3PYDA

Crystal structure of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) from mycobacterium tuberculosis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
298
structure length
298
Chain Sequence
SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 84
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pydA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pydA01
3K1JA 3PYDA 5GMEA 3H4LA 2CZ9A 4I3HA 5IWAI 5GMDA 1PKPA 2BM1A 3V2UC 4DR1I 1B62A 4LF4I 2VF3A 4DV6E 2ZM6I 4OX9I 5LL6R 3K17A 1UEKA 1DARA 4DR2I 1N32E 5FLXQ 1PIEA 4DPWA 5A2QC 2E1RA 2VQFI 4DPUA 4DR4E 1Z5CA 1FWKA 3JAMQ 4GKJE 2X36A 4PU9A 1KTVA 3J81Q 3ZKDA 4DUYE 4UTGA 4USMA 4JYAE 4DR5I 4FW9A 4DV6I 4MYUA 4LFAE 4PRVA 1N32I 3ZM7A 1EI1A 4HYMA 5FLXC 4JI5E 4DUZI 1FKAE 4P7AA 1Z0TA 4DR4I 3WU6A 4HACA 4K0KE 2UXCI 1A6FA 4JI6I 4GKJI 2GS8A 3T1HI 3JAMC 1XMOE 1XNRE 1XHKA 3J81C 2UUBE 1KVKA 4JI4E 4UT4A 4DV3E 1I94I 1N36E 2HHHI 4LFAI 1HNZE 1NHIA 4DU8A 4MYTA 4KQVA 4JI5I 4FWGA 2UUCE 4DU7A 1ZXNA 5LMNI 4B3TI 3HULA 1IBME 1Z5AA 1RR9A 5L3JA 3J7AG 1HR0E 4Z7CA 2UXBE 4B3SE 2XEXA 2R42A 1HNWI 4X64I 5LMUE 4DR6I 3PYGA 4DXLA 4JI7I 2HFSA 2V2VA 4LF6E 1NHJA 4X65E 5IT9Q 3B78A 1IBLI 1B63A 3CWVA 3OTOE 3ZZTA 4LF5I 3B8HA 2OI2A 1ZM3A 1ELOA 4DV7I 2UUAE 3V5RA 4EMDA 4B3MI 1K47A 4LF7E 1NZ0A 2UU9E 3QT6A 4X62E 2VQEE 4LFCE 3ZZ0A 4DV2I 5IT9C 3T1YE 1ZM9A 1Z0EA 2J7KA 2NPFA 5BR8I 4JI1E 4DV1E 1H74A 4KHPE 1N33I 1ZM2A 2UU9I 4FWHA 2V2QA 1PVGA 4AQYE 4JI3E 4WUCA 1OJ4A 1D6TA 2AJ4A 1ZXMA 4JI1I 4NXME 4DPTA 3PYFA 4DV4E 2UXDE 1MU5A 1N0UA 3J80C 1Z0WA 3PYEA 4X66E 2E5LE 2F4VE 4DUYI 4JI3I 4JYAI 1H7UA 4DPXA 3WU4A 4B3RE 4NXMI 2X7IA 4DV0E 4K0KI 1Z5BA 4DV4I 1XMOI 4FN5A 1S4EA 4JI8E 1XNRI 1Z0CA 3F0NA 4X66I 2E5LI 2F4VI 1ZM4A 2UUBI 4JI4I 1Z0GA 4DV3I 1N36I 1HNZI 2LJPA 1WUUA 3B82A 4YHHE 1HNXE 4JV5E 1MG7A 2UUCI 4LFBE 4DV5E 2ZITA 3ZZUA 1U2RA 1N34E 4JI0E 1FJGE 4DR7E 1IBMI 2A2CA 1H73A 1IBKE 1FI4A 1J5EE 1HR0I 1XMQE 2HKEA 3WU5A 2BM0A 2UXBI 4B3SI 3GONA 2ZBKB 3LTOA 3QT7A 2HK3A 1HNXI 5LMUI 4WUBA 5IWAE 2EFGA 4DR1E 1S16A 4LF6I 4DPYA 4LF4E 4OX9E 4X65I 4JI0I 4DR2E 3OTOI 2V8PA 4WUDA 2DEIA 1J5EI 3M6AA 4HXZA 2UUAI 3WU3A 4LF7I 1Z0BA 1XNQE 3QT8A 3J80Q 4X62I 4DR5E 2VQEI 4LFCI 4PRXA 3T1YI 4JI2E 4YY3E 1FNMA 4DUZE 1NHHA 1EA6A 4DV1I 2UXCE 4KHPI 4JI6E 1FWLA 1H7SA 3T1HE 1Z59A 1RREA 1XNQI 2A2DA 1I94E 3LNUA 2HHHE 3J7AM 4AQYI 4Z7YA 4JI2I 4URLA 4YY3I 3QT5A 4R1FA 2WW4A 1Z0VA 3Q1QA 5LMNE 4B3TE 3D4JA 4LF9E 2HKJA 2UXDI 1KKHA 2R3VA 2HK2A 4P52A 1VISA 1N0VC 3ZKBA 4DR3E 4RPFA 1HNWE 4X64E 2DEJA 4LF8E 1MX0A 4DR6E 4B3RI 4JI7E 4JG4A 2V34A 3LPSA 2Q2EB 4USKA 1IBLE 4LF9I 4DV0I 4LF5E 1QZRA 2BV3A 4HY1A 4GKKE 4DV7E 4JI8I 4NXNE 4HACB 4B3ME 2V2ZA 4FWDA 4DR3I 4LF8I 1H72C 4YHHI 2HFUA 4JV5I 4LFBI 4DV2E 4DV5I 4M1KA 2ZM6E 1BKNA 1N34I 1FJGI 4ED4A 4DR7I 1KIJA 4XTJA 4ZVIA 4GKKI 5BR8E 5A2QQ 1IBKI 4NXNI 2VQFE 1XMQI 1N33E
chains in the Genus database with same CATH superfamily
4KYZA 3PYDA 1X4BA 2HQIA 4O3RA 3VZIA 5KFYA 2IA6A 3UHMA 1E6VA 2R2UA 4X4UA 2V4QA 1ZS6A 2C38B 4ERDA 4JI8J 3FCVA 3OVAA 4PU9A 4ZP6A 4JOUA 1HNXJ 5KFBA 2PI5A 4JYAE 1WORA 3CJ5A 4LFAE 3TYTA 1AYEA 2Z5CB 4ETXA 3TUIC 2MZTA 4NLQA 1TVRA 1S6UA 4WTOB 4JI6I 2OIHA 4I2PB 2UUAJ 3GV8B 2V8DA 5F0UA 1RWUA 3OHAA 3TW0A 2D7SA 3D28A 4A8YA 1CBKA 4GQUA 4MYTA 2CQGA 2FVSA 2U1AA 3N5BA 3NGSA 1S6OA 4KQVA 3G96A 1BWVA 3ENWA 1SJ4P 9RUBA 2QX0A 4IFDF 3PEHA 3C66A 3ETOA 2HIQA 3SFUA 4AM3A 4ZVQB 2RB7A 1XNRF 1NHJA 1S1WB 3MFHA 5JMNA 1IBLI 2CQ4A 1HWJA 4DV3F 3U7JA 3I0SB 4R0EA 4RWWA 5LSRA 2C39A 5B09A 1TL3A 3MECB 3LP0A 2ZZTA 4P75A 4I69A 4LF7E 3QT6A 5EKWA 3M85D 1RAEB 2XLIA 1OY8A 4DV2I 2U2FA 4X4OA 3J7YI 2E7WA 3JAMY 3EGWB 4D3HA 2FJAB 4RUCA 3N79A 4P2SA 2PO1B 4FWHA 4DV2F 4RUBA 2NZ4A 2YWHA 2D9OA 2FD2A 1ZETA 2BVZA 3S1TA 3BO4A 4WF9Q 1JXVA 1D6TA 3PDNA 1ZXMA 2HBZB 1USUA 2DRAA 2FHMA 1TZ0A 3UDLA 1QM9A 4Q2MA 2DR7A 4WKRA 3PYEA 1X5TA 4OZLA 1MROB 3AD9C 3ENVA 1KDNA 4FNHA 4QNJA 2JOQA 3DXBA 4R5PB 4MKVA 3VR1A 4ZK7M 4CO1A 3GG1A 3TNVA 1RZMA 2G13A 2GVZB 3DOMA 3PZPA 4FBTA 4X66I 2IBKA 1VQNS 4J9RA 1TUWA 1KLMA 1N36I 2DGOA 3I56S 1RT2A 5IT9Y 5EWFA 4ETZA 3CJ2A 4LSZB 2D69A 1I6JA 1NPPA 2FHJA 1SKSA 2W8LA 1RUSA 3M1VB 3UVJB 4X66F 3K5MA 3QNWB 1FI4A 3G4SS 2VBXA 2VPZB 4OHZA 5DJBA 3QT7A 1HNXI 3DLJA 4PWWA 1S59A 4CQ1A 5U47A 4JI8F 5EWGA 5LSOA 3OLBA 2AU0A 4B02A 3HMJG 2Q1LA 4I0WA 2DNYA 3H20A 1HNXF 2UUAI 5GAHI 1HBNA 3HLUA 1S79A 4KBIA 2LVWA 2MLXA 4IH7A 3OR2A 5I42B 1SQEA 1ZOTA 3OL8A 3GE9A 5F8IA 4IQMA 5JVHQ 3ZFVA 4Y2AA 4K4ZA 5HBMA 4K8RA 1GMUA 2UUAF 4GVBB 2N82B 1NJIT 5H9EJ 1X4DA 3LANA 4JI6E 1H7SA 1T3NA 5ETKA 1K0TA 3EGVA 3D0HE 2WVBA 1TFWA 3M2VB 4O3NA 1X4HA 4L75A 1HPZA 4G65A 3R5JB 3OTOJ 3IR6B 4IFDB 4XK8C 1VOMA 1F5CA 2EG2A 2RU3A 3GTYX 4Y2CA 4DL7A 4Q8EA 5CYQB 2FTRA 1H2UX 3RYLA 1J5OA 1RTIB 1NLKL 3BGOP 3L7ZA 3O1LA 4LFCJ 2DY1A 2AZ1A 4CWBA 3A1YG 1IBLE 1TK0A 3PNIA 3G6YA 2BOAA 3MMJA 3VQTA 2VBWA 1LWEA 3OVBA 1N48A 3VVUA 3LGNA 4IOAQ 2HFUA 4LR8A 3BB5A 4DV2E 4NCGA 5K36A 2J7UA 1UPPA 1JJCB 3KWMA 4F36A 2CQ3A 3TZZA 1IBKI 5B0DA 4OYBA 1AROP 2IA0A 3H8YA 3SXLA 5I3QA 3PX0A 2DIUA 3MWBA 2C2ZB 5FLXY 5KOWA 4I3HA 1Y5NB 2UUCJ 4ES1A 3W65A 4FW5A 2MTLA 3EMTA 1RAHB 1PIEA 4KT0C 5B0CA 1FWKA 3W9IA 3MEDB 1F2HA 2OEJA 4FW9A 4LF6J 1UL3A 3CDUA 2YNGA 2ZVIA 4A8OA 4KKOA 1DTTB 5JVGQ 3OFEA 2XMMA 4HACA 1WI8A 3KMQA 4DQQA 3CEDA 1U24A 2KT5A 4Q7AA 3BDPA 3W1YC 1N36E 4DR1J 2I5JA 1PYOB 2CADA 5L39A 4EEYA 1T9UA 3G9CA 1C4CA 2EEYA 4EK2A 3FGVA 2W4CA 1TKTB 1EHWA 1S0MA 2KJVA 2NSCA 1G7CB 2ZHBA 2BKNA 4GO5X 3HSDA 4DUZJ 2AYBA 1LV5A 2XHCA 1VBKA 4DQSA 3B4DA 2ZZMA 5CHCB 1GMWD 5F8NA 4J90A 4ZIVA 1G4CA 4QYZJ 4CLWA 3L7UA 5AE2A 3SCKE 2UUAE 2RAQA 3S6EA 5KT3A 3KLFB 4N47A 1HQ2A 2KVQE 4DLGA 5L1LA 1RTZA 2MKYA 1S0VA 3R2CJ 2PNLA 4FF4A 1FVQA 1HIYA 3PTWA 4JUZA 3MAAB 1ZM9A 2J7KA 4ISAA 5DNLA 1ZAWA 4I2PA 2NPFA 3KHRA 3HM9A 5ETQA 2AW0A 3IR5B 2XNRA 1VQSA 3BSCA 3GYXB 2VFUA 1RTJA 4KPYA 3DNCA 3OTOF 4L73A 4IOBA 4OYIA 2YPZA 1M1HA 1S9GA 3VGUA 4NXNJ 1PAEX 4H4MB 2Q6CA 3IWNC 1N0UA 2E5GA 4LFCF 2NS1B 2BE9B 5KT4A 2GX8A 3A4TA 4BWJA 3IC1A 1S1XA 3PRBA 1KD1T 3R5GA 1HBOB 3GJSB 2ZBIA 4DX8H 1EIYB 2HHXA 4A8FA 2VPWB 1FJCA 5LSLA 2H5EA 4ZLLA 1KFSA 5A8RB 3TUZC 1R43A 4OX6A 2UUCI 4DLEA 2Q3PA 4CLYA 3HKZD 4DR4J 2PO1A 5B0GA 5DQHA 2IYGA 2XULA 1IBKE 4AUKA 5AT1B 2XC9A 4IRCA 4FP9A 1VRTA 4OHXA 3P3EA 5DRPA 2UUCF 1S0OA 3FK4A 2QIFA 3C6UB 4NYPA 4LF6I 4FVMA 3V4MA 3UDEA 2VODA 2C2NA 1U1NA 1YWXA 2LEPA 4N76A 2GHVC 5D3GB 4LF6F 7AT1B 3DLGB 1SBRA 3MUTP 3DRXA 2ILYA 3JQMA 3GILA 2ZE2B 2V5HG 4ZPCA 3CCMS 4ZPAA 4FF2A 3P3GA 2GVZA 5C0XF 2HFZA 5AJ3J 2WBMA 4DR1F 2FZGB 4ZLPA 4PG8A 1NK8A 4LBHA 3J7AM 1GXUA 4QWDA 4U8YA 3H98A 1R31A 4R1FA 3W7BA 3C6TA 4QWEA 2AJQA 1OWXA 1FX2A 2ATCB 2UXDI 2HK2A 3UNGC 4NBQA 2AYGA 2UU9J 3PO4A 3O8WA 2OKQA 5A6WA 4DR3E 4DUZF 4F04B 2NXJA 2XYPB 2H5IB 2HS4A 3SV3A 1N56A 4LF8E 1Q4RA 2OD4A 