3PYDA

Crystal structure of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) from mycobacterium tuberculosis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
298
structure length
298
Chain Sequence
SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 84
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pydA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pydA01
2XEXA 4PU9A 2R42A 1N34I 2BM1A 4JI5I 1XNRE 2VQEI 2V34A 2V2ZA 4B3TI 4Z7YA 4P52A 4KQVA 1DARA 4X66E 2GS8A 3ZZUA 3ZKDA 4DR5E 1N36E 1IBKI 4LFAE 3LPSA 3QT7A 4B3ME 5FLXC 1N34E 4FWHA 4RPFA 3Q1QA 4DV2I 4DR7E 3LNUA 5LMUE 4AQYE 4B3MI 5LMNI 4DV4I 3B8HA 4HACB 1KTVA 3PYGA 2V2VA 4X65I 5BR8I 3J7AM 4HXZA 4DR7I 4JI3I 1H74A 5IT9C 4LF4E 1B62A 2X7IA 4DPUA 4HACA 5LMNE 1N33E 2UUCI 4NXNI 1H7UA 3J80C 4DR4E 4DR1E 2BV3A 4FWDA 3WU6A 4DR2I 2X36A 4DV5E 4X64I 3V5RA 1N0UA 1XMQE 4WUDA 4JG4A 2UUCE 1U2RA 4AQYI 1VISA 3F0NA 2F4VE 4DV4E 4JI0I 4DV0E 3J80Q 3B82A 4YHHE 4DR4I 4HY1A 2UXDE 4X62E 4LF6I 3PYFA 1MU5A 3J81C 4OX9I 5IT9Q 2A2DA 1FI4A 3GONA 4X66I 4LF8I 4JI6I 1Z0BA 4M1KA 5FLXQ 4DV2E 1Z5AA 4DR6E 4OX9E 1ZXNA 2UXCE 3HULA 1HNXI 1XMQI 1HNZI 2UU9E 1ELOA 4DR2E 4FWGA 1H73A 5A2QQ 4DV5I 1NHHA 3T1HE 1IBKE 4DV3E 4JI8E 4DV6I 4JI7E 3CWVA 1Z5BA 1FJGI 4WUBA 3ZM7A 4GKJI 5L3JA 3QT5A 3H4LA 3QT8A 2F4VI 1PIEA 4FN5A 3K17A 4UTGA 2CZ9A 2UUAE 4JI7I 2OI2A 4K0KI 3QT6A 4DUZE 4NXNE 4DPYA 4B3TE 4DR3E 4LF4I 1NZ0A 4PRXA 1N0VC 1H72C 4DV3I 3V2UC 1HR0I 1IBLE 4JI0E 4GKKE 2V8PA 1A6FA 2ZM6E 4P7AA 1Z0VA 4DUYE 1S16A 1Z0CA 1BKNA 4UT4A 5GMDA 1Z5CA 4LFCE 4JI1E 1KKHA 1N32I 1J5EE 4K0KE 1Z0GA 4DXLA 4B3SE 2HKJA 1HNWE 1FKAE 1PKPA 3PYEA 4JI1I 1Z0EA 1Z0WA 1EA6A 1ZXMA 1IBMI 4LF9I 4DV6E 3ZZ0A 4B3SI 5LL6R 2AJ4A 1XNRI 3D4JA 3OTOI 5LMUI 4LF7I 4JI3E 1QZRA 1IBME 4DU7A 4B3RI 2HFSA 1FNMA 1RR9A 2VQFE 1HNWI 2UXDI 1RREA 1N32E 4YY3I 5A2QC 4FW9A 4JI4E 4LF8E 1IBLI 2J7KA 1N36I 4DUZI 4WUCA 2ZM6I 4MYUA 4DR1I 4DV1E 2HFUA 2VF3A 2HKEA 1ZM3A 2UUBI 4LF7E 4LF5E 2DEJA 4LFAI 4JV5E 4URLA 1FJGE 2WW4A 2UXBI 1OJ4A 4JYAE 3ZZTA 1Z59A 4X65E 4LFBE 5GMEA 4NXME 1MX0A 1NHIA 4JV5I 2HHHI 1PVGA 3K1JA 1ZM2A 2ZITA 3B78A 4JI8I 5IWAE 2HK3A 2UUBE 4JI5E 1HNXE 1HNZE 3LTOA 2UU9I 4MYTA 2HHHE 1XNQE 3T1YE 4LFBI 1XMOE 2E5LI 4XTJA 1HR0E 4LF5I 4B3RE 1H7SA 1Z0TA 4DV0I 5BR8E 4ZVIA 3WU5A 3T1YI 3OTOE 1EI1A 4DR3I 1KIJA 3PYDA 4HYMA 4KHPE 2BM0A 4JYAI 4JI2I 1D6TA 3JAMC 1ZM4A 4DV1I 3WU4A 4DPWA 3J81Q 3JAMQ 4NXMI 2VQEE 4KHPI 4X64E 2A2CA 1FWLA 3J7AG 1I94I 4USKA 4LF9E 4PRVA 2UXBE 1J5EI 3T1HI 4JI2E 2NPFA 2E5LE 1KVKA 1ZM9A 2Q2EB 4YHHI 2UXCI 4GKJE 4X62I 4LF6E 1S4EA 1WUUA 2E1RA 4DPXA 4R1FA 1NHJA 2HK2A 1MG7A 4DV7E 1XHKA 4JI6E 5IWAI 1B63A 2VQFI 2R3VA 4USMA 4I3HA 4ED4A 4DPTA 4DUYI 4DR6I 1XNQI 4DR5I 1N33I 2ZBKB 2EFGA 4JI4I 3WU3A 2UUAI 4EMDA 3ZKBA 4DV7I 4LFCI 1XMOI 1I94E 2V2QA 1UEKA 2LJPA 4Z7CA 2DEIA 3M6AA 4GKKI 1FWKA 4DU8A 1K47A 4YY3E
chains in the Genus database with same CATH superfamily
3M9MB 1CQNA 4ZVGA 1WNEA 2QLJB 2XEXA 3FK4A 4KGMA 3EZOA 2NYHA 3GFXA 1ZZFA 1FK9A 2MY8A 3D9BA 2UUAF 2PO1B 2CYYA 3P5BP 2J8SA 4DFJA 2CPJA 4IR9A 2BM1A 4CLWA 3MR2A 2MQMA 5J2MA 1FFGB 5KG2A 2ZHBA 2V68A 1VI7A 1XNRE 2NQPA 2V34A 3DOLB 2P8IA 1UW4A 2XWXA 4C3LA 3FRYA 5KFQA 4ZLLA 4OLPA 4P52A 3P4UB 1Q95G 2LU2A 1VC5A 1RJJA 5EGYA 2YH1A 1O5JA 4A48A 4ECZA 2MLZA 2Z2YB 3IN5A 3HKMA 1FRLA 2KO1A 4HEA9 5CCMA 3MI7X 2OUGA 2Z2LA 1VYAA 3M8PA 5C2GA 2RQCA 1URNA 4X66E 3LO3A 2J6SA 1UVLA 1E6YA 3PKYA 3W2VB 5F9NA 2XI2A 5EWGA 3V6DB 2IAJA 2LU1A 4GO5X 4KYZA 3LPSA 4FPIA 4F4ZA 4B3ME 3QO9A 4LBHA 4EO8A 2NN6F 4FYXB 1U24A 5FLXC 4E2FB 1N34E 1TKTA 2GCFA 2JVRA 4F3QA 5B0AA 3W1YC 1RHRB 3TA0A 1TAUA 2UZAA 3TUJC 1WKJA 2VQEJ 1NH7A 2IVFB 3MCSA 3ZTPA 1LW0B 4DV0F 1QSSA 1GEHA 1T3OA 3E3XA 4X64J 3VZHA 3EVMA 4FP9A 2ZEJA 3PW5A 4IFDB 5LMUE 2C3UA 2RHQB 2BANA 4OMFG 5E33A 4RZRA 3RR7A 1XMOE 1MMNA 3JSMB 1QVGR 3HD2A 1DQAA 1FESA 2FUG9 2Z58B 1T3NA 4FZVA 2UUAJ 1PSDA 1NM2A 3LA0A 3NOCA 1PKUA 3A3NB 3B8HA 2BYCA 4Y2KA 2F65A 2DY1A 1M1GA 4M63A 4XTTA 2LA6A 2LDIA 3IBWA 4K4YA 1E3PA 3CJ4A 3TA2A 2V2VA 4X65I 2Y0BB 1RT1A 3BYPA 3HVTA 2HS3A 5A8WA 2IHR1 4XPEA 4KGXB 2AF6A 5K8PA 1YTYA 2F1FA 1E3HA 4AFFA 1HNIA 2CZVC 4TNOA 5EX3A 2UUTA 5MLCV 1IR0A 1OYRA 3IP0A 1SQGA 3OVAA 3CDJA 5IT9C 1FVSA 1F5AA 1RBOB 2VFTA 1CJKB 3HF5A 5IQQA 4DPUA 4F3MA 1OY8A 1Q7YT 4IH6A 1IM4A 4BDPA 1KR4A 2HBQB 4NLXA 3VAFA 4MFBA 1VQ5S 2GHWA 3T9ZA 4DR6F 3R6LB 4ALZA 3Q8VA 2VODA 1PCAA 3CJSA 4CTAB 5CD4H 4JV1A 5DLFA 4RX6A 4TXSA 1VQ4S 2FHKA 3CMQA 4IOCQ 3DOKB 3BF4A 3L95X 4RW6B 5HBMB 3GIMA 3J80C 1RTIA 3QZ7A 5K36C 3RB0A 2Z4PA 1N36E 3Q83A 2MKYA 2HHWA 3MFHA 3MAAB 3DFEA 3NBPB 4HL9A 1VK3A 1JLAA 4DV5E 3MMJA 4AM3A 1LW2A 2AJ2A 2MEWA 1W25A 2K7KA 4H4MB 4LFBF 4NLTA 1XMQE 3TARA 3L7PA 2QGFB 2ZKUA 4AQYI 1VISA 2C28A 2FC9A 2PSZA 1HNIB 3DHWC 3EM1A 3HKZD 4WPAA 1L3TA 4FYWB 4K4XA 5A0YA 3TZWA 4J9RA 3CB4A 1VBZA 1J5EJ 1RTDA 4DV4E 4LVNP 3L09A 3MAAA 4X4UA 3EVOA 1WC0A 4I64A 1I94J 1HWUA 1NHUA 2ZVIA 4C7QA 1G6BA 2IC3A 2W2PP 3GYXB 3KG1A 3OW2R 2HAIA 1RTJB 1S97A 1S9GB 4FXWA 4QR1A 4X4RA 4WFNQ 1ITPA 3GCMA 1S5ZA 2VB6A 3SMZA 3ZZZA 1QDUB 4DFKA 4LF6I 1GMVA 4WK3A 2XO7A 2CPEA 5DG9A 2B4VA 2VV5A 3L3CA 1HYSA 1RT5A 5DM7Q 4QIWD 5KFGA 5K8OA 1HR0E 2ZFHA 1F9EB 4DQQA 4IFDA 3GONA 3BYRA 3W5ZA 4QWDA 4JV2A 4LF8I 4CT9A 4MH8A 2Z5EA 4J9OA 4JI6I 2XSFA 2BABA 4U96A 4O3SA 3OT9A 4M1KA 1Z0BA 4IFVB 2MGZB 3UD4P 3UO0A 2BKOA 1N6QA 3IAM9 3MPYA 3UW1A 2E9ZA 2BQRA 1Y60A 1R8CA 3AODA 2CPXA 4J9PA 1MU2B 3CNQP 2MY7A 4P75A 2HYIB 1MMDA 2XZWA 5HJXA 3MXHP 2E29A 1JLGA 4JI3J 1ZXNA 3VVTA 3R5CA 1KHWA 2AJ0A 4IZJB 1HNXI 1HNZI 4BCAA 1NK8A 4M5HA 3TVKA 1QSLA 4OV1A 1J27A 3D66A 1TL3A 3H5SA 4DR5J 1NHHA 4RW4A 4C0OC 4DV5I 1N36J 3T1HE 2R2UA 1WELA 4DFMA 4YP3A 1M5PC 2HGMA 4DV3E 4IDKB 3P96A 4AIMA 4DV6I 1SJ3P 4RBVA 2FVRA 2BE9B 4CLFA 1QD1A 3T3FA 1FKOB 1N5VA 2WONB 2B5JB 1S7IA 5DQHA 3G8TA 2HHXA 1YDLA 3BN7A 1WHXA 3RB4A 1N5YB 3A8IA 1Q79A 4K2XA 3QLHA 4YB6A 4WFAQ 4L76A 2FJWA 2OTJS 3PS3A 1C1CA 2RF2B 2Y1LB 2N3LA 3VWSA 1RLCL 1VRUB 4XIUA 3IM9A 1YJNS 1XQIA 4WYLA 4Y65A 3SSSA 4DN0A 5A76A 3RBDA 4A8FA 3UDCA 1VRTA 2F4VI 3DLEA 3DU5A 4ZJOA 3M8SA 4OO1F 1LOUA 2KI2A 3BKFA 1YQHA 1GXTA 3JYTB 3D3CJ 2ZNYA 1R89A 2XZDB 1IKVB 4LRAA 3K5NA 2W9CB 3R7SB 1VQ8S 2MQQA 1AUDA 1RI7A 3A4TA 3CCTA 5F3ZA 5KFMA 3KMSA 2R2RA 4DPYA 3V6HA 5J2QA 5FD1A 4F0MA 3QZ8A 4RL1A 1TKXB 2DNMA 5THWA 2R2SA 1FFSB 2DHHA 4H4MA 1M5VC 4TLRA 1GTEA 2FHJA 4EYHB 4DF4A 1S0VA 3NAIA 3EPGA 2K1RA 4HT5A 4R8UB 4FF1A 4OZ1A 2HURA 3C6UB 1CQMA 1GX5A 3J7YU 1Q81T 2KL8A 2R7UA 1NZ0A 4PRXA 4HTIA 2FJXA 1DAXA 3CD0A 5C42A 2F4FA 1SKRA 3V2UC 2GMLA 1HR0I 3TZYA 1F5CA 2YX1A 3PJXA 4IOBA 2N4CA 3HSZA 2YWFA 2HNZA 3O8WA 3NWRA 4ZVUB 2YX7A 4JI0E 3VZIA 4IZJA 4WWSA 3DC2A 4GKKE 5D3GA 2QLWA 4DR4J 1BQMB 4NWBA 1RTDB 4DUYE 4IFYB 4Q2MA 3EPIA 4ECRA 2RMLA 2XY7A 2NUUG 3DD6A 1N6QB 2DGUA 2B4PA 3ENAA 1JLQB 4PWUA 4DN9A 