3PYDA

Crystal structure of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) from mycobacterium tuberculosis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
298
structure length
298
Chain Sequence
b'SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 84
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pydA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pydA01
3T1YI 2UU9E 1Z59A 1N0UA 4FWDA 1PKPA 4LF9E 2DEJA 2GS8A 4LF5E 1HNWI 3T1HE 2WW4A 4DR1I 4DV7I 4JI8E 3WU5A 3T1YE 4FN5A 2J7KA 4FWHA 2UUAI 1B63A 4JYAI 4JI5I 4DPTA 1XNRI 1HNWE 5L3JA 1FWKA 1N32I 1ZM3A 3Q1QA 4DR1E 4AQYI 1MX0A 4DV7E 1ELOA 2HFUA 1Z5AA 1FI4A 4YY3I 2UUAE 4JYAE 4JI5E 1XNRE 4DUYI 2EFGA 4DU8A 3WU4A 1N32E 4K0KI 1A6FA 4MYUA 3V5RA 4DU7A 2A2DA 3J81Q 4AQYE 4PRVA 2HHHI 1N36I 1OJ4A 4DV2I 2HFSA 4YY3E 2X36A 3K17A 2ZM6I 2E5LI 4DUYE 4FWGA 4EMDA 4HACB 4B3RI 2HK2A 4K0KE 2E1RA 3QT5A 3PYDA 2ZBKB 4WUBA 2BM1A 2HHHE 4XTJA 4RPFA 1N36E 5IT9Q 4P7AA 3H4LA 4DV5I 4DV2E 4LFBI 3ZZTA 4FW9A 4JI3I 2V34A 1DARA 2CZ9A 2ZM6E 2E5LE 1KVKA 4B3RE 1H72C 1N0VC 4PRXA 1Z0BA 4JI1I 3J81C 3V2UC 4USMA 4DV5E 4LFBE 4JI3E 3K1JA 1K47A 5GMDA 1KKHA 1FWLA 4MYTA 4DR3I 3ZZUA 4WUCA 1Z0WA 4JI1E 2LJPA 4DR6I 4ED4A 3JAMQ 5IT9C 1NZ0A 2UUBI 4X66I 4DR3E 4GKKI 2BV3A 1Z0CA 4JV5I 4DR6E 4HXZA 3CWVA 2UUBE 5LMUI 1NHIA 1MU5A 3J80Q 4Z7YA 5BR8I 1VISA 4X65I 5FLXC 4X66E 1FJGI 4GKKE 1N33I 4M1KA 3QT6A 3PYGA 4JV5E 4X64I 1ZXMA 1ZM2A 1NHHA 4JI2I 5LMUE 1Z0GA 4LF6I 3QT8A 5BR8E 1D6TA 4X65E 2UXBI 1FJGE 2XEXA 3PYEA 1N33E 3WU6A 4DV6I 1MG7A 4X64E 4DR4I 3HULA 4JI7I 4OX9I 4DPXA 1N34I 4JI2E 3LNUA 4ZVIA 4LFAI 4LF6E 4KQVA 2UXDI 1HNXI 2HK3A 3D4JA 2UXBE 4X62I 1FKAE 4KHPE 2VQFI 3B8HA 1XNQI 4DV6E 1FNMA 3LPSA 1RR9A 4DR4E 4JI7E 4OX9E 1S4EA 1N34E 3QT7A 4LFAE 2ZITA 1KTVA 2UXDE 2DEIA 2VF3A 4JI0I 1HNXE 4LF7I 4PU9A 4X62E 