3PYCA

Crystal structure of human smurf1 c2 domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
GSEFIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human SMURF1 C2 domain
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords E3 ubiquitin-protein ligase SMURF1
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3pycA00
2Y3AA 3APDA 2QZQA 4A55A 2B3RA 2WXPA 4ICWA 2DMHA 3PYCA 4FJZA 4ANWA 5H4ZA 4J6IA 4IQHA 3F04A 4JPSA 1E8XA 2CHXA 5T8IA 1E90A 2N1TE 3L4CA 2K4AA 3OAWA 4Y1TA 3QK0A 3QR1A 4FJYA 2K45A 4PS7A 4FADA 1QATA 1WFMA 2WXLA 3ZVVA 4IHBA 5CCHE 3S2AA 4EZJA 4TS6A 2R83A 3MJWA 4BGDA 1A25A 1DSYA 4FHKA 2RD0A 4BFRA 1BCIA 2K3HA 4PS3A 3DBSA 4HLEA 2WXJA 4WWNA 3ML8A 3QJZA 1BDYA 4DNLA 2Q3XA 3PRZA 1E8YA 4LCVA 3L17A 3P2BA 4GNKB 4OVUA 1UOWA 4ANUA 3N5AA 1DJGA 5G2NA 2JQZA 3RPBA 2ENJA 2CHZA 1UOVA 2WXKA 2ENPA 1UGKA 1E8ZA 3FBKA 3F00A 3L08A 1DJYA 1WFJA 1E7UA 2CHDA 2NSQA 2D8KA 2ENQA 3F05A 4XZ4A 4G11A 4FA6A 3TL5A 1GMIA 3NSJA 5EDSA 5KJ7E 2EP6A 2CJTA 4ANVA 3CSTA 3DPDA 3NZUA 3TWYA 2WXMA 5JHBA 1BYNA 3IM1A 2YOAA 2KI6A 3ML9A 3QAQA 4Y1SA 2V4LA 1RH8A 4F92B 3ZIMA 2YRBA 2DMGA 4AOFA 5CCGE 4FULA 2A4ZA 4FLHA 4TUUA 1QASA 4L23A 1DJWA 4ICXA 3W56A 3F01A 4L1LA 4KITB 3QARA 2X38A 4NPKA 4F1SA 3HHMA 1TJMA 4QAMB 4DK5A 4HVBA 1DJXA 2ISDA 1YRKA 2FK9A 4NS0A 1K5WA 1DJZA 1CJYA 1W15A 4AJWA 3CSFA 3JZYA 3L9BA 3QR0A 3PFQA 4LT7A 4V11A 5JHAA 3HIZA 1V27A 3HN8A 3L13A 1E8WA 2K8MA 3W57A 2QZ5A 2WXOA 4ANXA 4F91B 2Z0UA 4URKA 4TV3A 4WAFA 5CCJA 4NPJA 2Q0ZX 4EZKA 4F93B 2CJSA 3L54A 2WXHA 2UZPA 2NQ3A 2WXRA 3GPEA 3IBEA 3LJ3A 4QJ5B 4LDCA 1RLWA 3APCA 1DJHA 2WXNA 4XX5A 5H4YA 4FHJA 2FJUB 1TJXA 3R7QA 2CM6A 1DQVA 1HE8A 3PS6A 4NP9A 3KWTA 4PS8A 4L2YA 4L1BA 3APFA 3FDWA 4WWPA 2CM5A 5G55A 2WXIA 1RSYA 3ENEA 2CHWA 3ZW3A 3M7FB 4KZ0A 4QJ4B 3T8MA 4MJJA 3PREA 4WEEA 3NZSA 3B7YA 2WXQA 3SD5A 4GB9A 2ZKMX 1W16A 1E7VA 3R7RA 2A5UA 1DJIA 2LHAA 2NCEA 2WXGA 2WXFA 4XE0A 3RDJA 3TJPA 4EZLA 4KZCA 3OHMB 3KWUA 3L16A 2BWQA 4QJ3B 4OVVA 4WWOA
chains in the Genus database with same CATH superfamily
1VGEL 1TTCA 2P5WD 4HCRA 5IVXA 2CNYA 2BC4B 2YGNA 1AZRA 3D25B 4XCYA 5H2BA 5JO5B 4YH6A 1GIGH 4BM7A 5CEZH 1CLYH 3F04A 2A9DA 3CC1A 3QXAA 1JD7A 4Q4EA 2CRIA 4AIXA 2AERT 2NY4D 1M3IA 4XP9L 3WD5H 4Z7VE 1F56A 1QI3A 5JIHA 5I1GH 1DR9A 4TSBH 4IYKA 3S35H 4KJPC 4BSVA 1HHGA 5LBVA 3NDZE 5AVQB 3LB6D 2XA3A 1BG9A 3NIDE 1H6UA 1A14H 3VM7A 3D4GA 4P46A 4HSAC 1UASA 4X5XB 1IGCL 4FOMA 4JFUA 3L08A 1T5KA 5GZND 2G2PA 3OXSB 2HPOA 3QIUC 1NC2B 4QWWD 3TIEA 3NJFA 3GXNA 3VGBA 4XPGL 3WFDH 1I8IB 1IRAY 1QLFA 4IMKC 3ZZLA 4QRUB 4EI5D 3DPDA 4IRZH 4UT7H 1UD5A 1V7NL 2ZWLT 4EIZC 2GBTA 5CJQL 4NKMA 3N1MC 4Y5YB 3TZVA 3ARQA 3MBEA 4FERA 5FKPA 4GXUM 3FSZA 2VLME 2GK0A 3WFZA 4KITB 5JOFA 2DJSA 5GGSB 4RGNE 5HDRA 3NACH 5TK4A 3CFJB 1V7NH 4TNVF 2Z31C 4PGZA 3NRQA 4GW4B 5ICUA 2CKBA 3WHXA 2VZUA 3MQIA 2H3XC 3BIAX 1SF3A 2ZUWA 2YD5A 1KIRB 5F21B 4EDXB 1ZLWH 4GIPD 2WD0A 1JZJA 1FFQA 5E00A 5F6HJ 1N9PA 2DICA 1C12B 1SHWA 3RY6A 4I85A 1GYUA 3NPZB 4W9IC 4XPHH 5DUJA 3HG1D 2H4EA 2I32A 2UZPA 2P26A 1S5IL 2X4TB 4FNPA 2NYKA 4H8VA 4RDBA 5IMOA 3P0GB 4LLVA 3HE7A 2CO3A 3AQZA 1KLUB 1AAJA 2L0DA 3Q01A 2ORBH 1B2YA 3SYQA 2K6ZA 3I84A 1KIQA 3MFGB 1P0SE 3VFRA 3RX5A 2ICES 2VDLL 4PWEA 3HFFA 4NN5B 1CICA 2RQ8A 1VA9A 2F53E 3K6SA 4FQQA 1BVKB 4MNGA 5D1QB 2O30A 2CUIA 1WA1X 1GGIL 5IESL 4L8BB 2A6KA 3MBWA 4HWBA 4BDVA 5HGBB 4U1IA 3MV9B 1ADQA 2F7IA 4JQXC 5E2UL 4HUVB 4I0KA 4Z3FA 3O3DB 1KXHA 5E24E 5D71H 1SJEB 5F1NB 1A2YB 1SJEA 4DQOL 3QIUA 3T1FB 5M94B 3ARSA 1T1ZB 2XTJC 3KLAB 1JNHB 2OTPA 4Y4FB 3SDAC 1C7TA 1QFPA 1ZHLB 2O6PA 1N0XL 3VFPB 2EDKA 3BFOA 3BKML 4CVUA 1B3JA 3R0NA 2Q9OA 5E0QA 4PJ9C 1X7SA 2IH8A 4MAZA 2A2QT 5HPMA 4G8GD 2GBVA 3SE6A 5F71A 5BV7B 4KX7A 2H1LM 1DBMH 4M5ZH 1U33A 3OAYH 4ZW8A 5C7XH 3D85B 4NJAL 1CFNB 2DQGL 3F58H 4OIFA 3RVTC 4P2YA 4E9VA 1KUMA 5A6IA 4ANUA 4HF5H 3GSVA 4RFNC 2RBLA 4ADJA 2V2TA 5I0VA 2HKHL 1WZAA 1JP5A 5EZOH 2Z6FA 3RUGF 2XX1A 4UQ9A 2DQGH 3F58L 4G11A 1USQA 3CLWA 3U1SL 4H2AA 5EHFA 1R17A 3CSTA 1JGIA 1QLEL 1FE8L 1TQSA 3NZUA 4Z3EA 1N10A 4JUSA 2J8UF 4XOCA 2GK2A 2HFTA 2WTRA 3VXOB 4B5ZA 3MCG1 2JCWA 4APQA 4TUUA 3ZKXC 4R0LC 5KVFE 1U30A 3AUWB 3OXRB 3ZO0A 3BVWA 4WFHD 1S5IH 1UEYA 3ZU8A 2QMKA 2AS5M 1ZOXA 4PJDE 1G9NC 3VFUB 3OJ2C 5D93C 4FXKC 1IILE 1AD9B 5I5JA 1TZIA 1LE5B 2EVFA 2YD1A 5JW5A 4MD5A 1CDGA 3HBQA 4Y1AB 5C09A 1E8WA 4EEEA 1I3GH 5GS1B 3L3DA 4GAGL 2P28B 1KBVA 3RAJL 4OLYL 2V37A 1BJ1H 4GRWH 4XMVA 1B0RB 4OD2A 3BJ91 5D1ZI 1D5MA 1R3KA 3CK0H 3LNEA 4JO1L 2J7LA 5F7YC 1SXBA 1AS8A 1OAXH 4KPHH 2X1PA 4BE5A 2CRZA 4EOWH 3PS6A 4DO4A 3KWTA 3L7EA 5DURB 1IQWH 1RP8A 1PQZA 4KUCF 5GRWA 2HG5B 1RSYA 1FZKB 2ZKXA 2YC1B 1G7QA 1OPOA 2AK4A 2B15A 2BMKB 3GI9L 1MCDA 3N40P 4I1RA 4UV7H 3T8MA 3VGAC 5ITBH 1N5YL 3QEUB 2C4XA 5BJTB 2HCZX 5F9DC 4ZSOE 4XPTH 1OSPL 2P44B 1WT5A 1XF4A 1NSNH 3AU1A 5L2KB 3EJSA 4YUEH 5CJXA 5I9QB 2F53B 4OW6A 3W81A 1J0YA 3MODH 5IW1A 1EFXD 1XTLA 4L8CA 2BSEA 1KN2L 4K3GA 1L9MA 4QKTA 2GAZA 1N6QL 1T2JA 5EIIA 1N4XH 4JO3L 2PCXA 1NLBH 1WAAF 43CAA 4AM0Q 2YK1L 1S5HB 5EOCJ 2O5XH 3RBSA 2R51A 3GQFA 4KJQC 4KY1H 4HD5A 3CPUA 4HC1A 5HDBE 