2GO9A 2FHMA 2AGPA 2C3PA 3BJYA 2C37B 2HQCA 3TJAA 5D4NA 1XMQF 3JTOA 4W4MA 3KLEB 4JI1E 1U2FA 3THPA 4CNYA 1S0MA 1N32I 1A9NB 5K36F 2CPYA 1T9TA 2B9XA 3MMCB 3QATA 5DG7A 3KOAA 4K0KE 2FLNA 4UUXA 2XY5A 1RA7A 3IRXB 3D7SB 3HP6A 2O1UA 1LWCB 1UJ6A 2YNHA 4Q0BB 3P3GA 3OUYA 1RT7B 4KRWA 3Q23A 1HNWE 1LWXA 3BH7B 1KOOA 1OO0B 2LDYA 3QGHA 4RBTA 1GX6A 1PKPA 4FDFA 3AA9A 2H5EA 3W63A 2UVVA 3CSKA 4KFBA 3CPWR 2XMVA 5DGAA 1U0HB 3K7RA 1KEKA 4G1IA 3T5LA 4X4PA 2J7UA 1OQ6A 4OO1C 4G6VB 3UCZP 4HVZA 4M5MA 4PG4A 5K36B 2DNZA 1CS4B 3JQKA 4ZVHA 3KLVA 3QRPA 2UXDI 1ZAWA 2UUWA 4LBPA 4IO1A 5D78A 1VQSA 5T41A 3G6YA 1K8AT 3QRQA 3WIVA 3M8WA 2PI5A 2Z5BB 3LWLA 4PUOB 3C14A 1VQNS 1XNRI 1YLXA 2RB7A 3T9NA 1E6YB 2RDIA 4K2JA 5HI7A 3D28A 1NSPA 2FGOA 2FY8A 3V4MA 5BR8J 4DV2J 1RAFB 4NRUA 2CQ0A 1JLFB 1YZ6A 3L7UA 5FLXY 3OTOJ 2WB4A 3OTBA 1FNXH 4BHQA 1NPRA 3OL8A 1IBLF 1L3KA 2V69A 3O6QA 4USVA 4UZCA 1KFSA 1WOOA 3NXZA 3SV4A 1SPBP 1TL1B 2BJ8A 3DOLA 3H0PA 2R7SA 4O4RA 4NZ7A 1CVJA 1IBKJ 3RRHA 2ZH1A 3M32B 1M90T 2YWGA 4FBUA 4JI8J 4PUOA 2CQ3A 1YBTA 5IC6B 5LXRA 3POTB 2HW3A 2C37A 5C0XC 4NLOA 1RR9A 2JC0A 3BSCA 3CO0P 4C11A 2VQFE 1N34F 1SH2A 2WVBA 1KDNA 4O3NA 1SV5A 4QWCA 4RW9A 2R7RA 3FBBA 3NGRA 1VQ9S 4C48A 5D3GB 1BHNA 3ETMA 1EJ7L 4CP5A 1Q53A 2HGNA 4IZKB 5LJ5Y 3HMJG 2IMOA 4HTJA 4JI2F 2XO6A 1SCJB 5C24B 1NSKL 4YY3I 1S6QA 2DGOA 3H20A 2YKNB 3ULHA 2XS7A 1IJEB 3CJ2A 1NPPA 5AXNA 2BA0G 1DTQB 2E66A 2ZH6A 4LF9J 2CG9A 5C0XF 4K4ZA 3ZTQA 2DIUA 3HHLA 3R5BA 4FBTA 2G0IA 2ERRA 2FHJD 1APSA 1IBLI 3M8RA 3JQJA 4ED8A 3DGVA 2JEFA 4RW8A 3HLUA 3BDPA 1FRJA 2ZUAA 1TMJA 3RRGA 1XNQF 2ZM6I 2WP8B 4DS5A 4RNOA 2VF3A 4FVMA 1FDNA 2HKEA 3H5UA 4L72B 2COLA 3TRGA 2VPYB 4U95A 4QYRA 2EXUA 4C2MA 1HR0F 4DR3J 1U49A 5F8LA 3QGIA 3KLEA 3DI6B 3M30A 5HLFA 2J0SD 1TKTB 4ECSA 4IG0A 4LF7E 3H59A 1XK8A 3H90A 2HQGA 3MD1A 4L74A 2DNYA 4CLTA 5CYQA 2DPJA 3HSGA 1C4AA 4RUBA 1YK9A 2QN6B 4TYBA 4AD6A 4EWTA 4OX9I 2CQPA 4FNHA 2C3YA 1SI9A 3I0RB 4LFAI 1XWLA 1RCXB 3M2VB 3SSRA 3KMQA 1B99A 2H5JB 2NZCA 2PI4A 4MU1A 4NXMF 3DRSA 3I87A 3M8PB 5LSOA 2UXBI 3ETOA 4H4KC 4EZ9A 1UDSA 3E8OA 2M5YA 3KLHA 1OJ4A 1DY3A 2Z2ZA 4F3OA 2GAGC 3C66A 3DLHA 3NMRA 3CJKA 4RNNA 3KLGB 1U1PA 3LWMA 1VR6A 3ZXWA 4DR1F 1T8EA 4OZ5A 4DPOA 4ICLB 5A8KB 2VDHA 3UI3A 2W7OA 2R7OA 3BB5A 1P6TA 1UJ5A 2QO3A 3CJ0A 4B08A 5KTQA 3GYNA 2EKNA 2BW2A 1ZA2B 2F63A 3NGSA 3ZZOA 4CIOA 4NLVA 1UA0A 5T7LB 1ZYQA 2BA0D 5KT7A 5DROA 5K36D 4X66F 5ETMA 3MPDA 4BWJA 4IH5A 3F56A 2YNIA 3PEJA 2XNRA 1PVGA 3BBBA 3FBCA 5BJRA 1JJCB 1OQ3A 1UWBA 3B78A 1EX8A 2MLYA 3H2VE 3MEEA 3R7NB 5C7PA 4KAIA 4DL3A 4HKQA 2BA1G 2EVZA 3E01B 1EKSA 1M0SA 4ED0A 1KS2A 2HMIA 1R27B 2CJBA 2UUBE 4WU3A 3UNYA 4DLEA 4JI5E 2UU9I 1REGX 1RWUA 4P9SA 2V8GA 3MUVP 3MR7A 1AB8A 4N8OA 2ABYA 1XNQE 2AEJA 4ZS6A 2EFQA 2GIRA 2VQFF 3DRYA 1BQXA 5HANA 1RT2B 3DNCA 4C8OA 2J6UA 4B3OB 2AW0A 4KBIA 4NX9A 5KFTA 4AL5A 2HRUA 3PV8A 5JVGQ 3H25A 4MK8A 1Z1ZA 1GMWD 1RA6A 3HHEA 3MEDB 1KVJA 3BGFA 5KG4A 3N6MA 1PGZA 1H7SA 3AD8C 2GMHA 2DVIA 1HWJA 2BUNA 5KFJA 2GZOA 4DV0I 3LP1A 5DLGA 1XNRJ 2YXLA 4KB7A 2XMUA 2LQJA 5FWKA 1QAYA 4IDKA 1V3RA 4GQUA 5CYMB 4TQRA 1VRQC 4NLPA 3DLGB 3KK2B 3PNIA 2KT3A 4CM2A 5DM6Q 4IS9A 2Z30B 4CLPA 5C42B 1U8SA 2CQDA 2HIYA 2XTJP 4ELVA 2Y8YA 1VQOS 3LANA 2M2BA 2UV8G 5H9FJ 1S1TA 1KIJA 1R6MA 4X4QA 1XEZA 1P1LA 2PEBA 3M6WA 4M5JA 4X66J 2F4VF 3J81Y 3WHIA 3PXGa 4N56A 1QVFR 4FYDA 1RWKB 2BM0A 2ASYA 2JFKA 2YQ3A 4CO5A 1D6TA 4YHHF 2DXDA 2LLZA 3BGRA 3VAKA 3JAMC 3K5PA 1UFLA 2EBEA 1VJWA 3GTYX 5J2NB 1NSAA 2W2NP 3BGLA 5IOLA 3IRWP 2MQ8A 1N5QA 2W7PA 3I0SB 3G8QA 1OSDA 1U1QA 1N34J 2YH0A 1N52B 3J81Q 3JAMQ 3MECA 3IMQJ 3THTA 1R8HA 2GO3A 2MKSA 1TL1A 2RKIA 3M4XA 1TR0A 3M8ZA 1KQFB 4ANEA 2PN6A 3IA0A 2VQEE 2PD1A 4A47A 2VZ9A 5KG3A 2DXFA 3G82B 4DR1E 4X64E 1QE1B 1F9HA 1YG0A 1SC4B 1H6KX 4NCGA 3MM8B 3GV7B 2QA4G 3CIMA 3T5JA 1H7XA 2WCXA 4DMZA 4EFAC 2C2EA 1QAJA 1HNZE 1PAUB 1I94I 1NB7A 1HHQA 1HARA 2OELA 2XULA 2ZE2A 3LPEA 4KT0C 1WJ9A 4RUHA 5KT5A 1J5EI 2VL1A 5DDPC 2UVUA 2P9EA 3G82A 3MF5A 4PXEA 4Q5VA 4B9UA 3KXDA 1RAHB 2CNOB 3RUBL 4A8SA 3IXQA 1HHSA 4W98A 1WF1A 1F60B 3NOGA 3TQEA 1T7PA 1X4AA 1NHVA 2AJQA 2V4JA 4YUDA 3KJVA 2ZBPA 4RNMA 2KM8B 1SH0A 2ZHAA 5L1IA 5E2QA 4PRFA 4CLKA 2UXCI 3GU0A 1WSVA 4F2RA 4OZ3A 4F36A 4LF6E 4ZPAA 2RUSA 1NXIA 2CADA 4LF5J 4IFYA 4R1FA 3JS9A 3L7ZA 4YEAA 3R5AA 4HHUA 1HBOA 2MXYA 5IWAI 1B63A 2VC0A 1SQEA 3DXSX 2XSJB 2ZBCA 4ECWA 4XPCA 3UFCX 2PO4A 4GKKF 1TL5A 1BGXT 5B0DA 3L7OA 2ZH2A 4LF6F 4OI2A 2OIHA 3J7YI 2MZ1A 2AV5A 4R0EA 5I4MA 1ZTTA 2J5AA 1LNQA 1RHUB 2QZ8A 1HKAA 1KLMB 3RGIA 3OR2B 2IM3A 5DDOC 2MQLA 4DV5J 4TY9A 4DFPA 4DR5I 2ZBKB 1EAYC 4MK9A 2BRLA 1NDPA 1X7VA 1XMQJ 4QW9A 2IA6A 2F1DA 3M7VA 1TVRA 3MM5B 4EMDA 3GWCA 2RAQA 3ITHB 5KG6A 2ALZA 3MCNA 2CQ4A 1JJHA 5DDRC 3QIPA 1HQ2A 2NLWA 3VGUA 4DV4J 5KFBA 4B9SA 1FO1A 4PKDB 4PQAA 1DRZA 3M7NG 1Q78A 3NLCA 1BUXA 4K4SA 1I94E 1YJTA 4B3MJ 4B3TF 5C5JA 1S6QB 2FLOA 1J2VA 2CZ4A 2XYPB 4URGA 2LJPA 3R27A 3MR6A 4FW5A 3PIOQ 5KG0A 2EFVA 1W2BR 2CWXA 1RDRA 4ETZA 2L41A 1NJWA 5D0HA 4WF9Q 4EO6A 2YQ1A 1HNZJ 1HNXJ 4X4NA 1JNZB 3BGOP 2MQNA 1YRTA 1PJ5A 1VIOA 2I38A 3PRVA 1IQZA 3US5A 4F0KA 5C25B 4DSEA 2VASA 5HVHA 1TFYA 4I1TA 4G1QB 4NA3A 2UUCF 3G2XA 2ZZNA 2BJEA 4MTPA 5HL7Q 1FT8A 3Q24A 2PFFB 2BJ7A 3G6ES 3FCWA 2LFVA 4KGVB 2NZ4A 4F0HA 1LEOA 3VQTA 4JI5I 2DH8A 1V5IB 3QJJA 1HQEB 3CTRA 3V81B 1WG5A 1J5EF 2V2ZA 2IAJB 5HROB 3J7AN 1TKZA 3QYYA 4Z7YA 3M6UA 3N9UC 4PWDA 2UXBJ 1R43A 3FSXA 4WP9A 3W9JA 2LP4A 4OYWA 4Y34A 1HQUA 3Q8SB 1FJ7A 2ZZTA 3CUNA 2J8AA 5GVQA 1RK8A 3MEDA 5LT5A 4NMLA 3NNHA 2FPHX 1CJVB 4KHPJ 2Z5BA 3CDWA 2GS8A 2G1DA 4HHJA 1YJ9S 1C1CB 3WX4A 4YY3F 2NREA 3ZKDA 4DR5E 2XMAA 3RW6A 2IDEA 4Y28C 1FE0A 4QR0A 3T1HJ 1FEEA 2RS2A 4DR7F 4DV3J 4HR2A 1SL0A 4ZHRA 1RUSA 4P74A 3VGSA 1RT6A 3PX6A 2XLJA 2JEGA 2DO4A 1JMTA 1FX2A 3WQPA 2XLIA 2BQ3A 2N82B 1H0HB 2HGLA 3SYZA 2DHXA 3E2EA 3H5YA 3K2YA 3X1LB 1YHCA 2X36A 3OLBA 2Y3YA 3AD9C 1FK9B 3NGKA 2ZM6F 4P6QA 4RPFA 4K4WA 1U1RA 1W7WA 1Z4UA 5ETRA 1QSYA 3PO4A 2ZD1B 3W8GA 1A0OB 1ZTWA 4ATNA 1MN7A 3Q89A 4CDIA 1EETB 4NXNF 2JE6A 1AZSB 4DR7E 1RT7A 2BBEA 5C0XB 1U6ZA 2OP5A 3S8SA 5LJ3Y 2BQUA 1MU2A 1Q8IA 2KG0A 1RTJA 4IZJD 4AQYE 2IC3B 3R97A 1SJFA 4B3MI 4C8KA 2BW7A 2E5JA 2JDJA 3H40A 1EB0A 4DV4I 3I5AA 4HACB 4DX7A 3VALA 1KD1T 1G3OA 3CJRA 3OQ2A 1PJ7A 3PYGA 1PYTA 3QAUA 1LK7A 4I56A 4NA1A 5IC4B 4ZLNA 3R5GA 2RU3A 4O3QA 4DSIA 2ASLA 3H7HB 1S1UB 5SUHA 2WNRB 2GA7A 4Q8EA 2IOPA 1E6VB 1IBKF 4HXZA 4DR7I 1VLYA 2XMJA 2HZAA 4U8YA 5K14B 3W66A 3Q8UA 1IUJA 1GMWA 1PYSB 1NK7A 1YRXA 2A3JA 4UOGA 2PMWA 2X3GA 1U7LA 2IBOA 4ZCKA 1EKRA 4ZVEA 3X3UA 1XMBA 3D67A 4RNFA 1RAOA 2X51A 3JQMA 4HDGA 3QSIA 3TVZA 2HHHF 4NLUA 4Z2XA 1YKWA 3AOCA 3PRDA 6FD1A 3BO2A 3IM8A 4N5SA 1QM9A 3OR1B 4WYWA 3P6YC 4OO1B 2Y1RI 2AZ3A 3MCOA 1DURA 1X0PA 2J9CA 5HQLA 3CF5Q 3DI6A 2Q6CA 5HK4A 4GKJF 3EGNA 3CXCR 1NMEB 1H7UA 1CC8A 