2VQFE 1XNQE 1H74A 4HYMA 1HR0I 4LFCI 3ZKDA 3ZKBA 3F0NA 4JI4I 4NXNE 1Z5CA 1BKNA 3LTOA 4USKA 4DUZI 2V2ZA 1ZXNA 4JI0E 4LF7E 1ZM9A 3GONA 5A2QQ 1HR0E 4LFCE 4HY1A 4JI4E 4DUZE 3B78A 3PYFA 2NPFA 4B3TI 4DR7I 4B3MI 3J7AM 3ZM7A 1H7SA 2AJ4A 5LMNI 1IBKI 2UUCI 3B82A 2BM0A 1EI1A 4LF8I 1S16A 4DPUA 4DPYA 4B3TE 4DR7E 4B3ME 2VQEI 1I94I 4B3SI 2R42A 5LMNE 1Z0TA 1IBKE 2UUCE 5A2QC 1Z0EA 4LF4I 1XMOI 4DV1I 4DR5I 4URLA 4HACA 3WU3A 3JAMC 4LF8E 1IBMI 1WUUA 4NXMI 2OI2A 2VQEE 1QZRA 4KHPI 1I94E 2HKJA 4B3SE 1B62A 2X7IA 4LF4E 1XMOE 4DPWA 4DV1E 4DR5E 2V2QA 2R3VA 1IBME 1PIEA 4DV0I 2A2CA 4NXME 3J80C 4DV4I 4YHHI 1Z0VA 4DV3I 5IWAI 1J5EI 1RREA 4JI6I 4NXNI 1KIJA 3M6AA 4WUDA 2Q2EB 3OTOI 4I3HA 4DV0E 1NHJA 2HKEA 4DXLA 3ZZ0A 5GMEA 4DV4E 4YHHE 4DR2I 1XMQI 4GKJI 1HNZI 1U2RA 1IBLI 4P52A 5IWAE 4DV3E 1J5EE 4JI6E 4UTGA 4UT4A 2F4VI 3J7AG 5LL6R 2UXCI 3OTOE 1XHKA 2UU9I 1H7UA 1XMQE 4DR2E 4GKJE 1HNZE 1PVGA 4LF9I 1EA6A 1Z5BA 4LF5I 1IBLE 4Z7CA 2V8PA 2F4VE 2V2VA 1ZM4A 5FLXQ 3T1HI 2UXCE 4JI8I 1H73A 4R1FA 4JG4A 1UEKA
chains in the Genus database with same CATH superfamily
1F3FA 2VBYA 1RISA 3OFHA 1VRUA 2QX0A 2E5JA 2HHPA 4ZVHA 2KG1A 2C2MB 2SXLA 2ZHBA 1FT8A 4DMZA 4DV2F 1EIYB 3DDNA 4DL4A 1KP6A 3KJFB 2MSSA 1O0PA 4B3RF 4WTOB 4NBQA 3ITHA 2Z57B 5JJBA 3MAQA 2E1CA 4JI6J 1XNRI 3MM6B 4TLQA 1KLMB 1HBUB 1LEOA 2OPRA 3R9LA 1FI4A 1OSCA 3TUIC 1VC0A 4JYAE 4NZ7A 1AFIA 3CCVS 4DU8A 1RP5A 1OPZA 5DNXA 4DU7A 3MPWA 1VIXA 4ZLLA 3QRPA 1LW0A 2XSFA 3QJPA 3MWBA 1UW4A 2IPOB 1JLQB 2RF2B 4TY8B 2IA6A 5C0XA 1TMJA 4HLBA 2XB2D 4RPFA 5LMNJ 4K4UA 3T5KA 5AJ3J 5KFIA 4X66F 3OBIA 4MU3A 4FXVA 4RUAA 4F04B 4MJKA 4H54A 1WC4A 1YHQS 1RT1A 3NBPB 4ATNA 3IWXA 2ACYA 2WP8A 5A6WA 1TK5A 3PCOB 4OO1C 3NGTA 4WZQA 3DRXA 4LF4J 3DGPB 1SPBP 1NNDA 3ZTPA 1RQ0A 2ZH9A 3ZFVA 4X64F 2EFPA 1WOOA 4OZEA 2DHXA 4G65A 2FY1A 4LF6F 2C2OB 