2ZUQB 3VFMB 1ZLDA 1I9RH 5J57B 1VGEH 2DYRB 2K7PA 2FYVA 1CE1H 2BVQB 1EHKB 5DQDH 4GBXD 4MXQD 1WUZA 4LAQH 1U6AL 2E7MA 5C0RL 5MEOA 4JZJB 4PYHA 4OBSA 4ZO6A 5B8CC 1UA7A 3F00A 1WC7B 3O6FA 3NFSH 5IJVB 1TZHB 2X0VA 2HN7B 3X17A 4F8NA 1WEJH 3KYNA 3O9WB 3NJNA 3MACL 2F5BH 4PWHA 3WFEH 4XOAA 4QLWA 3REVA 5LGHH 2H0FA 4MAYB 1AVAA 5BXFB 4N26A 4WIQA 1HZLA 1OB1B 1ADWA 3QISA 5BRZD 5JW5B 4N28A 4ZW7A 3RWIB 3G7TA 3U48A 2X2HA 3EJRA 3X12A 3VGFA 3B1UA 1KB3A 4J3SA 1TCRA 4ZX3A 4AK1A 3NGBB 5LNDA 4BQBA 2EUZA 5MEQB 3TIDB 2FK9A 4M6OL 5LCVL 5KVEH 5J1TC 3T71A 5HHOA 1JHKL 2LABA 2UY6B 4K71C 3DSFH 3ELQA 3M8OL 3ARFB 1NCWL 4ABVA 2H6UA 4ANXA 4YHNB 4JGNA 3CH8A 3GMNA 4X98A 3LEYL 3RJDA 3AXLB 2A4EA 3C12A 5AENA 3D07A 4OKVA 4G5AA 5HI3C 4YN3A 3PE9A 3GSXA 4YE4L 2EEDA 4L3CA 4OI7A 4HG4K 3FTWA 1R75A 3V52L 2B5IC 4TLUA 1CU4L 3CH1B 1BQRA 1NGYA 1CK0L 2VXQA 3TVMC 3RTQD 4S0TD 4JE4B 3WTTA 1K5NB 1G9EA 3GSNA 2V17L 3P9LA 1IL1A 4NO0D 3P77B 5I8EB 1ETA1 4XVOA 5I76A 3FTZA 1AZVA 5TQ2L 3HS8A 1GYCA 1P9MC 2AJSH 4D3CL 1DN0A 5E6ID 2Z7UA 4FFZL 4JKWA 4WCYH 5C2UB 4N2BA 1G4MA 2X88A 2ADJB 2HTLD 3HRZB 3HNVL 4F2EA 4XPAH 3TZVB 1SDDB 3UTTA 4IDLA 4GXVL 4AGNA 2EYSB 3SDCA 1FO0B 2IAMC 3BAEH 4H8QA 1P1VA 1PG7L 2SODB 3N1GC 2JI1A 1Z9OA 1QHOA 4J2QA 4O02B 3NT0A 7FABH 3X1GA 2FB4L 4E42B 3OKNB 3DBXA 4TUJA 4F7TA 1BCIA 1AMYA 3OGCA 2CKBB 2WVTA 2PETA 3ZHDA 1I9JH 4APQB 5EEWA 2Z7WA 2VLRB 3C8DA 3FMGL 1XBDA 1A5FL 4M6NH 3VMNA 4AT6B 3W38A 2ESVA 3TXAA 1OGAB 2HRPL 1TYRA 5C07D 3CVHB 2JJWA 4YLQT 4WEBL 1RUPL 1JUFA 4JZJC 1BIIA 4PV1C 4LLVB 3BRDA 3B6SA 1AC6A 3IEAA 4W93A 1WS7A 4QRUA 3NRPA 3QQDB 3LKSB 4NO0A 2ZF9A 3R18A 5I6XC 4Z18A 1ZSDB 4BZ2A 5CR1A 3NIDF 1BJ1J 2DRUA 4LQFL 5SWSE 3IGAA 1DHKA 1FHNA 4K8RD 2BNQE 4X5RA 4XCNB 4PGDA 5IHWA 1U8MB 2A9NL 2F19H 4C55A 4RBPH 4O58L 2R8SL 4PR5A 1R5IA 1YN7A 1XF5A 3HEIB 5FW7A 4JL2A 2VT0A 4CSZA 3LNHA 2ETWA 2JI3A 3VFSB 4YHYB 4TTGA 1TZHA 3QULA 1BLNA 2QFRA 3WEMA 4OZGE 3BZ5A 5JYMA 3HNTL 4N9GA 1O5DT 1DVTA 2Q0ZX 5IW6B 4MD4A 2NXYB 4K8RC 4X4ME 3KPRB 4NP4L 4Z7QE 4JR9H 2WLZA 1AZUA 3JUYA 4X6EB 3VVVA 2WO2B 2HKFL 2A6IB 3MCKB 1DQIA 2Z8VC 2GC4C 5L9DL 2XC8A 4ZZFA 1VIWA 5CD3A 43CAB 3AS1A 4JEGB 2JB6B 1XB3A 5AVWB 3QPKA 4XT1C 4OI9A 3AS3A 3LZFL 3PL6A 2RB8A 1TJIH 1T1YB 1H8LA 4KHXL 4GBXC 1BAGA 5LXGL 1FRGL 3OJDA 5KYXA 4ZFOB 2IPKB 3ULUH 1NOFA 3CN1A 1QSEB 2YEVB 4N2NA 4MJ5B 5E00B 3V7AG 4PP2A 2EC9U 1NGPL 1SJXA 1H5BB 1J8HD 1E3FA 3RFZB 3LS4L 3C08H 1PLCA 3OKEA 2EXWD 1Y0LB 1XCTA 1CDIA 1INQB 2K4AA 3AY4C 3FTYA 5DCCA 3ULUL 3DJTA 3FU7A 4J8QA 3N1FC 5BZDB 3MRRB 1C5CH 3NIGF 1TIUA 3CBRA 3QDMA 2G9HA 3RYMA 5ACLA 2NLJB 2VQ4A 4QD2E 1P6AB 1UM6H 3QH3A 2UUDH 4GSDL 4WUUE 3VI4A 3SPIA 3QZBA 3VD7A 1G0YR 3BN3B 3C60A 4HKBA 4NUPA 2GTZA 1SVBA 1MREH 1QZNA 4JPIA 3RVVC 1MI5A 3ECVA 4TSBL 3KH3A 3U7WL 5GGQH 4WK4B 3PHOB 3FRUB 1XBRA 1YMMB 2BIIA 5FPIA 4JO8A 2FE0A 4JVUA 2Q86A 1GH7A 1GMIA 4N0CD 3QUGA 4ESKA 2OL3L 1GIGL 5CEZL 3GSOB 2AV1B 2CIKB 5JQHC 2K70A 4S1RL 2NW3A 5IB1A 2GFBA 5D1XC 4DEWA 4AX3A 1YJDC 3HI5L 4QXGL 4PJDB 2AJYH 2R1YA 4XCCL 3KPMB 4NIKB 1B4RA 1KBBA 1XZWA 3STLB 1G7HA 1VACB 2ZNWA 4M4PA 4RISH 2NT1A 5IMMB 1EEQA 3EG9B 4I9WD 2Q3ZA 3CFTA 2X9YA 3TZVD 5GJTH 2OA9A 3WY3A 1AGDA 4E5XG 4JJOA 2EXWC 4Y4KA 3EZJB 4KK6C 3AB0C 1FNFA 3X13B 4CNIB 2IXQA 1OSEA 3MC0A 4MNHB 4NZTL 3RVUD 4CJ0A 4JN2B 5KSBA 3MLRL 3P30H 4QRBA 3VXRB 1PNDA 3ZDYB 3A3YB 1S7RB 2FYYB 4YSSA 2C26A 1JZ4A 3RPKA 4MMZB 5L0QB 1B9KA 2IADB 3W5NA 1IBYA 3D4CA 2P24A 2PP7A 2X5PA 4NUJA 3FF7A 3O2DL 2D7NA 5DR5H 3ES6B 1N64L 2FQDA 1E65A 2CZNA 4Y5XB 2BP0B 5TGBB 3CMGA 4F37K 3HA0A 3CFCL 3E6HA 1PX8A 5ESQB 5FK9B 1WYJA 3AM8C 4Q52A 3P0YL 1NUNB 3B2PA 1RZ8A 4ZOBA 1LO5B 3MV01 1CD1A 4Z77B 5J06A 5I6KA 1BVOA 4B27A 1KMGA 2WUCL 2Y7OA 3NESA 3FU0A 1F11A 1EJOL 5DDHB 3SKJL 2ODIA 4MRBA 4ZNEE 1JDDA 3LTVA 4G6FB 3ZTEA 4XHQA 4BK5A 2HRGA 3BSZL 5DT1H 3BVNA 1HDMA 4DKFH 5HHQB 3KWXA 2Z31B 5DMKB 1FYHB 4Y2LA 4FFZH 1NBYA 3K6SB 3BDYL 3GKZA 3FTXA 1JNJA 2AJSL 5EZIH 5FYLL 2OXHB 3X2QB 1N0XH 4BUQA 4D3CH 4PYGA 1OM3H 5KBDA 2ZWSA 4RIRB 3TURA 2EVGA 3ARPA 2K78A 3ARWA 2AJVH 3SSGA 2XN2A 1QKZL 1D6VL 4E9WA 1IAII 1USZA 1KGCE 1N2RB 4WI3A 3NK4A 5FM8A 5I82A 3V0AC 5FR3A 2XG4A 5AW6B 3NK3A 5FGBC 2F54A 1NAKL 4L2LA 4XXDA 4B53A 4X9IA 4KWUA 4PJAB 3VI3A 2HYMA 4MA8L 2BSDA 3MNZA 4TLSA 4LSUL 1AGDB 4A63A 1F97A 4RBPK 1L6XA 5D7JB 4AL8L 4IJTA 1MWAH 3TBWA 5K5YA 4GH7B 4KQ3H 5LGYA 2UZXA 4I13B 4B9YA 1IGTA 3MRBB 1RJCA 4M43H 3A22A 1UKTA 3WJJA 4JW3A 4QYAA 3KYOB 2AP2A 5ITFA 3PWPE 4U3HA 4N85A 1RERA 3BCFA 1A6AA 1TYJA 4GMSL 2ORBL 3D6GA 4DW2L 4G8EB 2WLJA 2EADA 2I9TA 4JB9H 4JM4H 3VWJA 3GI8H 3WFCL 3U2JA 5CBEA 1ODUA 2Z92A 3QDGD 4NDMB 2YD3A 3AT8A 4KDTC 4MCMA 3BE1L 3L13A 2VLKE 3W39A 5EU4A 3BUDA 1I1RA 4FQIL 4MXWH 4NNYB 2L7JA 4QEGA 4JFDD 2V8LA 3TFBA 5CCJA 4LHUA 1KFAL 2J20A 2Y6TE 2VC2L 3PIQB 4R6UA 2WXHA 5ESQA 1ZS8B 5FK9A 2H0JA 2Y6SC 1JFQH 1YO4A 4YQXH 5EUOB 1G94A 2R27A 1JHTB 2XKSA 1ZGLB 2IQAA 5D6DC 3SKNB 2C9SA 5DC4B 3UJJL 2NY5C 2DJMA 2WOBA 1T6WA 3UZQA 1Y0LA 2I7OA 5I8KH 4QO1A 4RA0C 1TCMA 1WIUA 2NY2D 4A2HA 4AW4A 5E0FA 4EAEA 2BRRH 2GVYA 1SBSH 4B95C 4ENED 4M7LT 1CYXA 4F8QA 4Y16D 1O0VA 2GTQA 4PLJC 3BPLB 