4ZVHA 2RHQB 3MI7X 5CD4H 1YI2S 3I0RB 1HLWA 4M5IA 2KZZA 3Q86A 5I42A 1REVB 3P3CA 1BY9A 1YTYA 1YKWA 3CCZA 3OJSA 1XN9A 2HVEA 4Q2LA 3HVWA 3NBPB 1NH7A 4CNZA 5KFKA 3L95X 5A2QQ 4NXNI 2J8SA 2G1HA 1WACA 1LK5A 2R2SA 2IESA 3OT9A 5C7PA 1HNZJ 1WI6A 3OSPA 2DXDA 2DPIA 2IRYA 3TVKA 4GO7X 1G2EA 4F4AA 4WIIA 1L3TA 4NXNF 5B08A 1HQUA 5CYQA 3C8YA 4BHQA 3J81Y 1MNEA 2E1RA 3AA9A 2CQPA 1VBYA 3M6WA 2LDIA 2AX0A 2YNFA 2EXUA 3BQ0A 4OJGA 4LFBJ 3KNAA 2FY1A 2G0JA 4F02A 2K06A 2AKWB 4CO4A 2CQ0A 4DR4I 2VPYB 1R6MA 4CH0S 2L3MA 1BGXT 1NKCA 4UT4A 5DNXA 1ZPWX 4X4VA 1KN6A 4MQYA 3KUHA 2AIRB 1RHKB 3UN3A 5JEAC 4DR4F 1NCLA 4FWGA 2UUCE 4BA2A 3EGZA 4DQIA 2HHUA 1OS5A 1Z5AA 3QPIA 1O8BA 5L1IA 1RBLA 2E7XA 1XNQJ 1RWVB 4OYOA 4EO8A 2B43A 1HL6A 3O44A 2AT1B 4ICLA 2KZMA 3IS9B 3FCHA 2XEXA 2XM3A 4LF6E 3M2RB 3EDRB 3DXSX 1TMMA 1U8WA 1JWWA 1UMJA 3H2LA 2JNJA 3MEDA 2E5IA 3V5RA 2HAFA 2A3JA 1K47A 4WFXA 1IWGA 2PSZA 1BLUA 3GSIA 2OPSB 4OI2A 1DTTA 5C0XB 1AFJA 3JTNA 2ZUGA 3Q8VA 2NYHA 4KE5A 5J2PA 1T11A 2HQCA 4PRFA 5HVFA 1QTNB 2F5GA 3NNHA 3HI9A 4ED3A 2UU9I 4KR0B 1SQFA 4JV2A 2Z2LA 2F63A 5KOXA 5GAGU 4U7CA 3HHKA 4A47A 1IJEB 3GJRB 1TKTA 2HHSA 3BPDA 1NPKA 1L3UA 2UU9F 1EETA 1VLYA 2UXDE 5EX3A 2QMUB 3T5JA 2F4VE 1R7IA 3CTRA 4OX9J 1T9WA 4CLFA 2FHKA 2FLOA 3I6PA 1NNDA 3KLFA 4MU3A 2V63A 2W2OP 4LRDA 3H5XA 2G2OA 4U95A 4UZBA 1HNZI 3M7ND 4WP9A 3MAAA 2MMYA 1OYEA 4X4NA 2G2YA 2ZITA 4ED2A 1U2RA 2DJWA 4IZKB 1HFEL 2UXCJ 2CA9A 1A7GE 4CYUB 2GAHC 1Q5VA 1Y0HA 1HNZF 4A8KA 4O0IA 3PRVA 2DT9A 2BMBA 5KFHA 3D6MB 3NMRA 2J0SD 3LPYA 3PIOQ 4BCAA 1TQLA 3EICA 1V3RA 2F1FA 4H4MA 4OZJA 4IH6A 2IM2A 2QA4S 4HKQA 3J80Y 1MLAA 3EYZA 3AQPA 2J0QD 3M6AA 4OO1C 4M5NA 4YHHF 5F8JA 3AOBA 2BRLA 1NXIA 4LFBF 2CUYA 3QGPA 2HQ3A 3QSIA 1HBOA 3CDJA 2BA1G 3T9NA 1RI7A 2AYMA 1IJFB 4YY3E 2XSJB 5HVGA 3T3FA 4M5MA 3TR5A 1S9EB 2B4UA 1NHHA 4ZPBA 1GAOA 3VAJA 2FGCA 2DGQA 4NRTA 1XNQI 1H98A 1L5UA 5A8RA 3E01B 3KK3B 3KUEA 4WPAA 4ANEA 3OTBA 5MAOA 4I2QA 2VL1A 4U9RA 4Q0BB 4C3MA 1XNQF 3MMBB 3PEJA 1JK9B 1KKHA 3ZNUA 1Q95G 4OQJA 2LDYA 2LFVA 1N5YB 2OFHX 3A3NB 2JWNA 1KQKA 3P06A 2DPJA 2LQBA 4ALZA 3CDAA 3KYLA 2C2MB 1TL1B 4ZOSA 4OYAA 2HBQB 1NJXA 3TVYA 2VV5A 1S77D 3AHPA 4TLQA 2IMWP 4AQYJ 4C8LA 2NN6F 5J1NA 3B4TA 1N52B 2H4YB 1YH8A 4AL7A 1QAIA 3H0PA 4NCBA 3J7A1 1S5ZA 4RW9B 2V69A 5BYRA 1PGZA 4FW7A 3RBXA 2H1YA 3V4IA 5IV4A 2RJZA 4OX9I 3BBBA 5ETSA 1UEKA 4PWDB 2VIHA 1KHWA 2HNZB 1GXLA 1CJVA 1TL4A 2GJFA 4RUHA 4CM2A 5CCMA 4OX9F 2VFVA 4DSIA 1QTMA 1C2PA 2OPQB 2K1RB 2DRBA 1U6FA 2ASLA 2XMUA 3W64A 5AXNA 3M4XA 1YVFA 3I0RA 3JSYA 2CWKA 4LCFA 4LF1A 1P9YA 3EZUA 4JI5E 4GC7A 4P7AA 2UXCI 3KKFA 2EC0A 5K14B 3JAMC 5D78A 1CQMA 5HMZA 5IWAJ 3NBPA 3EZ5A 3DU6A 1HNZE 2RDDA 2CPXA 3JSBA 2P9GA 5ETPA 5I3PA 3K8WA 1RHMB 1Y00A 8ATCB 3EZOA 5M2RA 5D4OA 4KH1B 1X9MA 4FKYA 1DLOB 3UNYA 2XS5A 1D9DA 3J7AG 1HD0A 5KFTA 1JXEA 1QAYA 3F73A 2CDQA 1F2GA 2WP8B 2DCLA 1TAUA 2K3KA 3R8YA 4NZ6A 1NSPA 4PPDA 3B78A 3ZO7A 3ZZTA 3X1LB 4LF5I 3B8HA 4EBEA 5L38A 4DV7I 2WBRA 2XG8A 1TP7A 2IIHA 1YJNS 3GFHA 3L4BC 4IZJB 1NZ0A 2ROEA 1RWNB 4Y28C 1JLAA 4MAKA 5JUMA 3DRSA 3LP2B 4USHA 4C8MA 5IT9C 4LOMA 3H5UA 4F8RA 4XPEA 2KRRA 1BUXA 2MKSA 4CLKA 3HO1A 3G87A 1QLNA 4JI7J 4AE5A 1OYRA 2O67A 1N34J 2RDIA 4PG7A 3CJ0A 4EWTA 4RW6B 3BN4A 4QR1A 4TU7A 4ZCLA 4DV4E 2CDRB 3UW1A 3IS9A 2NR0A 4FZVA 4X4PA 1QY7A 1F0XA 3DRPB 3M2RA 1LWCB 5KFNA 5CZXA 4YEAA 2C42A 2WHOA 5E41A 4OZ2A 4LCGA 1ZAXA 4RNOA 2MQQA 2FVPA 2LU2A 2NN6B 4WIQA 4AQYF 4GVLA 5DRKA 3N01A 3O2IA 2C3PA 2OPSA 3M32B 5F8GA 4F0KA 4OHVA 2GO8A 1URRA 2AQ4A 3UO0A 4PKDB 2HWIA 1GK8A 1KLNA 1H73A 2RRNA 1ZYQA 4WE1B 4ATNA 1U2FA 2L9WA 3DN9A 4UQTA 1NK7A 2HHHJ 3QLHB 2VG7A 2JE6A 2ZKTA 4X4SA 2JZ5A 2VD3A 3AT1B 4DPYA 4OX9E 2W4DA 5DRQA 1RA6A 4RJVA 1X5OA 3C16B 4ZP9A 2PI4A 4HXZA 3MPYA 1HI0P 2HBYB 4PR6A 1HNVA 5DG8A 4OLPA 2KKHA 4RW4A 4CO3A 1IBMJ 1T03B 1M5HA 2MSTA 3KK1B 4B17A 1IR2A 1U6ZA 4K4XA 2UXCE 3Q6MA 5IWAF 3PKMA 1B3TA 2JEGA 2Y1RI 3M2UB 1G1XA 4ECWA 5D0GA 1C0TB 4V1Ak 4M63A 2VG6B 3UE2A 1MMDA 3H7HB 3MCOA 4AIMA 1WOOA 5HO4A 4A8QA 2HQDA 4DFMA 1SC3B 3ULHA 2QLXA 2J5AA 2JVOA 3AXKA 1N33J 4FF3A 2R3VA 3EVWA 4EGLA 1WF1A 3VWSA 2HNYA 5IT0A 1IN0A 3D5MA 2BEFA 1UA0A 2CPEA 3R7SB 4IG0B 4JG4A 7FD1A 5IM0A 3QATA 1HQEA 5DQGA 3QJLA 1LW2B 1EAYC 3OFHA 4LF5E 3GP9A 3P6YC 4HDGA 1RWKB 3IAM9 3IN5A 2DNHA 3GFYA 1FX4A 4DV7E 1SQGA 2MSSA 4Y2MA 3BSAA 4UOHA 2XY6A 4FW6A 2DD8S 2WOMB 1S9EA 4QJVA 4PAAA 1XR7A 1CULA 5HVHA 1N34I 2EBEA 1NEEA 5IXUA 3M05A 4NLSA 3G82B 5F41A 1N6QB 3KK3A 2H3EB 3NNCA 4YDXA 2BRKA 2QG9B 4JI7F 2KG1A 4F3OA 4C0HA 2CZ9A 4G1PA 4B3RJ 2BM1A 1RT5B 1XC9A 1HBMB 4TYBA 1VDHA 3K5PA 3MMBA 4UOFA 1WF0A 4O3OA 4TY8B 4CI0B 5FLXQ 4ZMMA 1O5JA 3AB2B 2G0CA 4KQZA 4CH7A 5A2QU 1N5YA 4DPUA 2QLFB 2YNHB 3EX7B 5DM6Q 3Q24A 3HHLB 3ZKDA 2I9SA 5LMUJ 1H7WA 4Y2IA 2O1UA 2E66A 4UUXA 4CLTA 1WEXA 4HYMA 3NLCA 4J91A 1N5SA 1J5EJ 1JLGB 2J7WA 3F44A 4B3OB 3M8PA 1RAFB 1XHKA 1WC0A 2PMHA 5E3AA 1D0EA 3DLKB 3OPKA 2HHHI 2XLJA 4NOHA 5CZVA 3AODA 4HHJA 1DURA 4DU7A 2F3JA 2YKOA 3CE8A 2I2YA 4RW9A 3R2DJ 1H3DA 3HULA 4LUBA 4QIWD 1N5VA 2W25A 4U7UK 5I3UB 4ZS6A 5AXLA 1T8EA 4DR5J 4USTA 3MMAB 3CJ8A 3T9ZA 3O3LA 3HSZA 1I3OB 2J0XA 2ASYA 3PYGA 2N3OA 4DXLA 2HFSA 1JJ4A 1KEKA 1AXQA 3R7NB 5T7LB 2DHXA 1IQTA 3M7NG 1M0SA 1RAGB 2WSEC 2VZ9A 4O0NA 3CJQA 5KT7A 2OPQA 2K1RA 5EHHA 2RQ4A 4DL3A 1ZH5A 1IBMF 2H48B 2VH7A 5HSPA 3U27A 1VBXA 4LF9J 1FFGB 2J6UA 4M5GA 1SC4B 2M52A 2O1PA 2DH9A 3HFKA 1H74A 2B9EA 1N33I 2G0IA 5E3CA 2JH3A 4IQXA 6FD1A 3UR3C 2MDAA 2IM0A 3FZBA 4WUCA 5F8HA 1CS4B 3MR2A 4BWMA 1N33F 4OV6A 2R7SA 1D9AA 3NRBA 2MZSA 1MMNA 2WP8A 2QJ3A 5HQ8A 2HHTA 2X1GA 4EUVA 3FNNA 2CNKB 2POKA 2B0GA 2C3UA 1KONA 3QQCD 4HLBA 2RILA 2W7PA 5A8KB 4LT6A 1SB6A 3EXYA 5H9EK 2VHGA 1UEVA 4DMZA 1GMWA 2F7VA 3FC9A 2VQFJ 5RUBA 5B0AA 4S0MA 1Y4UA 4JI4I 1UWBA 1AUDA 3FFIA 1WOSA 2R7QA 3CD6S 2ZHAA 3LP2A 1WHXA 5CD4A 1XR5A 3AH6A 1BXNA 2HBRB 4ELTA 4ED1A 5IFMA 1KQGB 4ECYA 3QYYA 1N34E 4NLOA 4KIAA 2DGTA 4GKJJ 3HD2A 2CRLA 2RF2B 3I82A 2HZVA 1RT3A 2Z2YB 2JEIA 2MZQA 2BM0A 3I5BA 4B3RF 3D1HA 1S7IA 2HZCA 1I94J 2ZBKB 4N41A 1NSKL 5DGAA 2C3MA 1TTHB 4K4TA 3I31A 5K5MA 5LMUI 3DRYA 3KLEB 2N7YA 2Y1JA 4ILMA 1FD2A 2BACA 4DOZA 1Y6ZA 2JEAA 1J5EI 1NDKA 4DBQA 4PUOB 5J1PA 5LMUF 2M8HA 3DRPA 1LWCA 3EM1A 3M6XA 2CG4A 4DSLA 2JLGA 3DC2A 4X62I 4EU0A 2G9OA 4NEZA 2FJVA 4RNMA 4LVNP 4G1QB 4I6WA 1J5EF 5FDLB 2AEMA 1XMQF 1I5OB 3MEEB 3PFEA 4MK7A 2I0XA 4EBCA 2R8GA 1Q86T 2KXHA 4OZNA 4JB8B 4LPFA 2SXLA 1E3PA 1R8CA 3CVKA 2HHHE 3NNAA 1T3OA 3DFEA 2ROGA 3VGTA 2K2PA 4KV8A 2FIUA 2ZC4A 2OO4A 3D0IE 3LALA 1YITS 3SSSA 4WE1A 3UPFA 1AT1B 3D4JA 1NAQA 4OO1D 2IM1A 1ZPVA 1S72S 3I96A 4DR5F 3QLHA 1XIQA 3DRRB 2HEKA 2RRAA 3A8EA 1YZ7A 1S1UB 3PHTA 3M8ZA 3ZKBA 4RUAA 5HMWA 2O3DA 3OL9A 2FVCA 1FK9A 2V34A 3AJ2A 2W7AA 4B9NA 3C16A 1FF2A 4LF9I 4DV0I 1RWXB 4L76A 2R7UA 1U1RA 1DTQA 3OTEA 3SQGB 2YNIA 2JC0A 2Z30B 