2E5IA 1B99A 2UUBI 2ZZNA 5HP1A 1M90T 2HHHF 4KQZA 4OMFG 3NCRA 4K0KJ 2XMMA 1OY6A 3KFWX 3KG1A 2EFVA 4Y34A 4CQ1A 3I9ZA 1FRLA 4PWUA 1R27B 4DR4F 2VPYB 3PM9A 5IWAJ 2QLFB 2I38A 1RT7B 3US5A 4RW8A 2WVCA 3M8ZA 4RL1A 2DGUA 1XMQJ 2ZH1A 4JOUA 2VA2A 3EXCX 2MYFA 5F8JA 3MCNA 3DXSX 1RT6B 2MPUA 2G0IA 4X65E 4ED3A 1N33E 1KEKA 2DGSA 4NMXA 2CJYB 1H38A 1AZSB 1FRIA 4DCJB 2VBXA 4MKBA 4OI0A 4KR0B 4MKVA 4OYBA 2QLBB 4KHPE 4FBUA 1QVFR 4KO0B 4USWA 3HJCA 2Y0BB 4K4XA 4JI7E 3OR2A 2J76E 2B3TB 2YKPA 3QT7A 3W66A 2W2PP 4FBTA 4QWBA 5HLFA 4A8WA 5LT5A 2V69A 4QPTA 4LFCI 3KHRA 4FDFA 3UN2A 3LTOA 1RAJA 5ETLA 4DJBA 1Y9OA 1NKBA 2WCXA 5K36E 4DSEA 2ILYA 1TK0A 3KG0A 1HARA 3MM6A 5GAGI 1KLMA 3B78A 1LWXA 1RWUA 1TKDA 1ROFA 4TYAA 1HBUA 3BGUA 1KQSR 3TQEA 2YX4A 5H9EJ 4CI0B 5D0GA 4FXWA 4KB7A 3EZUA 5F8LA 3EDQB 4B9VA 1EI1A 2L48A 2H5IB 2DNKA 2UXDJ 2C2NA 2E9ZA 1R8PA 1X9SA 4WFBQ 5IS2A 3NL0A 1XMOI 1RLCL 2ZH5A 4LF8E 2RF2A 4TY8A 4EWTA 3CE8A 3MAHA 1IBLF 2CQPA 4KHPI 2DGQA 2VUGA 1NHUA 1UJ5A 1B62A 3C14A 2K3KA 2V2QA 1TP7A 2BKPA 1GXUA 4LF9F 1RU1A 1S99A 2JEAB 3NBPA 1U6BA 4YHHI 2W9CB 2IJRA 3MURP 4UOFA 3DGPA 3MM7B 3TA1A 3WBZA 1KRPA 5AT1B 4Q44A 1FCAA 1VQYA 3ZTRA 3GWCA 1U6FA 2LECA 3BQ1A 1SV5B 5B08A 5JEAF 4DV7F 4Q5VA 3SQGB 5KFEA 3FCHA 2JC0A 4ZVQB 2ZH4A 1J5OB 2DO4A 1PVGA 2C28A 1RT7A 2V2VA 4LF6J 1XERA 1H73A 4WCEQ 1N88A 1FRXA 2GVZB 1MLAA 3VVTA 4CO0A 1Q79A 3PZPA 4LF5E 4DR4J 4KGVB 5DGBA 1RT6A 1IXKA 1A6LA 5K8OA 2C2EA 3CSKA 2J5AA 3FZBA 1IM6A 4P73A 2AIRB 4DL5A 4IOBA 4BDPA 1AZSA 4ZPBA 3MUTP 4LFBF 4HTIA 1T94A 4HHJA 4QU6A 3N28A 1HNZJ 4PYDA 4GRSA 4KO0A 5D6GA 2LVWA 4JI1F 5F9NA 3CCMS 3MD3A 1WTBA 3ZNUA 3I56S 4WIQA 1S9EB 2XCPA 3OTCA 3M4XA 5KAKA 2RVJA 2HS3A 2X51A 4RNFA 2B4VA 4YUDA 1WDDA 2OUGA 2Z5EA 1N5QA 3AA8A 3J81j 2V94A 2ROEA 3CCES 3J80Y 2KFNA 5LM7E 3V81B 1U1MA 5BR8F 3MGJA 3BKTA 3HHEA 4UOHA 1SC6A 