2VLKA 3BSHA 4QTIL 2G30A 4CSPA 4ILDA 3VB9A 1PX3A 1UXLA 3ARBA 3U46A 4H20H 1H3UA 4GLRH 4R4ND 2AF2A 3ULUC 4HAGA 3MJ9A 4G3YH 5IEKA 3ATDA 3B9KB 4ZPTA 1UG9A 3FQ4A 1NSNL 3WUWB 2QSVA 1NANI 3S3PA 4AKQA 2J5LC 1MCOH 1DYZA 5D6CB 5F88A 2APXA 3TJHC 3HG1E 2ZYIA 3RILA 5ICZA 3QDME 1N5YH 3LKNB 3TIEB 3C2AL 4JCLA 1WTLA 2QVMA 2K9FB 1XVSA 5T3XD 5CLWA 5B3NA 5GZNA 3T3PB 4PH8A 1Q90A 3TT1H 5JYLA 4MCNA 5KJRH 3S5LB 3THMH 3WXWH 3IGKA 1I8MA 4PJXB 3DHPA 1RZFH 1OTUD 3K6FA 3Q8EA 5E8NB 3LSOA 3W0WD 2AXFB 4IGBC 4LLQB 2FWLB 4ZFGL 4Y5XC 5HVFB 2LW3A 3LZFH 4PR5B 3I75A 2YGOA 5HDWA 1TTAA 1SYSB 5HGDB 2ZCKL 4MMZC 4AJ0A 4O9HH 1BQSA 1ZAGA 2NZ9C 3IPEA 4K7FB 3DX2A 5FUZH 4E0RA 2D0GA 1IC7L 2EE6A 3M88A 1HVXA 4ORGA 5GXBB 4YWGL 5SWQB 4MJIB 1QQDB 2HMID 3LZLA 4G8AC 5BQ7B 5BO0D 4KJQD 3CQPA 2F68X 3QNFA 3DV4A 4Z0BH 4WJKB 2OMZA 1Y18B 5E99H 1I4FB 2VIRA 4ZPTB 2WYHA 5IMKB 4OZHA 4JFVA 4YDMA 4N1HB 4YHYC 3DVNB 3J2PA 1UTDA 2W9LA 2F1EA 3S5YA 1G9NL 4HFUL 1UT9A 5KN5A 1KN4L 5E2TL 3UBXG 1I31A 1QSED 1R3JA 2ICEB 2DMBA 3B5TA 3R7QA 2OJZH 5FUCC 2VLLA 3ARDC 1JPFB 2Q8BL 2DQTL 1XTMA 3DJ9A 3G5VA 4LSDA 4PS8A 3S7GA 1MCLA 4HLZH 3BRFA 2FHFA 5J9PB 4WUUA 4WHCA 5D4HA 1J9CT 1FV1B 3EJJX 4RGOL 1S9YB 4HDIA 4AC4A 3ULVH 5MP6H 2IBZY 1XSKA 4HMEA 2ZKMX 4MJ2A 2ED8A 4LL9A 5BS0A 4OGQC 1G1YA 1UJ3B 1VDGA 2WXGA 4JG0H 6FABL 3BEWB 3ZR5A 4NKQB 4HS8H 3OX8A 2YJLA 3P0VH 4FLQA 5LWYH 3VXMB 1R46A 5D1ZA 5MERB 5EU6E 2B4CL 4G6ML 1TQCC 3LS5L 4OGAC 3DX7B 3PNRB 3CZKA 3GSQA 3QUZB 5IEHB 5KVGH 4J6IA 3WKNA 1IKFH 4LLWA 4YXHL 4PTTA 1HCZA 1M4KA 3WNOA 3IDJA 4UTAL 4QTHA 3X3FL 1R19A 4G8EA 1AJ7H 4HQQL 4WZ9A 1VEOA 3SKNA 2HA1A 4JDZB 4UOJA 1FFTB 1HIML 3F7VA 1T4KA 4PMFA 2F74B 3BH9B 1AO7B 4GSDH 4H0LC 1L6ZA 2BH0A 2VDLH 2OXHA 4ZTPL 2JCCF 3AXLA 1LMIA 4WHTB 4P2AA 3PIQA 5D7IA 1IC5H 2YO3A 5F8RC 2JJUA 5I6OA 4AL8C 4G59C 1URLA 4TNWK 3V6ZB 2AEOA 4OQTH 4RGOH 3ULVL 4MJIA 1ID5I 2YAFA 5CWSB 1OAYH 3PUCA 1NGPH 2XPYA 3LQMA 5GRJH 4ZFFB 4XN9A 4ONFH 1Q9OA 5I74B 5T33H 4PG9A 5K9QI 4PM1A 2YRZA 4KMLB 4UILL 4FQ1H 3QRLA 3EBGA 2WUBL 2UZIL 4HVBA 3REVB 1IJ9A 1QBLL 5BZZA 3HN3A 5HDBF 4QIRA 1QEWA 4YBLC 2ZCHL 1DN0B 4NYLA 5SWSA 4NYLB 5SWSB 3MRKA 2K3TA 3SJVA 1CYWA 3WEAA 4A2DA 1D9KA 4XNUH 4XMZA 1JXGA 2YEZB 1GS7A 1S7TB 1IMHC 4P5KA 1OQOA 4BH7A 5B39B 4F93B 4RWYL 2BOCA 3PP3H 3CFIC 4FJ6A 3TN0D 2NQ3A 4N3UA 3ZYIA 2FECI 3O3AB 5CBEB 1HS6A 3UO8B 2DQUL 4XRCA 4BA0A 3V8CA 1FL3B 2D3NA 2WBXA 2J6EA 2WQUA 2BSSB 2G2NA 4XX5A 4J1UB 4P5MB 4XVTL 1A6ZB 1CFTA 1CUOA 4N0YH 2CD0A 2GIMA 1WFTA 2XN9D 1UT1A 3II1A 4LPXA 3ZL2A 2BERA 2ARJQ 2G9KA 5CZRA 3BD5A 3V0WL 4GRWB 5J89A 5IK3B 5D7EA 2OR7A 2HXAA 2XIDA 2Z93A 3PP4L 4ZS6C 1JGEB 1EFXA 1S8DB 3NCFB 2MHAA 3BC9A 5HHQA 2DYSB 4HWEH 2QELA 3LDBC 3NRFA 4U6VL 1CGVA 3X11B 3K91A 3AROA 4PREB 3D18A 4AXWB 5I6NA 1QBLH 1I8LA 2VR4A 3EGSA 4PPTA 3KPNB 4QF1A 3T0AA 5B1CA 1EPFA 1HINL 1TITA 3NCEB 4NI6A 5DO2D 2V9RA 1IFHH 1KPUA 5T1DL 2IAMB 4K7PY 3DVGB 2C9AA 3U36B 3VX0A 1MVUB 1RZGA 4L18A 5HJBA 1U2HA 1KG0B 1RD6A 2E8ZA 1SYVB 4HEPG 2JKJA 1D9KB 4KHXH 1RMFL 4ALAC 4PJFA 3BQUA 1WJ3A 2X4QB 2AVGA 3RWDA 2XWBA 1ROWA 4EI6B 3CSYA 4I77H 2NT0A 3U4KA 4X9HA 2WWNA 4K5LA 5MHSE 3KEHA 5IIEA 1QRND 4G72B 1KXTA 4NUJB 3NSYA 1A8JH 3DX9B 2H2SD 4MJ4A 1BFVL 3C6SA 2WQVA 3HW7A 4PY7A 1E3ZA 4RNRA 3QDMD 1BBJA 4X7SL 3MGTB 1M6OA 3GSRB 2ZF8A 1UWGH 3ZE2F 5E8EA 4OFYD 4L1DA 2B39A 3L7FA 1CXIA 2F61A 5EU5A 5KVEE 4GP8B 4KZDL 3VFNB 3L1EA 5KANG 1E4JA 4K2UH 3EG9A 3FT2A 2QSTA 3QC6X 4NN6B 2VDNL 4OZFB 1HYRC 3WSQH 3N44B 1CE6B 3T4YA 4DCQB 3DRTB 3FTSA 3O4LD 2ZXAA 4TMPA 2JQMA 5D2LF 5B38A 3N1QC 4Y5XA 1JJUA 5TGBA 5DJDB 3DO7B 5CCKL 3P0VL 1KLGB 3M86A 3I6GA 1OD7A 3VMOA 1XGZA 3AZUA 3RU8H 3TBCA 3BJLA 5TQ0H 5LAXB 2HUHA 4X9YA 1WA2X 5J12B 4CJ1A 2QR0B 3T2PA 3ZE0B 4H8UA 3QEQE 5IT2H 2XWJB 3EO0A 1FQ9C 1FH2A 1ZWIA 2X4SA 2AJUH 1UM5L 2BVOA 1J88A 4DP6X 3WL9A 1S7XB 2DQCL 4YE4H 3WTWA 4OU3A 1TU2B 1EK3A 2PXYD 5H37G 4C54A 3VXMA 2CDFB 1IAIH 3STLA 3CBKB 4NP9A 3LEYH 3L3IB 2CHNA 5LLIC 5DMKA 3RX7A 5ANME 5IMLA 3TBVB 2X2JA 3P3RA 1QMUA 2D7QA 4I0PA 4QTIH 4WEEA 4MD0B 1T66C 1Q9LB 4IM8A 3QDGE 1ZA6B 4LLUB 4LBEB 1T21B 1ITBB 2IH1A 1GA2A 4JHAL 5FWQA 4EZLA 4BSWB 1YEFL 5IOKA 5EC2A 2QBWA 1MHCB 1IE4A 1NBVH 3QQDA 1OANA 5E6YA 2VR5A 5I75C 3QG6A 2O93L 4NUGH 1T1YA 4P8QA 4WTZA 4ZPVB 4NLHA 4PCKA 5IHZA 3HKZA 4ETYA 3B9KA 1QWNA 4Y9GA 3U0WL 5DQJB 5FFGA 3TVMD 4QTFA 1ONQA 4KKAC 3CFCH 5J1AA 5F0MB 5E9DD 4NOBA 4PGEB 3OKYA 1AE6H 3LPWA 1YN7B 1UFUA 2FAUA 2UX7A 3MMEA 3IJSA 3T3PE 3UGXA 3KS0J 2OM5A 1T7XA 2YQBA 2JCCE 1F4YH 5IMOB 5DVLA 1Z2KA 3K0YA 2WIIB 1XR8B 1MUJA 1FO0H 4CNIA 1X5KA 4R84A 1P7QB 2NX5E 3BPCB 4OTXH 2ROYA 1PKOA 1FI8C 2O6EA 1JZ6A 3FQXB 5SX4H 3OV6A 2UZYA 5K33A 3AXIA 4JG9A 2OQJA 3NSJA 3PWNB 3VYPA 5CJ5A 3ZIYA 3OF6A 2B08A 4LCYA 3US0A 5DD3H 5C09E 1BQLH 2CO4A 3F7YB 1XIWB 4AGMA 3K8LA 4QRRB 4IGBB 4OD1H 4PB9H 2X0WA 3CZFA 4B9CA 2CRMA 3SY6A 1P5VB 1MRFH 4LSQL 3GSOA 2J4WL 5EU3B 3N9GL 4FF9A 1KCKA 5D7KD 3ZTJG 4R7DB 3QXDA 1RK1A 1WPCA 3QNYB 1XZ0A 3E3QC 3FB6B 4UT9A 1N7MH 2ZX7A 1B0GA 4FEIA 2GJ6D 3SE9H 3LN9A 3D9AL 1JV2A 4Y16B 3C87A 3WIHH 3SDAA 5IFAH 1S7VA 2FT7A 1ID2A 2VL5A 3CUPA 5CHNB 4YSQA 5ADPH 4NPJA 3DTUB 