5D0EA 2ZVSA 5L46A 1AZSB 1H72C 1FXLA 3LO3A 4LF9F 1FDDA 3VAKA 2BJ1A 2CNNB 3KK1A 3AD8C 4MKAA 3CCWA 2F8EX 3M9OB 2DH8A 4HI2A 3M2UA 1S6QA 4TQRA 1C0TA 1N33E 1BQMB 3K1JA 2VG6A 3Q2TC 4ED8A 4I1TA 3H4LA 4QIFA 1YGYA 1HD1A 2E1PA 4LF4I 2C37B 4ZPTR 3N28A 4QYZK 2NUHA 2CJBA 1Q0NA 1D09B 1IUJA 3J7ZT 2VQFI 1IKWB 2Z58B 3G8QA 2F1DA 3VAGA 3J81Q 4IG0A 1U0HB 2E29A 2M88A 2XI2A 4USMA 2HWTA 1WKKA 4USUA 2DKOB 1UVNA 4H4KC 1RADB 3ZM7A 2VQFF 2DNKA 2ZH8A 3ZTSA 3T5KA 5FJ4A 3ITHB 2BR0A 1FRMA 5DM7Q 1TKXB 3CC7S 5KG1A 4DFKA 4GKJI 2HVDA 2GS8A 2DB1A 2XI3A 1RHYA 5KFJA 3LUYA 1JLBB 2W2NP 2WOMA 4JI4E 4TU8A 1I94I 3RBZA 5AXMA 4C8OA 3JS9A 5DQIA 4PQUB 5HJYA 1XTZA 4CM0A 2I1RA 3R9LA 4DL6A 2M7SA 3N6LA 1HHSA 5K8OA 2QLJB 3G82A 4GKJF 4U67Q 2PNZA 2L41A 2E9RX 1UZDA 1YBUA 3JSRA 2PNMA 2VPXB 5KFQA 4HTIA 1VC0A 1I94F 3FDSA 4K5SA 4IUFA 4F4ZA 2R4FA 1WC6A 3P96A 1RT5A 5KG6A 1MWYA 4F7VA 1HBMA 2XHWA 3CCES 4TY8A 5LMUE 2L08A 4OI1A 3MR3A 1B63A 4A46A 1D1UA 2YNHA 3RBEA 2YTCA 3H5SA 4C48A 3GPAA 3HHLA 3NWGA 1B0PA 3IM9A 2WB1D 3FKBA 5ETOA 3BH6B 2AHOB 4X62E 4OX8A 2XMWA 3GMEA 1JLGA 1HYSB 1FD8A 4YOEA 2VG5B 3DLKA 1GT8A 4ZN1A 1D3WA 2J76E 1RAOA 4HYKA 2DIVA 3PACA 4JI3E 5C5JA 2I6WA 2XWXA 4ZVUB 3CUNA 2PA8D 2LMIA 4RW8A 3MMAA 4J7CA 3J80C 5DETA 4DX5A 3IAS9 5SUHA 4CLLA 4CDIA 2UP1A 3N5FA 1YJ7A 3M8RA 4DPXA 5T7LA 4P9SA 4KB7A 4MU0A 3W9JA 2ZDPA 2JRSA 3DGPA 4DV0E 3E2EA 1FKOB 3CJRA 4WTYA 3HVAA 3HZGA 2RUSA 4QR2A 1VIOA 2Z0GA 3R5CA 2V94A 2LJPA 4TVAB 2FPHX 1P9QC 1UDSA 1NKEA 1T9VA 3CDIA 1S48A 5C42A 1X4FA 3GIJA 4ZJLA 2NLWA 2ZH5A 1U1PA 1FRHA 4MJKA 3V6DB 3MPWA 2QL9B 3ZTPA 3TO8A 1WWHA 4LFAJ 2PT0A 1CS4A 3NGKA 3T5LA 3BH7B 4WUBA 5FIIA 3UFCX 5LJ5Y 2HYIB 5D6GA 2OTJS 4LF4E 4QOTA 3CCLS 4B3TJ 3CCTA 1AW0A 5BYSA 3GZ7A 3P4UB 1GNKA 1RQ0A 4IYQA 3NXZA 2C2RA 1NK5A 1K8AT 3J80Q 4IR1A 3GV7B 1KVIA 2KHCA 1U1OA 3MM8B 3NCRA 3W62A 1RK8A 2XMJA 4DG1A 1VQKS 1WHWA 3TEHB 1EA6A 5JEAF 1XMBA 3NMAA 3FJ2A 4MU1A 2E1AA 3BPSP 1X5SA 1TL3B 3CO0P 4QWBA 2DNZA 3LP0B 1U49A 1I94E 2XY5A 3OXFA 2O5DA 3QJJA 2R8IA 2IERA 1QSYA 2RF2A 1FRKA 5BR8J 4E8UA 3W9HA 2GO4A 5KG0A 3QGHA 4LF7J 3J7YU 1RJJA 5K36F 3RRHA 3B54A 3KLEA 1Y3KA 1U45A 1RGVA 1RISA 2Q2EB 3H1CA 4PUOA 3MM5A 5IC6B 1GMVA 4GKKE 2JX2A 4QU6A 2GQCA 5BYQA 3K7RA 2LYVA 2LQ8A 4G1QA 4V19X 1ROFA 3RR8A 3MEEA 3GJQB 2B8QA 4DJBA 3BQ1A 4QU7A 4M1KA 2IPOB 2ZM6E 4F4WA 1KIJA 2P5VA 4K0KJ 2FY8A 2XO7A 4WFBQ 2GCFA 2J65A 2JHEA 3MM6B 2WONB 3RW7A 4AIDA 1B4SA 3U1YA 3AY0A 4DL2A 2DGWA 1A0OB 1U1LA 3I55S 1V9OA 1SC1B 1RT2B 3IBWA 1F60B 4UQGA 5LL6R 1YJVA 3BDEA 4N8OA 2RQCA 1MU2B 3DRRA 4KY3A 4DCOB 1S1UA 3POTA 2HLUA 3KNGA 1M5KC 3VF0B 3NCPA 3IWLA 3DGVA 2YH1A 1RWWB 1QSSA 3CC4S 3ICLA 5K9FA 1SJRA 3CD0A 3KLGA 2MKIA 5FLXU 3SQGA 2XMKA 1Z0TA 2XMTA 1UJ6A 3KUGA 4M95A 4ID5B 4RNNA 3H40A 4L72B 5GMKa 1HWKA 1HBNB 2Q43A 1BHNA 2DGXA 3RB3A 4LFAI 1N88A 3OR2B 2H4WB 5GAHU 2ZHOA 4ILLA 2YKNA 3VAHA 4NA3A 2MGZB 1P1LA 5HAOA 3V6HA 1SCJB 3BYPA 2GGPB 2AGOA 1OSCA 4RWXA 2FJWA 4B3TI 4JYAF 4RLEA 1ICEB 3HKMA 4LFAF 3D9BA 2PEHA 1YRUA 2A6MA 2F4FA 1HNWI 3MTJA 4YFUA 1MN7A 4B3TF 1SPBP 4IG3A 2EPIA 1HPZB 4WZMA 2CVIA 2VJVA 1IKWA 3OL7A 3QJPA 2KO1A 3QFWA 2DTJA 3SZ2A 1ELOA 5IQ6A 3GJTB 2HHVA 1DQAA 4DSFA 3EXCX 5JEAE 2OGUA 3IG1A 3ITHA 1P42A 5JEAB 1NH8A 1TKXA 4M5HA 5G0RA 2JEJA 2RE1A 3MXHP 2Z8QA 5BR8I 2LKZA 1JLBA 4K7QA 2K7JA 4ECTA 2Y0BB 4B9VA 4PQUA 3RG6A 4DCPB 1ZBTA 1FDBA 1LWEB 2MQLA 2ZH9A 4JV5J 2CKWA 1RHUB 2FC9A 2AJ0A 3UCGA 4NXME 4LF7F 3OXGA 4NCGB 5K36B 3ILOA 1P8GA 2ZH7A 3G8TA 3VAFA 4Q45A 1UFWA 2XB2D 2E5LE 1MWZA 2C22A 5H1SV 3KG0A 3GU0A 1U2CA 4F67A 3OFGA 3TX8A 2DGVA 3PX6A 1JLCB 4QIVA 3VTIA 4K0KI 1Z5BA 3VAMA 1H38A 1X5PA 1ZM4A 2LQ5A 4NLXA 4KGZB 1HYSA 4P73A 4I6YA 1ZZNA 3SSQA 1Y5YA 2ZFHA 3C46A 4IKAA 2BA0D 3H2UB 4N5SA 2VG5A 1CLFA 4C6AA 3T1HJ 3DLEB 3GQCA 1TKZA 3W66A 3ZXWA 1XQIA 5THWA 1U47A 1KP6A 2XBPA 4M5KA 2I5JB 2WW8A 4NLYA 3ENQA 4KAIA 1EQMA 2KN4A 4M5DB 3U1MA 2DEIA 2DNPA 4RNFA 4OYPA 4C2MA 2FHJD 1P27B 3PRYA 1S0NA 3D67A 3UR0A 2V4JB 1N36J 2OEMA 3THPA 2XGQA 1B70B 1Z0BA 2Y8YA 4DN0A 4XDCA 2E9TA 1SXLA 4JI2E 4EBDA 1SJ1A 2YH0A 1FKOA 2DXFA 1P6TA 3MPDA 3KHLA 3H90A 4Y0FA 3KJQB 5DG7A 1OYSA 4LCHA 1DJ0A 2AJFE 2MXYA 2W01A 2EKNA 4UZCA 4A48A 4OO1E 5AE3A 4YR2A 3V6DA 4QYRA 4B3TE 4DL5A 1ITPA 5EUHA 3MAQA 2HKJA 4OO1B 3IBFB 2R7RA 4O3SA 4NLTA 2V9KA 1RTJB 3GCXP 1B0VA 1HNWE 3Q8QB 1GQEA 3ZZRA 1RB0A 4JI6F 4ZIWA 1K9MT 3JXOA 1O0PA 4OZEA 2MY7A 2CPDA 4YUDA 2YWKA 5I4MA 1Y9OA 2CQDA 5C2CA 1S9GB 2R7OA 2Z57B 5DDOC 2EBGA 4F2SA 2V2ZA 1JNRB 3PW5A 3MM8A 3RRKA 3TRGA 4URQU 4K2JA 2W2MP 5EDWA 1S49A 2M3DA 1R6LA 4JV5I 3IRWP 1S1XB 2YPYA 4J5OA 4CRJA 4YP3A 5BR8E 1CG2A 2O1WA 4DPOA 4BDPA 2H9ZA 1R3NA 4JV5F 3EPGA 1IBLF 2PGCA 4NYOA 2ZZNA 1KVJA 5A76A 4DV6E 3QRQA 3TP2A 1WF2A 4CO5A 3DDKA 1VJWA 2DRDA 1Z5CA 3M9NB 2YKAA 1IQZA 4PYDA 1PJ6A 4DI6A 2QFJA 1VRTB 1ZZFA 1KQFB 4ZCMA 3QSYB 1VJQA 4IO1A 4Z2XA 4MU4A 1EI1A 1IBKJ 2BYCA 2MPUA 4QIGA 4K0KE 5IC4B 1A6FA 3T1HI 2X1FA 1Q1KA 1JX4A 3J81U 4LQ9A 4ZLJA 1UVMA 2ALZA 4OHWA 4B9MA 3DOLB 4EO6A 3GR1A 3T1HF 1ZXNA 4PABA 2EVZA 3MM6A 1Q5YA 4LJMA 3HCXA 3KXDA 2WONA 3EGNA 5KFFA 3IO1A 1WELA 3JQKA 2RVJA 3GIKA 4C9DA 1UW4A 1AB8A 1UWAA 4ZITA 4RO0A 4RR5A 2ZD1A 5DG9A 1MU2A 4AT1B 3BGFA 3GCMA 1IR1A 2HQFA 3P5BP 4GRSA 1LNQA 3CDEA 1N36F 3C6TB 4NCAA 2OI2A 3PVXA 4J9UE 2FQQB 4ID8A 1R89A 2MKCA 2Y0SD 4H4OB 2CPIA 2K8GA 4K59A 4O4GA 1FEEA 1QE1B 5C25A 4QWAA 3W8PA 3ADAC 1RKIA 2QT7A 4OI3A 3NGUA 4QPXA 1HK7A 4ID5A 4JP8A 1QAXA 4DR3J 3GFZA 4LF8J 2MGZA 2CAJA 3V81B 2GGPA 4XTTA 3FSIA 4BLGA 4DN9A 2ZWPA 2BJ9A 3LA0A 3BQ2A 3KLHA 2BX6A 4DPTA 5DLFA 4YMEA 4DFPA 1RAJA 1SJ3P 2GQ0A 1B99A 2QL7B 1JJ2R 3H42A 3WZ0A 1RWPB 4CNYA 2QMXA 4DR2J 2D3UA 5ETTA 5C0XC 2X7IA 2RDJA 3JTPA 1HQUB 2GVDA 3WC2A 2X3DA 1UFKA 3AA8A 4PXBA 5F0WA 1D9FA 2DCUB 1LW0B 1Z0GA 2YNFB 5JEAA 4DSJA 1U6BA 4WP8A 2VESA 1UJ4A 4JV5E 1QSLA 4WFYA 5HP1A 4C7QA 3WIVA 5ADZA 2OSQA 3L09A 4IR9A 1HR0I 1H6KX 2BJ8A 2CJQA 2PIIA 3CWJA 1S97A 1CC7A 3CCVS 1NSAA 4KH0B 3G71S 1JQGA 4HR2A 3BKFA 3CMES 3TA1A 1D8ZA 1DQ9A 1UJ5A 2VFSA 3HXMA 2V8PA 2R8JA 3S8SA 4BA2B 2VUGA 2AX1A 1WHVA 3M8QB 1WC3A 2DR5A 2IVYA 4LREA 2ZDOA 4DX7A 2IC3A 3WU3A 3VGSA 3RRGA 1WG1A 2YBVA 4PPZA 5GADI 4ICLB 1IBKF 4WXWA 2OJ3A 1NK9A 1JLCA 3BGRA 1H2TZ 4C3KA 1IKXA 1K73T 2YX7A 4L3NA 3K57A 4DV1I 1PC5A 3BEGB 3W5ZA 2CNOB 3T1HE 2CG9A 4BC9A 2BBEA 3I5AA 3GFXA 5T41A 3KK2A 4OZ3A 4TKTA 1HNIB 3QT5A 2B6AB 3ET6B 1Q79A 3FMBA 3Q8PB 1Z2ZA 3DLEA 5IZHA 2D9PA 5KFRA 2Q6BA 5J2PB 1MMLA 2GIFA 4C8YA 2KI2A 3BZQA 3US5A 1UCNA 2AJ1A 1NM2A 3CC2S 1FFWB 4M5DA 3WIUA 2VC0A 2V4JA 2X51A 3T19A 3R97A 2YWEA 4F50A 1PBUA 4U3BA 4B9SA 1EETB 4DR3I 1R8BA 2YWGA 3FQLA 2LA4A 1SH0A 4LF8I 3CULA 4JV0A 3FBBA 2BW7A 2O3ZA 1WD6A 3BR9A 3GMGA 4DV5I 3VVTA 2UXDJ 4DR3F 5DRRA 4XIUA 4HI1A 4W90B 4LF8F 2F4VJ 1E6YA 2KU7A 3OR1A 5JXSA 2B5JA 3GLJA 3KFWX 4Y65A 3R7BB 4B08A 2H65B 1HW8A 3PR4A 4DR2I 1B7FA 