F0JB 4X9BA 4S1RL 3PABA 4WI4A 3NCYP 4JFED 4YX2H 1GS7A 1MSPA 2PETA 3RX8A 4Q6IB 3GSWA 1VRSA 2X1PA 2A6DA 5EG6C 2ZONA 2FH8A 2DQFB 1U8MA 1K8IB 3LD8B 1V3JA 3LQAL 4GRWF 2XXMB 4UV4L 5DK2B 1YYLH 2DQGL 1F11B 1OXYA 3K72A 4K3GA 2VTFA 2HT3D 3PFUA 4N3TA 5ANHA 2ZX5A 1U3NA 2YD3A 3TBSB 3O11A 3O45A 3PS6A 2ZXEB 2H0FA 3X1BA 1GZHC 3NT0A 4NNPH 1EMTL 1J1OL 5IFHH 4YHIB 4J1UA 5AFAA 4W9ZA 5BRZB 1IC0A 5KVEL 1USQA 3MCLH 4HSAC 5HDRA 1UB5B 2BIPA 2DJ4A 2ZP8A 1T4KA 1WA1X 3GZPA 1BREA 3HRPA 4KNTA 2UZXA 5GZOC 1PG7L 1LDPL 2BX5A 1G6RB 3LEYL 4ZOAA 3I9GH 4UNTA 5ICYA 1FVCB 2R7EB 5GRYA 2P43B 4EPSA 3WXVL 4P9HH 1CQYA 1RZGA 1T5WB 2AP2A 5KSBB 1WD9A 3OMAB 1I7RA 3MV7D 4XB7A 1V5JA 2C1OA 4KKLC 4PRPB 1A7PL 1K2DB 5DA4A 4EI0A 3WMQA 5L0QC 3EIFA 4PI0A 1MWOA 3GI8L 2XV0A 1BMZA 1R5VB 4PR5A 1MJ8H 5BV7C 3KLDA 5F89B 4MNHA 4QRAA 4TVPH 5BXFA 1A3RH 3OAUH 1DVFA 2X88A 4RA0C 4WKZB 2EECA 2P46B 2VH5L 3QQ9D 3CX2A 4XB3A 5T3XD 2ZXGA 3QIWD 1Q9LB 3WENA 2AS5M 3SYOA 1PKQB 4I0PB 3F7KA 4NYLA 5DWPA 3W2DH 3ZGHA 4FLQA 3ZIMA 1J18A 1VIWA 5E24E 5I1LB 2GJ6A 3S96A 3VXRD 5J9PA 4PJ9B 4PGBA 1EXUB 4M43H 5EU6B 4X4KA 3W37A 1IC1A 2Q5BA 3VYPA 1G7MB 3QARA 1GA2A 1Z9NA 2Z93B 2EEBA 4WWKD 1GYCA 1QLEB 1CDIA 1QSFA 1B9KA 1SOSA 1YNTA 2BS71 2ZX9A 3EFFB 3KYMB 4UQDA 5DRNA 5E1HB 5HTSA 3RRQA 3BX7C 4A38A 1ZDQA 4PRIB 2XACC 4G80B 1J0HA 5TD4A 2FRGP 4JFEE 3VFSB 4KDTA 1S9KC 3QR1A 3IDNB 4LSSL 5J1TC 2QPSA 1U92B 4QHLB 3FCSA 2RB8A 5JPMA 1BVLB 1OIOA 2W0KA 3BN9C 5F6IC 1VACB 2DJMA 3MBWA 2VISA 2Y1VA 3FFCA 3G5VA 2KZ1B 2HX7A 5LGJB 3DIDA 1U8IB 4PJCB 2ZUVA 5HYQA 2V2WA 2EH7H 4M1GL 2XTJB 1JNNL 1Z0NA 1SFDA 2CBOA 4U1SA 5BMFH 5F9AC 5C1MB 1NAKH 3OR6A 2P5WB 4MLSA 5I2IA 1T5XA 3U1SH 4F57L 1N6VA 2VZUA 1A02N 3DDFA 3NMEA 2IXQB 2NY5H 4Y8DC 1SXZA 4ZBJA 2AITA 2WIIB 2D0HA 4AW7A 5I82A 4F7MA 3L3DA 2GIXA 1QYGL 3QAZC 5AZEL 3ROOA 1XCXA 3SKNA 2AI0H 4IRSC 5TF1L 1JV5B 3J07A 4B96A 3OQRA 4U3SB 5IV2A 1MCCA 4ODSH 4ZW3A 3ABLB 5BW7C 5LXGH 4O2EB 5DUMH 3ZSSA 1P6WA 3QZPA 4EO5A 2WZAA 3T2QA 5LNDA 3MV7E 4F9LA 2VDLL 1KTLB 1OQXA 4OI9A 4Y5YB 4AK2A 4H1LA 4NT6A 1T66C 2ZOWA 2NZ9D 2VOTA 1N0XH 2B20A 1PSKL 3PWNA 3EJZC 3PGCB 1M05B 3VH8B 3CH1A 1B0RB 4NQEB 2X70A 2NY1C 3QEGL 5T3XE 1NUNB 3UABA 3GHBH 2K3HA 4YDIH 3LS5H 1BG9A 3DO4A 4RAVA 1QKZL 2ZF9A 2Z8WC 1TFPA 4PY8I 1TTBA 3ARZA 2OSLB 2FR4B 3O3EB 2YARA 5E95B 5BRPA