3WKML 2JIXD 1SXZA 4F33B 2AK4E 1BJ8A 4N2GA 1XIWC 1U3YA 3LQZB 4HWBH 2YXWA 4DWHA 2BNRD 1ADQH 1Z6JT 4FQCL 1T89A 4FCAA 4P49A 1KZYA 1MI5E 4PWKA 4WSGA 3ZHLA 1O6SB 2OI9C 1RU9H 3Q8CA 3C5ZB 1OM9A 2Q2EB 2ICCA 3K0WA 5HHOB 2LU4A 2CM5A 3BAEL 5K1NA 2JVUA 3ZW3A 5D55A 2C9VA 4IDJL 3T4AC 5IROA 4JY5L 4JFWA 1LO0H 1DFBH 5DXWA 4B9JA 3II3A 2Q1EA 1EJFA 1G1KA 1DJIA 2WIMA 1DSFL 2DTSA 4P2OA 3RDJA 3WHXB 2Q8AL 2CCWA 4KXZH 4WO4B 4IJ3B 1FFPA 1L9NA 4L3CB 4HPYH 3QUYD 5F7EL 1JL8A 5CLTA 3OHXC 2WMPA 1RJYB 4YHIA 1P6WA 5IBTL 1AZCA 1A47A 4YR6A 2PYEA 1OAKL 2ZNXA 3AAZB 5HDBB 4A6YL 4A39A 2C4FU 4QXUL 4OFYA 2NSXA 2NUTB 2F54E 5GS3A 4UI2A 3FCGA 2YGQA 4PJGF 4H8HA 4ZAKC 3ZTNL 1IL1B 4S1SL 1CS6A 1KCVL 1YAZA 4IBLT 2ITCA 3HHRB 2AK1L 3RZCC 3RWEA 5KTEL 5HD8D 4EZJA 3EDDA 5DJCB 1IFHL 3JT0A 3SDAD 3MLRH 3P30L 5EZPA 2XN1A 1HH9B 5PCYA 4DP7X 2OJEA 1NCDL 1HWHB 5BS0D 3RWIA 1QSZA 3KWWB 3RY5A 2VUKA 4N2EA 4HJ0C 5EU3A 1AD0A 3RUGB 5GJSH 3S36L 1ZANL 1NC4A 3SODB 4Q97A 2ADJA 3CV5A 4IK7A 1YY9C 1C16B 3FS9A 2DMCA 3VXSE 1HJBC 5FM5M 2YEQA 2W0FB 2LLLA 4WUUD 3HMWH 3F12A 5MENE 3KPSB 4ACTA 5D72H 4QWWC 2DYPD 4X4XA 3P2DA 3S48A 1IX2A 5F8QC 1MJUL 4BCYA 3MUGA 4LIQE 4ERSH 2BIOA 4LU5H 2YSSB 3MRQB 5IB3B 4OCLC 1AGBB 4JR9L 2A73B 3QPQC 1NANH 4GW1B 2H32H 5FGBA 3UMTA 2AQ2A 2LVEA 1IT9H 1LWJA 5DS1A 4KGLA 4KXAA 4JFOA 1RUML 1NFAA 3VSQA 1CFQB 1JUFB 2YAPA 4EIBA 3C09C 1ILUA 2KZWA 3HE6A 1HEZA 2CJ3A 4OAWB 3DV6A 5KSVA 1QLEB 5C0AE 4UIKL 1NDMB 3S88H 2WKOF 1LK3L 5F3HA 2EDHA 1I1AC 3T2LA 2E9GA 4PG2C 3X14A 3NCWA 4WW2C 5B38B 3ULVF 4K8RH 3KW7A 1DLFH 2PW1B 1LK2A 3A4AA 4QNPF 1NWOA 3FZUC 4L48A 4PVMA 3GPEA 1T1XB 3V79C 1CE1L 3OLDA 3S34H 2WXNA 1YEEL 3S4SB 2C4FT 2XVBA 4XTRC 1VHPA 4PJHF 1F4AA 4O51A 3SKOA 1BEYL 4J4PC 2R39A 2FD6H 2WSDA 2B1AL 3BCDA 1KT2B 2VB5A 3GLZA 1OAYL 2QSCH 3QHZH 4L5FH 3MRMA 2H3KA 3AXHA 5CEZE 3GZOA 2P9RA 4PJFE 4B9KC 3C6SB 1SM3L 3UL4A 5IV2B 5DJ8B 3BP6A 4XX1E 3ROLB 3NAAL 2ZOTA 2FZ3A 3NBNA 3I9AA 4YFDB 2GSMB 2H5UA 3QUXD 1UATA 4YDVA 5I8EA 5DTFA 4Z9KB 2CLZB 3V6OA 2X4QA 3E38A 3D2UB 4PJBA 3X3FH 5T1KA 5E9AA 4JFFA 1CG9B 2CIIB 4UMSA 1MFUA 4GT7A 5CZKA 2ZPKL 5FO7A 4MD5B 4BFEA 1UZ8A 1BVLA 4CSTA 5BV7L 2G0LA 4QRQA 2EO1A 4PRHD 4EDWH 3VW3L 3BSGA 1B3IA 2WINB 5IESH 5HYSA 3OJDB 4GRMB 5B38G 5KYXB 3ML8A 4PTUA 3DURB 1L3NA 1E8YA 2BS9A 3VYNA 4D0CA 4X4XB 2EIEA 4JZOA 4H8PA 2XKUA 2G3MA 2Z7YA 1OQXA 3AQXA 5DMIH 2VCOA 4IIQC 1AGCA 3IDNB 1CLZL 4YSCA 5D1XB 3DV6B 1BXAA 3MRMB 5C09B 1EZSA 2XVKA 2EDNA 1XR9B 3CQFA 1TMQA 2C5DC 1JWMA 5BUPA 3G5XB 5DZAA 3O11B 2DLHA 4EVNB 5IR1B 1QD0A 2V6HA 1IJNA 2VABB 4TUOB 4AITA 4B7IA 5HYJB 4TLTA 3VFUA 1GC1L 4WV1A 3EJPA 2J8UE 3SQRA 3ZYZA 1DLFL 3FYIB 5HYEA 2EDEA 4LSVH 3UAFA 5DTFB 3UZEC 4HLJA 3VRJA 4GI9A 3PWLA 1XGRB 2A83A 1CICB 4OT1H 5EO9B 3VRIA 1JZEA 3B9DA 1J1OL 2AI0H 3GF8A 3GS0A 3NOIA 2J88H 2FQGA 4LNRB 4V11A 4PBVC 1IC1A 5DRNA 4D9QD 1SYVA 5F44A 3FOLA 2A99A 5C1MB 1NGXA 2JELL 3DRQA 2XG5B 3HCVB 5A1AA 2AQQA 4A7GA 5DQDL 5EA0H 3SPHA 1WBYB 2OK0H 4FNSA 1EXUB 3TBBA 1CR9L 3KLLA 3O45B 2W91A 4ZYKA 1P7BA 1MCPL 3J8F7 5FGSA 5I8CA 3MOAH 3RIFF 3ZK0A 2RCSL 1GCFA 5DGQA 5DJCA 1EJ6A 2Y2YA 3MLXL 5DRZB 2IWEA 2NDFA 2F5BL 1OAZL 5PAZA 3D39E 3QDGB 5IG7B 1JHLL 4R97C 5FCUH 5INCB 4BQ6A 1X5ZA 3G6JF 4RDQF 4B9PA 3KBFA 3F7KA 4D0BB 3KBEA 4C4KT 4ADGA 4JDEA 5TE4L 4BFNA 2VRQA 4L05A 5D71L 4UYQA 2G5BB 3PFUA 2JNZA 3WNKA 1MFBH 2KZBA 3GSVB 5BRZE 2FLMA 1UWEH 5IHUL 5I1JH 3S35X 1J9SA 3MRQA 4FG6C 4YDZA 2FATL 5AW3B 3WAJA 1B4LA 2WGXA 3TA4D 4LP4A 4WLCA 4UNUA 3RIAF 1KIRA 2PPAA 2QVFB 1IQWL 2EYTB 2PR9A 3ISWA 2KL6A 5D1ZB 5MERA 4NQCE 2ZTBA 4KRPD 5ID1B 4PVLA 5JMRA 1A25A 4FGMA 2ZP8A 3ARXA 4I0CC 5JXEA 1EVUA 3R1GH 1CFBA 1EHNA 2G75B 1DANU 1JAEA 1JVOA 1G7IB 1I8KB 1YHPA 3VXTA 3ZTNH 4P3CH 3MX0B 4NT6A 4AQ8A 2DQHL 4HKJA 3RDTB 4B9GA 5KVMC 4WY7L 4F58H 2VW4A 3K1DA 2P49B 5B1AB 4NKMB 4A2MA 2NTSP 3FQXA 2R0ZL 4W9JC 1XD1A 1H3PL 1HH9A 2NY7L 3EHBC 3FO1B 4ZO7A 1ZDQA 4KDTA 2WGNB 4N20A 3W9DB 1DVFC 5F1IA 3VDAA 3I50L 4BDVB 3W11C 4XP1H 1RVFH 2XBTA 4K9JA 1RCYA 1UA6H 4AOFA 4JRXA 1FH5L 1FG9C 3NJMA 4NRXA 2APFA 5SV4A 2R2HA 1V8HA 5AB9A 1P84K 1F02I 2IDTA 3NFSL 2QMJA 4IRSA 3ULVC 2C7UB 3GHEH 1BZDA 1KB5B 3LEXB 3EBAA 4MHHG 4NQVB 1FWXA 3OGCB 1CZ8L 3CSFA 4HC1L 3FUDA 1A6UH 2NYYC 1WV7T 3MN8A 2RAMA 3C5SA 1IGJB 1W8NA 1JV2B 5A40E 2ZXCA 3T77A 1F1AA 1AIFB 1IT9L 1BZ9A 3BP4A 3DMMB 4JJHA 4LLMA 4N87A 4X5XA 3OF6D 1OB1A 4HV8B 3TNNA 3WFBL 1FAIH 5D2NA 4MLIA 2F8VA 5AYUH 4ODTL 4LEOA 4K3DL 2ZOLB 3BISA 4OFKA 1MLCB 3RKPA 1HQ4A 1CDJA 1U93B 3U25A 1N4XL 3PABB 4JO3H 5E4IA 1E9OA 4RWHA 6CGTA 1YDPA 3L5XH 4GQQA 2WSKA 4MWFA 4XZUA 1G9NH 3DYMA 2MRYA 1YEFH 2F0CA 4BJLA 4OD1L 1KJ2L 1UADC 3S9DB 1QFWL 5F1KC 1C5DB 1MLBB 1WFNA 5H2BB 4IU3A 2QGCA 5HP5A 4NKOB 4MBRA 3TVMA 1MW3A 1QFOA 3LHPL 3P3UA 1RUQL 5ESAB 4WWOA 4K3EL 5LQBH 5CKAA 3D87B 4EE2A 2XQYG 3QA3B 3PAVA 5A2JH 4X6CB 2G2RB 1FO0L 2F58H 3K2MC 4X50A 4DKEH 2NY6C 4D7BA 4IBSA 4LHJB 4FP8H 5JR1H 1XFPA 4PJEE 4CDGC 4P2QD 4JO1H 5IMLB 1Q8MA 4JFTA 4HOWA 3L5XL 3QDGA 5IG7A 3MCLH 4FQLH 3VNYA 3DECA 1AC0A 3V0VA 1SN2A 5CCHE 5E56A 5IQ9B 1JG9A 5AYUL 5T5FL 4JRWA 1V10A 1X5LA 1ZVHA 2VDRL 4KH9A 4DH2A 4LCCB 1J0ZA 3KYAA 2QR0A 