1P1TA 4OO1A 3BGLA 2AP6A 4C8ZA 1LK7A 1URNA 1C1CA 3TANA 4DR2F 2DNGA 2CPYA 4Q5VA 4Q44A 4PG5A 2XYGB 4IFDD 1TV6A 2Q66A 2VONA 3HT0A 3RU0A 1R6VA 3ILJA 3OSNA 4URSA 3MGJA 1Y10A 1NKBA 3PS1A 2M70A 5KFSA 3RZAA 1W25A 2RKIA 1OO0B 3HX9A 4R0JA 4DU8A 4O23A 3NP5A 2FUG9 2WVDA 3A3PB 3IMQJ 4WP3A 4WK1A 1PO6A 2LLZA 5L3JA 1HR0E 2FLNA 3MTKA 3GSDA 4OJ3A 1ZTWA 1T7PA 4YY3J 2G2ZA 4XDDA 1UP1A 1V6HA 1RKJA 3W2VA 1TL7A 5A2QY 2HAIA 4I2QB 4PYAA 2PN6A 2DNQA 1SKWA 1UFLA 1EB0A 5KFCA 5IOLA 2DHAA 2IJFA 5HQMA 4KTQA 4LMZA 4L3KA 1ZTTA 2VU5A 1Z0EA 1KNZA 4Y6IA 3FSXA 4NASA 4DQRA 2QSFA 2CVEA 4DV1E 4YB7A 3AJDA 1GX6A 3DMJB 1R0CB 1NZ8A 3NKYA 4ZHRA 3DOLA 2CYYA 3VAIA 3DDNA 3AAWB 2EC2A 2BZ2A 3FSYA 1KSPA 1KOHA 3LH2S 3FEYB 3FBEA 1VS3A 4HL9A 1WDDA 1T02A 2YX4A 1O6XA 3N4WA 4G6VB 2B56A 4QIEA 2LQJA 2V4RA 3V4IB 2I8EA 5E0OA 1QD1A 3HF5A 2VDHA 5F9LA 4H4OA 1OMSA 2GFFA 3ZZPA 4TU9A 3KMSA 1XMOI 2RQKA 3U1NA 3ONQA 2IFXA 4K5RA 2UUBI 2F4VI 3DHXA 1QE1A 4WKYA 1CJVB 2ZJQQ 1WUUA 3W61A 3KG4A 1CJTB 2QC3A 2UXDF 4Q43A 4DV5E 4NPOA 2YWWA 3P49B 1X0PA 4JI0E 3Q0AA 5EN1A 2F4VF 2KB2A 3LOUA 2BW2A 2V50A 2QN6B 3L9ZA 3V81A 3PG9A 2ZKUA 2AEFA 3GONA 2IVFB 3TVZA 2VASA 4RU2A 4JI5J 1S16A 1MN9A 4IRKA 4DR2E 1TU0B 4RBUA 3JB9k 4ECRA 4WFZA 2RQMA 2NN6C 4CO0A 1ZAVA 3WDOA 3LQVA 1I51B 4DR6J 1HHQA 3R5AA 2DY9A 3AQOA 3FCWA 5LOQA 3CCRS 1YZ6A 1S1VB 2RHSB 4UOGA 2HLTA 3M85G 4XAKA 5ETMA 2HVZA 1LW0A 1APSA 1RREA 2AF6A 1CSJA 3RB6A 1WKLA 3LNUA 2GV1A 1F5AA 4Z7YA 3AB4B 1RBOB 4YY3I 3VHQA 2UV8G 1JLAB 3UN5A 3DRSB 2BE2B 5J2QA 3UD4P 2ZUAA 2CQ1A 3M9MB 4M94A 2HVIA 2IOPA 4YY3F 1WOPA 3HVRA 3D7SB 2C1EB 4RPFA 2W9CB 3HFZB 3QO9B 3R6LB 2DEJA 1MX0A 1FTRA 3LPSA 3M8QA 4USKA 3W60A 4AYBD 3DLBA 1C0UA 2B4VA 2XY7A 1QZRA 3TEGA 3K58A 3LGHA 1WTFA 2JFKA 4FWDA 1WG4A 2FLLA 1QUPA 3UDCA 5F8LA 2LXFA 2XSFA 2J8AA 3PXGa 2DR8A 1WDTA 3N9UC 2APOA 4U7UD 1MWQA 4DR7I 4P2MA 4XTJA 1W2BR 4DV4J 1VFJA 1WEYA 1XNRJ 4OYMA 2VDIA 2ACMA 2WTFA 1W2IA 3JTOA 1HNIA 2B6AA 3ET6A 2B4OA 3VZHA 5M2PA 1PKPA 1FVSA 2PFDA 2CGEA 4EZ9A 5AJ3F 1N32E 3MUMP 5GAEI 2V8VA 4KGMA 4IS9A 2XMVA 3MOJB 4W98A 3DD6A 3OQ2A 3SQOP 3Q8RB 2VG7B 2JE6B 4ENOA 3MEGA 4XO0A 1UAWA 3BKTA 3JSMA 2PC6A 1XWLA 4X4QA 2VKRA 2JEBB 1XMOE 3ZZYA 4RBTA 3A12A 4LSLB 2UUBE 2ZH3A 2LQ9A 1Q8BA 1HNVB 1W7WA 5K20B 4ED6A 1UDNA 4JI5I 2IJRA 4ES2A 4NZ7A 2ILZA 1V5IB 4IRDA 4RW4B 5L1JA 4E98A 1RHQB 1RR9A 2B7BB 2DNRA 3HPOA 5D0HA 5DZ7A 3NL0A 1FCAA 1JLFA 4FDFA 2O01C 3DKDA 5KT5A 5DDQC 4JI5F 2JDJA 5J1EA 3MM7B 2B4PA 4DR6I 1K1QA 4AD6A 3ILIA 5HMXA 1OPIA 1HBUB 2BDPA 4QW9A 3DOKB 3CW2C 1ZM3A 3Q8YA 2KFZA 2BJDA 2FJDB 2HRTA 4LBIA 4UOCA 1YHCA 4DR6F 5G4DA 2HNYB 2J6TA 2QA1A 3DM2B 2VA3A 4KPCA 2QTWA 2IAJA 3SFGA 4MFBB 3R5DA 3I9ZA 1LWFB 1SC6A 3ZZ0A 3OW2R 4WXOA 5IM0B 3GYGA 1HQEB 4JI1E 2KG0A 3IGVA 5CYMA 2A10A 2LXIA 4ZVTB 2ASDA 1GFWB 3RAXA 4NA1A 1IM6A 1YX2A 1H7XA 2W9BB 2AJ4A 3HP6A 4LF5J 5CYJA 2ZWOA 3OFFA 1CULB 4DV7J 1T0TV 4IDKB 4RW7B 2NQPA 4MKBA 1Z0WA 1YLXA 3QZ7A 1L3VA 1YJRA 4DHVA 3RBDA 3CO9A 1R0AA 1TFYA 4F4YA 2MLYA 3PJWA 3NGDA 2VFTA 1RTDB 4DV4I 2ZH2A 4FN5A 1K0VA 1XNRI 5J2NB 3BV8A 4O44B 1CJUA 4A8XA 2G1DA 5ETLA 4DV3I 2MHNA 3B82A 4O3PA 3HKWA 4DV4F 1VQ8S 2WAQD 1X4GA 1IWAA 2NXEA 4DR7E 3LWLA 3DMJA 4F3MA 4ZVPB 2BOPA 2KYZA 2HS3A 3RB0A 4ZVGA 1R8PA 3MD1A 4F0MA 1U26A 2JSXA 2X3GA 3M8PB 1FRXA 5FWKA 2CPFA 2IYIA 1X7VA 3QMQA 3QWUA 3BREA 3PX4A 5C0XD 1L3KA 4DL0C 3O6QA 1VYAA 4DZDA 1OPZA 1XK8A 3PW0A 2RNEA 1RTHB 2R8HA 3R1HA 2QV6A 4WK3A 2IRXA 3MPUB 5C24A 3VV2B 4WFAQ 3GIMA 4PXCA 4PRXA 1K44A 1WSRA 2DH7A 3OTCA 2RU9A 2ZC3A 5KFAA 3DLHA 4B3MJ 2D3ZA 3G2XA 4F26A 4USVA 1CJTA 3UDVA 1SL2A 2G4BA 2CZVC 2PFFB 3Q83A 2VOOA 1UPMB 5DZ6A 4LF2A 3MD3A 4RZRA 2OFGX 3Q1QA 3BN7A 2KTQA 3I5CA 1NBEB 2ERRA 4U8VA 5LL6d 2VFRA 3K5NA 2V6AA 1X8DA 4UUWA 1S1TA 3C15B 4P2XA 1F6TA 3P3DA 4DX6A 2UXCF 4DR6E 3OVSA 5F3TA 2ZH1A 2EK6A 3BSOA 1M1KT 1DBDA 4A8MP 1C1BA 3GR0A 1FE0A 5HROA 3HDSA 3TOQA 4JI8I 1Y5IB 1LXNA 4FYVB 4KC5A 5KFPA 4PEOA 1T95A 2OAUA 4ECVA 4YDDB 1S1VA 4USJC 2ZOMA 4ZVRB 1X0FA 1NZAA 4N3OA 3C3LA 2YWFA 4OZ5A 1PSDA 4BA1A 2XMAA 2R7WA 1VI7A 1X9WA 3C19A 2N3LA 2HG4A 3QIPB 3TJ9A 1FO1A 3H4BA 2IJNA 5GMEA 2V9WA 1UWBB 5BXIA 3FFIB 4LF5F 2XCPA 2BE2A 2B9XA 3NEKA 5D4PA 4DV7F 5A8WA 3KLVA 1X60A 4X2BA 4I68A 4DPWA 4G1IA 1R6YA 4AL5A 5L9XA 3KLIA 3JAMQ 1RLDA 2W9CA 1RT3B 2KXFA 4J9VA 4B3SJ 2E5HA 2RT3A 3QO9A 3MR7A 4UTGA 1SKUB 4IFDE 2IDEA 3AFGA 2XYHB 5E3RA 3NS6A 4WFNQ 1FJEB 2DGUA 4P74A 4X65J 3FMWA 2YKQA 5HANA 1HMVB 2FLPA 4HT5A 2NYIA 3PJ9A 3WU6A 1JMTA 4K50A 1DFDA 2JEAB 4I7FA 1XNRE 1F9EB 2Y1LB 2W9AA 1N54B 4DV3E 3LPEA 3OUYA 2XTJP 1GTHA 5EWEA 1UVIA 3T1YJ 2BJ3A 2GIRA 2IVMA 1NJWA 3MR6A 3I9V9 1VK3A 2QL5B 3QGIA 1RT4B 3L3CA 2O1TA 1RT1A 5H9FJ 2BQ3A 3U1LA 3PFOA 2A0FB 2EFPA 3NWRA 2ZEJA 3TJAA 3CMQA 1QUVA 3CJ4A 5IT9Q 4KV8B 2VB6A 1V3SA 2MJUA 3IXQA 1RHJB 5HQLA 4QZVB 2RS2A 4Y34A 4DCJB 2VJUA 2UV8A 1JLEB 1HKAA 2Z5EA 2BA1D 5LM7E 4FBUA 4B3MI 5CABA 4OX7A 5DS7A 3E51A 3I32A 2V68A 2PO0B 3U1KA 3VCDA 1FK9B 3IBCB 5KAKA 1U8SA 4ED5A 2XWYA 5ETVA 2JEBA 3FEZA 3NAIA 4B3MF 1GEHA 4AL6A 2IDLA 1GTEA 4LSLA 3IRXB 3CT9A 3D2WA 1DTQB 1VQMS 2GO3A 2YNIB 3RAMA 3KJVB 1ZA2B 4O4RA 1FTCA 4BS2A 1NB2A 2LEBA 3GWCA 2EFOA 4CO2A 1OJ4A 3BYRA 4HT7A 2BANB 3P8BB 2KVIA 4C97A 2C3YA 4QW8A 5MLCV 3G6ES 4CT9A 1RU1A 1NHVA 2LECA 4YQWA 3VALA 1S6QB 2C2EA 3MM7A 4H4KA 4X66E 3Q89A 4AXJA 3RGIA 2KFYA 2COLA 1Z4UA 5IT4A 3UI3A 4LVOP 1HBUA 3DOKA 4NMLA 2PO2A 3PW7A 1BWEA 3HSGA 4C0OC 3T5HA 4JI8E 1DZ5A 1Z0CA 3EJMA 3DM2A 4PXEA 5HL7Q 1RE1B 4MFBA 1LWFA 2DITA 2CWXA 4ZJOA 1HNXE 2QO3A 3PIPQ 1BQNB 2C38A 4MK8A 4NWBA 2XO6A 3MCNA 2D3OR 1JLQB 2BKPA 4EZ6A 3HHEA 4C11B 2IBOA 3AD7C 3MPVA 2OMLA 3P45B 4B3SI 4IZJD 4ANCA 1A9NB 2KRBA 1VRUB 2W9BA 2HSEB 4ANDA 3Q23A 3PM9A 4ES3A 4DS5A 2Z5CA 4IDKA 4RW7A 4X65I 1IKVB 3OTOI 5LMNJ 4K4VA 2PNZB 4B3SF 2CG8A 1TUVA 4JI4J 4GMKA 1F9HA 2BJEA 3RB4A 1CQNA 2DHHA 4DL4A 4X65F 1E3HA 4UY85 1RWMB 1N34F 3BBFA 1BC6A 3M6VA 4QR0A 1YSJA 2Y8WA 1FFSB 4LFCI 1SIWB 1YRXA 1RTDA 3T1YI 1SJFA 3IGNA 4IH5A 3AOAA 1VQYA 3ISZA 2MB0B 3H25A 5J2NA 4O44A 4ZPDA 1VBZA 1EP4B 2BQRA 5KTQA 1KC8T 2XS2A 2R7XA 3UN2A 4CZCA 2A2DA 4KFBB 2KL8A 3T1YF 1X31C 5E33A 5E3QA 2WNRB 2E5JA 3SCIE 1IBCB 1S1WA 2DGSA 5ELWA 1Q8IA 3QAUA 2XZWA 3I0SA 2CQ2A 2UUTA 5LXRA 3W8GA 2NN6D 2PMWA 3MECA 4N56A 4F4XA 3UD3P 2W2PP 4X62J 5ETRA 3BBCA 1YBAA 1YJUA 2CPHA 3CCUS 2JLFA 3HHNB 3D6TB 1VRQC 1RTHA 4MIAA 2HHHF 3HJCA 3GCWP 1YBTA 2GNKA 3QBCA 4B3ME 2EFNA 4RW8B 1RYSA 1KHVA 1ACMB 4JI3J 3TI0A 1JJHA 4J9KA 1LXJA 3QAEA 4TXSA 5CQGA 1NJZA 1F5BA 2JC1A 8AT1B 1H0HB 5L1KA 3DGPB 3D68A 4CIOA 1JNZB 3H2VE 3T1AA 1HI1A 3CDBA 2K3IA 4DF8A 3ISND 4QBUA 1RABB 3MZIA 1MROA 3NGTA 2EFQA 3SEOA 3C14B 1FXDA 5GMDA 1U25A 3EWGA 4N7TA 1VQPS 3ZC4A 4DR1I 4IOCQ 2NSBA 1OY9A 1FRIA 1QDUB 3DCAA 4WBFA 4DV0J 4R5PA 5L9NA 2L9NA 5A2QC 5DGBA 5C42B 2BE7D 3KTQA 1WEZA 2MQNA 1YHQS 1MSWD 4OJHA 3ILLA 3C15A 