2Q1LA 1R0AB 2MHEA 5FDLB 4MDTA 2E1MC 1MNEA 4OJHA 2K3IA 1U8WA 5HJYA 5CYMB 1NJYA 3QSYB 5HMXA 2HBQB 4OIXA 1YITS 3R6GB 4GKKI 3BO3A 4DV4J 4A8OA 3HO1A 4DR6E 3CMQA 4YB5A 1JXVA 3TZZA 1U1OA 2FHJD 4NLRA 2DRBA 1XNQF 2MY8A 5ELWA 3MM8B 2JEAA 2W9CA 4UY85 1IBLJ 3QZ7A 1H3DA 3MM7A 1N5YB 2VDIA 3B4DA 2QL5B 2PEBA 1CJKA 3FFIB 5HMZA 3N0VA 3K57A 3FEXB 4B08A 4DUZF 3DLBA 2PO0B 1SV5A 4LF9J 3OFGA 1UDSA 5C0XD 4KH0B 1WNEA 1Q1KA 5C25B 1XK8A 3SQGA 5KFJA 2BDPA 3DU6A 4YN3B 2H54B 2CPFA 1K0VA 2XGQA 2C39B 5GAGU 1JNRB 1N5TA 2HNYB 1J5OA 3VF0B 1NU4A 2PDAA 2W2NP 3M8YA 1JK9B 2DPIA 4B3TF 4AD6A 5IQ6A 4LFAE 4M5KA 3MUMP 4JV1A 1HNXE 1OPIA 2GVZA 1PJ7A 4MK8A 2H5JB 4RW4B 3NOCA 4JI4I 1F5BA 5AE3A 4O4GB 2DJWA 5KFMA 4PPDA 3V4MA 3SSRA 3GJSB 4P7TA 4LREA 2KFYA 3BQ0A 1T9VA 3SCKE 2V8VA 4LBIA 2Y1JA 1BQNB 3SCLE 4IYQA 2KRBA 3JSYA 4NOHA 1GX5A 2HURA 2W8KA 1VQMS 2GO3A 2UUCI 3B82A 2Y9HA 3GG0A 2BM0A 1XQIA 3P5TL 4IH7A 5DRPA 2AZ3A 4XIUA 2AGOA 4DG1B 3GJRB 4B3ME 2CNKB 5B0FA 2ASDA 1NDKA 2Q6CA 1E3PA 2VQFJ 4P75A 1S9EA 4LFBJ 3EYZA 2VG6A 3DYAB 4RX6A 1X4EA 3CB4A 2E9RX 4KV8A 3MEEB 2NSCA 3WX4A 2Q6BA 4EI2A 4ECVA 2BBEA 2F40A 3P3DA 3D1HA 2IRUA 1VQ8S 3HKWA 4ZN3A 1FD2A 3O2IA 1PC5A 3V81A 2UVWA 2IESA 2MLZA 3O5TB 4RO0A 4A46A 1LW2B 4K2XA 1XR7A 2EEYA 4LVNP 5CZVA 1X5TA 4I3HA 2JLFA 1NHJA 1R0AA 1RTIB 3UI3A 5DQGA 2PO1B 2ZE2B 2QL7B 3K59A 2EBGA 4ID8A 3UD4P 3PJ9A 4LF1A 4DR1F 3SEOA 3U1KA 1OIAA 1IR2A 5CYMA 3OHBA 4DSJA 3ETOA 2DNZA 3NMRA 5LL6R 2ATLA 3X3UA 2AP6A 2V4JB 2WB4A 2ZHOA 2ZKTA 4GKJE 1EA6A 1WF0A 3V4IA 3NNAA 4WYWA 4M5GA 4AL5A 2PFDA 3R8YA 1BGXT 4DDFA 4DX6A 1NK8A 4YY3F 3MM8A 1QTNB 3S8SA 2YQ0A 4ENOA 1N5SA 4V19J 3VAFA 4YDXA 4DV6J 4FWDA 5ETMA 2YNHB 1YRUA 2JNJA 3PRVA 2QA4G 2VU5A 3RAQA 9ATCB 2DHSA 1AYEA 2G1HA 3FFIA 4OQJA 1EAYC 2E5LF 3T1YE 3D3BJ 2O67A 4Y2AA 4KY3A 1DLOB 2VFRA 5C25A 2HWHA 3NCPA 2OD4A 