4X6DA 5AB1A 2J43A 4QRRE 3ROOA 5EOTA 1ZA6A 3RX8A 1KXVC 4QT5B 4DTGL 1KCRL 2A74C 3EFOB 4JMXA 4OJFL 3UMNA 2EIDA 1SFHA 3DGGA 3CIAA 1EUUA 4MVBD 2XZQH 3O9WC 5HHNB 3Q44A 4HIQA 2AAAA 1MFEL 2KI6A 2HZHA 3IU3B 4WNQB 3O4OB 1E9PB 2WLLB 4JREB 2JWYA 3ZDZB 3V4PL 1QZ1A 3VA2C 3QUZD 4PJCF 4DZ8A 1TYEB 3RNKB 4WTXA 5ABDE 4V2BA 1BQHB 3LCYA 3LAFA 2VUOA 1HKLH 2MIZA 4P23D 2OKMA 1NL0H 4JKKA 4QRRD 5F7FA 4LARH 4EI0A 4OZIF 3RZCB 3G08B 2AJ3A 4OF6A 1U8PA 5CSGA 1WIPA 2DYPA 2FJFB 4ZUUB 4RAUB 1PU0A 4U2YA 4OM0L 3RX9A 4GAJL 3A4FA 4X7CC 4R90L 3UC0L 2BY1A 5BVJB 1K4DB 2IDUA 3SY0B 2EO9A 5IROD 3N43B 4QYOA 2DIBA 2OCJA 5EDXA 1W6WA 3MXWL 1C8PA 3C60C 1U58A 5I17A 1O9VA 1EO5A 4NUMA 1W2KT 3BKMH 5TK2A 5FYJU 5CJQH 3SE3C 2VMCA 1UGNA 2BFVL 3AU1B 4NQEE 5L2KA 3MNZB 3HUJA 3GSUB 4GXUN 4U1GC 3ULVE 1TSRA 2CHWA 3EF7A 1FBIL 3RL1B 3SDDA 5A2BA 1MF2H 1XF3B 4L8SC 4P4KA 3MLPA 3BAIA 3V0JA 4QNPE 1C08B 4JMNA 2WYZA 3K2UL 3D18B 3S6CA 1JDAA 1EDYA 3L16A 2R69H 4YDVB 5AOLA 1PBYA 4TULH 5CGBA 1KLFB 1H15B 1K4CB 4HZLB 1IGMH 1J87A 1QR4A 2GJ6A 3LPFA 3EYQD 1UYWH 4B7LA 3F12B 3WXVL 2NX5A 3E3QE 3BX7C 1ZHBB 4P2OD 4XN2A 1T6VN 4AIZA 4C4KO 1LL1A 2PWFA 1FE8H 3DROB 4XVJH 3HBPA 1RZIB 2W5PA 3OL2A 3OQRA 4H26A 5FW8A 4EMZA 4LAJH 4R5XA 1HHJB 1MH5A 5GHWH 1HHJA 1MH5B 2MNWA 5C0ND 2C3XA 4UINL 1U8CA 5DUML 1A9EA 3BQUD 3O3AA 5IW3A 2BVPB 4XN5A 3OPZL 5K9JL 3OTTA 3ETTA 3HHSB 3P2BA 4MLSA 4CRPA 4H1LA 1UOVA 2H9GB 5TDOA 3AS0A 2W0LA 5HVHB 1M56B 4XOEA 4WUKH 5D8JH 2JTDA 2WUBH 5L6YL 3GT6A 4UCFA 3IYLW 4IOFD 4L0YA 1CL7L 3MLTA 5CN2A 2XFGB 3WMPA 1S9WA 3GMQA 1JZ2A 1I3RB 1FG2A 1PG7X 1KGXA 4IBWA 1LDSA 1KTDB 3SE3A 4JDZA 3SIKA 4N22A 5IB2A 3E8VA 3V4VA 1FF5A 1GZPB 2IADA 3ILQD 1CTMA 2WQWA 3PDOB 1KTRL 4M5TA 2X7LB 3L9RB 4FLSA 4JZNA 5E6IB 4GSQA 5E6IA 4QRFA 1C5BL 2W9EH 4WTQA 4MJ6B 4YHPA 5I19L 2IXQB 2WNKA 4MNHA 4ES9A 2XOTA 4G43A 2RA1A 4DHLA 5GRXG 4WI9A 5C0DB 2FSEA 3V6FA 4LSQH 5DC0A 4XMXA 3OSVA 4OCXL 2VN6A 4ZX6A 1GTFA 2E4TA 1PY0A 3P4NB 5DYOB 5TF0A 4J2XA 1U58B 1Z9SA 3EYOB 2A9CA 4DZBB 4ZMTA 1GAFL 2XU9A 4PJ9A 1KGJA 5FYKU 3L1OL 5BO1H 3TBSB 4JKMA 2ZCZA 2EDTA 1E4XH 3WNIA 4KHTH 5BS0B 4UTAH 4JPKL 1PF3A 1MPAL 1ZA3A 5I1AB 4M7ZC 4UM9A 4OCXH 1WWWX 5K59F 1M53A 3UYPB 4MYPA 3SDAB 4Y4FC 4H8WL 1R47A 1OLLA 3UTPD 1E6JL 2IDCA 4NRZA 1CPUA 3VB8A 3WENA 1JPEA 5A2CA 3LXCA 3MYJA 4R4BB 1NC2A 3QG7H 1JGVL 4CVZA 5GS0D 4RSYA 5AWNL 5L8JB 3EJQA 1NEUA 3GHBL 4I9XA 4KK9C 4L8BA 5JZ7C 3OKDB 3J07A 3KLHD 2E75C 3LD8B 1H9VA 1GGBL 1S9VB 4JQIA 4JG5A 2VSMB 3GS7A 2X1OA 4P2QB 2EE0A 4DK3A 3ABZA 1IUZA 1YN6A 3CFKA 2P8MA 3RPIA 2EUVA 1F4WL 5KYWA 5DJZB 2NR6C 1M7UA 3TO4D 3ZRFC 1U3ZA 2OMVB 2ZXDA 3ATAA 2GCYA 3QGVA 4YPGA 1JZGA 1IC5L 3AACA 2I24N 1WBZA 3EYUL 4XAWH 1SM3H 3D39D 2VJ8A 1EEYB 3HZVB 4B41A 3KDMB 1PZSA 3P2TA 3BXNA 2BVYA 1XGTB 3NFPB 3RFZC 3OKEB 2CHXA 4FQXC 5CJ8A 1U8HB 5AAPA 1G4RA 2IG2L 3RVXD 1P7QA 3INUL 2WXLA 5CWSA 4OBRA 1AS6A 2BNRB 4LPWA 2X9WA 4EN3C 4UNVA 2CDGB 4WY7H 3ZGIA 2FO8A 4PS3A 2IAAC 5IVZA 5EUKA 3UPAA 4EUPG 4UT6H 4OJDH 3WEOA 1Q1JL 3IJ7A 5JIKA 1KWKA 4D9QE 4GKZB 1VERA 5C6PB 3RIFK 1A7NH 2ROXA 4LKCB 5TDPA 1RHFA 2GHWB 5HVHC 4EQ3A 4B97A 1PKQE 4X4MA 4HOZA 2NY1D 3HS0B 1CDBA 3LN4B 4BUGA 5FF6A 2GB2A 2VXTL 2CJTA 3BDXA 5J13B 1DSWA 3HB3C 3ML9A 1QX1A 1JPFA 1VB9A 2V5RA 4S2SB 2A3TA 2V4LA 2DQUH 5EMYA 3NCJH 2D4FA 1IO4C 3C08L 3CVHH 4UTBL 2BJML 5DD5H 3Q5YA 5D1XE 5CSZA 3F01A 3X1BA 5JXAL 2X38A 4M9PA 5L2KD 2VDOB 4IRJD 1BAFL 4KMQA 2NMSA 2XWXA 3GRWA 4G6AD 3RIKA 1AFVL 3ARGA 1HHGB 4YOKA 4JHVA 4YC2B 1C7SA 1EMTL 1UJ3A 3DDFA 3GJEA 4AW7A 4B0MB 1IAMA 4FQXD 2BJMH 1EO7A 3IJHA 2W9DH 1IAIM 2X4NB 3LKRA 4NO5A 5CLXA 1TETH 1WA0X 3U4BH 3QORA 1BGXL 1OPGH 1AFVH 3MRLB 4Y9BA 3LZPA 1WHPA 1H5BA 1JZ8A 1ZT1A 1NCDH 1CIUA 1D7DA 1KYFA 4JJ5B 4X0KA 1J0IA 2ESVE 4LEBA 3BEVB 2ICEA 4NO0B 1P5UB 3HJEA 1W72B 1FFOA 4FNRA 3PDGA 5JIDA 2GABA 4OV6F 1O7DC 3LN4A 3V0FA 5D4IA 5IVNA 2X41A 2YD8A 3BVXA 1TZ8A 5EEVA 1ONQB 1MFAL 1PY9A 2B2XH 4FG2A 3ZMEA 4C47A 3RTQA 3D4YA 1LO4H 5D2LA 2H0EA 3MBED 3DX8B 5INDA 1RAMA 1ZE3C 1EBAA 2CCLA 3K4AA 3RURA 4RGNC 3K6NA 4KO9A 5EUKB 4HX1B 5JNYB 3ZN6A 4UNIA 1CLOH 4XI5C 3UG4A 4K3JL 3IAGC 5JORA 3POHA 1BAFH 1YNTB 5HGHB 5DHEA 4FTVE 2IV9A 1E6OL 2A77L 1AIZA 4XNYH 1MRCH 1B2WH 2MQ3A 2AQSA 2AKRA 4PRID 4Q14A 2GEQA 3LKRB 5LXVA 1PPIA 4JREC 3TFKC 5AVUB 1A3QA 2G4EA 2WVVB 2VXTH 1T0NB 2QV4A 4MQXD 3AWFA 5DZNA 5BRZB 1IU1A 3MCLL 3O6ML 4FQLL 3IS0X 4TULL 2AXFA 2EH8H 1AY1H 4KQ4L 4UDUB 5TTRA 5CLYA 1YSOA 3GO1H 1EX0A 4N8CH 4X2UA 3VGHA 3KW8A 2PKDA 4JRFA 1T04A 2N7AA 2ENJA 4GG6B 1O5PA 4IRZA 3E1F1 4Y4KC 2UUDK 3JWOC 4DW2H 4NKDB 4R2GB 4PJAA 1MAKA 1NPNA 1IFRA 2X6AA 3BW9A 1N8ZA 1ULVA 3CHXA 3MBXH 3RGHA 4L8SA 4P4KC 5LAXA 3NIDB 5GS2H 5JQ6H 2VR3A 2YD4A 1IEAB 3QZOA 4U1MA 3ZKMC 2B4CH 4G6MH 4LVHC 5DD0H 4CU8A 1CGXA 3FQWB 1T7ZA 1XO8A 2DQJH 3EJCA 3QWQB 1SLWA 2DMGA 1MWAL 1KPRA 3OC8A 2EXYC 3PWPB 4UQIM 1BJMA 3GHPA 5I0YA 1AR1B 2DOCA 1YEKH 1F5WA 4L4TE 4TUKH 3T65A 1KELH 1AXTH 4MCYB 1JNLL 4E5XA 5C2BH 4AGLA 1MDAA 2FO4B 3JV5A 4E41B 4YO0A 3ARFC 1BF5A 3D3VA 2ATKA 3N91A 5D70H 2C8NA 2VLKB 3NIFE 4CVZB 4GRLB 3WFBH 1DDHB 2Y24A 1HCVA 4G7RB 4OM1H 2L8AA 2BP8B 4HT1H 3FXIC 3L45A 3UO1L 