2F65A 3RJMB 2UVRA 4ZPVR 1NU4A 4ER8A 2HWHA 3M1VA 3UVJA 2FJBB 3LP1B 4DUZI 2EWHA 2ZNYA 4B9LA 1UVKA 1RDRA 2YVSA 3D66A 3CXCR 5KFOA 1U1QA 2PE8A 1B0TA 4WYLA 1KVKA 2OTLS 3N6NA 4LF4J 5EX0A 2RS8A 4WU2A 2OSRA 3FZ2A 2MQPA 3TAQA 4RKUC 4ZPWR 4DG1B 5LMNI 2CQBA 4LIWA 1NSQA 1NHUA 2P9EA 3QIPA 4FXWA 3SYZA 2AD9A 2KM8C 4B3SE 5GVQA 2R42A 3HVTB 5LMNF 4ELVA 4GVBA 3CJ3A 4X65E 3NOGA 3OTOE 4JI4F 5KFGA 1EQ0A 4I56A 3ZTRA 3UQSA 3W63A 3M2VA 2P6TA 1KWMA 1VHFA 4NLVA 1HMVA 2OPRB 4IFDA 1RAAB 4LBPA 4C3LA 2M9KA 4LFCE 2HFVA 2GQQA 4D3GA 3T1YE 1CEZA 2KXNB 1S6PB 2D1CA 1RXOB 1DRZA 4Q8FA 1IXKA 1RTIA 1VK8A 3MM5B 4OYZA 3K0JA 3U02A 1X4AA 3HHLD 2QYGA 4KRWA 4C0BA 4N77A 1FRLA 1PVGA 4YHHJ 1HHTP 1NPRA 1RT4A 1Y7PA 1HWIA 1FJGJ 1TK5A 4GKKJ 1NB7A 1S10A 3PYFA 3DLLQ 3KDNA 2O1VA 4X62F 3OJUA 2IM3A 4ZKAA 2UVVA 3OBIA 1Q81T 2CJAA 2HQGA 1F9FA 1ZA1B 4J9QA 2C3OA 4JI3I 2QGFB 2M8DB 2A6OA 2H54B 1FRJA 2ZM6J 2JEFA 2CPZA 3HT3A 4C8NA 3VQSA 3FQKA 1JLEA 2FZKB 3BM7A 5HJXA 4ZJQA 3IP0A 4JI3F 3DHWC 2PO0A 3F0NA 1LEOA 1IR0A 3POTB 2CQCA 3UD5A 5E2QA 2GJ2A 2XZTB 4K2XA 3MF5A 4A8SA 3WX4A 1MG7A 3H5YA 2OEKA 3IRXA 3KLGB 2W4PA 5K36C 2PMZD 3KJVA 1BQXA 3WU5A 1RWOB 5K8NA 2M2BA 4OLOA 1YG0A 5C0XE 2BANA 4DV0F 2FJEB 2ALYB 4DR1E 1N4LA 3HHDA 2YKNB 2R9LA 1JKHB 2JL9A 2MHEA 4PG4A 4CLUA 5B0FA 5LXYA 3ZNJ1 3QRPA 1QJHA 5KFVA 3IM8A 1YJ9S 2CPJA 3LWMA 5D4LA 2EKYA 3TJ8A 3NAHA 3JYTB 3P76A 2E7VA 4IG3B 3BO3A 4DUZE 3V6KA 1UDQA 5KFWA 3A3OB 4U3DA 2B51A 2DNLA 4LF4F 2V0NA 2Y3YA 3CMAS 1BQNA 1FDAA 3OXLA 2WRMA 9ATCB 4MT1A 2R2RA 1F1BB 3G86A 3IG1B 5KG4A 3BF4A 1JLQA 4C11A 5G0RB 3BS9A 5LMNE 3GV5B 1PJ5A 2R7VA 4LRFA 4LR9A 1VRUA 2FVRA 1VQLS 2VA2A 4FW4A 1IKVA 2QRRA 1TL5A 5KG3A 3W2WB 1DHMA 2AYEA 4A4JA 3RR7A 5D8HB 2CQIA 3R3TA 2DHGA 4HDHA 4NXNE 4K4SA 3NOCA 2OMOA 1SV5B 4YHHI 4NRUA 2DHSA 2HURA 2LEAA 4NXMJ 4LFBI 1VQOS 5A0YB 2MZRA 4MDTA 1FJGI 1EP4A 1TUGB 4GKKI 4FXDA 3CJSA 4FNIA 1NDLA 1NO8A 2R8KA 4KFBA 2N4CA 3CB4A 2E5LJ 2Z2MA 2B8PA 2MYFA 4J9OA 2WNRA 3EE3A 2D74B 3R1LA 5K8MA 1FJGF 2Z2ZA 4GKKF 1WC1A 2ZM6I 2DK2A 1DARA 1VQ4S 5JJBA 5C2GA 2ZJRQ 4DR4E 1KTVA 1R27B 3BGUA 3CSKA 2ZM6F 1TKZB 3KG1A 3G6VA 5DROA 1TELA 1FESA 4YS2A 4DDFA 2OELA 2WVCA 1U4BA 1SL0A 2VOPA 3MUVP 2RMLA 2EG1A 3PY8A 3JAMU 3SV4A 3K59A 3MFIA 4E2FB 4C8KA 3C6UA 3TUJC 2NUUG 5D4NA 2LP4A 3QWPA 3GG0A 2L9DA 3ZZZA 3TZYA 5CCLA 2UVUA 1Q7LB 1S76D 4LIRA 5D3GA 4KGVB 2YKPA 1USVA 3C14A 1RU2A 2AGPA 2K7KA 3DLGA 1RCXB 2QA2A 2YKMB 3R27A 2W8KA 1FERA 3W5YA 2BR2B 1M5OC 4JI2J 3W3SA 4FPIA 5HLFB 2ZE2A 1YJTA 4WJBA 3K85A 4ECZA 2RD5C 3Q8UA 4DEZA 4EMDA 2D3O1 1FNOA 2UU9E 1VLOA 1VGYA 3LP1A 3M8WA 3BR8A 2B3TB 1JXLA 1HWLA 5IT9U 2PDAA 2WCXA 5DDRC 5L8RC 4KO0B 4IFVB 4NA2A 2GQ2A 1HNWJ 1M90T 5D15A 2B9WA 3QGGA 4CLSA 2AEJA 2IRUA 4XPCA 1PAUB 4ECQA 1REVA 3D54A 4MK9A 4RBVA 4MKYA 3HVTA 5HI7A 2DNMA 3ZTOA 1OYDA 2BJ7A 2C2KB 2VICA 2HMIB 4V19J 1EKRA 4NXMI 2ROPA 4TY9A 2X1BA 4TYAA 3PW4A 4CCHA 4P72A 1S4EA 5LJ3Y 2E5LI 2OPRA 1BE4A 2J6SA 1VMBA 2DO4A 4NXMF 2NXCA 4DV6J 4ECUA 1RSCA 1S6PA 1FKAF 4YHHE 1S7HA 5ITHA 4FS2A 1XBWA 4LFBE 2YQ0A 3ZZUA 3UWTA 1FJGE 1Q16B 2E5LF 4J9NA 5AXKA 2CJKA 2YXLA 2FVQA 2CIMA 3DDIA 1Z2LA 2Y1IA 1Y4SA 5D77A 1IVZA 3DU5A 4IFDC 3KJNB 1Q82T 1FJ7A 3T6JA 3THTA 1SKRA 4WUDA 4TLRA 5IV3A 3SI8A 1YDLA 3ZZOA 1PYTA 3GYNA 1OSDA 3PRDA 4MIBA 4IO9Q 5KFEA 1REGX 1XNQE 3QT8A 1OQ6A 2MZJA 1IM4A 2ZD1B 5KFZA 1S12A 2GHPA 2W1BA 4WU3A 1U0SA 1FNMA 3QFHA 1HARA 4ECXA 2PO4A 2IHR1 5CH7B 1JIHA 3FBCA 1IKYB 2RUGA 1M1GA 5DDPC 3TZWA 4C4WA 2AE8A 3DI6B 4OI6A 3D1QA 4AQYI 4JI2I 3GB0A 4O4GB 3AXMA 3I87A 1WHYA 2V8GA 2UZAA 6FDRA 5C25B 2NN6E 1NDPA 3Q8SB 2CXEA 1HA1A 2J9EA 1RP5A 4P52A 1VISA 4JI2F 1J27A 2KT2A 1WKJA 5C0XA 3PS2A 3L7PA 1JKHA 3CJTA 1XXEA 1G3OA 2ZBPA 1WNEA 2GIQA 3KLHB 2FZCB 1TR0A 4X4TA 4HY1A 2RSQA 5GAGI 4A8WA 1U1MA 4DUYJ 4OO1F 4DUTA 4FXVA 4U6PA 3JYTA 2HFOA 4X84A 2E1MC 4FKXA 2JJ4D 4J3DA 1U02A 1CJKB 4ED4A 3M6UA 2J9DE 2KDOA 3D3CJ 5M2UA 2GVDB 4NLWA 3CIMA 2HZAA 1HNWF 2EFVA 2A1BA 5KG7A 4W4MA 2KFNA 2XNQA 2QSWA 2RRBA 3I4PA 1LOUA 5IWAI 4NYZA 4CH1A 2FYXA 3PHEA 4N8NA 1SJQA 2Z5BB 1VC6A 1N8RT 1VC5A 3QRRA 5SZTA 3THVA 5HP1B 3A8JA 1KRPA 4ZVEA 2X36A 4URGA 1RT6B 3W2WA 2WVEA 5BR8F 4DV6I 4MYUA 2VBZA 3R5BA 4PRVA 3D6FB 4IZKA 5FLXC 4NLGA 3HD1A 4CYUA 1FKAE 4PZVA 4ZLNA 2GMLA 4DV6F 1SV5A 3E3XA 4J37A 4L6V3 2GZOA 1GXTA 3ZTQA 1UZHA 4EI2A 2IC3B 4FW3A 2HS0A 1NHIA 1U1KA 5A0YA 5K8PA 4J9SA 1SH2A 4BBYA 2CFXA 2PA3A 4M5JA 3TQ1A 1KFDA 3BGRB 2W7OA 5GADU 4K4UA 3IFEA 1IKXB 1FT8A 3MURP 2HHPA 3CDWA 3JQJA 2GC8A 3N6MA 4OI0A 8RUCA 4K0KF 2XSJA 4JI7I 3CIZA 3CCJS 3KK2B 3IWXA 2IOQA 1Q7YT 4IFYB 5KFXA 1YQHA 3CWVA 1RACB 2NPIA 1KS2A 5KG5A 5E7OB 4NLDA 3E01A 3RTVA 3NS7B 2OH2A 4AFFA 4F2RA 1FKPB 2ZH6A 3B4MA 4ZP7A 4QWCA 3O5TB 1FDNA 4PG6A 4ZVFA 2F8MA 4Q0BA 3OHBA 2HRYA 3S01A 1Q8KA 1EZZB 1KOOA 2P8IA 4FYXB 4NLPA 4FPRA 3TX0A 4OYWA 4LQ3A 4ZA1A 2VC1A 4AQYE 2ZNZA 4HH0A 4NI2B 2NREA 2RIJA 1TL1A 1AFIA 5CAAA 3TUPA 1RA7A 4OZ1A 4LRCA 3PKYA 1XMQJ 4FYYB 2YKMA 5AE1A 4PWUA 2BR2A 1Q8LA 4DWIA 5HLFA 1E6YB 3MCSA 3OR1B 4DUYI 2DVIA 2B5JB 1UETA 1H7UA 2QZ8A 1VQ6S 5KT6A 3WU4A 3N0VA 4ZCIA 3M8SA 3ELHA 4LRBA 1LFPA 1SI9A 5B0BA 4DF4A 5E5NA 4DUYF 1UDOA 3HJFA 2JLEA 1T94A 4NZ0A 1LWXA 1DY3A 3SCLE 4I6AA 1U7LA 1C1CB 1DQ8A 1PKUA 4PWDA 2AJ2A 4YR0A 4WYWA 3HSJA 2HNZA 2EI5A 1TV6B 1IBMI 4KO0A 3FUYA 4IFVA 1NJYA 3RAQA 4USWA 3SDEB 1D8YA 2MQ8A 4OYXA 3PW2A 1EKSA 3ENAA 1VQ9S 2XS7A 3SCJE 2H51B 3B6BA 2WSCC 3LTOA 4R8UB 4FF1A 4M8LA 5IWAE 2RKIB 5JEAD 2YY3A 4L74A 1J2VA 3F56A 3M30B 1DAXA 1RLCL 5KG2A 3DYAB 5K14A 2AMCB 3TARA 3FRZA 1PILA 3K89A 4UW2A 1VQ5S 1T9YA 2HMIA 4X64J 2OPPB 1CC8A 1WC4A 1DLOA 2WVFA 3AJ1A 3W2VB 1TL7B 3TA0A 3SSRA 1RT7B 5K36D 2MZ1A 1HR0J 3NG8A 2FHOB 3MM9B 2R7TA 4Z37A 3EDQB 1Q78A 3WBZA 3TAPA 3FVYA 4FYWB 3NGRA 5EGYA 3A13A 2P6SA 3GLLA 1PYSB 2ZJPQ 3NS5A 2WW4A 1YIJS 1OIAA 1TAQA 5LT5A 3EUNA 2KT3A 4IZJA 1MW7A 5HK4A 1AA1B 1N0VC 4ZHRB 3V6JA 4JV1A 3LW5C 4Y3CA 4B3RI 2JVRA 4JI7E 1VCTA 1SL1A 4DV1J 2HNDB 4OFZA 2GW8A 2KHDA 2GHWA 1WSVA 4WCEQ 3KHHA 4YB6A 4ITSA 2LXUA 1G6BA 3J81j 2OHDA 1X9SA 1QVGR 5IQQA 4RW6A 3HJVA 5H9FK 4ZVIA 1IKYA 4MTPA 5ETNA 5F8MA 2XZDB 3MCMA 1XEZA 2ZBCA 4F25A 2HPUA 3DI6A 1L3SA 1XMQI 4RL1A 2H5JB 3CGIA 1WG5A 4O3QA 4WWSA 2KYXA 3PR5B 1SH3A 5HN0A 3Q22A 1NHKL 4X4RA 1B62A 2VF3A 2P2CB 3K17A 1RCOB 2NN6A 7FDRA 1SIZA 1TMJA 3TWZA 3UCUP 3PJXA 1XERA 3UCZP 1FWPA 2UXBJ 4H54A 3M32A 1PJ7A 1V5VA 4HHHA 1KQSR 1F3VA 4DUYE 2J9CA 4C98A 1WJ9A 4NMXA 2DISA 4DR5I 1VIXA 1FNXH 4DV5J 1TKDA 5FD1A 4JI0J 4KGXB 4KGKA 4P71A 5HMYA 2ABYA 4HH1A 4EYHB 3Q6NA 4JBCA 5J2MB 4HVZA 2MLZA 3J81C 3LAKA 1LFWA 2CJXB 2VQEJ 1CJKA 2FGOA 2Q79A 2MY8A 2YX1A 1FEHA 2HVHA 1IBME 2J9DA 4KHPJ 2GMJA 2WZ1A 2VBYA 4ZCKA 4Z7CA 4NLRA 4LSNB 2BXJA 2ADBA 2XLKA 3TA2A 4KHMA 2Z5BA 1EJ7L 1CVJA 4X64I 2BKOA 1T03A 4UF4A 4J9MA 2GAGC 1R0BG 2MJNA 4DSKA 1SVDA 4CTAB 3WX8A 5J2QB 1RT6A 4ELUA 2DNNA 