3AQOA 4FXVA 1WHVA 4DR4E 4F2SA 1KQKA 4ZVFA 4DUYJ 1O8BA 2XY6A 1USUA 3I56S 2YX4A 4CM0A 2CJ9A 2ZJRQ 4DV4F 1U26A 3KUGA 4NZ0A 3WU6A 1HW9A 1S7HA 2B3TB 3M1VB 5T14A 2KFZA 3SIPB 1MSWD 2O66A 3AH6A 1JWWA 1TKXA 1S1UA 1TU0B 1QUVA 3I96A 2DT9A 4DZDA 5K36A 1RHKB 4AT1B 1U1NA 2HBRB 1HK7A 4WUDA 2F9JA 3CCQS 4JI1J 1Q5VA 4OYZA 4XAKA 4PG8A 3PW4A 2F4VE 5H9FK 4OX6A 2OEJA 4JI0I 2MZQA 2V67A 2DRAA 4PG7A 2HVEA 2ASJA 4GVLA 2HWHA 4YHHE 4DHVA 4IFDD 4OZLA 4KGKA 5C0XA 1KHVA 3DLEB 3AB2B 1KNZA 4C98A 3I4HX 1JLEB 5GADU 3JSMA 2J0QD 9ATCB 4YS2A 1R8AA 5HN0A 5ITHA 5KFYA 2ADCA 2YNIB 2IVYA 4ZVSB 3VQSA 2AJ1A 4RU9A 1Q5YA 1S1WB 1UFKA 3J81C 4O23A 7FDRA 1KVIA 1SKUB 3OVBA 1RBLA 2IM2A 3GR0A 3OFEA 5CZVA 4YY3J 3PIPQ 1JJ2R 1FI4A 1B3TA 1XERA 3CC7S 4JV5F 5J2PA 5A8KA 5B0CA 1L3UA 3BEGB 1B7FA 2ZVSA 1MROB 3DMJB 4OIXA 2EC0A 1M1HA 2RHSB 3IR7B 1HLWA 1RABB 1YRUA 2CG4A 1RLDA 4L75A 1NJZA 1P8GA 3JSBA 5IXUA 2VHGA 4OI0A 1HL6A 3GIRA 3KDOA 4OX7A 3RB3A 4OYPA 1GFWB 2DGXA 4DV2E 1U6BA 3I5CA 1Z5AA 4C3MA 2GHPA 3FKBA 2H9ZA 3I0RA 3VAGA 3OD2A 2DNOA 1SIZA 2MZTA 4NMXA 1E6VA 3GZ7A 2R7WA 1KONA 4OYXA 5CH7B 1OYSA 2PA8D 2RILA 2LQ5A 2HWTA 4P72A 4IFVA 1ELOA 3PW0A 2W2QP 1FKPA 4DCPB 4FWGA 1H73A 4ZJLA 4EEYA 5DRQA 1NU4A 5A2QQ 3RG6A 1F5BA 2KXHA 1IBKI 2M52A 1IBKE 4ZCMA 2L3MA 1J5OB 3DDNA 2C39A 4TYAA 4QNJA 4JI8E 4O0NA 2QLBB 3HCXA 4CLZA 1C0UB 1PJ6A 2B7BB 3D54A 3Q8PB 3ZM7A 3QQCD 2QTWA 3NGUA 2ZE2B 2VBXA 2W24A 2LECA 4GKJI 4Q2LA 1S10A 3KK1A 2NCKL 2CVEA 5L3JA 4DJBA 3IR6B 5E3QA 3PR4A 3P76A 1V6HA 3I5BA 1PIEA 3PO5A 2KZZA 1RSCA 4WIIA 1HWKA 3K17A 4JI4J 4LF9F 4M5IA 2H54B 1IJFB 4LOMA 4AQYF 4GRSA 1U47A 3PEHA 4M5DB 1Y0HA 4NEYA 3CDUA 2RRAA 3OL9A 4K0KI 4C0BA 5DQIA 3R7BB 5CCLA 4NXNE 2RD5C 2MSSA 2NSCA 2WK4A 4ECTA 5DJBA 4J9KA 5EKWA 1DLOB 2QV6A 1FTCA 1C1BA 2QJ3A 1X9MA 4TVAB 4UQTA 2RQ4A 3HK2A 1WDTA 2OKQA 2WONA 3DHXA 4GC6A 1XR5A 2XHWA 1OY6A 2ZBQA 3AA8A 3EDQB 3MDFA 5ETOA 4DR3E 3A12A 2QMWA 3SFUA 2E1AA 4A8XA 1DQ8A 3DLJA 1T11A 2XGQA 4KKOA 4I7FA 4I2PB 2OO4A 2BE2A 3FZBA 3OLAA 5LMNJ 4DF8A 3N4WA 4KH0B 1OS5A 2H5IB 3C6TA 3CW2C 3DYAA 3MM6A 2VH7A 2EFPA 3KHLA 2IVMA 3P3CA 4TU8A 5I3QA 2YNFB 1RTHA 1RAJA 2BZ2A 2OPQA 3GMEA 2FZGB 3QWUA 1X60A 4N8NA 3ZTSA 2AMCB 3S6EA 4ZVPB 2XB2D 1NB2A 2V63A 6AT1B 3LH2S 2V5HG 2CRLA 4DR1J 5A6PA 2HFNA 5CZXA 4I69A 3RBXA 5J2QB 4FF3A 1S16A 5FLXU 5E3PA 1S1XA 2JLEA 4UT4A 2E5LF 5GMDA 4LRFA 1VK8A 4NXMJ 2OPSB 1FWPA 4HH1A 1L3VA 3CDEA 1UVNA 2Q66A 3EX7B 2M3DA 5F3TA 1GNKA 1VOMA 2IDLA 3NG8A 1GT8A 2VKRA 4ZCIA 3TZXA 1VRTB 5DETA 1RE1B 2C2DA 4TN2A 1VFJA 4KR0B 3DGPB 3IWNC 2JE6B 1S6UA 1OSCA 2G2YA 3DLKA 4CYUB 5KG1A 4DXLA 5KG5A 3EMTA 5KFNA 4ED2A 4USUA 3MOJB 4B3SE 3N0VA 3CGIA 1GQEA 5T7LA 2W2MP 3ENWA 2H51B 4JI5J 3MMCA 1SUQB 3QPIA 2W9AA 2UXDJ 1RWXB 3IS9A 4ECXA 3MECB 2WAQD 3M6VA 4LIWA 4LFAF 1UDNA 3OV7A 4JI1I 1XNQJ 4ZHRB 4M95A 2VBYA 4Y2MA 4EGLA 1HNVA 5L9NA 1EA6A 1Z0EA 2RU9A 2O1VA 1K1SA 3BKTA 1Y5YA 1HMVB 2GQCA 4CLSA 4NLDA 4DV7F 3U1YA 4LRCA 5CD4A 4WFXA 2DH9A 4LFCF 3M85G 4DLGA 2KU7A 4LF9I 1RWVB 2HQFA 4NL5A 1BC6A 3FDSA 5LL6R 5IFMA 1IKWA 3QGPA 5F8HA 5GAEU 3DOMA 5ETPA 3CDBA 4ZLJA 2W4PA 3BM7A 3GP9A 3GSDA 3KLFA 3D4JA 2GIFA 4YB7A 1HMVA 2V9KA 4RW7A 4F7VA 3DN9A 2VBWA 4DR6J 2HVZA 4LCGA 2JWNA 1VQMS 5LMUI 1S0OA 3MMBB 4PG5A 4LF7I 2CPZA 2FDNA 2UXCJ 3LP0B 1XJWB 2C3MA 4WK1A 2JEJA 4DR2J 1T9WA 1NSQA 3WIUA 5KOWA 1VQ6S 4DU7A 2YVSA 1UVKA 2C2OB 3AJ1A 1RAGB 4FNIA 1R6VA 5KFCA 4M5GA 2VPWB 1HWLA 3IBFB 1RT5B 2IJRA 1WG4A 3KTQA 4M5NA 4E8UA 5E0OA 3SV3A 4DL5A 2NYIA 4DOZA 2UU9F 3D0HE 1P1TA 3GPAA 3NNCA 3CCVS 4OI6A 2Z5CA 1RT4B 1R3NA 1RWNB 1DJ0A 1S6PB 1WSRA 2F8HA 2HZCA 2IRYA 2WZ1A 2YKOA 2MTLA 4MKVA 4N7TA 4USTA 4QIGA 4AE5A 5LSRA 5GAHI 4E0DA 4EK2A 4WKRA 4LF2A 4PEOA 1L3SA 4CRJA 4LRBA 1D3WA 3FSYA 2QEXS 1FRIA 3MPUB 2DHAA 1IKXA 3JSRA 4CO1A 3UD5A 5CABA 1HNXE 4WP3A 3BR8A 1JKHB 2AEFA 2HQIA 1YJUA 2GO8A 3IR5B 4NOHA 1NDCA 4CO4A 4MT1A 5I3UB 2DYAA 3M85D 2MZRA 3IFEA 4QPTA 5AE3A 4LF7F 4DQPA 3FC9A 2RQMA 4ER8A 1KQGB 1RXOB 2DRDA 1RWOB 4NE9C 4MYUA 2MKCA 2KXNB 2JH3A 1SL2A 2DRBA 2G2ZA 1X4CA 4B3TJ 1VDHA 1MNEA 1NO8A 2KJWA 2VG7B 1NBEB 2OFHX 4R25A 5HSPA 5J1EA 2YKPA 1NKEA 4DWIA 5KFAA 3AOAA 4XDDA 3ZTRA 2G0CA 2UUBI 2OEMA 1T0TV 1U8WA 2XSJA 1TZ0A 1TL3B 2PMZD 1K9MT 4Q44A 4LF6J 4RLEA 3KLFB 3KLHB 4LF5E 2ZBRA 3MTKA 4ENOA 2HVIA 2QLXA 5KFRA 1VCTA 2DCUB 2QRRA 3ZZRA 2KZMA 2KHDA 3UNGC 5F8JA 4LSZB 4JV5E 3UVJA 3ZNJ1 3I31A 2W8LA 5HMZA 2Y1IA 5IM0A 1FJGE 1FVQA 2HSEB 1D0EA 1TFWA 5E3AA 1CS4A 2D41A 5CA5A 3SXLA 3FMBA 4IG0B 1K1QA 2ZM6J 1B4SA 4AL7A 3D6FB 4ES3A 1OMSA 1CJTA 2M7SA 2V94A 4OV6A 5J2MB 4ED6A 1NJYA 3LGHA 4UY85 4I67A 2CQGA 3FEYB 1UZHA 2WHOA 2DGQA 2C42A 4H4OB 4LF1A 5B0FA 1QLNA 5DG8A 2HZVA 2SXLA 3OBIA 4OQJA 4ED7A 3G86A 5B09A 1MX0A 3HX9A 4JV5I 1WORA 4LFCJ 4OHYA 2VDIA 1RKJA 4DQSA 3V4IB 3NEKA 5HATA 2WOMA 2KYZA 5D0GA 1I6JA 2UUBF 4F8RA 3RTVA 1KFDA 4IOAQ 1ZM2A 2WRMA 1V9OA 2C22A 2PO0A 2DGWA 1FRXA 3HPOA 3KKFA 3P06A 3AAWB 2HIQA 2YKNA 4WE1A 2AGOA 3JXOA 1X4HA 4MK7A 2G13A 1C0TB 3F44A 1NEEA 3WX8A 1X0FA 1H7WA 3GIKA 3GILA 1RGVA 3PM9A 3RAQA 1FKPB 3UR3C 2E5GA 1HBMA 1G7CB 1Y5LB 2AHOB 1QTNB 4RKUC 5A0YB 5EX0A 2ZDOA 1RAIB 1YBUA 1FERA 2FC8A 4RW9B 4YFUA 1IWAA 1G1XA 4U3BA 3M8QB 1BLUA 3J7Z5 3T1YE 2CQ1A 3GMGA 1Z2LA 2FVQA 3BO3A 3POTA 1R0AB 3TUPA 1RTHB 4P10A 1DFDA 4DV6J 3FEZA 3TI0A 4LF5I 2PDAA 2L48A 2IRXA 5BXIA 5IZHA 4NEZA 5F0WA 2H65B 4A8KA 2MHNA 1U1OA 4LF4I 4B3RE 5IT9U 1KQSR 3MGJA 3AXMA 4JB8B 4KKOB 3TWZA 3P3EA 2DY9A 3KLIB 5D8HB 4OZNA 2HNYB 4YDDB 1RTZA 4KPCA 1U6FA 2CJAA 4LQ3A 2NXCA 2RVJA 1Y4SA 3WU5A 4NCAA 2FVPA 2C38A 5JMNA 1V3SA 3HT0A 2DHSA 2JT2A 3QAEA 4ZJQA 3PYDA 2PO1A 2OHDA 2Q79A 1UEVA 4Y2IA 3U02A 4IG3A 4KHPE 4LIRA 2JRSA 3J7ZT 3FRZA 1MWQA 4HI2A 4IR1A 1OYDA 5K20B 2FJDB 1Q4RA 3EICA 5DNLA 3NCQA 1U45A 1SKWA 1BXNA 4DCJB 4C8YA 2CJKA 2OSQA 1HBUA 5EN1A 2R7QA 1VIXA 2ZH4A 3R8YA 4FXDA 1H98A 3B6BA 3MTJA 4XK8C 5FDLB 2OTLS 1KRPA 3H1CA 3D2WA 4RO0A 2IM0A 3C46A 1X4BA 2F5GA 1HFEL 2LVWA 2Y9HA 2EW9A 1SJQA 1JIHA 1WTBA 4DX8H 3QIPB 3QWPA 2B9WA 4R5PB 3I9V9 2FTRA 2OPPB 3NGDA 1W26A 3PFEA 4PR6A 1NK6A 4MU3A 3RRKA 1D9AA 2DNKA 3J7AG 2A18A 1T05B 1JLBB 4AQYJ 3EGWB 2AJFE 4ID5A 4KV8A 2IESA 4J5OA 2D3O1 2QL9B 4WCEQ 2BR2B 1RP5A 2QC3A 1NJIT 2FJBB 2QSWA 4JI2E 3BR9A 4G3IA 3JSYA 4MU0A 2QIFA 3DM2A 2NPFA 4YHHI 4DV1J 1EZZB 4URSA 2M9KA 5L39A 2FVSA 3PS1A 1JX4A 2JEBA 3MMAA 1HBNB 1LKZA 3ONQA 2LEPA 1CJVA 1YJ7A 3FZ2A 5GADI 3Q2TC 2QSFA 2LKZA 2CDRB 1IKWB 3VR1A 1RACB 3P5TL 1YGYA 1S4EA 3C14B 1SJ4P 2O1PA 3SCIE 2YWWA 4GO7X 5ETKA 4CNZA 1NHJA 3MM7B 2ZH5A 5HROA 5C0XD 2HK2A 1HQEA 1V5VA 1TTHB 2B6AA 3N6LA 5HMXA 1UZDA 3OUYB 2MQOA 4ID8A 4JI6E 1NK4A 2V4JB 3KJVB 2N4DA 4WBFA 2MYFA 3TQ1A 2A0FB 4ILLA 5KFLA 5ETVA 2GMJA 4DDFA 4USMA 3O5TB 3QIDA 4I3HA 3NWGA 9RUBA 4QCLA 2D1CA 3DRPB 1FEHA 3AJ2A 1XTZA 8AT1B 3HM9A 4YR0A 5AT1B 4X65J 5CXTA 2V9WA 2PO0B 2RJZA 1P27B 2KJVA 4K8RA 2QA4S 1D9FA 