1RJLB 3L3OC 4HIEB 1SLXA 1T3FB 3RI5K 3ZZ1A 4YDNA 1B0WA 1KIPB 4Y5VC 3BXNB 4N3TA 5EUOE 1SDDA 3T6WA 3QUZC 3CLFL 3Q6GH 4UQCA 4GI8A 4TRPH 5B7MA 3W37A 2V3EA 4N2HA 4EF3A 3FOLB 3V52H 4M62H 4JFEE 1UXSB 1P9MA 2P5EE 4U1KA 2F54D 3RVUC 2IOOA 3WKPA 1BM7A 1MPAH 5DJ6A 2LV4A 1A8ZA 2HAZA 3HG3A 5IJVA 4X99B 4D8OA 4L1HA 3L1OH 3N41F 3S96A 3NJKA 4DFIA 1JGDA 3IDIB 4FMVA 4H5SB 2XV2A 1W16A 4Q2ZB 3RNQA 1VADA 1J7VR 2WXFA 1P4IH 2D73A 1KXVA 4OIIL 4MA7L 4KC3B 5D7KE 4CDHA 4KJYA 5EC1A 3FT3B 1FYTA 1JWMB 3TJEH 1I8AA 4FG0A 4LOEA 5E08L 3LXAA 3BUBA 1MHEA 4Y4HC 4XNQA 5C0GB 3CDYA 4XWGH 3OAZH 1IM9B 3UTOA 5FFOA 4PRHA 3NCBB 4WU7B 4HS8L 5C09D 4P23C 5I0XA 1ZVNA 2OYMA 4FJYA 4ETQB 3HMWL 1A6PA 1PZ5A 3CC5B 2H9GA 2CUAA 4PP1C 5EU7C 4N6QA 4WHYG 3NQKA 5DHVA 2DM7A 1A9EB 3RWGA 1XB8A 2D0FA 2NX5D 2OW7A 3QIBB 3AGVA 2BNUB 3CGTA 4LEEA 4F7CA 4W9KC 4XNMB 5ICYA 5F3BB 1P7KB 4FXKA 4KRPC 1BQHA 2GJ6E 5IKCB 1AYRA 4RAVA 1JPGB 5C2BL 4XGZA 2LLGA 2NSQA 5I0WA 1X4ZA 4JAMB 4M6ML 4JFDB 4UQ3A 5DFWH 1HCFX 1DUYB 4GFTB 4YZFE 3UCQA 3FKUS 3V5HB 4HK3N 5F0JB 4KI5F 4R3SB 1EFQA 1H15A 1K4CA 3PWLB 4P23A 1UXWA 3PUUA 4H20L 1K4DA 3MHZA 2XWRA 1CGYA 1HEHC 5I66A 1NL0L 3O6FD 4ICXA 3Q2NA 3EJYD 4OLXH 1DSFH 4L1LA 1UWXK 3QIBD 4R90H 2AJ3B 3GMRB 2NW3B 1FN4B 4JS7A 3MNDA 3IRPX 3TTYA 2JB5H 2KLTA 2VAAB 5A6MA 4JO4H 2XXGA 2CDEB 2HFFB 4IOFC 1SLVA 4NZRL 4GRLC 2Z0UA 1FNGB 4JE0A 3LXBA 1I9IH 4JN1H 4A1RA 3DYPA 1BQUA 5I1CH 4P04A 4KVPA 2AJXL 2B59B 1SXAA 3O6FC 4JFFE 5D7HA 1NJ9A 4NZJA 1JWSA 5E9DE 4L8CB 4IRSC 2H2PD 1TTUA 3IPFA 2VDPB 4RISL 4BFIA 1FSKB 2AGJH 4QHKI 4M6MH 3FTGB 3TO2A 4MMZA 3D0VB 4N5ED 4L4TA 2IH3A 4XP6H 4L4VE 2VR8A 3H8NA 4L29B 5AAWA 2XUWA 4WK0B 5EOQL 3MOBH 1W8EA 3IJEA 4NO3A 1PQZB 1OTSD 1SYSA 5IBUB 1EAPA 5DWUH 1MFAH 2B2XL 3T0WA 2OW6A 3HC4L 3NABH 3T0EA 3DOIA 2FJSA 3IBOA 1ECYA 1JK8A 1T0OA 4TYUA 1DEEA 2FQEA 1JWUA 4LHQB 1Z3RA 3LS4H 3ZZQA 1QO3B 3F5WA 1FC1A 4LPYA 1F18A 2GTWB 2VWEC 4TPRL 5DMGD 4DOHE 3UGUA 1CURA 3JV0A 3VQMA 1H3TA 4KO7A 2C34A 3BWZA 2WBJC 4POZC 3SPCA 4KNQA 4LVOC 4E41D 3A6CH 2HTKD 1P4IL 2HWZH 3IFLL 3L48A 2Q3XA 3C5ZD 2BM3A 3JWDC 5JLZB 3GBML 1BP3B 4U1HB 1K8DA 2UY7B 4HP5A 5AEAA 2I5YH 4A37A 4HS3A 5IJBC 4BKSC 3ABMB 1YUHB 4NO2A 1BPLB 1E8ZA 1EDQA 1KXQA 4L3AA 3RVXC 1GW6A 2Q76B 4Z7UA 4M61B 5D7IF 5DUBA 4N5EC 3WCYA 1URZA 1M7DA 5DK3A 5AVVB 1DBML 4M5ZL 5CF3A 2DZEA 3RB7A 5F72S 1TFHA 4FKEA 4PBXA 4R7LA 1JVLA 3UDWC 2XJLA 1CLVA 1GGCL 3TA3C 1A7QL 1QW8A 1P5UC 5J3HC 4PJ8B 4NENA 5GGTH 3RVVD 2CKNA 4G7YH 1INDH 2AQNA 1K9TA 3QJVB 2YD6A 1PKQA 4M7JL 4PN6A 1VPOH 3ZKNC 3D33A 1J48A 4MJ5A 3RA7L 2XV6B 3IETA 4NBXB 1CFVL 1T20B 3OPUA 3FT0A 4Q9BA 3VX1A 1A7PH 2AVFA 1A6TB 1MCWM 5LN4A 2VE6A 3B7TA 4NQDD 5HPMB 1T4WA 3EGDA 1KGYE 1QRNE 2C3HA 4H25B 5JOPE 1OGAA 4HH8A 4DGVH 4X8CA 4ZX5A 4L9LC 1FZJB 5GGSY 1YEKL 3S88L 3SGJA 2P8MB 3RPIB 1KB5H 4JFZH 1ZJAA 4Y2DD 1QA9B 4UOQA 1YNKH 4KROC 4IBYA 4P59H 1T80A 1S3RA 1XCWA 3WIIH 5IHBA 2J1YA 3E8UL 4JY6B 5KBPA 3KWWA 2QDWA 3CZUB 2DM4A 3SDYH 5EU4B 2W95A 2XPGB 1KBWA 1GHFH 4YSAA 1MJJB 4NZTH 1ND0B 1L9QA 4LLAA 3BVUA 4CU6A 4EUPB 2QPSA 4EUPA 3VWJB 2Q6WA 4KK6D 3GNML 4JFSA 1FO0A 4QHLB 4CBZA 1VRSA 4H0HB 3EYSH 5FB8B 1GJIA 2H26A 1IBDA 4PGCB 3RI5F 2XQBL 3CZLA 2FVNA 3ZQWA 5ISZA 1G7IA 2HT3C 3NA4A 3VXTB 1T83C 1GJWA 4YHML 4PUBL 2WNGA 1DQTA 5CIPH 4DVBB 3O3EA 5IGXH 1QEXA 4NQCB 1FJ1A 2NW2A 5DT1L 4XNBA 3MCYA 4E42A 1VFUA 5HYSG 2UZYB 5DD1L 3TCLA 1JGUH 4H8WH 5KS9A 3MRNA 4J8RA 4YIQA 4MNQA 3S3JA 5DSCB 4H4NA 1IZJA 1YAIA 3O2VL 2J8HA 4UT7L 4JFZL 5KUMA 4F9LC 5IVXB 4PJ8C 1MY7A 1CT8A 1G87A 1MCNA 4H88H 5F9JB 4ABUA 2NY0D 1LO2L 2IH9A 5I73C 1NBCA 1NCWH 3TCXA 1RLBA 1JBJA 5LNGA 4N1EA 3N50A 1QYGL 4RGMC 2FGWH 3VGEA 1J10A 1UM4L 4TLKA 5E8PB 2NXZB 4MASA 3VRJB 3FQYA 1AHMA 2OX5B 3GBNH 3QDJE 3RA7H 2MTPA 1NLDH 4Z7WE 3NIGE 1XAUA 5E99L 4LL4A 4QHLA 3UTQB 3D85D 5KJ7E 4O02A 2WXMA 3WD5L 3H7BB 3LQAL 2A1WL 1NMAH 3QNYA 3AC0A 1MKFA 3Q48A 4HEME 3GINA 4FXTA 2VH5L 1PFCA 1WGVA 1OPGL 5ITFB 2NZ9D 3VJ6B 1SFDA 3QB7C 2CBMA 3ZUCA 3C8KB 4X9GA 1OARL 4YDKL 1FZJA 4JO2H 3QDJD 4UV4L 3FF8A 3UJIL 2X6MA 3VRIB 1OAJA 2PCFA 2E7BA 2ZAGA 1FDLH 4KO6A 1A6WH 2DN7A 2H8PB 3T0EB 3W57A 4BV1A 4OT1L 3X3GH 2FR4A 2A6DA 2VXVL 4MJIE 4RX4A 3TYFA 4AIOA 3BUIA 2OULB 4G80B 5FO8A 4TQIA 4AZUA 3HC3H 3TONA 4NGHL 3FH7A 4P48A 2FL5A 3ZJAA 5EF2A 1NMAL 5E6IC 1DQKA 5FO7B 4AZ8B 2DWEA 4K9EH 1NCGA 2OTWB 2B14A 2Y9RT 3RHWF 2CM6A 4AQAB 2BSTB 3PP3K 3PXHA 3BGAA 3OR7A 4MCZB 1MJUH 4ODBD 2AV7B 3EXJA 4PD4J 1VFOA 2R2EA 3K80A 1KSRA 5INCA 3QWNA 3VXUE 1QOKA 2EDDA 3LNFA 4NERA 4U33A 2O6DA 3HMXL 3OZ9H 3QIWB 4FNQA 3ARRA 1YUHA 3SBRA 1MAMH 5TDOB 5KSBE 2VDKH 3TM6A 3KPQA 3JTSB 4BK5C 1P69B 3QQ3A 4ZUSA 3HG5A 1ZJBA 4OFPA 2X3BA 2F53A 2JK5B 3JVGC 2EUWA 4Y16C 4GQ9L 5EEUA 3ESVF 4YHKH 3SKMB 1LO0L 4P9MH 4DGIH 4KZEL 2AABH 1T03L 3QUKA 4UUJA 4LBAA 2AK1H 3PQYE 4Z5RA 1FZKA 1ZHBA 2H32A 1QSEE 3VG0L 5DRNB 1LO3L 3DX9A 5A6LA 4PJCE 2UWEF 2DLGA 4GAJH 2FHCA 4KY1L 2E27L 4Z7QF 4QXUH 2VERA 3NJIA 3OBAA 3VXOA 4LOFA 3ILDA 2ZWNA 5IBTH 4RRPM 1AKJA 12E8H 2HLFD 3DURA 4WI0B 3GKWL 1U92A 1OSPH 5FUCE 4U6HA 3SGKC 1EAJA 2BDNL 3V4VL 1TU2A 4NQDE 1F2QA 1MJ7L 2A4CA 1H19A 3VFWB 4MXWL 4M8UA 