4JI3F 4N56A 2C39A 1RKJA 3DLEA 2HNYA 1Z5AA 2B7CB 3BEGB 4LRBA 3S7RA 5I42B 3HVAA 3DNCA 4OZ1A 4OZNA 4C8LA 4F4KA 2BMBA 5KFTA 2R7TA 4PRVA 2I8EA 5KFNA 2HHXA 3RTVA 1PSDA 3BSCA 4RW4A 5BYSA 3MECB 3K17A 1RAEB 2ZM6I 3MCMA 1KQGB 4CO3A 2QN6B 4B3TJ 1RYSA 2CUYA 1N36E 4P7AA 3DXBA 4L73A 2CZ9A 1SBRA 4NX9A 2IOPA 4NLYA 3GILA 1BQNA 3KOAA 2C22A 4ZITA 3PIOQ 4OYWA 1R8AA 2DY9A 2C3OA 3OFEA 3EWGA 1BD6A 4CLSA 2QYGA 3FSXA 3D9BA 1S97A 4DG1A 2FPHX 3RRKA 4DR3I 1G7CB 3JTNA 2CYYA 2BJ1A 4O4RA 2EPIA 2M52A 2XMTA 5CYJA 5K36A 1T05B 3MEEA 3FEZA 2JLGA 1WD6A 2JOQA 3MR5A 3DI6B 4IFDC 1FDDA 2XY5A 2XY7A 1Y4UA 3CWVA 2KXNB 2NREA 4QWDA 4ZPDA 4F2SA 2JVOA 1B4SA 3C8YA 3G87A 4KBIA 2HRTA 1LW2A 4EO8A 2IBKA 1NHHA 2FUG9 3GV7B 3C6UB 2Y1LB 3OD2A 1EHWA 2PO1A 1SVDA 2ZE2A 1FRKA 2IDLA 3RB3A 1TAUA 1WF2A 5A8KB 3DDIA 1R8CA 3KUEA 4ED0A 1UZDA 1RCXB 2CWXA 3GE9A 2FIUA 1S6OA 2DNYA 3AXKA 2LEAA 4WK3A 4DR7F 2OTLS 1B64A 1W26A 3PRYA 2PGCA 1N34E 2M4MA 4DSIA 4DR1J 4FP9A 2DEIA 2VF3A 3CJ2A 4JI0I 3DD6A 1HWUA 2M5YA 4C8ZA 3BR8A 2B9WA 2YNHA 4CIOA 1K1SA 4NXNE 1Z5CA 3CCJS 1R3NA 3O3LA 1ZXNA 4DSFA 3DRRB 2ZZTA 3TZXA 1O6XA 4DV1F 4TQSA 4DR5F 4F4XA 4QQBA 4YY3J 2CDQA 1DLOA 4M95A 2DH7A 3NWRA 3NZKA 1T9UA 4TLRA 2XMJA 3PYFA 4K2JA 1R0BG 1BLUA 4OJ3A 1H7SA 2O01C 4DV0F 5I42A 4ZVRB 3UD5A 1PAEX 3TWZA 2RE1A 1NDLA 2V8GA 4FPIA 5G4DA 3IRWP 4I64A 2PO2B 1Q95G 1RDRA 3D67A 1I94I 4B3SI 2F8HA 2B6AB 3MZIA 3MECA 3A8KA 4JUZA 4JI3J 2M7SA 3RAXA 3BSOA 4NXMI 2QFJA 2DNGA 3H25A 1WHXA 1QZRA 2DGXA 1RTZA 1SI9A 3Q8UA 2CQCA 3CCLS 2ZDOA 3FMWA 3P3EA 4OYAA 1LV5A 3J80C 4DLEA 5JVGQ 1X4CA 4IFDE 4F50A 4NXNI 4WWSA 2VFTA 1EB0A 5ETTA 1D9DA 4P52A 4KPCA 4ZVTB 1T05A 3N5FA 3GSDA 1XHKA 1OQ6A 4QCLA 3GFHA 5DLFA 3DI6A 3J7YI 1U1NA 2LXIA 5B0BA 3FGVA 1RI7A 1HI0P 4BBYA 1Q7LB 1S9FA 2JFKA 3LGHA 2MKKA 4Z37A 4R1FA 5KFOA 1SKWA 2KKHA 1ZS6A 2N3OA 3DOKB 