4B3MF 4UOCA 5KT3A 1FXLA 1I5OB 1KWMA 1UPMB 2CA9A 2E1MC 2EFGA 3HHKA 2GJ2A 3BN4A 4ZPTR 5IT4A 1R31A 2UVWA 1Q8LA 2MZSA 4IQXA 2UUAI 1KOHA 5L8RC 1LFPA 1XBWA 4LFCI 3TP2A 2F4VJ 3EWGA 4DR3F 3W64A 3PZPA 3C15A 1VBKA 5AXMA 2E1CA 2KT5A 2VPXB 4P73A 1XMOI 1WHYA 1CPZA 1LK5A 1A7GE 2AX1A 4IZKA 4OO1D 4YHHJ 2UV8A 2V2QA 5IWAJ 1X5SA 4V19J 4UW2A 4RBUA 2WSCC 4EBCA 3MPWA 5M2UA 4DL6A 3EDRB 1UL3A 2CJXB 3KJFB 1TP7A 2KRRA 3M6AA 1TVRB 3PFOA 4WFYA 5IQ6A 3TVYA 2AYGA 1T03B 2R8GA 4KJIA 1VLOA 3QLHB 4OYBA 4JI0F 3BH6B 1BQMA 4DU8A 2ZOFA 1SB6A 1V3ZA 1SVDA 2XBPA 3TA1A 2VICA 3NBPA 1K47A 1WACA 4DR5F 4YY3E 1HW8A 4C3KA 5EL9A 4PWDB 1TKDA 2MDAA 3MMBA 2M4MA 4LBIA 3RB6A 3FSIA 4RW6A 1B0TA 3D6TB 2R42A 2F3JA 3HFKA 4WFZA 1Y5IB 3HFVA 1FRKA 4NRTA 5KFEA 3MR5A 1REVA 1N34I 2QLFB 3CCSS 1IKYA 1AYEA 2PA3A 4F50A 1YZ7A 2IOQA 3ZTOA 2G4BA 3G87A 4MFBB 2KM8C 3FUYA 2OGUA 4TKTA 3MAQA 2X1FA 3LOUA 4ZA1A 4JI8F 3K8VA 1S9EB 1F3FA 2HQ3A 2Q6BA 3R5DA 3AB4B 2PGCA 4KC5A 4WXWA 5CHCB 3J81j 1B64A 1K0TA 5KFKA 4KQVA 1D09B 3MEGA 1YBAA 3NMAA 2JJ4D 2FHOB 2DNGA 3DKDA 2WSEC 1HBMB 2MJUA 3U7JA 4FF2A 3K0JA 4C4WA 3AFGA 1FJGF 4NBQA 5DNXA 2JX2A 3ZZUA 3K5OA 2ROPA 3PRBA 1RT1B 3HVTB 3L4BC 4X62F 3ICLA 1U0HA 4LFAE 1SIWB 1WD6A 2PNZA 2RS8A 1N48A 2MJNA 3HZGA 4ZP6A 3LP2A 4I6YA 4BLGA 1PO6A 3AY0A 3TJ9A 2GVDB 1UDQA 1FX4A 2GJFA 4FWHA 4KO0A 3FBFA 3N6NA 3NKYA 1BQNB 4X2BA 1VHFA 4PABA 1LWCA 3KHGA 4XDCA 3TX8A 4A8WA 3DM2B 4QOTA 4YN3B 2K2PA 3NGTA 1KLMA 4YDXA 3FNNA 5EDWA 3W3SA 3JAMY 2B5JA 1XXEA 4OKGA 2YKQA 1EARA 1Y7PA 2AKWB 3TAQA 1U1MA 4PPZA 5LMNI 3V6KA 1NKBA 2V6AA 3LGNA 2H4WB 1KTVA 2AZ1A 2NPIA 3KG4A 4WJBA 3CJKB 1LWFB 4YQWA 2CQCA 3KLGA 3HDSA 4OJGA 4NXNJ 2MKJA 2YKMA 1S57A 1HNWF 1LW2B 2CPFA 4D3HA 2DNRA 1FD2A 4QR2A 4EUVA 1XR6A 5CYJA 4OYIA 4CO0A 4JI4E 3M2VA 1EQ0A 1JB0C 1GXLA 1WF2A 2O3ZA 2HNZB 1H74A 4DSLA 4JI3I 3PG9A 4LF4E 2VC1A 5D6GA 1LWFA 1Z2ZA 2OD6A 3CJ3A 4ZN3A 4LREA 1S72S 2MGZA 2RQKA 2E9RX 1NPKA 5LMNE 1N33E 4WU2A 3Q8RB 2V0NA 2O1WA 4ELTA 1DQ9A 1HI0P 1AA1B 3W5XA 5HQMA 3M9OB 1IBCB 2J76E 4DV7J 4NXNI 2FJVA 2UUCI 1NLKL 4PXCA 5ETLA 4CO3A 2L9WA 2Z2MA 5B7WA 4K5SA 4K7QA 1CJKA 4FYYB 3D5MA 1QJHA 2DPIA 3T1HF 4R5PA 2AYEA 1Y6ZA 2BV3A 5JJBA 4FWDA 2MSTA 1X4DA 5F41A 1RISA 4X65F 5H9EJ 2ATCB 3FFIB 1XMOF 4DR2I 1JXEA 3H2LA 1TUVA 2DB1A 4A8OA 2CDQA 5A8WB 2CIMA 2HS0A 1N0UA 2IM1A 4ZVRB 4LF8F 4ES1A 2CUYA 3M9NB 1WWHA 4JG4A 1S59A 4OFZA 2WVCA 2UUCE 5KT4A 5JEAB 3ZZPA 3TUIC 3KK1B 2WW8A 4DV0E 2JNJA 2JLGA 2PEHA 2I8EA 3OXGA 3B82A 4M5LA 4U7UD 1O0PA 1T9XA 2VFVA 1IR2A 3UE2A 4QIFA 4F4WA 1VBXA 5LL6d 4B3SJ 2JEAA 1SJRA 2J0WA 2L08A 1LQ9A 2RRNA 1JLCA 2W4CA 2XC9A 4OHZA 3TANA 2HHTA 2UXDE 4F04B 4X62E 3PYFA 1IM6A 2HBZB 2HFOA 2KN4A 3C6TB 2NXJA 1UEUA 2HNYA 3HJVA 3LUYA 4OI4A 2LA4A 2JLFA 1CULB 2KYXA 3FQLA 4WE1B 3T6JA 2A2DA 3DLGA 4DSFA 5IT9Q 3B4MA 4DV2F 2X1BA 4M5KA 4J9UE 2CAJA 2ZWPA 2XG8A 1Q7LB 3E51A 4KO0B 5GAEI 1JLGB 3FMWA 4ZPVR 1YJWS 1R6LA 2GHVC 3HJCA 3I4PA 4O0IA 1X5OA 4MIAA 2M0GB 2QMXA 2MQPA 1R6YA 2DR5A 5JEAE 2D3ZA 3M8QA 3CMAS 2KG1A 5F8MA 1NDKA 3AJDA 5HJYA 4DQIA 2D9OA 4B3OA 4P2XA 3OFGA 3RJMB 4DR6E 2K8GA 3VF0B 4OX9E 1FXDA 5C2CA 2XCPA 4C8MA 1S76D 5A6WA 3W9IA 2UXCE 1Y10A 2GJIA 2E5IA 3OTCA 3CMES 2Y8WA 2VU5A 3R3TA 4DR2E 1DHMA 4LSLA 2R4FA 2X3DA 3DRXA 3C16B 4KFBB 1U2CA 3KWMA 1HHTP 2PNZB 2NXEA 2D3OR 3ET6B 1CLFA 2WP8A 2UU9E 2QA2A 2FD2A 1N56A 5M2RA 2HHSA 4LRDA 5ETQA 1AROP 4LF4F 1FJGI 2H3EB 1Y3KA 3OSPA 2BR0A 4HYKA 2ZH7A 4DUTA 4LSLB 4IUFA 1S1VA 2GGPA 1T9VA 2RUGA 1F0XA 2XNQA 3QT5A 3ZZYA 2DNPA 2ZKTA 8RUCA 4DV3F 3DLBA 3R2CJ 2U1AA 2KRBA 4A4JA 1QAIA 2C1EB 3KUEA 4B3SF 3BBFA 1ZOTA 5HP1B 4LMZA 1ICEB 3BQ0A 1NZ8A 2CZ9A 3TAPA 3VGTA 2X1GA 1G4CA 3QT6A 2C2RA 2PFDA 4DUZE 4FKXA 2EPIA 1TL7A 3HHLD 4PQUA 1Y9OA 4Z37A 4LQ9A 4UF4A 3TW0A 4O44A 1S77D 3NNAA 4ILMA 4B3TE 1KN6A 2DITA 5AXLA 2GQ0A 4MJKA 2HFZA 2VIHA 2HNDB 4OO1A 1RWMB 1MROA 3D6HB 3DMJA 3NL0A 5EHHA 1WOSA 5HQ8A 2GFFA 2BA1D 4IKAA 3DDIA 3T41A 1LWEB 1UCNA 1UJ4A 2I0XA 2W1BA 2XI3A 4EYIB 2GO4A 2NUHA 3LQVA 1N32F 3HVWA 5HMWA 5KFPA 4C6AA 4PZVA 3WC2A 4CT8A 1YHQS 3G6XA 1LXNA 2R7VA 4OO1E 1H72C 1SBRA 4IFDC 4QJVA 4JV5J 2CPIA 2ADBA 1OIAA 1WF0A 5K14A 3GJRB 4OL8A 1FJGJ 3DDKA 2R7TA 2NN6E 3EXYA 4P2SA 2O67A 3I82A 3PDNA 5C24A 4TQSA 3O3LA 2HWIA 4M5DA 3W60A 2Y1JA 1A6FA 2DGTA 4P7AA 2C3OA 2KHCA 4V19X 1Z0VA 2ZM6E 1RHQB 4EBDA 2G0JA 2B6AB 2KH9A 1S0NA 4K0KF 4X4TA 5GAHU 2XS2A 2VOPA 4OYAA 1M5OC 1F3VA 1RADB 4U8VA 2EWHA 1BKNA 1WOPA 2QG9B 1CJUB 1H2UX 2GQQA 3E01A 1QY7A 5A8RA 4QBUA 5K8NA 5IS2A 1UVJA 1Z5CA 1PG5B 3UDEA 1RCOB 4ECVA 4LFCE 4I0WA 1NDLA 1KKHA 3JB9k 3DXBA 3T1AA 3GB0A 4HLBA 1NUEA 1HPZB 1WC6A 1PBAA 1X4EA 5KFIA 2MB0B 4LVOP 2Z0GA 2P6SA 3FEXB 4OX9F 1X9SA 2VFSA 1SJ1A 3GQCA 3I9ZA 2Z57B 2HKJA 2CNNB 4CLLA 4IFDE 1FKAE 2KXFA 3LP0A 1KTQA 1RU2A 2HLUA 2L9DA 1Y4UA 4O3PA 4DUYF 2VJUA 5GAGU 2VQEF 1VQPS 5ETSA 4L3KA 2QE5A 4RW4B 1EP4A 1FFWB 1N88A 2RE1A 1HPZA 3GV8B 4HDHA 1N33F 2FIUA 3ILIA 5H1SV 3T1YJ 2HVHA 2PT0A 1Z0WA 3DGPA 2ALYB 3TAMA 3GFHA 3ILJA 5GMKa 1TV6B 2VONA 2GVDA 4J37A 4WTYA 4DV6E 2NSBA 1CJUA 3EZ5A 4B3SI 4LR8A 3PS2A 2CNLB 2K3IA 4B3RJ 5LXYA 4PCQA 5ETTA 1EP4B 4A8YA 1B7YB 2Z56B 2RNEA 3GFYA 2I2YA 3EJMA 1HNVB 1RQ0A 4QZVB 3HHNB 3ZC4A 3W65A 1HIYA 2M8HA 4N77A 1VQ7S 4K50A 3UN2A 4X84A 1N5SA 5ADZA 2B4OA 1U48A 2BOPA 2LXUA 1I94F 1WTFA 2GC8A 2ASDA 4KV8B 2OD4A 4RWXA 1JLCB 2KB2A 2LEBA 1QZRA 2UU9J 4DUZF 2EKYA 3NS5A 1K73T 1FJCA 4RW8B 4OZEA 2E7XA 4DL2A 5LMNF 3C2PA 5FJ4A 2D7SA 4B3RI 4U67Q 4DX6A 5A2QY 4Y2CA 4B02A 1R8BA 1AFIA 4DR7J 5ETNA 3SQOP 5KFSA 5EWEA 4JI7J 1FNMA 2NR0A 3MURP 1BWEA 4I2QB 2V8VA 5KFZA 3G6VA 4ZP8A 5D77A 2UXCF 2L9NA 1D8ZA 2EI5A 2XHCA 4OLOA 4DSKA 4DG1A 2R7XA 1QAXA 2OMOA 1AT1B 4WP8A 4ZKAA 4H54A 2D69A 3BGRB 3ILLA 1RKIA 4ZPCA 3RAMA 2MMYA 2AWZA 3BV8A 3HFZB 5IWAF 1Q8BA 3P45B 4RWWA 1HI1A 1KBRA 3DRRA 4O3OA 3VAHA 2W2OP 3N28A 1WC1A 1KSPA 3HI9A 1NK0A 2Q3PA 3UCGA 4DG1B 2XM3A 2J7KA 2OPRA 2BEFA 3D0IE 4J91A 4JI2J 5JEAF 4DUZI 3PR5B 1WKKA 1TQLA 3TZZA 1FF2A 4AIDA 3IGVA 3N5BA 4NPOA 1ZETA 4DV1E 3D0GE 2VG5A 1HBOB 1GTHA 2F8EX 2RRBA 1FA0A 4F4KA 1SC6A 2WTFA 3EZUA 1DBDA 1GXUA 2ROEA 3GJTB 3O2IA 4J90A 4WKYA 2IFXA 3BSAA 3CE8A 3IWXA 3N5FA 2YKMB 1WC5A 4DL7A 1AFJA 3OL7A 4HH0A 3H5XA 1TELA 2BMBA 1XR7A 4QYZK 2QL7B 3TOQA 3HHDA 4J9LA 4JI6J 4URLA 1IBLJ 4Q45A 1L5UA 3TNVA 5IT9Y 2GGPB 3H42A 3ZZTA 3PJ9A 1H38A 1Z59A 3RBZA 1U09A 1UVMA 4X65E 3NRBA 5L1KA 4QPXA 2NN6A 3EYZA 2XGPA 2OH2A 1MW7A 1Q16B 3M2RA 2CG8A 1HBNA 2DGSA 3OXLA 3QJLA 2DR9A 1NHIA 1NH8A 1S9GA 3T5KA 3FCHA 3TX0A 1SH3A 4ZVQB 3CCJS 2CJQA 2IA0A 1N8RT 1LW0A 2XZTB 2YWKA 3UCUP 3RAXA 4MMOA 1N5YA 5D4PA 2RKIB 1AW0A 3MCMA 3M05A 1CJTB 2DHGA 2ZITA 2BJ9A 4JI8I 3EXCX 4NA2A 2RH3A 4ICLA 5IWAE 1TK5A 4PWWA 3IWLA 4HT7A 2BX6A 1JLBA 3Q0AA 2BJDA 3DRRB 3QO9B 3M6XA 3CC4S 1UW9A 5JVHQ 5LM7E 5IM0B 5B0BA 2HK3A 2JL9A 4F02A 2HEKA 2QX0A 3LALA 5I3UA 2OMLA 2I9SA 3H2UB 