4YSRA 5JHLL 1KN2H 1I9EA 4AYDC 4M8RA 3QQ4A 5IVOA 3RFZA 4ORZC 5DEFB 1UB5B 1UVQA 2FBRA 1UB5A 1UVQB 1X9QA 2Z4TA 5DI8B 5ETUA 5ETUB 1RULL 2IEPA 3PAYA 1OWRM 1AZNA 3QJXA 5ICXA 1RIHH 4AQZA 5FYLD 3FB5A 5CINH 1B9ZA 2RACA 3FAXA 3QFDA 2R2BB 4ZD3H 4G80A 2FIKA 5EWIL 4GT0A 4KKCC 5TFSL 3NCMA 4GQ9H 4Q74A 4C56B 1YQ2A 3V95A 2WNWA 4PLKD 3MJ7B 4ES8A 3WELA 4X8XA 1PIFA 2C1PA 3KD4A 2D31B 4RAHA 3VRLF 4OZ4B 4YL9A 2HKHH 2FLRT 3DSFL 3U2IA 4Y4HB 2HP4A 2ITDA 1GJUA 2AFNA 3ARZA 4ZTEA 5GGVL 1TTRA 5AVYB 3ESNA 5T5NG 3PPEA 2BSSA 3QEUA 4OTXL 3INOA 1FP5A 5E4EC 4ZOCA 4RNRB 4EZKA 4E41E 2CPCA 4HIJB 4EKJA 4PMEA 4PLKC 3BAYA 4AENB 5H37H 5EORH 3W5MA 2FD6L 1PLGH 1FVEA 2CK0H 2YEZA 2YXVA 4LF3A 1AO7D 2EDXA 3DTDA 3JWDH 3MV11 3O4OC 4UNTA 5E9NA 4BXSV 3Q1EA 4Z23A 3NYKA 1A02N 1KEML 1UOLA 5AW9B 4U0RB 5DJ8A 3FDWA 4Q6IB 2YD0A 4ODVL 1UWXH 5ILTL 4XR8C 1J8HB 4MA7H 2GUOA 2LAAA 3VVWA 1PGRB 3FQUA 1U6AH 3C8KA 3U0PB 2F5AH 1E5AA 3U4AA 2A74B 2KKQA 1IEBA 1BZEA 3QUKB 4UUJB 1N5AB 1E43A 2P5EB 1XIWD 2Y6SD 2QV2A 3IDYB 3BT0A 4JDVA 2X9ZA 4WWKA 3QIBA 2OZNA 4YSPA 2JB5L 3M45A 4PV9A 1CGTA 2BP8A 2EKSB 3JUZA 4Z7UE 3APDA 1R4XA 4OZIA 1W9XA 1OCWL 2VDLB 4I18B 3ALWA 3MV9A 2JF1A 3AY4A 4JRYA 2F1BA 2Z64C 4ELDA 4X6DE 2BNQA 1K3IA 2D9QB 2P1YA 5EBWA 4PRDA 2AJZA 1P4BH 3O2DA 5HHVL 3U9UB 1SXNA 5F7NC 2D03L 2OCFD 5M95B 4FFWC 4IIQA 3ILEA 2RD0A 3GRWH 5ABZA 4PRIA 1CFQA 1CB4A 5CD5C 4E9LA 1R9FA 3CHPA 4MS8C 3B2VL 3HUJF 3L8QA 1I8IA 1QLFB 1CQKA 3IDJB 5AD0B 3QDJA 1GYVA 4JHAH 5IP4A 3FUNA 2IANE 2XXCB 3H7LA 2QQLH 4Z7VB 3MLYL 3FRPG 2X53A 4FMFA 3SGEI 4WDIB 5KEZA 2OMNA 2Y5TB 3ZDXB 2KBGA 2RMNA 5I16B 2V5SA 2H8PA 1ZS2A 4FG6D 1BM3H 3PWPD 2VYRE 4HK0A 2KMWA 1HQ4B 3I6LD 1LJMA 3BSZA 3QCUH 4F80A 4MS8D 1IARB 1ZKAA 5B8CB 4PJ5D 1D9KC 5KANI 2FCBA 4HW6A 1S7VB 2EEFA 4LLMB 1AG6A 1HOEA 2WO4A 3QZWB 3T8XA 3H4HA 4PRPA 5K1VA 2PABA 4GQRA 4ONOA 1OF0A 3M6DA 5G5DB 2WIIA 4XPHL 5CLZA 1UFGA 4NQCA 5GGQL 1O6SA 2FNBA 3AREC 4E41A 3PV7A 3FTGA 5D7LA 4Z95L 4AWJC 1QA9A 1NCCL 4BE6A 3LV3B 1XH3B 2XACC 2VDOH 4NZ8A 2F74A 3VM5A 1KB5L 4AV0A 3GMNB 4X98B 4NQEA 1MCCA 4PB0H 2IGTA 5I1CL 1R3LA 3JWNG 4JRYB 4TRPL 4CAGA 5F0LB 2IBBA 4U4IA 4P5TB 4HBQA 2C3VB 1NCOA 3ETSA 1KCSL 4F57H 4KJWD 5DZPA 4RSVA 5LBGA 1Z9MA 4BFOA 4JO4L 1QQDA 2DBLH 2VW7A 5FDWA 4R7DA 1Q0XH 4Z8FL 1REIA 1F6AB 2UXTA 3IFOB 3B9KD 5ES4B 5FM4A 4UYPA 3V9CA 2N7BA 1HH6A 5B8CA 4XVSL 1S7QA 4HKJB 1WK0A 1YEDB 1EQWA 3RDTA 3UADA 3S35L 4DVBA 4HWEL 3H2WA 2HG0A 4MQSB 1OAZH 3O9WA 2QTVA 4OZIE 3BD4A 3NIFF 5ID1A 1UXWB 4XODA 3CN0A 4OF5A 5C07B 3LSOB 3FPXA 2AMUA 3MOAL 4HA1A 1EWHA 4OB5L 5D1ZC 4PJCB 4AUYA 4JFED 1PZDA 3FU5A 4FXGA 1DBKL 1KACB 2ERJB 2W65B 4CL7A 3QNZB 4L3EA 1M2VB 2NNAB 4APQD 2R0KH 3RGVC 2VLJB 4Z7OB 1CBVH 4S1QL 4WTWA 2TAAA 1ET8A 2X6BA 4QRTA 1P2CA 4NOFA 4MDJA 1BPVA 1GCYA 1EO8H 3FQ1A 4RWYH 5IFJA 1MEXL 3QUMH 4QCIB 3BAJA 1U91B 3RPBA 3ZQXA 4PGEA 1ACYH 1FORL 5D4JA 4R0LB 3ZKXB 1CDUA 5JPMC 4GG6E 2MWCA 2XT1B 4A7TA 5I24A 4YHMH 3UGEA 5I0DA 2BNQB 3MJ8A 3F6IA 2W60B 2VE6B 2ZCHH 4ZAKA 3UYRH 5BPPA 4PV8B 3OD3A 5I15L 4NNPL 5AVZB 4CMMA 3ZSSA 2CDGA 3VRLE 5EH1A 3IDGB 4HBCL 2ZP9A 4X83A 3O45A 1BOGA 3OMNB 3EJTA 3D48R 4RFNB 4UZGA 3RDTD 1VFAA 2NNCA 1TJMA 1KC5H 1T7WA 2X40A 3P9MA 2B9AA 1ORQA 2OZ4L 3O9WD 4NS0A 4EQ2A 4N2KA 1H6FA 1VADB 4AJWA 2BS8A 1MCRA 3EYVA 5T1KD 1MG3C 3ZHKA 5EIIG 1V27A 3GMOB 3PHQA 5TQ0L 2C1OA 1M7DB 3HG1A 1G7PA 3HAEA 4ISVB 1SOSA 3CSYB 2K9UA 3FT9A 2B1OA 5AUMA 5HGAA 3CFKB 4RDQG 3NH7H 1TZGL 3TCTA 1T89C 4XBEL 6PCYA 2NY0C 4JGJA 2A9AA 4O5LL 2H32B 2V33A 3JVGA 5E6RB 1FNGA 1IBFA 3GZPA 5CMAA 1OZUA 2FH8A 2WZ6A 4DP0X 4IOSD 5GRJL 3WBDA 4M7JH 1BA9A 3RWHA 2AXGB 1AD9A 2AJUL 3GSRA 3OKOB 4NQSB 1WZMA 3RWGB 3P4MB 4TL5A 4A2GA 4G9FE 1WG3A 3JWNE 4WO4D 4YFLI 4QHNB 3UTSA 5KYUA 5DD6A 2HTLC 2APSA 2J6EH 4XCEA 4KRMB 3HZKA 2YFNA 4MAYD 3NZ8B 1E5CA 1EFXB 1S8DA 4UBDD 1RMFH 4TUKL 2Y7LA 1L0XA 4RGMB 3ESOA 5TE7L 3TP4A 1SXCA 4OKDA 2Y07H 1TEGA 1NIDA 3CSBA 4M02A 1QWUA 4AY0A 4F9PA 4QXTB 5I73B 1FFRA 2MKWA 1RJZB 2BSBA 4XNQB 1JF1B 2CALA 5EN3A 4PJIA 5LAPA 1TVHB 5C97A 1MEXH 3IJEB 3FSAA 2FSEB 3V6FB 1WRFA 2ATPA 1F1GA 1SMAA 3P11L 4HWNA 5KYYA 3A67L 5DK0B 5IHUH 2JE8A 4YK4C 3FB8A 2ESVD 4JKLA 3A6BH 4GO9A 5LBSH 4XNMA 4F7KA 5LUMA 1HNYA 2VDKB 1LEIB 1IM3A 2YUXA 2R83A 2PCPA 4MA3B 3SE4C 1IGYA 4FHKA 2YKKA 2ARJB 1NQBA 2A0LD 4ZPVA 1R33A 4M48H 4YXKH 5C07E 5ENWA 1OP5H 5DEGA 3LNIA 3MLTB 3QIWC 3AGWA 1LWHA 5E23A 4UQEA 5GISL 3B3IA 5AALA 1KJ2A 5C70A 1UXSA 1RUMH 4YBHA 4Q9QH 1J8KA 5I19H 5F70A 3UAAA 2GY5A 4P0DA 1MVUA 2FWSA 1A7PL 1I3VA 1KTJA 1T5WB 3VJ6A 5CEYA 2AKRB 3SGDH 4ELMA 4ANVA 2Z31D 2CH8A 2BNQD 5EC1B 2VMDA 2FWOB 1Q0EA 2X0UA 3VWKC 4HUXA 3MLVL 1EEZA 2BHYA 3KCPA 1JXFA 3QIUB 3V4PB 4MXVF 1AHWB 2YAMA 2J5LB 1SUHA 5MENA 3W56A 1HI6A 2BSRB 4KNSA 2GBUA 1A7QH 1BQKA 4U6TA 4XWOC 4ZW3A 3WIFA 4XNDA 2DAVA 1YY8A 1A1MA 1HU8A 2NSMA 4AQ1A 5KVDH 3I2CH 4UTAA 3KPPA 2WTRB 3AUVA 3MU3A 5DA0B 4AV4A 2EE9A 5DJ6B 4HEMA 1QI5A 4PRHB 1XGUA 2XFXA 4JK0D 1IBGH 3K4ZA 4Y9FA 4K5MA 4IBTA 4YLBA 4QRPB 3ES6A 3C09B 4G9FD 1V05A 4PBDA 5K39B 3Q3GB 3THML 1A6ZA 1BZ8A 1CFTB 3FQWA 4JFOB 1PDKA 1UT2A 3GHBH 5E8OA 4RETB 5C0IB 1I7RB 1MDTA 2ZG2A 1HTYA 4DF9A 