4X64F 1Y3JA 3OD2A 2CJYB 1YRTA 4BC7A 1RAIB 2AV5A 1GH8A 5HATA 1HR0F 1BD6A 2CJ9A 1Y11A 1C0UB 3FBFA 4MMOA 3CJKB 4OL8A 4QQBA 3FRYA 3PO5A 2EW9A 1ZM2A 4FYDA 4R25A 2V2QA 2HGLA 1Q53A 2WB4A 2BA9A 2BABA 4EFAC 1S99A 1LW2A 3A8KA 5KT2A 1H2VZ 1T9TA 4P2FA 2GA7A 2FDNA 4DS4A 2DR9A 4ZN3A 1MU5A 1UTAA 2GMHA 2QYCA 4PQAA 3EPIA 3WHIA 1X4EA 2O66A 3J80U 3PS3A 1W26A 4WZQA 1PBAA 4IFYA 1SUQB 3KRNA 1UKUA 4DV1F 1C4AA 3GIRA 4B3RE 3HK2A 3OV7A 4F4KA 1T05B 2WK4A 4I67A 1R8HA 1N6QA 2JT2A 2F9DA 1FKPA 4OI4A 2XQCA 5GAEU 4OIXA 4ZDNA 1B64A 4GC6A 3W5XA 2F9JA 1N32J 3L7OA 2UVWA 3MMCB 4EYIB 2Z4PA 4F0HA 2BUNA 3MEGB 2MQMA 2A2CA 1UA1A 3KOAA 3JSMB 2MQOA 1J5EE 2NZCA 1XMQE 3D1OA 5BJRA 2UXBI 2DXEA 3RUBL 2KH9A 2PEBA 4NI2A 4B9TA 2HK3A 3LF0A 3NCQA 4DQPA 3TAMB 5T14A 1RHRB 4NX9A 4P7VA 2IY5B 4JI0I 1NUEA 1OQ3A 1KBRA 2V8HA 1XMOJ 2ZOFA 2UXBF 4B3OA 2UUBJ 1ULRA 3BO2A 3PV8A 4CP5A 2QLWA 3C2PA 3VGVA 4DV5F 1JLFB 4TN2A 1B7YB 2V2KA 1LQ9A 4JI0F 2A18A 3OTDA 4DR5E 2VQEI 2AWZA 2B7CB 5J1EB 2QE5A 5KFDA 3D3BJ 2MEWA 4ZVOB 3RW6A 5I3UA 1FA0A 1M5SA 2CQHA 3NY0A 4KHPI 1FWLA 5CA5A 2QFIA 1Z59A 5A6PA 4OV1A 4CLPA 4DZ6A 2VQEF 2NXNA 1CPZA 1S9FA 1U48A 2OLWA 2ADCA 4URLA 2IAJB 3SDEA 4KHPF 2MKHA 1E6VB 4LF9E 4K4WA 1K1SA 1WC5A 1R8AA 2QLBB 1HWUA 5KFMA 3KHGA 4ZVSB 1V3ZA 4R8UA 4LR7A 5CYMB 1VHIA 3WC0A 1JB0C 1UW9A 4X64E 3M30A 2YQ3A 3DYAA 2XGPA 4JI1J 2HGMA 2VKZG 4G3IA 1UVJA 2ZOGA 2BV3A 3F41A 1WTBA 3T41A 1TVRB 1PCAA 1FXRA 2OPPA 1OYPA 3T6BA 4KSEB 4J9LA 3A8IA 4JYAJ 2CZ4A 3K8VA 4USIA 2ZBQA 1RT7A 2I38A 1KTQA 3D0GE 4QNKA 3MM9A 3Q2SC 5B0EA 3TQEA 1R0AB 1BKNA 3P5TL 4E0DA 2YQ1A 1BMQB 2RH3A 4I64A 4YB1P 1S4FA 3AOCA 2BA0G 2VQFE 5EL9A 3CNQP 2J0WA 4RX6A 4Y00A 2HHWA 4B9UA 4K4YA 5A8KA 4OKGA 1CJUB 4ED0A 4Y2KA 4QCLA 3V2UC 2E44A 5KFLA 4KJIA 4F3QA 3LAMA 2DBBA 2E1CA 4DFJA 4GKJE 3FEXB 2C39B 1M5VC 2OD6A 2HNDA 2V67A 1N32I 4DR7J 3OLAA 1NMEB 4PXDA 2JFDA 4FVCA 1XR6A 3BSNA 3NZKA 3IR7B 2C2OB 4OZ0A 1N32F 2WSFC 5C24B 2HIYA 1I1GA 2R2TA 2EK1A 3CD7A 1FE4A 1EARA 3K5LA 3IA0A 4P6QA 1QVFR 4FS1A 1TK8A 4NL5A 1NDCA 2XCAA 2UXBE 4MH8A 3G6XA 3CD5A 5FDLA 2V2VA 3D6HB 1XMOF 2NXUA 4M5LA 4OMFG 3GIIA 2UUBF 1Y60A 4TNOA 1U09A 2W2QP 3I4HX 2N7CA 1S57A 2F40A 3DOMB 1NRKA 1UEUA 1S1TB 2VQEE 3MDFA 1KLMB 3G8SA 2DNOA 2HRUA 3EVMA 4OJ1A 3SIPB 4W92B 4NLUA 5J2MA 1C1BB 2GO9A 4KHPE 4ECSA 1GX5A 5HROB 2KM8B 2HHQA 3MAHA 3BKUA 2ZH4A 3EVOA 1NK6A 4HTJA 3LGMA 2C28A 4JI1I 4DSEA 2NCKL 4LSNA 5B7WA 1LKZA 4BA1B 1FHTA 2QA4G 2LA6A 1AZSA 2MKJA 2W24A 1AUSL 3KJFB 4JYAI 4JI1F 1VQ7S 2ATLA 4J9PA 3M7VA 2FC8A 4U96A 2HFNA 2FB0A 4CTAA 1NK0A 5DLGA 5A8WB 2HGNA 4HEA9 2M5YA 5HBMB 4I4BA 2HW3A 1BQMA 3H59A 2C2DA 2E9ZA 3QZ8A 3TZXA 1NK4A 3CCSS 5D0RA 3KLIB 4PCQA 3J7AN 3ISNC 2QEXS 1Y5LB 4ILRA 5IS2A 3CPWR 2C37A 1EX8A 6AT1B 2ASJA 4MIWA 2L48A 1UVLA 2QMWA 3CJKA 2BQUA 2Z56B 1T9XA 2IMOA 4JI6J 4TQSA 2AZ3A 2B9YA 1O51A 2HKEA 5KFUA 1U0HA 1KR4A 5E3PA 4I7FB 5F3ZA 1J5OB 3HFVA 2CNLB 1YK9A 3WQPA 1F3FA 2FJXA 2EFGA 3L7ZB 3OUYB 3MOZA 1XJWB 2Y9HA 3PCOB 3X3UA 3QIDA 2GJIA 1HW9A 2MKKA 3CF5Q 4DV3J 1QAJA 1SUQA 3KDOA 3K5OA 4LF7I 2DR6A 4NE9C 1RT1B 2DYAA 1A6LA 4DR7F 1RBAA 3MR5A 1T05A 2LU1A 2ACYA 5KFIA 1OY6A 2M4MA 5K36E 1YJWS 1IBLJ 4HHUA 1RYRA 4YB5A 1VR6A 4YR3A 3R6GB 3SMZA 1PC4A 1Y4ZB 2PD1A 3J7Z5 2UUWA 2N4DA 2F8HA 3MMCA 2OUGA 2ZBRA 3OL6A 4DV2J 4KHRA 1Z0VA 1N5QA 4ED7A 3K2YA 4P10A 2OP5A 3MEKA 4ZP8A 3TAMA 4OHYA 3ETMA 3MHYA 4YN3B 3CCQS 2X1AA 4RNHA 2LCWA 3M8YA 2DO0A 4QPTA 3E8OA 1HI8A 2YNGB 1N5TA 3S7RA 4CLZA 5DO2A 4LRAA 3SBMA 4KKOB 4P7TA 1Z1ZA 4HACB 3H4DA 4CT8A 3HHLC 1PG5B 2AGQA 2KJWA 2M0GB 3HZEA 5F9NA 1X4CA 4NEYA 2P9CA 4AXIA 2PO2B 3BJYA 1M5PC 5CXTA 2D41A 4UY8T 4RU9A 4X66J
chains in the Genus database with same CATH topology
3K1JA 3PYDA 5GMEA 3H4LA 2CZ9A 4I3HA 5IWAI 5GMDA 1PKPA 2BM1A 3V2UC 4DR1I 1B62A 4LF4I 2VF3A 4DV6E 2ZM6I 4OX9I 5LL6R 2Z5BB 2CGEA 3K17A 1UEKA 1DARA 4DR2I 1N32E 5FLXQ 1PIEA 4DPWA 5A2QC 2E1RA 2VQFI 4DPUA 4DR4E 1Z5CA 1FWKA 3JAMQ 4GKJE 2X36A 4PU9A 1KTVA 3J81Q 3ZKDA 4DUYE 4UTGA 4USMA 4JYAE 4DR5I 4FW9A 2O1UA 4DV6I 4MYUA 4LFAE 4PRVA 1N32I 3ZM7A 1EI1A 4IZKA 4HYMA 2Z5CB 5FLXC 4JI5E 4DUZI 1FKAE 4P7AA 1Z0TA 4DR4I 3WU6A 3Q6NA 4HACA 4K0KE 2UXCI 1A6FA 4JI6I 4GKJI 2GS8A 3T1HI 3JAMC 1XMOE 1XNRE 1XHKA 3J81C 2UUBE 1KVKA 4JI4E 4UT4A 4DV3E 1I94I 1N36E 2HHHI 4LFAI 1HNZE 1NHIA 4DU8A 4MYTA 4KQVA 4JI5I 4FWGA 2UUCE 4DU7A 1ZXNA 5LMNI 4B3TI 3HULA 1IBME 1Z5AA 2PNMA 1RR9A 5L3JA 2O1TA 3J7AG 1HR0E 1USVA 4Z7CA 2UXBE 4B3SE 2Z5BA 2XEXA 2R42A 1HNWI 4X64I 5LMUE 4DR6I 3PYGA 4DXLA 4JI7I 2HFSA 2V2VA 2IOQA 4LF6E 1NHJA 4X65E 5IT9Q 3B78A 3K85A 1B63A 3CWVA 3OTOE 1IBLI 3ZZTA 4LF5I 3B8HA 2OI2A 1ZM3A 1ELOA 4DV7I 2Z5EA 2UUAE 3V5RA 4EMDA 4B3MI 1K47A 4IZJB 4LF7E 1NZ0A 2UU9E 3QT6A 4X62E 2PNLA 2VQEE 4LFCE 3ZZ0A 4DV2I 5IT9C 3T1YE 1ZM9A 1Z0EA 2J7KA 2NPFA 5BR8I 1HK7A 4JI1E 4DV1E 1H74A 4KHPE 1N33I 1ZM2A 2UU9I 4FWHA 2V2QA 1PVGA 4AQYE 4JI3E 4WUCA 1OJ4A 1D6TA 2AJ4A 1ZXMA 4JI1I 4NXME 4DPTA 3PYFA 1USUA 2O1VA 4DV4E 2UXDE 1MU5A 1N0UA 3J80C 1Z0WA 3PYEA 2GQ0A 4X66E 2E5LE 2F4VE 4DUYI 4JI3I 4JYAI 1H7UA 4DPXA 3WU4A 4B3RE 4NXMI 2X7IA 4DV0E 4K0KI 1Z5BA 4DV4I 1XMOI 4FN5A 1S4EA 4JI8E 1XNRI 1Z0CA 3F0NA 4X66I 2E5LI 2F4VI 1ZM4A 2UUBI 1Y4UA 4JI4I 1Z0GA 4DV3I 1N36I 1HNZI 2LJPA 1WUUA 3B82A 4YHHE 1HNXE 4JV5E 1MG7A 2UUCI 4LFBE 4DV5E 2ZITA 3ZZUA 1U2RA 1N34E 4JI0E 1FJGE 4DR7E 4IZKB 1IBMI 2A2CA 1H73A 1IBKE 1FI4A 1J5EE 1HR0I 1XMQE 2HKEA 3WU5A 2BM0A 2UXBI 4B3SI 4IZJD 3GONA 2ZBKB 3LTOA 3QT7A 2HK3A 1HNXI 5FWKA 5LMUI 1Y4SA 4WUBA 5IWAE 2EFGA 2Z5CA 4DR1E 1S16A 4LF6I 4DPYA 4LF4E 4OX9E 4X65I 4JI0I 4DR2E 3OTOI 2V8PA 1Y6ZA 4WUDA 2DEIA 1J5EI 3M6AA 4HXZA 3PRYA 2UUAI 3WU3A 4LF7I 1Z0BA 1XNQE 3QT8A 3J80Q 4X62I 4DR5E 2VQEI 4LFCI 4PRXA 3T1YI 4JI2E 4YY3E 1FNMA 4DUZE 1NHHA 1EA6A 4DV1I 2UXCE 3Q6MA 4KHPI 4JI6E 1FWLA 1H7SA 3T1HE 1Z59A 2CG9A 1RREA 1XNQI 2A2DA 1I94E 3LNUA 2HHHE 3J7AM 4AQYI 4Z7YA 4JI2I 4URLA 4YY3I 3QT5A 4R1FA 2WW4A 1Z0VA 3Q1QA 5LMNE 4B3TE 3D4JA 4LF9E 2HKJA 2UXDI 1KKHA 2R3VA 4IZJA 2HK2A 4P52A 1VISA 2IOPA 1N0VC 3ZKBA 4DR3E 4RPFA 3P06A 1HNWE 4X64E 2DEJA 4LF8E 1MX0A 4DR6E 4B3RI 4JI7E 4JG4A 2V34A 3LPSA 2Q2EB 4USKA 1IBLE 4LF9I 4DV0I 4LF5E 1QZRA 2BV3A 3HJCA 4HY1A 4GKKE 4DV7E 4JI8I 4NXNE 4HACB 4B3ME 2V2ZA 4FWDA 4DR3I 4LF8I 1H72C 4YHHI 2HFUA 4JV5I 4LFBI 4DV2E 4DV5I 4N3OA 4M1KA 2ZM6E 1BKNA 1N34I 1FJGI 4ED4A 4DR7I 1KIJA 4XTJA 4ZVIA 4GKKI 5BR8E 5A2QQ 1IBKI 4NXNI 2O1WA 2VQFE 1XMQI 1N33E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1J A;  3PYD A;  5GME A;  3H4L A;  2CZ9 A;  4I3H A;  5IWA I;  5GMD A;  1PKP A;  2BM1 A;  3V2U C;  4DR1 I;  1B62 A;  4LF4 I;  2VF3 A;  4DV6 E;  2ZM6 I;  4OX9 I;  5LL6 R;  3K17 A;  1UEK A;  1DAR A;  4DR2 I;  1N32 E;  5FLX Q;  1PIE A;  4DPW A;  5A2Q C;  2E1R A;  2VQF I;  4DPU A;  4DR4 E;  1Z5C A;  1FWK A;  3JAM Q;  4GKJ E;  2X36 A;  4PU9 A;  1KTV A;  