3LTOA 1YJRA 2A1BA 3QFHA 5E41A 4LSNA 3RU0A 2W9BB 2RDDA 3OJUA 4O4GB 7FD1A 2FQQB 4LFBI 1UFWA 2VG5B 3U1MA 2FLPA 3I32A 4OZ0A 2B4UA 3S1TA 3BSNA 3ISZA 4NYOA 2DNNA 4U7UK 3GJSB 2FY1A 4YR2A 1FDBA 5L9XA 3DU6A 4F67A 3OL6A 4IRDA 1OYPA 1USVA 3UQSA 2Z5CB 3PRYA 1UMJA 2CPHA 3GR1A 1Z0TA 3LAMA 2DNQA 3PVXA 3S7RA 1D1UA 2KFYA 3ET6A 4I4BA 4F26A 4ZVIA 2O01C 3T1YI 1SKSA 1YIJS 2JEAB 3K57A 4CLYA 4DR3I 4JOUA 1JLEA 4USJC 1IBMJ 1VJQA 2ZH3A 4ZN1A 3CCRS 3UD3P 4HYMA 4KIAA 1X8DA 1MMLA 4OX8A 5KFUA 3CCWA 3FQKA 2D74B 1FJEB 3CCLS 5CQGA 4JYAI 4RW7B 1TK0A 4ILRA 4LFAJ 2M8DB 2MKHA 2W25A 4Y3CA 1S1XB 4C8NA 2C2NA 4WTOB 3Q86A 3HO1A 4RUCA 1JXLA 4W90B 2P9GA 4IH7A 4QWAA 1P42A 4K4UA 5L38A 5E5NA 1R0AA 2GNKA 4BC9A 4J3DA 4KHPI 1M5KC 1TMMA 3C8YA 3G71S 1C2PA 1DTTA 1OYEA 1N32J 5KFFA 2HLTA 1X31C 2A2CA 3OTEA 1QTMA 4DL4A 2PO2A 1FWLA 1FKOA 1I51B 4LF8J 4USKA 3JTPA 3KHRA 1ZZNA 4ZLPA 2OJ3A 2V2KA 3PHTA 2HFVA 2ILYA 3PHEA 4PRVA 2HHPA 4CH0S 3W8PA 3QJPA 2UXBE 2DNLA 2FVCA 3T1HI 3UDVA 6FDRA 4ECQA 2O1TA 2QFIA 3UN3A 3TEHB 4UY8T 3B4DA 3V6DA 1JLFA 1KVKA 1ZM9A 2DXEA 2IBKA 2Q2EB 2HRTA 1TV6A 2AU0A 2POKA 4B17A 2R2TA 3DLLQ 1H2VZ 2M88A 5BYRA 1AUSL 2CQBA 2QFJA 4OI1A 4PXDA 4LF4J 1OWXA 2APOA 1CC7A 3BZQA 3SQGB 4X62I 2E7WA 3SEOA 3JTNA 5DDQC 2YWEA 1U4BA 1N33J 1U25A 3UN5A 2LYVA 1RT6B 2MZJA 4DZ6A 4F25A 5AJ3F 3CEDA 1IQTA 4JUZA 4DV7E 1FDAA 4B9LA 3MM9B 1XHKA 2G2OA 3TUZC 5KFDA 5E3CA 1VHIA 2IIHA 2DKOB 5AE1A 4IG3B 4L73A 2EBGA 1T05A 2ZC4A 5IV3A 1MLAA 2DIVA 1BQNA 2CWKA 4ED4A 4JYAJ 1N4LA 1SC1B 2WOMB 4DPTA 4UQGA 1N36F 1IWGA 3OFHA 4AYBD 3VVUA 2BANB 2GAHC 1SC3B 4OJ3A 2FJAB 4Q0BA 1XNQI 1C0UA 3GE9A 2E44A 5JUMA 1DTQA 1T95A 3BPDA 1NJXA 2HHVA 4BA2A 2ILZA 1N33I 3ZKBA 2H48B 2UUCJ 4DV7I 3BDEA 3BS9A 3CJ5A 2OPRB 2XCAA 3J7A1 5JEAC 2YWHA 3BKUA 1VC6A 2XLKA 1ZBTA 1SXLA 2ZOMA 3FJ2A 4DV0J 2F40A 2OLWA 1SL1A 2D9PA 4CH7A 1JLQA 1XN9A 3WDOA 1EHWA 1R8PA 4JBCA 2LEAA 4Z7CA 4CCHA 2DEIA 1T9UA 1JKHA 1VQLS 3V6JA 1UPPA 1VGYA 2KT2A 2CQIA 2YNFA 5DZ7A 2ZH9A 2UXBF 4FW4A 4GKKI 3IO1A 4PYAA 4X62J 1KLNA 5DGBA 4W92B 2E1PA 1FWKA 4TU7A 2HHHJ 3C15B 3V81A 1S1VB 3KLIA 4OYOA 4K4VA 3IBCB 5HVGA 3GV5B 2Q1LA 2HNDA 3IGNA 5J1EB 2OAUA 3JAMU 1P9QC 4FW3A 2VG7A 1RT3B 2ZDPA 3KYLA 3D68A 3AOBA 2DISA 4NYPA 3A13A 3MOZA 4ANDA 4PU9A 2EFNA 4FKYA 5JEAD 2XYGB 4KY3A 4PXBA 1RYRA 4DR2F 1F2HA 2J9EA 3LAKA 5K8MA 4C9DA 2CNKB 3P3DA 3C16A 5LSLA 3OHBA 2VQEI 1UDOA 4H4OA 3MPVA 2A10A 3MD3A 2R8HA 4B3TI 4ZITA 1M1KT 2HAFA 3MM9A 1J5OA 2C39B 4CZCA 5HP1A 3C3LA 1WEYA 4OX9J 1UVIA 4HI1A 3K5LA 3ADAC 3W61A 1M5HA 1DARA 2JVOA 1PAEX 2FB0A 4N47A 2B8PA 1NK9A 5K36E 5HAOA 3J80U 4C8LA 2AEMA 2VFRA 1RAAB 4P7TA 1SQFA 3G8SA 2NN6D 4IO9Q 3KUHA 3CD6S 2YPYA 1QUPA 3QT7A 2AX0A 3TAMB 3EUNA 4ZCLA 3KJNB 4EI2A 2MKIA 4Y2AA 4M8LA 3GFZA 4DR4F 5G0RA 2M70A 3Q22A 2KDOA 3CWJA 2WVEA 4JI5F 1ZS6A 3ELHA 3GG0A 1NCLA 3D1HA 3SFGA 3VHQA 5BYSA 1NZAA 3MR3A 3HXMA 4FW6A 4ISAA 5ELWA 1VQKS 4DV2I 4QNKA 5RUBA 3AQPA 1YVFA 2PNLA 1AXQA 5L1JA 4P7VA 1G2EA 3LNUA 3WC0A 3QGGA 2NN6C 3CCMS 4ETXA 2HG4A 4OJHA 4Q7AA 4ZVTB 7AT1B 3F73A 4Y6IA 1T03A 1KC8T 1X5PA 4I68A 3U1NA 4JP8A 2VESA 1YJVA 2BXJA 2VPZB 2XYHB 3BREA 5KT6A 4X64F 4DUZJ 2MHEA 4QIVA 4USHA 2VBZA 4DBQA 2W8KA 3L7ZB 2BJ3A 2E5LJ 1S79A 5BR8I 3J7AM 1PILA 1RBAA 2EC2A 1Q0NA 4BA1A 2CVIA 4G1PA 1VS3A 4KHRA 2IPOB 4I2QA 2YNGA 4GKJJ 4ZPWR 4MIWA 1NAQA 3UWTA 2X7IA 1YITS 1B62A 4J9NA 2B9YA 2H1YA 2I5JB 2VUGA 4HACA 2B43A 3W2WA 4ED5A 2QYCA 3F41A 4KE5A 3M1VA 4NLQA 2GVZB 3K5MA 3KFWX 5AE2A 5C25A 1S9EA 4LR7A 4UZBA 3OJSA 5AXKA 5F8NA 1Y00A 5KG7A 1VC0A 1YI2S 3HSDA 1N54B 1ZAVA 3HHLB 5KFHA 5J1PA 4QWEA 1WEZA 2BE2B 4P71A 2IYGA 3AT1B 1FE4A 3IG1A 5B0EA 3U1LA 3ZFVA 5F9LA 1U02A 3LF0A 4JI6F 1VBYA 3B4TA 4X64I 3V5RA 4RUAA 4WZQA 2EEYA 1HBUB 4ZVOB 1LV5A 1RB0A 3VAMA 4I6AA 4UOHA 1X9WA 1U2RA 1YX2A 2GV1A 3F0NA 2OFGX 1NK5A 3TYTA 3FCVA 1VRUA 3RBEA 2A6OA 2RF2A 3KHHA 4H4KA 4YB1P 3J80Q 1CBKA 4F4XA 5D15A 3CJ8A 1JLAB 2JZ5A 2CQHA 1XIQA 3M32A 3CCUS 5LMUF 1ZPVA 4B9MA 2HBYB 2XMMA 3HVRA 5DRRA 2R8KA 3B54A 4DR4I 1HI8A 2P5VA 4MDTA 4HY1A 2ZUGA 3R9LA 2VFUA 3DOKA 2DD8S 3G96A 1MU5A 3ILOA 3SDEB 4RR5A 3LP1B 4KQZA 3DLKB 4CYUA 4NXME 1UWBB 4ES2A 2AYMA 1EETA 4NLRA 3CDAA 4XO0A 2W7AA 2MLXA 3MZIA 2NN6B 1TAQA 1PC4A 5EUHA 1C1BB 4X66I 2F8MA 4L3NA 2CFXA 2OPSA 3QRRA 2HHQA 2UXDF 1RWPB 3W2WB 4PG6A 5I42B 3M8YA 2I5JA 3HD1A 4EZ6A 3HJFA 2NXUA 3EGVA 2HS4A 4C97A 4Q8FA 3NCPA 4U3DA 1NRKA 5FLXQ 3IC1A 1S48A 3I6PA 4ECUA 4J9VA 4JI7F 5HMYA 2R8JA 1WG1A 4ZP7A 3MWBA 2AD9A 2BVZA 2UP1A 2BKNA 2ACYA 4TLQA 4QW8A 1I3OB 2K06A 2XMWA 3HULA 4CWBA 2E9TA 2AE8A 1XMQI 1GK8A 1WC3A 3D3BJ 2ZOGA 2P6TA 1VMBA 3CD5A 5KFWA 3RR8A 3OTDA 2MKKA 1U0SA 2DR6A 1Q82T 4MQYA 1O6XA 1R0BG 1TKZB 3BBCA 4OHXA 1LFWA 3D1QA 4NCGB 4OJ1A 3SDEA 3WBZA 1D8YA 4LR9A 3CWVA 3WZ0A 2FZKB 1Z5BA 1GAOA 4JI7E 1KP6A 3PCOB 4WUBA 4TY8B 4FVCA 2W4DA 3BQ1A 3M30B 5K9FA 2U2FA 5KFVA 1S49A 5L1LA 4GC7A 2RIJA 3P49B 1ZAXA 4B3RF 1TL7B 3GSIA 4ZP9A 3H4LA 1JK9B 1T94A 3QT8A 5FIIA 3PACA 1DLOA 1TL4A 1Y3JA 2VA3A 4FN5A 3EGZA 5LMUJ 3W9HA 1VQYA 1HA1A 4FS1A 4UTGA 4OHVA 4KH1B 4ANCA 1IBMF 2ZZMA 1T02A 3KDNA 1W2IA 3DRSB 2UUAE 3H98A 4JI7I 2ZJPQ 2OI2A 2LCWA 4PPDA 3GLLA 2QMUB 3NS7B 4IRCA 4LPFA 2VJVA 1XNRF 1F1BB 1H2TZ 1TUGB 3IG1B 5MAOA 2LMIA 4I2PA 3TEGA 1O51A 2FYXA 4B9TA 4Y00A 4BA2B 2GQ2A 4USWA 1R7IA 5J2PB 5SZTA 1U1KA 4CTAA 4PAAA 2OSRA 5K5MA 2EG2A 2A6MA 4ED3A 4ITSA 2BDPA 2C2KB 5H9EK 2HQDA 5HVFA 4ZPDA 3W5YA 5J1NA 1N0VC 2EK1A 1S99A 2F9DA 3OR2A 1JQGA 4JI4F 2C38B 3KRNA 4DV3I 4AXJA 1WDDA 4J9QA 4BWMA 1IKXB 1S4FA 2FZCB 2H4YB 3MM8A 4A46A 4BS2A 4CQ1A 4QYZJ 2E7VA 2YNGB 1IBLE 3K58A 2BKPA 1CEZA 1D9DA 2V8PA 3SQGA 3JYTA 2ZJQQ 2QYGA 1B70B 3LGMA 3MM7A 1HD1A 5DZ6A 4K59A 3SZ2A 5DRPA 2XMKA 2B7CB 3NCRA 4O4GA 1DZ5A 2P2CB 4PQUB 3VAIA 1Z0CA 4L6V3 2CGEA 5L46A 2I1RA 2DTJA 4DQRA 3GLJA 5J2NA 3THVA 2LQ8A 3VGVA 4FF4A 2JFDA 1UTAA 3OXFA 2JC1A 1MWZA 1WI8A 3MMAB 2V50A 3RW7A 3W7BA 4C11B 1YH8A 3A8KA 3MUTP 3NZKA 1Y5NB 2YKAA 3TO8A 3Q8YA 1JJ4A 2NS1B 1NHKL 1J5EE 3DRPA 2FGCA 1BWVA 4OZ2A 5DS7A 4BC7A 1Z0GA 4D3GA 2CKWA 2N7CA 5A2QU 4YR3A 3G9CA 2QA1A 4AXIA 2DCLA 1PYOB 3BGUA 8ATCB 3GJQB 4Y0FA 3OR1A 4A8QA 2RSQA 2YQ0A 3R6GB 4ID5B 2IYIA 3LPYA 5D4OA 4E98A 2Q43A 4LJMA 1HWIA 2B51A 4ZMMA 2R8IA 4DV6F 4G65A 4F4AA 2IY5B 4LT6A 1PBUA 3PYEA 1OY9A 1ZA1B 2XWYA 3DOMB 1RAEB 3KG0A 3D6MB 2AP6A 3SCKE 3CD7A 1OPZA 3W2VA 2ROGA 3OSNA 2YNHB 2VOOA 1ZXMA 1IBMI 2EFOA 1XMOJ 5FDLA 4USIA 3SSQA 3ZZ0A 1HR0J 4DSJA 2UVRA 1RT4A 1RWWB 3PW2A 1B0VA 3CO9A 2DR7A 2GW8A 2PE8A 5HLFB 4MKYA 2AJ4A 3IS9B 4X4SA 4ECYA 4KHPF 2BR2A 4OZJA 5F8GA 1YWXA 3R2DJ 4U9RA 1OPIA 2OEKA 2BRKA 1P9YA 2AIRB 2R9LA 2ZBIA 4HHHA 3SCLE 3UVJB 1FDDA 3MHYA 2YY3A 3A3OB 3OTOI 2OPQB 3SBMA 1F9FA 1LXJA 1M5SA 2JOQA 4JI3E 1RU1A 1IBME 2O5DA 2Z8QA 4QIEA 3H4DA 1IVZA 5F0UA 1T9YA 3VCDA 2LQBA 3SCJE 1RYSA 4AL6A 1REVB 2N7YA 1LWEA 2DK2A 4JI1F 3C19A 1A6LA 1PC5A 2J65A 3G4SS 