2CVIA 1Z59A 4LIRA 4OI6A 2ZH3A 3NAHA 3DLGB 3GG1A 1VQSA 2EXUA 3W8GA 3C6UA 2ADBA 4JI8E 3U1YA 3H7HB 2Z56B 3FKBA 3RAMA 2QTWA 5C5JA 2J7KA 2HGLA 2H3EB 3M8WA 4OYZA 4UW2A 3GIRA 2Z2YB 5A8KA 5LSRA 1ZBTA 1NRKA 1FWKA 4WP9A 1F2GA 5KTQA 1XJWB 3TA2A 4K4ZA 2HFUA 4I1TA 2B4PA 1E6VB 3GU0A 4I2QB 2QV6A 1UETA 2EKYA 3HMJG 3QFWA 1ACMB 3DM2B 3M85D 2A2DA 4IO9Q 3A3PB 1Z2LA 1UJ4A 2PI4A 5E3AA 1C1CB 2MZ1A 2GZOA 2CQ4A 1TL1B 2AE8A 3CT9A 3LANA 1AUDA 4DUYE 4CLKA 3QLHB 2MKHA 4NA2A 5F8GA 2N4DA 3DRRA 2AF6A 4DR7J 4KJIA 3H4LA 1TFYA 1S12A 1ZA1B 1MU2B 1DARA 1H72C 4WJBA 2PD1A 2VJVA 4ZMMA 3EMTA 5D0HA 2XLJA 2APOA 1NJIT 3GR1A 4X65F 5IXUA 3SBMA 3CCRS 1XNRJ 4DV1J 4DR5J 4FF4A 3PR4A 2CQ1A 1XTZA 1EZZB 2D74B 2R7OA 4FS1A 3SV4A 3ILLA 2PO2A 3PKMA 2OPPB 2B6AA 3DLKB 4I0WA 1JXEA 3GLLA 2AT1B 2LXUA 2DXEA 5KFZA 3BKUA 4DV0J 3LPYA 4RR5A 4JI7F 3IGVA 5FWKA 2VB6A 3M30B 4F26A 1RWPB 4HXZA 3GCXP 5K8NA 2KL8A 1FJGI 5C24B 2HAFA 4JV5E 1KDNA 4PABA 1UPPA 2D3OR 4DCOB 5K8PA 4JI2I 5K36F 1FXLA 4M5NA 4ZP7A 2CPIA 3UDCA 3H5UA 3V6KA 4NYPA 2A6OA 2UXBI 1S9GB 1KHWA 4DL2A 3G82B 2RDIA 3TVYA 2LEBA 5F0WA 3LNUA 5CZXA 1XXEA 1NJWA 4AE5A 1TKZB 2BZ2A 2KT3A 4OX9E 2W7AA 5L46A 2ZUAA 5EGYA 1KTVA 1XWLA 7AT1B 1LXNA 2KRRA 2AJFE 3DOKA 4LF8F 3LAMA 5KFWA 4JYAJ 3KKFA 3DLGA 3SDEB 3L7OA 1IKYB 1RWXB 5B7WA 1T03B 1SL1A 4N41A 3M9NB 2HFOA 4IZKB 2EG1A 3H42A 2W25A 2PMZD 4KYZA 1S59A 3ENWA 4Q2MA 3TVKA 2IAJB 2V6AA 2H51B 1WELA 1E6VA 5LMNI 4I2QA 3ZZZA 3EVWA 4NCGB 3DM2A 5C2CA 3AJDA 4YS2A 4GQUA 4ANCA 1N4LA 4M5DB 3N6NA 4NRTA 1TL1A 1K44A 4LF4I 3PHTA 2YKOA 3QLHA 5CQGA 4ZVGA 3Q24A 4B9UA 1T02A 1VRQC 2ZDPA 1R8BA 2RQCA 1MU2A 1SKRA 4DN0A 3MPDA 4PXEA 3L09A 1RAFB 1Q5VA 4U96A 3FZ2A 3J7YU 1IBME 2HQIA 4DSLA 4LF5F 3BO2A 5DDOC 1VCTA 1CG2A 1UL3A 4NI2B 4MKAA 2MKJA 3HXMA 1Z0VA 3CCZA 3R7BB 3P76A 5IWAI 4DV3I 1RREA 1DFDA 2XY6A 4U6PA 1GX6A 1C0UB 