3J81 Q;  3ZKD A;  4DUY E;  4UTG A;  4USM A;  4JYA E;  4DR5 I;  4FW9 A;  4DV6 I;  4MYU A;  4LFA E;  4PRV A;  1N32 I;  3ZM7 A;  1EI1 A;  4HYM A;  5FLX C;  4JI5 E;  4DUZ I;  1FKA E;  4P7A A;  1Z0T A;  4DR4 I;  3WU6 A;  4HAC A;  4K0K E;  2UXC I;  1A6F A;  4JI6 I;  4GKJ I;  2GS8 A;  3T1H I;  3JAM C;  1XMO E;  1XNR E;  1XHK A;  3J81 C;  2UUB E;  1KVK A;  4JI4 E;  4UT4 A;  4DV3 E;  1I94 I;  1N36 E;  2HHH I;  4LFA I;  1HNZ E;  1NHI A;  4DU8 A;  4MYT A;  4KQV A;  4JI5 I;  4FWG A;  2UUC E;  4DU7 A;  1ZXN A;  5LMN I;  4B3T I;  3HUL A;  1IBM E;  1Z5A A;  1RR9 A;  5L3J A;  3J7A G;  1HR0 E;  4Z7C A;  2UXB E;  4B3S E;  2XEX A;  2R42 A;  1HNW I;  4X64 I;  5LMU E;  4DR6 I;  3PYG A;  4DXL A;  4JI7 I;  2HFS A;  2V2V A;  4LF6 E;  1NHJ A;  4X65 E;  5IT9 Q;  3B78 A;  1IBL I;  1B63 A;  3CWV A;  3OTO E;  3ZZT A;  4LF5 I;  3B8H A;  2OI2 A;  1ZM3 A;  1ELO A;  4DV7 I;  2UUA E;  3V5R A;  4EMD A;  4B3M I;  1K47 A;  4LF7 E;  1NZ0 A;  2UU9 E;  3QT6 A;  4X62 E;  2VQE E;  4LFC E;  3ZZ0 A;  4DV2 I;  5IT9 C;  3T1Y E;  1ZM9 A;  1Z0E A;  2J7K A;  2NPF A;  5BR8 I;  4JI1 E;  4DV1 E;  1H74 A;  4KHP E;  1N33 I;  1ZM2 A;  2UU9 I;  4FWH A;  2V2Q A;  1PVG A;  4AQY E;  4JI3 E;  4WUC A;  1OJ4 A;  1D6T A;  2AJ4 A;  1ZXM A;  4JI1 I;  4NXM E;  4DPT A;  3PYF A;  4DV4 E;  2UXD E;  1MU5 A;  1N0U A;  3J80 C;  1Z0W A;  3PYE A;  4X66 E;  2E5L E;  2F4V E;  4DUY I;  4JI3 I;  4JYA I;  1H7U A;  4DPX A;  3WU4 A;  4B3R E;  4NXM I;  2X7I A;  4DV0 E;  4K0K I;  1Z5B A;  4DV4 I;  1XMO I;  4FN5 A;  1S4E A;  4JI8 E;  1XNR I;  1Z0C A;  3F0N A;  4X66 I;  2E5L I;  2F4V I;  1ZM4 A;  2UUB I;  4JI4 I;  1Z0G A;  4DV3 I;  1N36 I;  1HNZ I;  2LJP A;  1WUU A;  3B82 A;  4YHH E;  1HNX E;  4JV5 E;  1MG7 A;  2UUC I;  4LFB E;  4DV5 E;  2ZIT A;  3ZZU A;  1U2R A;  1N34 E;  4JI0 E;  1FJG E;  4DR7 E;  1IBM I;  2A2C A;  1H73 A;  1IBK E;  1FI4 A;  1J5E E;  1HR0 I;  1XMQ E;  2HKE A;  3WU5 A;  2BM0 A;  2UXB I;  4B3S I;  3GON A;  2ZBK B;  3LTO A;  3QT7 A;  2HK3 A;  1HNX I;  5LMU I;  4WUB A;  5IWA E;  2EFG A;  4DR1 E;  1S16 A;  4LF6 I;  4DPY A;  4LF4 E;  4OX9 E;  4X65 I;  4JI0 I;  4DR2 E;  3OTO I;  2V8P A;  4WUD A;  2DEI A;  1J5E I;  3M6A A;  4HXZ A;  2UUA I;  3WU3 A;  4LF7 I;  1Z0B A;  1XNQ E;  3QT8 A;  3J80 Q;  4X62 I;  4DR5 E;  2VQE I;  4LFC I;  4PRX A;  3T1Y I;  4JI2 E;  4YY3 E;  1FNM A;  4DUZ E;  1NHH A;  1EA6 A;  4DV1 I;  2UXC E;  4KHP I;  4JI6 E;  1FWL A;  1H7S A;  3T1H E;  1Z59 A;  1RRE A;  1XNQ I;  2A2D A;  1I94 E;  3LNU A;  2HHH E;  3J7A M;  4AQY I;  4Z7Y A;  4JI2 I;  4URL A;  4YY3 I;  3QT5 A;  4R1F A;  2WW4 A;  1Z0V A;  3Q1Q A;  5LMN E;  4B3T E;  3D4J A;  4LF9 E;  2HKJ A;  2UXD I;  1KKH A;  2R3V A;  2HK2 A;  4P52 A;  1VIS A;  1N0V C;  3ZKB A;  4DR3 E;  4RPF A;  1HNW E;  4X64 E;  2DEJ A;  4LF8 E;  1MX0 A;  4DR6 E;  4B3R I;  4JI7 E;  4JG4 A;  2V34 A;  3LPS A;  2Q2E B;  4USK A;  1IBL E;  4LF9 I;  4DV0 I;  4LF5 E;  1QZR A;  2BV3 A;  4HY1 A;  4GKK E;  4DV7 E;  4JI8 I;  4NXN E;  4HAC B;  4B3M E;  2V2Z A;  4FWD A;  4DR3 I;  4LF8 I;  1H72 C;  4YHH I;  2HFU A;  4JV5 I;  4LFB I;  4DV2 E;  4DV5 I;  4M1K A;  2ZM6 E;  1BKN A;  1N34 I;  1FJG I;  4ED4 A;  4DR7 I;  1KIJ A;  4XTJ A;  4ZVI A;  4GKK I;  5BR8 E;  5A2Q Q;  1IBK I;  4NXN I;  2VQF E;  1XMQ I;  1N33 E; 
#chains in the Genus database with same CATH topology
 4KYZ A;  3PYD A;  1X4B A;  2HQI A;  4O3R A;  3VZI A;  5KFY A;  2IA6 A;  3UHM A;  1E6V A;  2R2U A;  4X4U A;  2V4Q A;  1ZS6 A;  2C38 B;  4ERD A;  4JI8 J;  3FCV A;  3OVA A;  4PU9 A;  4ZP6 A;  4JOU A;  1HNX J;  5KFB A;  2PI5 A;  4JYA E;  1WOR A;  3CJ5 A;  4LFA E;  3TYT A;  1AYE A;  2Z5C B;  4ETX A;  3TUI C;  2MZT A;  4NLQ A;  1TVR A;  1S6U A;  4WTO B;  4JI6 I;  2OIH A;  4I2P B;  2UUA J;  3GV8 B;  2V8D A;  5F0U A;  1RWU A;  3OHA A;  3TW0 A;  2D7S A;  3D28 A;  4A8Y A;  1CBK A;  4GQU A;  4MYT A;  2CQG A;  2FVS A;  2U1A A;  3N5B A;  3NGS A;  1S6O A;  4KQV A;  3G96 A;  1BWV A;  3ENW A;  1SJ4 P;  9RUB A;  2QX0 A;  4IFD F;  3PEH A;  3C66 A;  3ETO A;  2HIQ A;  3SFU A;  4AM3 A;  4ZVQ B;  2RB7 A;  1XNR F;  1NHJ A;  1S1W B;  3MFH A;  5JMN A;  1IBL I;  2CQ4 A;  1HWJ A;  4DV3 F;  3U7J A;  3I0S B;  4R0E A;  4RWW A;  5LSR A;  2C39 A;  5B09 A;  1TL3 A;  3MEC B;  3LP0 A;  2ZZT A;  4P75 A;  4I69 A;  4LF7 E;  3QT6 A;  5EKW A;  3M85 D;  1RAE B;  2XLI A;  1OY8 A;  4DV2 I;  2U2F A;  4X4O A;  3J7Y I;  2E7W A;  3JAM Y;  3EGW B;  4D3H A;  2FJA B;  4RUC A;  3N79 A;  4P2S A;  2PO1 B;  4FWH A;  4DV2 F;  4RUB A;  2NZ4 A;  2YWH A;  2D9O A;  2FD2 A;  1ZET A;  2BVZ A;  3S1T A;  3BO4 A;  4WF9 Q;  1JXV A;  1D6T A;  3PDN A;  1ZXM A;  2HBZ B;  1USU A;  2DRA A;  2FHM A;  1TZ0 A;  3UDL A;  1QM9 A;  4Q2M A;  2DR7 A;  4WKR A;  3PYE A;  1X5T A;  4OZL A;  1MRO B;  3AD9 C;  3ENV A;  1KDN A;  4FNH A;  4QNJ A;  2JOQ A;  3DXB A;  4R5P B;  4MKV A;  3VR1 A;  4ZK7 M;  4CO1 A;  3GG1 A;  3TNV A;  1RZM A;  2G13 A;  2GVZ B;  3DOM A;  3PZP A;  4FBT A;  4X66 I;  2IBK A;  1VQN S;  4J9R A;  1TUW A;  1KLM A;  1N36 I;  2DGO A;  3I56 S;  1RT2 A;  5IT9 Y;  5EWF A;  4ETZ A;  3CJ2 A;  4LSZ B;  2D69 A;  1I6J A;  1NPP A;  2FHJ A;  1SKS A;  2W8L A;  1RUS A;  3M1V B;  3UVJ B;  4X66 F;  3K5M A;  3QNW B;  1FI4 A;  3G4S S;  2VBX A;  2VPZ B;  4OHZ A;  5DJB A;  3QT7 A;  1HNX I;  3DLJ A;  4PWW A;  1S59 A;  4CQ1 A;  5U47 A;  4JI8 F;  5EWG A;  5LSO A;  3OLB A;  2AU0 A;  4B02 A;  3HMJ G;  2Q1L A;  4I0W A;  2DNY A;  3H20 A;  1HNX F;  2UUA I;  5GAH I;  1HBN A;  3HLU A;  1S79 A;  4KBI A;  2LVW A;  2MLX A;  4IH7 A;  3OR2 A;  5I42 B;  1SQE A;  1ZOT A;  3OL8 A;  3GE9 A;  5F8I A;  4IQM A;  5JVH Q;  3ZFV A;  4Y2A A;  4K4Z A;  5HBM A;  4K8R A;  1GMU A;  2UUA F;  4GVB B;  2N82 B;  1NJI T;  5H9E J;  1X4D A;  3LAN A;  4JI6 E;  1H7S A;  1T3N A;  5ETK A;  1K0T A;  3EGV A;  3D0H E;  2WVB A;  1TFW A;  3M2V B;  4O3N A;  1X4H A;  4L75 A;  1HPZ A;  4G65 A;  3R5J B;  3OTO J;  3IR6 B;  4IFD B;  4XK8 C;  1VOM A;  1F5C A;  2EG2 A;  2RU3 A;  3GTY X;  4Y2C A;  4DL7 A;  4Q8E A;  5CYQ B;  2FTR A;  1H2U X;  3RYL A;  1J5O A;  1RTI B;  1NLK L;  3BGO P;  3L7Z A;  3O1L A;  4LFC J;  2DY1 A;  2AZ1 A;  4CWB A;  3A1Y G;  1IBL E;  1TK0 A;  3PNI A;  3G6Y A;  2BOA A;  3MMJ A;  3VQT A;  2VBW A;  1LWE A;  3OVB A;  1N48 A;  3VVU A;  3LGN A;  4IOA Q;  2HFU A;  4LR8 A;  3BB5 A;  4DV2 E;  4NCG A;  5K36 A;  2J7U A;  1UPP A;  1JJC B;  3KWM A;  4F36 A;  2CQ3 A;  3TZZ A;  1IBK I;  5B0D A;  4OYB A;  1ARO P;  2IA0 A;  3H8Y A;  3SXL A;  5I3Q A;  3PX0 A;  2DIU A;  3MWB A;  2C2Z B;  5FLX Y;  5KOW A;  4I3H A;  1Y5N B;  2UUC J;  4ES1 A;  3W65 A;  4FW5 A;  2MTL A;  3EMT A;  1RAH B;  1PIE A;  4KT0 C;  5B0C A;  1FWK A;  3W9I A;  3MED B;  1F2H A;  2OEJ A;  4FW9 A;  4LF6 J;  1UL3 A;  3CDU