2CPDA 5CYMA 2HFSA 3KK2A 4WZMA 2PNMA 4DL0C 4ED1A 4O3RA 2DBBA 2KKHA 4NLSA 2ZNZA 3DCAA 1FRMA 1UA1A 2PO2B 1Q8KA 4A8MP 3NAHA 4DI6A 1URRA 1HNWI 5LOQA 3CULA 3UDLA 4U6PA 4N3OA 1RHJB 3AXKA 2FJEB 5BR8F 1RREA 5CAAA 2BJ1A 1ROFA 3GCXP 3CIZA 1RT2A 1K0VA 1N32E 2WNRA 4UUWA 5A2QC 1TK8A 1WEXA 3Q6NA 4FW9A 5EWFA 5BYQA 2V8HA 4KPYA 4LF8E 2VG6A 4B9VA 3GIJA 1C4CA 1SUQA 2K7JA 1UETA 5E3RA 1RTIB 3OTOF 2V4QA 1HNXF 1HNZF 2VA2A 3O1LA 1ZH5A 2QL5B 4UOFA 1S6PA 4ZOSA 4KHMA 3CT9A 1Q86T 2GIQA 4C8ZA 1K44A 1N36I 3BO4A 3T1YF 3FFIA 4WUCA 1WHWA 4YMEA 3MAHA 4DR1I 2ZHOA 1BY9A 1AZSA 2V8DA 1Y11A 2LXIA 2HFUA 4ZK7M 3MFIA 4N76A 4G1QA 1YSJA 3KK3B 1Y4ZB 4DCOB 1ZM3A 4C0HA 3A1YG 3LP2B 3N01A 3AD7C 3UPFA 4RJVA 2V4RA 1UWAA 4IQMA 2AQ4A 4JYAF 2DEJA 3KNGA 3ISND 3RZAA 4DEZA 3T19A 3TJ8A 1IN0A 2WBMA 2WVFA 4N41A 5E7OB 2B9EA 4FW7A 1UAWA 4GMKA 4P2FA 4GVBA 3CVKA 4BA1B 5M2PA 1UKUA 2WW4A 2XMTA 4J7CA 4JI0J 1FKAF 3K8WA 2IRUA 1FHTA 3ENQA 3BPSP 2WBRA 4GKKJ 4JYAE 4CH1A 3V4IA 3A3PB 5KFXA 2QT7A 4Q43A 1IKYB 2AT1B 5B08A 2G1HA 1ZPWX 3T6BA 3CCES 4J9MA 3VTIA 3HVAA 2FLLA 4MU4A 2JSXA 1RZMA 3FGVA 3A8EA 4IRKA 3CDIA 5GMEA 1MWYA 3KJQB 1X4FA 2CXEA 1FCAA 3K89A 4LF5F 4NZ6A 4QQBA 4EU0A 2HHHI 4ELUA 1FD8A 3IAS9 5KFOA 4FPRA 5DQGA 2W01A 2IJFA 4K0KJ 3VV2B 3U27A 3Q8QB 3K1JA 4TU9A 1DTTB 2YBVA 2J6TA 3NP5A 4ZIVA 2JEBB 1CSJA 2D3UA 2N3OA 5D4LA 1S9FA 2J7WA 2OPPA 1HNWJ 3M2RB 2HRYA 4ZDNA 3P8BB 2DO0A 3OVSA 3OPKA 2LQ9A 3I55S 3QBCA 4AUKA 2P9CA 4YB5A 2VKZG 4DS4A 5JEAA 2MPUA 1R0CB 4MYTA 1TUWA 4DX5A 2KVQE 2XQCA 4YOEA 2HHHE 2DGVA 3PKMA 1WKLA 2ZC3A 2KVIA 5IT0A 3VAJA 3Q6MA 3TR5A 1S12A 5KAKA 2KTQA 5HO4A 5F8IA 1EIYB 4K4TA 3NY0A 3I0SA 1I1GA 1NKCA 4XTJA 5D0RA 4WFBQ 2E5LI 4CI0B 3A8JA 5KT2A 3CJQA 1SV5B 3MEGB 4NLWA 3ITHA 2HPUA 2K1RB 4R8UA 4QU7A 4OI3A 1S1WA 1XC9A 4R0JA 1NNDA 2HVDA 4IYQA 3UR0A 1S6OA 1HYSB 1F2GA 5JXSA 4FYVB 3GYGA 4WIQA 3W62A 5BR8E 2BA9A 3H4BA 4ZPBA 3DYAB 3MM6B 1RT3A 3OTOE 2B56A 3CJTA 3M2UB 4WXOA 4NASA 4CO2A 3KNAA 2BOAA 1EI1A 2DH7A 3HSJA 4MIBA 3HT3A 4NLGA 2EG1A 1UP1A 2PIIA 1FNOA 1CG2A 3PJWA 4KSEB 5U47A 2C2ZB 2PMHA 4NI2B 4O44B 5DRKA 3PY8A 4LSNB 3QNWB 2W9BA 1HD0A 2K3KA 4JI2I 2HHUA 2O3DA 1ZM4A 2RDJA 2VQFJ 4DV1I 4JV0A 3WU4A 3HZEA 4S0MA 3MM5A 5D0EA 4DPWA 4JI3F 2KFNA 4IFDF 2JHEA 1H3DA 2DNHA 2ZWOA 2WB1D 1RHMB 3SI8A 1F6TA 5IV4A 4F4YA 2Y0SD 4LCHA 4NXMI 1IR1A 3OFFA 1GMUA 1B0PA 2B8QA 2GX8A 3D1OA 5B0GA 2PC6A 4NI2A 2B0GA 5I3PA 2XS5A 3PW7A 1X4GA 2AGQA 3FBEA 4B9NA 1C0TA 4DV5F 2F7VA 4BBYA 3R1HA 2ATLA 4TY8A 2BACA 4X4VA 2HMIB 5AJ3J 3GIIA 4ZIWA 4LF9E 3FVYA 3M2UA 4URQU 4QWBA 4LFBE 3RYLA 1IXKA 2C2MB 2YPZA 3C6UA 4LUBA 3CCZA 3EVWA 2LXFA 4EBEA 2J0XA 2X1AA 2G9OA 3PTWA 2DR8A 4V1Ak 4M94A 3K85A 4RU2A 3MUMP 2E5LE 2NXNA 1QE1A 4J9SA 3CC2S 2GVZA 4KGZB 1Q1KA 3M7ND 4GVBB 5C0XE 2J9DE 2VD3A 4LF7J 4GKJE 3HKWA 4MAKA 1JNRB 4MKBA 3PX4A 3GG1A 3UHMA 3MEKA 3J81U 1MN9A 3EE3A 1WUUA 2E1RA 3L9ZA 4K5RA 5DO2A 2WSFC 4NYZA 4DPXA 2W9CA 4FS2A 3S01A 5I42A 1U1LA 2IMWP 4I6WA 3ENVA 2ACMA 3GCWP 1WI6A 1MG7A 2DJWA 3U1KA 3QFWA 4MKAA 3KK3A 4OYMA 4RNHA 2VQFI 2R3VA 1HQUB 1S1TB 2CJYB 3ZO7A 4QU6A 2ZD1A 3OHAA 3ZNUA 3T5HA 3Q1QA 5CYQB 4DUYI 4I7FB 3IRXA 5G4DA 4KTQA 1BD6A 1CULA 4LCFA 4DR6I 3K59A 1BMQB 2E5HA 1ULRA 1FTRA 3H8YA 1N5TA 4OHWA 2AYBA 2EK6A 1EQMA 2VG6B 4U7CA 4LFBJ 4JI4I 1FRHA 4NLYA 2ZH8A 3N79A 3R1LA 3NS6A 3WU3A 2BE7D 1RHYA 2RT3A 1JXVA 3HHLC 3Q2SC 5G0RB 3J80Y 1FXRA 2CQ2A 4CLUA 3BQ2A 3QMQA 3AHPA 4NCBA 2YTCA 1UEKA 4PYDA 3R5JB 3PX0A 5A8RB 1GH8A 4DV1F 4X4OA 2I6WA 3O44A 1ACMB 1IKVA 2JEIA 3BSOA 5KOXA 2UUBJ 4P2MA 1X5TA 3QSYB 3ISNC 2IJNA 5HBMA 2IERA 5GAGI 2J9DA 3LW5C 1BE4A 3MEEB 2WVDA 4ERDA 1WC4A
chains in the Genus database with same CATH topology
2XEXA 4PU9A 2R42A 1N34I 2BM1A 4JI5I 1XNRE 2IOQA 2VQEI 2V34A 2V2ZA 4B3TI 4Z7YA 4P52A 4KQVA 1DARA 2Z5BA 4X66E 2GS8A 3ZZUA 3ZKDA 4DR5E 1N36E 1IBKI 4LFAE 3LPSA 3QT7A 4B3ME 5FLXC 1N34E 4FWHA 4RPFA 3Q1QA 4DV2I 4DR7E 2PNLA 3LNUA 5LMUE 4IZJD 4AQYE 4B3MI 5LMNI 4DV4I 3B8HA 4HACB 1KTVA 3PYGA 2V2VA 4X65I 5BR8I 3J7AM 2IOPA 4HXZA 4DR7I 4JI3I 1H74A 5IT9C 4LF4E 1B62A 2X7IA 4DPUA 4HACA 5LMNE 1N33E 2O1WA 2UUCI 4NXNI 2O1UA 1H7UA 3J80C 4DR4E 1USUA 1Y6ZA 4DR1E 2BV3A 4FWDA 3WU6A 4DR2I 2X36A 4DV5E 4X64I 3V5RA 1N0UA 1HK7A 1XMQE 4WUDA 4JG4A 2UUCE 1U2RA 4AQYI 1VISA 3F0NA 2F4VE 4DV4E 4JI0I 4DV0E 3J80Q 3B82A 4YHHE 4DR4I 4HY1A 2UXDE 4X62E 4LF6I 3PYFA 1MU5A 3J81C 4OX9I 5IT9Q 2A2DA 1FI4A 3GONA 4X66I 4LF8I 2Z5EA 4JI6I 3Q6MA 3HJCA 1Z0BA 4M1KA 5FLXQ 4DV2E 1Z5AA 4DR6E 4OX9E 1ZXNA 2UXCE 3HULA 1HNXI 4IZJB 1XMQI 1HNZI 2UU9E 1ELOA 4DR2E 4FWGA 1H73A 5A2QQ 4DV5I 1NHHA 3T1HE 1IBKE 4DV3E 4JI8E 4DV6I 4JI7E 3CWVA 1Z5BA 1FJGI 4WUBA 3ZM7A 4GKJI 5L3JA 3QT5A 3H4LA 3QT8A 2F4VI 1PIEA 4FN5A 3K17A 4UTGA 2CZ9A 2UUAE 4JI7I 2OI2A 4K0KI 3QT6A 4DUZE 4NXNE 4DPYA 4B3TE 2GQ0A 4DR3E 4LF4I 1NZ0A 4PRXA 1N0VC 1H72C 4DV3I 3V2UC 1HR0I 1IBLE 4JI0E 4IZJA 4GKKE 2V8PA 1A6FA 2ZM6E 4P7AA 1Z0VA 4DUYE 1S16A 1Z0CA 2CGEA 1BKNA 4UT4A 5GMDA 1Z5CA 4LFCE 4JI1E 1KKHA 1N32I 1J5EE 4K0KE 1Z0GA 4DXLA 4B3SE 2HKJA 1HNWE 1FKAE 1PKPA 1Y4UA 3PYEA 4JI1I 1Z0EA 1Z0WA 1EA6A 2O1VA 1ZXMA 1IBMI 4LF9I 4DV6E 3ZZ0A 4B3SI 5LL6R 2AJ4A 2Z5BB 1XNRI 3D4JA 3OTOI 5LMUI 4LF7I 4JI3E 1QZRA 1IBME 4DU7A 4B3RI 2HFSA 2PNMA 1FNMA 1RR9A 2VQFE 1HNWI 4N3OA 2Z5CA 2UXDI 1RREA 4IZKB 1N32E 4YY3I 5A2QC 3Q6NA 4FW9A 4JI4E 2CG9A 4LF8E 1IBLI 2J7KA 1N36I 4DUZI 4WUCA 2ZM6I 4MYUA 4DR1I 4DV1E 2HFUA 2VF3A 2HKEA 1ZM3A 2UUBI 4LF7E 4LF5E 2DEJA 4LFAI 4JV5E 4URLA 1FJGE 2WW4A 2UXBI 1OJ4A 4JYAE 3ZZTA 1Z59A 4X65E 4LFBE 5GMEA 4NXME 1MX0A 1NHIA 4JV5I 2HHHI 1PVGA 3K1JA 1ZM2A 3P06A 2ZITA 3B78A 4JI8I 5IWAE 2HK3A 2UUBE 4JI5E 1HNXE 1HNZE 3LTOA 2UU9I 4MYTA 2HHHE 1XNQE 3T1YE 4LFBI 1XMOE 2E5LI 4XTJA 1HR0E 1USVA 4LF5I 2Z5CB 3PRYA 4B3RE 1H7SA 1Z0TA 4DV0I 5FWKA 5BR8E 1Y4SA 4ZVIA 3WU5A 3T1YI 3OTOE 1EI1A 4DR3I 1KIJA 3PYDA 4HYMA 4KHPE 2BM0A 4JYAI 4JI2I 1D6TA 3JAMC 1ZM4A 4DV1I 3WU4A 4DPWA 3J81Q 3JAMQ 4NXMI 2VQEE 4KHPI 4X64E 2A2CA 1FWLA 3J7AG 1I94I 4USKA 4LF9E 4PRVA 2UXBE 1J5EI 3T1HI 2O1TA 4JI2E 3K85A 2NPFA 2E5LE 1KVKA 1ZM9A 2Q2EB 4YHHI 2UXCI 4GKJE 4X62I 4LF6E 1S4EA 1WUUA 2E1RA 4DPXA 4R1FA 1NHJA 2HK2A 1MG7A 4DV7E 1XHKA 4JI6E 5IWAI 1B63A 2VQFI 2R3VA 4USMA 4I3HA 4ED4A 4DPTA 4DUYI 4DR6I 1XNQI 4DR5I 1N33I 2ZBKB 2EFGA 4JI4I 3WU3A 2UUAI 4EMDA 3ZKBA 4DV7I 4LFCI 1XMOI 1I94E 4IZKA 2V2QA 1UEKA 2LJPA 4Z7CA 2DEIA 3M6AA 4GKKI 1FWKA 4DU8A 1K47A 4YY3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEX A;  4PU9 A;  2R42 A;  1N34 I;  2BM1 A;  4JI5 I;  1XNR E;  2VQE I;  2V34 A;  2V2Z A;  4B3T I;  4Z7Y A;  4P52 A;  4KQV A;  1DAR A;  4X66 E;  2GS8 A;  3ZZU A;  3ZKD A;  4DR5 E;  1N36 E;  1IBK I;  4LFA E;  3LPS A;  3QT7 A;  4B3M E;  5FLX C;  1N34 E;  4FWH A;  4RPF A;  3Q1Q A;  4DV2 I;  4DR7 E;  3LNU A;  5LMU E;  4AQY E;  4B3M I;  5LMN I;  4DV4 I;  3B8H A;  4HAC B;  1KTV A;  