2HKEA 3R27A 2OPPA 3OV7A 3PXGa 1XMQI 1GK8A 3MEDB 3LPEA 1SCJB 2RQKA 3DKDA 4ZCLA 4NWBA 2P2CB 1H6KX 4X65J 2CQIA 1X5OA 3LAKA 1N33J 1K0TA 3M30A 1KVJA 5E2QA 1XMOJ 2UXCE 4ELUA 4QIFA 4KHPJ 1P8GA 4N47A 3UCGA 4LRCA 4F67A 3D0HE 1HLWA 1B0PA 2E5GA 3RRHA 4OZ3A 4OI2A 1Y5NB 4ZLPA 4C2MA 2F5GA 3WU5A 1S9GA 5EWFA 3N9UC 1FK9B 4YHHJ 2NN6B 4W90B 2VZ9A 1B63A 2G1DA 3PV8A 4DPTA 5LXRA 3G82A 4X4OA 4A8XA 3OXGA 1ZM3A 3D5MA 4DR2F 3Q1QA 1MMNA 3TAMB 4HI1A 1NK0A 5J2MB 1NAQA 3KWMA 2L9NA 1RBAA 2HHQA 1TKZA 1DBDA 2BOPA 4LOMA 3FCVA 3T9ZA 2V5HG 2JEJA 4FS2A 2CQ3A 2XHWA 4DV2I 4CT9A 2W7PA 2X36A 1U47A 3SDEA 1IKYA 2D3ZA 4FWGA 5DGAA 1USUA 3HKMA 2XS5A 4B3RI 4C8NA 4YR3A 4DR6F 4USVA 2CGEA 3KG4A 4IZKA 2HHHE 3FBBA 2ZC4A 3M8PB 1G2EA 4WZMA 3W5XA 1UFLA 3NS5A 4LF8J 1UDQA 5HMYA 3GMGA 2IAJA 1Z0BA 4I56A 3SCJE 5GAEI 4EZ6A 3CCUS 4USMA 3K1JA 1U1RA 4ERDA 3P45B 2IDEA 4Y6IA 2LMIA 4NCGA 4X84A 1FWLA 5JEAC 1C1BB 1RTJB 2XMVA 4ZJLA 3D6MB 1UCNA 1NK7A 2K7KA 4Q45A 2DO0A 3A3OB 1BMQB 2COLA 1HMVA 4JV0A 5J2PB 3CJKB 2ROGA 2BJ7A 4X66I 3IWNC 4ZIWA 1AW0A 4LFAF 1B70B 4FXDA 1WI6A 1X60A 4Y28C 1NHIA 3UCUP 1PBAA 2W4PA 4HI2A 2I2YA 4NI2A 3G8TA 2RUSA 3CPWR 4X64I 1KQKA 4J37A 2Z5CB 4KIAA 2HIYA 4WXOA 5AXMA 1RHQB 3H0PA 4LF6I 4LCHA 3AB4B 4OJGA 4USJC 1NMEB 1GTHA 4O0IA 2QIFA 3MEDA 2BACA 1JLGB 1MG7A 2FVQA 3Q8RB 3C3LA 3KNAA 4DR4I 2VKRA 4OO1B 3AY0A 3QO9B 3RRGA 3BGFA 1B0VA 4YB1P 2AX1A 4OX7A 4ECYA 4MU1A 3ET6B 4ZP9A 3VWSA 4NLTA 4GKKJ 5AE2A 4F3OA 3R5AA 1H74A 3AFGA 3UQSA 5HL7Q 3ZZPA 1QSSA 3Q8YA 2Z0GA 2HNZB 3CEDA 1VQ6S 3THVA 3RBDA 1C4CA 1FK9A 4LF7E 2VPWB 2BQRA 2NN6A 3A4TA 1GMWA 3EX7B 2NZCA 3PW7A 3GZ7A 4RU2A 1VLYA 3MEKA 1RJJA 3W3SA 3TAMA 3RG6A 2G0CA 4LSLB 5J2MA 3DRPA 3W7BA 4YR2A 2AJ4A 2F7VA 4Q8FA 2DNLA 4EYIB 2F1DA 2DR7A 1D3WA 5J2QB 3C46A 2XWYA 1S16A 3MR3A 4K8RA 1NPRA 3WC2A 4DPYA 4QW9A 2W9BB 3D1QA 1GMVA 