3VACA 3ARTA 1JGLL 5T5NF 3IFLH 4A04A 4NP4H 5BQDA 4MNGE 4J4PA 5SWZD 4F7MB 2BNUA 4JFQA 3FUEA 1MCFA 1UENA 5MEPA 4U1GB 1ZIBA 4ODWB 3D34A 5FV2A 4O2FA 3U4BL 4RX4D 5D1QE 3U1QA 3P9WB 5IBUG 3RHWK 3WAKA 1DUZA 3M17B 3MRKB 1V3MA 3IGUA 4NB7A 4NN7B 1L7IL 2NXZC 4ETQA 4DUVA 3GBEA 3NG5A 5GGSA 1FNEB 3BIKB 5B22A 1I8UA 2V7HB 3G6JB 2WCPA 4Y4FD 1C16A 4IS6A 1RZKL 1CTOA 3UP6A 2I25N 3WJJC 4IRJC 5JHDD 1IGFH 1QR1A 3AVEA 3NFNA 2KUTA 3II2A 3MRDA 1FBIH 3Q8AA 3W1ZA 1ZSHA 1JNHA 1OHZA 1N3NA 2AV1A 4DEPB 4HD9A 3MO1A 1WZ1L 2WBJB 1ETB1 1U3HC 1B0GB 1IC0A 1THCA 2X4PB 3ECWA 4N4YB 2W38A 4AYSA 4GW5A 4Y2NA 3UJJH 2EKJA 2X09A 1JGUL 2Z35B 5BZWA 5EEYA 3AADB 3I9GL 1D5XB 4OLEA 3K2KA 4M5SA 5I5RA 2QQNH 3OLGA 4R5TA 3D9AH 3D2TA 5EBMA 5C9JA 4PJ5B 1R5WB 3W11D 4ELKB 3K81A 1E50A 4I7ZC 2DQ6A 2ENPA 4WNSA 1ODAA 2B20A 2IALB 2VDML 3KYMA 3ZO9A 1D5ZA 2SEBA 4UF7C 4UINH 5J9PA 4X6DF 4F2MB 1FPTL 3DK2A 3T4AA 1PKQB 5AAMC 4E0RB 5HHPA 4TNGA 1DQQA 4R4FL 2VXQL 5I1KH 5HI4D 2J1XA 1RSFA 2J56A 1Y7VA 4GW4A 5CBAA 2JXMA 5CCGE 3PY9A 1LYQA 5T3ZL 3BI9X 2C9UA 2W60A 5J1AB 2Y36L 3ASNB 4FTVA 2B16A 2ZSWA 3ARGB 2DMKA 3O41B 2G2RA 1UA3A 4KFZC 3K2UH 1RFDL 5AKVA 3KXFE 3QWRA 5B1BB 4I87A 2OMZB 4NQSA 1VFBA 3MFFB 4LSUH 1I1YA 2J2ZA 4KDWA 4X6FB 2GSIB 5EBLA 3IVKA 5JLZA 5G4MA 5I6MA 3QZLA 3WEXB 3WEXA 4C59B 4AH2B 1OALA 1CU4H 4R5VA 5A2AA 4NRZB 1AYOA 2UWEB 3SE4A 4MHHI 3ZDWA 1QUPA 3QJFA 2N7SA 3IBEA 5E5LA 5KN5B 4JPIB 3C75A 1RUKL 2P8PA 2WHVA 1TT6A 3FPYA 3ZMRA 1ZHKB 3Q8FA 3HAEB 3KG5A 4ISVA 1XIWA 4IS6B 2MOGA 3T0XA 2ED7A 4UT6A 5KBLA 3MRPB 5LGJB 1YQVL 3UAJA 1NUFA 5AQ0A 4KZ0A 3ARBB 4E9QA 2CDFA 1SPDA 2DLTA 3MGAA 1A9VA 3KL3A 4RFEA 4IHOA 2XV0A 3S36H 3G04B 2VDMB 2BNRA 4N2MA 5IQ7H 1HKFA 3C6LA 1QLRA 3EO0B 2L7QA 2RALA 2DLFL 1ZEAL 4BD4A 1ZTXE 4YSDA 1AIFA 3T77B 1ORSA 4ZXBB 2XXFA 3VU2A 4PV8A 5D4QA 5BRQA 2Y3NA 1PDKB 1LM8V 1KTDA 4NQED 4WFFE 5KG9B 4DVRL 4XC3H 1ZT4B 3N43F 3BDYH 1BD2D 2E7HA 2JB6A 1D7BA 1MHPH 1UM6L 1IQDA 3QEQA 4PSPA 4DGWC 1QPXA 4BRVA 1E5UI 4PJXE 4Y4HD 3KPPB 3BLBA 1KYDA 2R1XB 3E7JA 3FT2B 5DUPH 3VG0H 2UWEA 4A7QA 2XY2A 4YEFA 3QHTC 4KX8A 4JKPH 4X0KB 5HHPB 3CDCA 2JJTA 4ORGB 2IFFH 4GUPB 2Q7AA 3MV8E 2V9TA 4JY5H 4FYQA 3MO1B 2O5YL 1BWWA 4ALAL 3TEZA 1TKWB 2I85A 1DJYA 1XGTA 2OMUB 2WB7A 3V2AR 2CHDA 3D8MA 4HHWA 1FRGH 4MQ7B 4PS4L 4UM9B 1Z9LA 1LP9A 5HYJE 4WFHE 4KI5C 3OZ9L 3ARFD 1MHPL 1OE2A 4ONHB 5JXEC 3DJZA 3R8QA 2NYZA 3WDJA 2VN3A 3ZIMA 3KPOB 4HWZA 3BZEA 1VKXA 2F08A 3CLEL 1WBXB 1KJVA 5IOPB 5L9DH 2VL4A 1GC1C 4U49A 1NCCH 1HXYB 1JPSL 2A9ML 3VMPA 1NKRA 4HISA 1SMOA 4JHZA 1SQMA 1ASQA 3L9BA 3CDGA 1JGVH 2ZX5A 5I1LA 1Y1DA 3ZZSA 2I07A 1XH1A 2WXOA 4A6YA 1G5AA 1VAHA 1WBZB 1YPZA 1R3LB 1NGZA 2FGZA 2E7DA 3S3BB 3HC2A 4N8CL 4LSTL 1GSMA 1T0MB 2GJZB 3A6OA 5DJZA 3QDHA 4W6WB 3VWJD 1DVZA 4DK6A 2XN9A 1VZIA 1E4XL 1W72L 2BX5A 2WP3O 4YHNA 5J5EA 5KAQG 3UTZA 1HCYA 4P2QE 2HVJB 2MCPL 4HH9B 3NZ8A 2IPTL 4F7TB 5JXAH 3IU4L 3NDYE 4WJ5B 1CBJA 2NY4C 3GIZL 4P9HH 4R4BA 3LZOA 1S2EA 5E8EB 3VE0B 3ZRSA 4JFQB 2A1WH 4MA8H 4JFPA 1WFIA 2D03H 1MN4A 5IM7A 4FFYA 1ZVYA 2BOCB 4YLCA 1KTKE 3KLSA 4K3JH 3FTVA 1ZT7B 2ED6A 4GO8A 3QS2A 3SEPA 4RGND 1B88A 2LU7A 3B2VH 2GCYB 1J8HA 4NT6B 5IOPA 4ZT1A 5HHMB 5KOMC 1UM4H 6TAAA 4R3SA 3WS6C 4EI6A 3TV8A 1YN6B 4D7PA 3DIFA 1XGRA 3RKDD 3PWVA 1FLTX 3TESA 5ENWB 3L4CA 2R4RH 1R3HA 1I85A 3QR1A 3WNPA 2CO1A 4UMGA 1AXIB 4MJ6A 4YHPB 3S2AA 1P7KA 2HLEB 2V5TA 3Q2WA 4D0DA 3K6OA 1KIPA 1DQJB 3VSUA 2H2PC 4QT5A 2OMWA 1M1XB 2FJGB 2FH6A 1BF2A 5HI5D 1BOGB 2AI0L 4L1TA 4NIYE 1YECL 2KERA 2AQRA 2NUPA 3JV6A 2DKUA 4AEHL 4YSUA 4N0FA 4BWWA 3U9UA 3BUYB 1JGEA 3D3VB 5LO7A 1EH9A 3E0GA 2VXSL 3BZ4B 1E7UA 1B0IA 2YPLA 2OSYA 3L4WA 2J3SA 5EPMA 3A23A 4G8IA 5AKTA 1AZZC 3PL6C 5H37A 5C08A 1BX2A 5B7FA 2QT6A 1J5IA 5FGRA 1DQML 3PG2A 5FLUA 3H42L 5C0DA 2WINA 3GMMA 5K93A 3NUKA 5I1LB 5EF3A 5GJTL 2P5WE 4N2AA 3QPXL 4DQOH 3US1A 3LRKA 3FB8B 3OG4B 2XRAL 3VD3A 3P3YA 5C0JB 5E2WL 2R1WA 4DAGH 4G1MB 3UTTD 4BH7B 2O5ZL 3GZQA 4B5EA 3A4DA 3KNBA 3N44F 4X7EC 3WKQA 5HY9B 5GRZA 2X42A 3JZYA 2HJLA 2EC8A 3UO1H 3HBZA 4DKAA 2YBRB 5DJ2B 4LNRA 4PW4A 3SYAA 4U6HB 2PO6C 3ZT5A 4KRNA 1GAFH 1EZUA 1JHLH 3UIZA 3K72A 3P73B 4PJ7E 4K94H 4XNXL 4ZMNA 4OLUL 4AENA 4ZS7H 4NQCD 5IBLC 3MRCB 4P2RD 2R0WH 4I18C 2VQ1A 4HHAB 1J8SA 4JN2A 2DDQL 5KSBB 3BT2L 4PW9A 5ISZD 3O2DH 1H0DA 1W8OA 2ATPB 3HB3B 5JIPA 3E9UA 3L3HA 5J13C 5FDYA 3IDGA 3ATBA 3V0EA 4R2GC 5FYKE 2EECA 5I17B 2HRLA 3IKCA 3DXAB 2K1MA 4OZ4A 1MRDL 5B1JA 4BCXA 1AZBA 4OSUL 5IREA 4NJ9L 3FULA 3WTXA 2KYIA 4WW2A 5BVJA 1RIUL 4LB8A 3GSNH 4H0IA 1Q9KB 2AANA 3CDFA 4GEIA 2R2HB 2O4EA 5ANHA 2Y72A 4GY4A 4HWUA 2YR3A 3B3BA 3NZHL 3KLHC 3HNSL 4QXGH 4XCCH 5JW4N 3L2LA 3RWHB 3EFOA 3FT1A 3VD0A 1Y6NR 3G5WA 4NWTL 2TRYA 2N1TE 3J7HA 5ESAA 1SVCP 2MJWA 3G6DL 4NQDB 2Y7SA 3RL1A 3SDDB 1DE4A 2R0ZH 2DQDL 5LJYH 3GXTA 5C0FA 3ZVVA 4RZKA 2DLIA 5D7SL 3TBYA 4NCC2 3TT3H 2E8YA 2IALA 3GK8H 3KYMB 2EO7A 3N85H 5AW0B 3B2UC 3UZVB 1E9PA 4PJCA 4WWNA 5HDLA 1KB9J 4UIKH 4XNZB 2C3GA 3T1WA 5EG6C 1LDPH 4MB3A 4W6YB 1ZVSB 1U8LA 3TF4A 3C2SA 3A4EA 2HKFH 2XTJE 2Q10A 1MLCA 3UBXA 1I1FB 1Q94B 1QWHA 2EEAA 4PEEA 3NSCA 4OF0A 5CD3B 5DWUL 4J3OF 3EH2A 1XGPB 1FV1A