3PYG A;  2V2V A;  4X65 I;  5BR8 I;  3J7A M;  4HXZ A;  4DR7 I;  4JI3 I;  1H74 A;  5IT9 C;  4LF4 E;  1B62 A;  2X7I A;  4DPU A;  4HAC A;  5LMN E;  1N33 E;  2UUC I;  4NXN I;  1H7U A;  3J80 C;  4DR4 E;  4DR1 E;  2BV3 A;  4FWD A;  3WU6 A;  4DR2 I;  2X36 A;  4DV5 E;  4X64 I;  3V5R A;  1N0U A;  1XMQ E;  4WUD A;  4JG4 A;  2UUC E;  1U2R A;  4AQY I;  1VIS A;  3F0N A;  2F4V E;  4DV4 E;  4JI0 I;  4DV0 E;  3J80 Q;  3B82 A;  4YHH E;  4DR4 I;  4HY1 A;  2UXD E;  4X62 E;  4LF6 I;  3PYF A;  1MU5 A;  3J81 C;  4OX9 I;  5IT9 Q;  2A2D A;  1FI4 A;  3GON A;  4X66 I;  4LF8 I;  4JI6 I;  1Z0B A;  4M1K A;  5FLX Q;  4DV2 E;  1Z5A A;  4DR6 E;  4OX9 E;  1ZXN A;  2UXC E;  3HUL A;  1HNX I;  1XMQ I;  1HNZ I;  2UU9 E;  1ELO A;  4DR2 E;  4FWG A;  1H73 A;  5A2Q Q;  4DV5 I;  1NHH A;  3T1H E;  1IBK E;  4DV3 E;  4JI8 E;  4DV6 I;  4JI7 E;  3CWV A;  1Z5B A;  1FJG I;  4WUB A;  3ZM7 A;  4GKJ I;  5L3J A;  3QT5 A;  3H4L A;  3QT8 A;  2F4V I;  1PIE A;  4FN5 A;  3K17 A;  4UTG A;  2CZ9 A;  2UUA E;  4JI7 I;  2OI2 A;  4K0K I;  3QT6 A;  4DUZ E;  4NXN E;  4DPY A;  4B3T E;  4DR3 E;  4LF4 I;  1NZ0 A;  4PRX A;  1N0V C;  1H72 C;  4DV3 I;  3V2U C;  1HR0 I;  1IBL E;  4JI0 E;  4GKK E;  2V8P A;  1A6F A;  2ZM6 E;  4P7A A;  1Z0V A;  4DUY E;  1S16 A;  1Z0C A;  1BKN A;  4UT4 A;  5GMD A;  1Z5C A;  4LFC E;  4JI1 E;  1KKH A;  1N32 I;  1J5E E;  4K0K E;  1Z0G A;  4DXL A;  4B3S E;  2HKJ A;  1HNW E;  1FKA E;  1PKP A;  3PYE A;  4JI1 I;  1Z0E A;  1Z0W A;  1EA6 A;  1ZXM A;  1IBM I;  4LF9 I;  4DV6 E;  3ZZ0 A;  4B3S I;  5LL6 R;  2AJ4 A;  1XNR I;  3D4J A;  3OTO I;  5LMU I;  4LF7 I;  4JI3 E;  1QZR A;  1IBM E;  4DU7 A;  4B3R I;  2HFS A;  1FNM A;  1RR9 A;  2VQF E;  1HNW I;  2UXD I;  1RRE A;  1N32 E;  4YY3 I;  5A2Q C;  4FW9 A;  4JI4 E;  4LF8 E;  1IBL I;  2J7K A;  1N36 I;  4DUZ I;  4WUC A;  2ZM6 I;  4MYU A;  4DR1 I;  4DV1 E;  2HFU A;  2VF3 A;  2HKE A;  1ZM3 A;  2UUB I;  4LF7 E;  4LF5 E;  2DEJ A;  4LFA I;  4JV5 E;  4URL A;  1FJG E;  2WW4 A;  2UXB I;  1OJ4 A;  4JYA E;  3ZZT A;  1Z59 A;  4X65 E;  4LFB E;  5GME A;  4NXM E;  1MX0 A;  1NHI A;  4JV5 I;  2HHH I;  1PVG A;  3K1J A;  1ZM2 A;  2ZIT A;  3B78 A;  4JI8 I;  5IWA E;  2HK3 A;  2UUB E;  4JI5 E;  1HNX E;  1HNZ E;  3LTO A;  2UU9 I;  4MYT A;  2HHH E;  1XNQ E;  3T1Y E;  4LFB I;  1XMO E;  2E5L I;  4XTJ A;  1HR0 E;  4LF5 I;  4B3R E;  1H7S A;  1Z0T A;  4DV0 I;  5BR8 E;  4ZVI A;  3WU5 A;  3T1Y I;  3OTO E;  1EI1 A;  4DR3 I;  1KIJ A;  3PYD A;  4HYM A;  4KHP E;  2BM0 A;  4JYA I;  4JI2 I;  1D6T A;  3JAM C;  1ZM4 A;  4DV1 I;  3WU4 A;  4DPW A;  3J81 Q;  3JAM Q;  4NXM I;  2VQE E;  4KHP I;  4X64 E;  2A2C A;  1FWL A;  3J7A G;  1I94 I;  4USK A;  4LF9 E;  4PRV A;  2UXB E;  1J5E I;  3T1H I;  4JI2 E;  2NPF A;  2E5L E;  1KVK A;  1ZM9 A;  2Q2E B;  4YHH I;  2UXC I;  4GKJ E;  4X62 I;  4LF6 E;  1S4E A;  1WUU A;  2E1R A;  4DPX A;  4R1F A;  1NHJ A;  2HK2 A;  1MG7 A;  4DV7 E;  1XHK A;  4JI6 E;  5IWA I;  1B63 A;  2VQF I;  2R3V A;  4USM A;  4I3H A;  4ED4 A;  4DPT A;  4DUY I;  4DR6 I;  1XNQ I;  4DR5 I;  1N33 I;  2ZBK B;  2EFG A;  4JI4 I;  3WU3 A;  2UUA I;  4EMD A;  3ZKB A;  4DV7 I;  4LFC I;  1XMO I;  1I94 E;  2V2Q A;  1UEK A;  2LJP A;  4Z7C A;  2DEI A;  3M6A A;  4GKK I;  1FWK A;  4DU8 A;  1K47 A;  4YY3 E; 
#chains in the Genus database with same CATH topology
 3M9M B;  1CQN A;  4ZVG A;  1WNE A;  2QLJ B;  2XEX A;  3FK4 A;  4KGM A;  3EZO A;  2NYH A;  3GFX A;  1ZZF A;  1FK9 A;  2MY8 A;  3D9B A;  2UUA F;  2PO1 B;  2CYY A;  3P5B P;  2J8S A;  4DFJ A;  2CPJ A;  4IR9 A;  2BM1 A;  4CLW A;  3MR2 A;  2MQM A;  5J2M A;  1FFG B;  5KG2 A;  2ZHB A;  2V68 A;  1VI7 A;  1XNR E;  2NQP A;  2V34 A;  3DOL B;  2P8I A;  1UW4 A;  2XWX A;  4C3L A;  3FRY A;  5KFQ A;  4ZLL A;  4OLP A;  4P52 A;  3P4U B;  1Q95 G;  2LU2 A;  1VC5 A;  1RJJ A;  5EGY A;  2YH1 A;  1O5J A;  4A48 A;  4ECZ A;  2MLZ A;  2Z2Y B;  3IN5 A;  3HKM A;  1FRL A;  2KO1 A;  4HEA 9;  5CCM A;  3MI7 X;  2OUG A;  2Z2L A;  1VYA A;  3M8P A;  5C2G A;  2RQC A;  1URN A;  4X66 E;  3LO3 A;  2J6S A;  1UVL A;  1E6Y A;  3PKY A;  3W2V B;  5F9N A;  2XI2 A;  5EWG A;  3V6D B;  2IAJ A;  2LU1 A;  4GO5 X;  4KYZ A;  3LPS A;  4FPI A;  4F4Z A;  4B3M E;  3QO9 A;  4LBH A;  4EO8 A;  2NN6 F;  4FYX B;  1U24 A;  5FLX C;  4E2F B;  1N34 E;  1TKT A;  2GCF A;  2JVR A;  4F3Q A;  5B0A A;  3W1Y C;  1RHR B;  3TA0 A;  1TAU A;  2UZA A;  3TUJ C;  1WKJ A;  2VQE J;  1NH7 A;  2IVF B;  3MCS A;  3ZTP A;  1LW0 B;  4DV0 F;  1QSS A;  1GEH A;  1T3O A;  3E3X A;  4X64 J;  3VZH A;  3EVM A;  4FP9 A;  2ZEJ A;  3PW5 A;  4IFD B;  5LMU E;  2C3U A;  2RHQ B;  2BAN A;  4OMF G;  5E33 A;  4RZR A;  3RR7 A;  1XMO E;  1MMN A;  3JSM B;  1QVG R;  3HD2 A;  1DQA A;  1FES A;  2FUG 9;  2Z58 B;  1T3N A;  4FZV A;  2UUA J;  1PSD A;  1NM2 A;  3LA0 A;  3NOC A;  1PKU A;  3A3N B;  3B8H A;  2BYC A;  4Y2K A;  2F65 A;  2DY1 A;  1M1G A;  4M63 A;  4XTT A;  2LA6 A;  2LDI A;  3IBW A;  4K4Y A;  1E3P A;  3CJ4 A;  3TA2 A;  2V2V A;  4X65 I;  2Y0B B;  1RT1 A;  3BYP A;  3HVT A;  2HS3 A;  5A8W A;  2IHR 1;  4XPE A;  4KGX B;  2AF6 A;  5K8P A;  1YTY A;  2F1F A;  1E3H A;  4AFF A;  1HNI A;  2CZV C;  4TNO A;  5EX3 A;  2UUT A;  5MLC V;  1IR0 A;  1OYR A;  3IP0 A;  1SQG A;  3OVA A;  3CDJ A;  5IT9 C;  1FVS A;  1F5A A;  1RBO B;  2VFT A;  1CJK B;  3HF5 A;  5IQQ A;  4DPU A;  4F3M A;  1OY8 A;  1Q7Y T;  4IH6 A;  1IM4 A;  4BDP A;  1KR4 A;  2HBQ B;  4NLX A;  3VAF A;  4MFB A;  1VQ5 S;  2GHW A;  3T9Z A;  4DR6 F;  3R6L B;  4ALZ A;  3Q8V A;  2VOD A;  1PCA A;  3CJS A;  4CTA B;  5CD4 H;  4JV1 A;  5DLF A;  4RX6 A;  4TXS A;  1VQ4 S;  2FHK A;  3CMQ A;  4IOC Q;  3DOK B;  3BF4 A;  3L95 X;  4RW6 B;  5HBM B;  3GIM A;  3J80 C;  1RTI A;  3QZ7 A;  5K36 C;  3RB0 A;  2Z4P A;  1N36 E;  3Q83 A;  2MKY A;  2HHW A;  3MFH A;  3MAA B;  3DFE A;  3NBP B;  4HL9 A;  1VK3 A;  1JLA A;  4DV5 E;  3MMJ A;  4AM3 A;  1LW2 A;  2AJ2 A;  2MEW A;  1W25 A;  2K7K A;  4H4M B;  4LFB F;  4NLT A;  1XMQ E;  3TAR A;  3L7P A;  2QGF B;  2ZKU A;  4AQY I;  1VIS A;  2C28 A;  2FC9 A;  2PSZ A;  1HNI B;  3DHW C;  3EM1 A;  3HKZ D;  4WPA A;  1L3T A;  4FYW B;  4K4X A;  5A0Y A;  3TZW A;  4J9R A;  3CB4 A;  1VBZ A;  1J5E J;  1RTD A;  4DV4 E;  4LVN P;  3L09 A;  3MAA A;  4X4U A;  3EVO A;  1WC0 A;  4I64 A;  1I94 J;  1HWU A;  1NHU A;  2ZVI A;  4C7Q A;  1G6B A;  2IC3 A;  2W2P P;  3GYX B;  3KG1 A;  3OW2 R;  2HAI A;  1RTJ B;  1S97 A;  1S9G B;  4FXW A;  4QR1 A;  4X4R A;  4WFN Q;  1ITP A;  3GCM A;  1S5Z A;  2VB6 A;  3SMZ A;  3ZZZ A;  1QDU B;  4DFK A;  4LF6 I;  1GMV A;  4WK3 A;  2XO7 A;  2CPE A;  5DG9 A;  2B4V A;  2VV5 A;  3L3C A;  1HYS A;  1RT5 A;  5DM7 Q;  4QIW D;  5KFG A;  5K8O A;  1HR0 E;  2ZFH A;  1F9E B;  4DQQ A;  4IFD A;  3GON A;  3BYR A;  3W5Z A;  4QWD A;  4JV2 A;  4LF8 