A;  2YNG A;  2ZVI A;  4A8O A;  4KKO A;  1DTT B;  5JVG Q;  3OFE A;  2XMM A;  4HAC A;  1WI8 A;  3KMQ A;  4DQQ A;  3CED A;  1U24 A;  2KT5 A;  4Q7A A;  3BDP A;  3W1Y C;  1N36 E;  4DR1 J;  2I5J A;  1PYO B;  2CAD A;  5L39 A;  4EEY A;  1T9U A;  3G9C A;  1C4C A;  2EEY A;  4EK2 A;  3FGV A;  2W4C A;  1TKT B;  1EHW A;  1S0M A;  2KJV A;  2NSC A;  1G7C B;  2ZHB A;  2BKN A;  4GO5 X;  3HSD A;  4DUZ J;  2AYB A;  1LV5 A;  2XHC A;  1VBK A;  4DQS A;  3B4D A;  2ZZM A;  5CHC B;  1GMW D;  5F8N A;  4J90 A;  4ZIV A;  1G4C A;  4QYZ J;  4CLW A;  3L7U A;  5AE2 A;  3SCK E;  2UUA E;  2RAQ A;  3S6E A;  5KT3 A;  3KLF B;  4N47 A;  1HQ2 A;  2KVQ E;  4DLG A;  5L1L A;  1RTZ A;  2MKY A;  1S0V A;  3R2C J;  2PNL A;  4FF4 A;  1FVQ A;  1HIY A;  3PTW A;  4JUZ A;  3MAA B;  1ZM9 A;  2J7K A;  4ISA A;  5DNL A;  1ZAW A;  4I2P A;  2NPF A;  3KHR A;  3HM9 A;  5ETQ A;  2AW0 A;  3IR5 B;  2XNR A;  1VQS A;  3BSC A;  3GYX B;  2VFU A;  1RTJ A;  4KPY A;  3DNC A;  3OTO F;  4L73 A;  4IOB A;  4OYI A;  2YPZ A;  1M1H A;  1S9G A;  3VGU A;  4NXN J;  1PAE X;  4H4M B;  2Q6C A;  3IWN C;  1N0U A;  2E5G A;  4LFC F;  2NS1 B;  2BE9 B;  5KT4 A;  2GX8 A;  3A4T A;  4BWJ A;  3IC1 A;  1S1X A;  3PRB A;  1KD1 T;  3R5G A;  1HBO B;  3GJS B;  2ZBI A;  4DX8 H;  1EIY B;  2HHX A;  4A8F A;  2VPW B;  1FJC A;  5LSL A;  2H5E A;  4ZLL A;  1KFS A;  5A8R B;  3TUZ C;  1R43 A;  4OX6 A;  2UUC I;  4DLE A;  2Q3P A;  4CLY A;  3HKZ D;  4DR4 J;  2PO1 A;  5B0G A;  5DQH A;  2IYG A;  2XUL A;  1IBK E;  4AUK A;  5AT1 B;  2XC9 A;  4IRC A;  4FP9 A;  1VRT A;  4OHX A;  3P3E A;  5DRP A;  2UUC F;  1S0O A;  3FK4 A;  2QIF A;  3C6U B;  4NYP A;  4LF6 I;  4FVM A;  3V4M A;  3UDE A;  2VOD A;  2C2N A;  1U1N A;  1YWX A;  2LEP A;  4N76 A;  2GHV C;  5D3G B;  4LF6 F;  7AT1 B;  3DLG B;  1SBR A;  3MUT P;  3DRX A;  2ILY A;  3JQM A;  3GIL A;  2ZE2 B;  2V5H G;  4ZPC A;  3CCM S;  4ZPA A;  4FF2 A;  3P3G A;  2GVZ A;  5C0X F;  2HFZ A;  5AJ3 J;  2WBM A;  4DR1 F;  2FZG B;  4ZLP A;  4PG8 A;  1NK8 A;  4LBH A;  3J7A M;  1GXU A;  4QWD A;  4U8Y A;  3H98 A;  1R31 A;  4R1F A;  3W7B A;  3C6T A;  4QWE A;  2AJQ A;  1OWX A;  1FX2 A;  2ATC B;  2UXD I;  2HK2 A;  3UNG C;  4NBQ A;  2AYG A;  2UU9 J;  3PO4 A;  3O8W A;  2OKQ A;  5A6W A;  4DR3 E;  4DUZ F;  4F04 B;  2NXJ A;  2XYP B;  2H5I B;  2HS4 A;  3SV3 A;  1N56 A;  4LF8 E;  1Q4R A;  2OD4 A;  4ZVH A;  2RHQ B;  3MI7 X;  5CD4 H;  1YI2 S;  3I0R B;  1HLW A;  4M5I A;  2KZZ A;  3Q86 A;  5I42 A;  1REV B;  3P3C A;  1BY9 A;  1YTY A;  1YKW A;  3CCZ A;  3OJS A;  1XN9 A;  2HVE A;  4Q2L A;  3HVW A;  3NBP B;  1NH7 A;  4CNZ A;  5KFK A;  3L95 X;  5A2Q Q;  4NXN I;  2J8S A;  2G1H A;  1WAC A;  1LK5 A;  2R2S A;  2IES A;  3OT9 A;  5C7P A;  1HNZ J;  1WI6 A;  3OSP A;  2DXD A;  2DPI A;  2IRY A;  3TVK A;  4GO7 X;  1G2E A;  4F4A A;  4WII A;  1L3T A;  4NXN F;  5B08 A;  1HQU A;  5CYQ A;  3C8Y A;  4BHQ A;  3J81 Y;  1MNE A;  2E1R A;  3AA9 A;  2CQP A;  1VBY A;  3M6W A;  2LDI A;  2AX0 A;  2YNF A;  2EXU A;  3BQ0 A;  4OJG A;  4LFB J;  3KNA A;  2FY1 A;  2G0J A;  4F02 A;  2K06 A;  2AKW B;  4CO4 A;  2CQ0 A;  4DR4 I;  2VPY B;  1R6M A;  4CH0 S;  2L3M A;  1BGX T;  1NKC A;  4UT4 A;  5DNX A;  1ZPW X;  4X4V A;  1KN6 A;  4MQY A;  3KUH A;  2AIR B;  1RHK B;  3UN3 A;  5JEA C;  4DR4 F;  1NCL A;  4FWG A;  2UUC E;  4BA2 A;  3EGZ A;  4DQI A;  2HHU A;  1OS5 A;  1Z5A A;  3QPI A;  1O8B A;  5L1I A;  1RBL A;  2E7X A;  1XNQ J;  1RWV B;  4OYO A;  4EO8 A;  2B43 A;  1HL6 A;  3O44 A;  2AT1 B;  4ICL A;  2KZM A;  3IS9 B;  3FCH A;  2XEX A;  2XM3 A;  4LF6 E;  3M2R B;  3EDR B;  3DXS X;  1TMM A;  1U8W A;  1JWW A;  1UMJ A;  3H2L A;  2JNJ A;  3MED A;  2E5I A;  3V5R A;  2HAF A;  2A3J A;  1K47 A;  4WFX A;  1IWG A;  2PSZ A;  1BLU A;  3GSI A;  2OPS B;  4OI2 A;  1DTT A;  5C0X B;  1AFJ A;  3JTN A;  2ZUG A;  3Q8V A;  2NYH A;  4KE5 A;  5J2P A;  1T11 A;  2HQC A;  4PRF A;  5HVF A;  1QTN B;  2F5G A;  3NNH A;  3HI9 A;  4ED3 A;  2UU9 I;  4KR0 B;  1SQF A;  4JV2 A;  2Z2L A;  2F63 A;  5KOX A;  5GAG U;  4U7C A;  3HHK A;  4A47 A;  1IJE B;  3GJR B;  1TKT A;  2HHS A;  3BPD A;  1NPK A;  1L3U A;  2UU9 F;  1EET A;  1VLY A;  2UXD E;  5EX3 A;  2QMU B;  3T5J A;  2F4V E;  1R7I A;  3CTR A;  4OX9 J;  1T9W A;  4CLF A;  2FHK A;  2FLO A;  3I6P A;  1NND A;  3KLF A;  4MU3 A;  2V63 A;  2W2O P;  4LRD A;  3H5X A;  2G2O A;  4U95 A;  4UZB A;  1HNZ I;  3M7N D;  4WP9 A;  3MAA A;  2MMY A;  1OYE A;  4X4N A;  2G2Y A;  2ZIT A;  4ED2 A;  1U2R A;  2DJW A;  4IZK B;  1HFE L;  2UXC J;  2CA9 A;  1A7G E;  4CYU B;  2GAH C;  1Q5V A;  1Y0H A;  1HNZ F;  4A8K A;  4O0I A;  3PRV A;  2DT9 A;  2BMB A;  5KFH A;  3D6M B;  3NMR A;  2J0S D;  3LPY A;  3PIO Q;  4BCA A;  1TQL A;  3EIC A;  1V3R A;  2F1F A;  4H4M A;  4OZJ A;  4IH6 A;  2IM2 A;  2QA4 S;  4HKQ A;  3J80 Y;  1MLA A;  3EYZ A;  3AQP A;  2J0Q D;  3M6A A;  4OO1 C;  4M5N A;  4YHH F;  5F8J A;  3AOB A;  2BRL A;  1NXI A;  4LFB F;  2CUY A;  3QGP A;  2HQ3 A;  3QSI A;  1HBO A;  3CDJ A;  2BA1 G;  3T9N A;  1RI7 A;  2AYM A;  1IJF B;  4YY3 E;  2XSJ B;  5HVG A;  3T3F A;  4M5M A;  3TR5 A;  1S9E B;  2B4U A;  1NHH A;  4ZPB A;  1GAO A;  3VAJ A;  2FGC A;  2DGQ A;  4NRT A;  1XNQ I;  1H98 A;  1L5U A;  5A8R A;  3E01 B;  3KK3 B;  3KUE A;  4WPA A;  4ANE A;  3OTB A;  5MAO A;  4I2Q A;  2VL1 A;  4U9R A;  4Q0B B;  4C3M A;  1XNQ F;  3MMB B;  3PEJ A;  1JK9 B;  1KKH A;  3ZNU A;  1Q95 G;  4OQJ A;  2LDY A;  2LFV A;  1N5Y B;  2OFH X;  3A3N B;  2JWN A;  1KQK A;  3P06 A;  2DPJ A;  2LQB A;  4ALZ A;  3CDA A;  3KYL A;  2C2M B;  1TL1 B;  4ZOS A;  4OYA A;  2HBQ B;  1NJX A;  3TVY A;  2VV5 A;  1S77 D;  3AHP A;  4TLQ A;  2IMW P;  4AQY J;  4C8L A;  2NN6 F;  5J1N A;  3B4T A;  1N52 B;  2H4Y B;  1YH8 A;  4AL7 A;  1QAI A;  3H0P A;  4NCB A;  3J7A 1;  1S5Z A;  4RW9 B;  2V69 A;  5BYR A;  1PGZ A;  4FW7 A;  3RBX A;  2H1Y A;  3V4I A;  5IV4 A;  2RJZ A;  4OX9 I;  3BBB A;  5ETS A;  1UEK A;  4PWD B;  2VIH A;  1KHW A;  2HNZ B;  1GXL A;  1CJV A;  1TL4 A;  2GJF A;  4RUH A;  4CM2 A;  5CCM A;  4OX9 F;  2VFV A;  4DSI A;  1QTM A;  1C2P A;  2OPQ B;  2K1R B;  2DRB A;  1U6F A;  2ASL A;  2XMU A;  3W64 A;  5AXN A;  3M4X A;  1YVF A;  3I0R A;  3JSY A;  2CWK A;  4LCF A;  4LF1 A;  1P9Y A;  3EZU A;  4JI5 E;  4GC7 A;  4P7A A;  2UXC I;  3KKF A;  2EC0 A;  5K14 B;  3JAM C;  5D78 A;  1CQM A;  5HMZ A;  5IWA J;  3NBP A;  3EZ5 A;  3DU6 A;  1HNZ E;  2RDD A;  2CPX A;  3JSB A;  2P9G A;  5ETP A;  5I3P A;  3K8W A;  1RHM B;  1Y00 A;  8ATC B;  3EZO A;  5M2R A;  5D4O A;  4KH1 B;  1X9M A;  4FKY A;  1DLO B;  3UNY A;  2XS5 A;  1D9D A;  3J7A G;  1HD0 A;  5KFT A;  1JXE A;  1QAY A;  3F73 A;  2CDQ A;  1F2G A;  2WP8 B;  2DCL A;  1TAU A;  2K3K A;  3R8Y A;  4NZ6 A;  1NSP A;  4PPD A;  3B78 A;  3ZO7 A;  3ZZT A;  3X1L B;  4LF5 I;  3B8H A;