I;  4CT9 A;  4MH8 A;  2Z5E A;  4J9O A;  4JI6 I;  2XSF A;  2BAB A;  4U96 A;  4O3S A;  3OT9 A;  4M1K A;  1Z0B A;  4IFV B;  2MGZ B;  3UD4 P;  3UO0 A;  2BKO A;  1N6Q A;  3IAM 9;  3MPY A;  3UW1 A;  2E9Z A;  2BQR A;  1Y60 A;  1R8C A;  3AOD A;  2CPX A;  4J9P A;  1MU2 B;  3CNQ P;  2MY7 A;  4P75 A;  2HYI B;  1MMD A;  2XZW A;  5HJX A;  3MXH P;  2E29 A;  1JLG A;  4JI3 J;  1ZXN A;  3VVT A;  3R5C A;  1KHW A;  2AJ0 A;  4IZJ B;  1HNX I;  1HNZ I;  4BCA A;  1NK8 A;  4M5H A;  3TVK A;  1QSL A;  4OV1 A;  1J27 A;  3D66 A;  1TL3 A;  3H5S A;  4DR5 J;  1NHH A;  4RW4 A;  4C0O C;  4DV5 I;  1N36 J;  3T1H E;  2R2U A;  1WEL A;  4DFM A;  4YP3 A;  1M5P C;  2HGM A;  4DV3 E;  4IDK B;  3P96 A;  4AIM A;  4DV6 I;  1SJ3 P;  4RBV A;  2FVR A;  2BE9 B;  4CLF A;  1QD1 A;  3T3F A;  1FKO B;  1N5V A;  2WON B;  2B5J B;  1S7I A;  5DQH A;  3G8T A;  2HHX A;  1YDL A;  3BN7 A;  1WHX A;  3RB4 A;  1N5Y B;  3A8I A;  1Q79 A;  4K2X A;  3QLH A;  4YB6 A;  4WFA Q;  4L76 A;  2FJW A;  2OTJ S;  3PS3 A;  1C1C A;  2RF2 B;  2Y1L B;  2N3L A;  3VWS A;  1RLC L;  1VRU B;  4XIU A;  3IM9 A;  1YJN S;  1XQI A;  4WYL A;  4Y65 A;  3SSS A;  4DN0 A;  5A76 A;  3RBD A;  4A8F A;  3UDC A;  1VRT A;  2F4V I;  3DLE A;  3DU5 A;  4ZJO A;  3M8S A;  4OO1 F;  1LOU A;  2KI2 A;  3BKF A;  1YQH A;  1GXT A;  3JYT B;  3D3C J;  2ZNY A;  1R89 A;  2XZD B;  1IKV B;  4LRA A;  3K5N A;  2W9C B;  3R7S B;  1VQ8 S;  2MQQ A;  1AUD A;  1RI7 A;  3A4T A;  3CCT A;  5F3Z A;  5KFM A;  3KMS A;  2R2R A;  4DPY A;  3V6H A;  5J2Q A;  5FD1 A;  4F0M A;  3QZ8 A;  4RL1 A;  1TKX B;  2DNM A;  5THW A;  2R2S A;  1FFS B;  2DHH A;  4H4M A;  1M5V C;  4TLR A;  1GTE A;  2FHJ A;  4EYH B;  4DF4 A;  1S0V A;  3NAI A;  3EPG A;  2K1R A;  4HT5 A;  4R8U B;  4FF1 A;  4OZ1 A;  2HUR A;  3C6U B;  1CQM A;  1GX5 A;  3J7Y U;  1Q81 T;  2KL8 A;  2R7U A;  1NZ0 A;  4PRX A;  4HTI A;  2FJX A;  1DAX A;  3CD0 A;  5C42 A;  2F4F A;  1SKR A;  3V2U C;  2GML A;  1HR0 I;  3TZY A;  1F5C A;  2YX1 A;  3PJX A;  4IOB A;  2N4C A;  3HSZ A;  2YWF A;  2HNZ A;  3O8W A;  3NWR A;  4ZVU B;  2YX7 A;  4JI0 E;  3VZI A;  4IZJ A;  4WWS A;  3DC2 A;  4GKK E;  5D3G A;  2QLW A;  4DR4 J;  1BQM B;  4NWB A;  1RTD B;  4DUY E;  4IFY B;  4Q2M A;  3EPI A;  4ECR A;  2RML A;  2XY7 A;  2NUU G;  3DD6 A;  1N6Q B;  2DGU A;  2B4P A;  3ENA A;  1JLQ B;  4PWU A;  4DN9 A;  2GO9 A;  2FHM A;  2AGP A;  2C3P A;  3BJY A;  2C37 B;  2HQC A;  3TJA A;  5D4N A;  1XMQ F;  3JTO A;  4W4M A;  3KLE B;  4JI1 E;  1U2F A;  3THP A;  4CNY A;  1S0M A;  1N32 I;  1A9N B;  5K36 F;  2CPY A;  1T9T A;  2B9X A;  3MMC B;  3QAT A;  5DG7 A;  3KOA A;  4K0K E;  2FLN A;  4UUX A;  2XY5 A;  1RA7 A;  3IRX B;  3D7S B;  3HP6 A;  2O1U A;  1LWC B;  1UJ6 A;  2YNH A;  4Q0B B;  3P3G A;  3OUY A;  1RT7 B;  4KRW A;  3Q23 A;  1HNW E;  1LWX A;  3BH7 B;  1KOO A;  1OO0 B;  2LDY A;  3QGH A;  4RBT A;  1GX6 A;  1PKP A;  4FDF A;  3AA9 A;  2H5E A;  3W63 A;  2UVV A;  3CSK A;  4KFB A;  3CPW R;  2XMV A;  5DGA A;  1U0H B;  3K7R A;  1KEK A;  4G1I A;  3T5L A;  4X4P A;  2J7U A;  1OQ6 A;  4OO1 C;  4G6V B;  3UCZ P;  4HVZ A;  4M5M A;  4PG4 A;  5K36 B;  2DNZ A;  1CS4 B;  3JQK A;  4ZVH A;  3KLV A;  3QRP A;  2UXD I;  1ZAW A;  2UUW A;  4LBP A;  4IO1 A;  5D78 A;  1VQS A;  5T41 A;  3G6Y A;  1K8A T;  3QRQ A;  3WIV A;  3M8W A;  2PI5 A;  2Z5B B;  3LWL A;  4PUO B;  3C14 A;  1VQN S;  1XNR I;  1YLX A;  2RB7 A;  3T9N A;  1E6Y B;  2RDI A;  4K2J A;  5HI7 A;  3D28 A;  1NSP A;  2FGO A;  2FY8 A;  3V4M A;  5BR8 J;  4DV2 J;  1RAF B;  4NRU A;  2CQ0 A;  1JLF B;  1YZ6 A;  3L7U A;  5FLX Y;  3OTO J;  2WB4 A;  3OTB A;  1FNX H;  4BHQ A;  1NPR A;  3OL8 A;  1IBL F;  1L3K A;  2V69 A;  3O6Q A;  4USV A;  4UZC A;  1KFS A;  1WOO A;  3NXZ A;  3SV4 A;  1SPB P;  1TL1 B;  2BJ8 A;  3DOL A;  3H0P A;  2R7S A;  4O4R A;  4NZ7 A;  1CVJ A;  1IBK J;  3RRH A;  2ZH1 A;  3M32 B;  1M90 T;  2YWG A;  4FBU A;  4JI8 J;  4PUO A;  2CQ3 A;  1YBT A;  5IC6 B;  5LXR A;  3POT B;  2HW3 A;  2C37 A;  5C0X C;  4NLO A;  1RR9 A;  2JC0 A;  3BSC A;  3CO0 P;  4C11 A;  2VQF E;  1N34 F;  1SH2 A;  2WVB A;  1KDN A;  4O3N A;  1SV5 A;  4QWC A;  4RW9 A;  2R7R A;  3FBB A;  3NGR A;  1VQ9 S;  4C48 A;  5D3G B;  1BHN A;  3ETM A;  1EJ7 L;  4CP5 A;  1Q53 A;  2HGN A;  4IZK B;  5LJ5 Y;  3HMJ G;  2IMO A;  4HTJ A;  4JI2 F;  2XO6 A;  1SCJ B;  5C24 B;  1NSK L;  4YY3 I;  1S6Q A;  2DGO A;  3H20 A;  2YKN B;  3ULH A;  2XS7 A;  1IJE B;  3CJ2 A;  1NPP A;  5AXN A;  2BA0 G;  1DTQ B;  2E66 A;  2ZH6 A;  4LF9 J;  2CG9 A;  5C0X F;  4K4Z A;  3ZTQ A;  2DIU A;  3HHL A;  3R5B A;  4FBT A;  2G0I A;  2ERR A;  2FHJ D;  1APS A;  1IBL I;  3M8R A;  3JQJ A;  4ED8 A;  3DGV A;  2JEF A;  4RW8 A;  3HLU A;  3BDP A;  1FRJ A;  2ZUA A;  1TMJ A;  3RRG A;  1XNQ F;  2ZM6 I;  2WP8 B;  4DS5 A;  4RNO A;  2VF3 A;  4FVM A;  1FDN A;  2HKE A;  3H5U A;  4L72 B;  2COL A;  3TRG A;  2VPY B;  4U95 A;  4QYR A;  2EXU A;  4C2M A;  1HR0 F;  4DR3 J;  1U49 A;  5F8L A;  3QGI A;  3KLE A;  3DI6 B;  3M30 A;  5HLF A;  2J0S D;  1TKT B;  4ECS A;  4IG0 A;  4LF7 E;  3H59 A;  1XK8 A;  3H90 A;  2HQG A;  3MD1 A;  4L74 A;  2DNY A;  4CLT A;  5CYQ A;  2DPJ A;  3HSG A;  1C4A A;  4RUB A;  1YK9 A;  2QN6 B;  4TYB A;  4AD6 A;  4EWT A;  4OX9 I;  2CQP A;  4FNH A;  2C3Y A;  1SI9 A;  3I0R B;  4LFA I;  1XWL A;  1RCX B;  3M2V B;  3SSR A;  3KMQ A;  1B99 A;  2H5J B;  2NZC A;  2PI4 A;  4MU1 A;  4NXM F;  3DRS A;  3I87 A;  3M8P B;  5LSO A;  2UXB I;  3ETO A;  4H4K C;  4EZ9 A;  1UDS A;  3E8O A;  2M5Y A;  3KLH A;  1OJ4 A;  1DY3 A;  2Z2Z A;  4F3O A;  2GAG C;  3C66 A;  3DLH A;  3NMR A;  3CJK A;  4RNN A;  3KLG B;  1U1P A;  3LWM A;  1VR6 A;  3ZXW A;  4DR1 F;  1T8E A;  4OZ5 A;  4DPO A;  4ICL B;  5A8K B;  2VDH A;  3UI3 A;  2W7O A;  2R7O A;  3BB5 A;  1P6T A;  1UJ5 A;  2QO3 A;  3CJ0 A;  4B08 A;  5KTQ A;  3GYN A;  2EKN A;  2BW2 A;  1ZA2 B;  2F63 A;  3NGS A;  3ZZO A;  4CIO A;  4NLV A;  1UA0 A;  5T7L B;  1ZYQ A;  2BA0 D;  5KT7 A;  5DRO A;  5K36 D;  4X66 F;  5ETM A;  3MPD A;  4BWJ A;  4IH5 A;  3F56 A;  2YNI A;  3PEJ A;  2XNR A;  1PVG A;  3BBB A;  3FBC A;  5BJR A;  1JJC B;  1OQ3 A;  1UWB A;  3B78 A;  1EX8 A;  2MLY A;  3H2V E;  3MEE A;  3R7N B;  5C7P A;  4KAI A;  4DL3 A;  4HKQ A;  2BA1 G;  2EVZ A;  3E01 B;  1EKS A;  1M0S A;  4ED0 A;  1KS2 A;  2HMI A;  1R27 B;  2CJB A;  2UUB E;  4WU3 A;  3UNY A;  4DLE A;  4JI5 E;  2UU9 I;  1REG X;  1RWU A;  4P9S A;  2V8G A;  3MUV P;  3MR7 A;  1AB8 A;  4N8O A;  2ABY A;  1XNQ E;  2AEJ A;  4ZS6 A;  2EFQ A;  2GIR A;  2VQF F;  3DRY A;  1BQX A;  5HAN A;  1RT2 B;  3DNC A;  4C8O A;  2J6U A;  4B3O B;  2AW0 A;  4KBI A;  4NX9 A;  5KFT A;  4AL5 A;  2HRU A;  3PV8 A;  5JVG Q;  3H25 A;  4MK8 A;  1Z1Z A;  1GMW D;  1RA6 A;  3HHE A;  3MED B;  1KVJ A;  3BGF A;  5KG4 A;  3N6M A;  1PGZ A;  1H7S A;  3A