4K5RA 2CG9A 3UN3A 4TXSA 3OL7A 1VRTB 1NH8A 2JC1A 1RCOB 3OLBA 4DZDA 4GKJF 1DRZA 4ZVPB 1YBAA 3I9V9 3HZGA 3M8PA 2RUGA 1V3SA 3HI9A 2R2TA 1SKSA 3JTPA 3CJRA 1TUVA 3Q8PB 4OLPA 2ABYA 4EBEA 4DV4I 4DBQA 5L1JA 4DR6J 5HQMA 1PO6A 3T1YF 2GHPA 2C3PA 3CCWA 1C1BA 4DXLA 1RTJA 2KO1A 4KGKA 3B4TA 1XN9A 1G6BA 4CO4A 3AB2B 1ULRA 1IBLI 2J0QD 5ETSA 4CP5A 1TUGB 4HH0A 4AXJA 3CJKA 3WHIA 3OTOE 2HPUA 3AOAA 3LALA 3N4WA 4LF9I 3BDEA 3Q6NA 1RHRB 2XO6A 1FX4A 3IR7B 4DQIA 2OAUA 1N52B 1FXRA 2UU9E 1TL4A 1MW7A 1XIQA 1OSDA 1NB7A 5KFAA 3IAS9 4ID5B 5DO2A 2Z5CA 2EWHA 1N36F 3H20A 3A8IA 4LFAJ 1S1WB 3RJMB 1WG5A 4DV7I 4IQXA 1PYTA 1HNXJ 4DL7A 4QW8A 1WI8A 3JAMU 4ZLNA 2GAHC 1JLGA 3D54A 3R5GA 2XNRA 2CQ2A 1D09B 4LF2A 3GMEA 2FLNA 4C9DA 2DVIA 4PG4A 1O51A 1YZ7A 3QO9A 3HHNB 3P49B 4KHRA 1X31C 5GAEU 2DR5A 3Q0AA 1QUPA 3ET6A 3RUBL 2Z58B 1N32E 1N6QB 2UV8A 3J81Q 2RKIA 5KFYA 3GFYA 5HJXA 3M6VA 5C0XE 1MN9A 4N7TA 2HNZA 2NYIA 3HM9A 4OX6A 3M2RB 1RGVA 1BUXA 4XPCA 3ENAA 2GW8A 5EN1A 4B3MJ 1IR1A 2I0XA 4Y0FA 1EQMA 4LFBI 3DMJB 4C11B 2DIVA 3R5CA 1VHIA 2ZJRQ 3HSDA 1TU0B 2E9TA 3DC2A 5E0OA 1SH0A 4LSLA 2IA0A 2HRYA 4JI1I 1YJWS 1Y3KA 2KT5A 3W9IA 2QRRA 1RT2B 4A48A 4WYLA 3Q2SC 5J2QA 2MQ8A 1VK8A 4P2SA 2MLXA 3RR8A 2HEKA 4MYTA 3SSQA 3CTRA 2W9BA 1QM9A 5KOWA 4I68A 2DR9A 1HFEL 4DFJA 1JJHA 1VRTA 1UDOA 4ANEA 5CAAA 2P9CA 3CDUA 4Y2CA 4U7UD 3KLIA 2WZ1A 2OH2A 1N34F 2FYXA 5CD4A 4MKYA 4BHQA 1NK5A 2ZM6J 2FC8A 3DLJA 2YNGB 5EWGA 4ED1A 1IKXB 3J80Q 5BR8I 4Z7YA 3IXQA 1D0EA 3CJ8A 4GKJJ 3BYRA 4ZN1A 3M9OB 3G6YA 5ETOA 5HSPA 1ZM2A 3QT8A 4YEAA 5CCLA 3KLGB 5L1IA 2BR2B 4USIA 2Z5BA 4DV6I 2BR0A 2BANB 2BKNA 1VFJA 3U1MA 4ZVSB 5FJ4A 1QAJA 3KDOA 2YBVA 5E33A 1ZZFA 4ZVUB 2YY3A 1XNQI 1WTFA 4WFAQ 2GHVC 3ILIA 3L3CA 4H4OB 4F2RA 1WWHA 2RRBA 5KG2A 4M5JA 4DLGA 3R1LA 3IR5B 2GQQA 2FY8A 4NZ6A 2H1YA 4ID5A 1UA0A 4NRUA 3VCDA 4DUZI 3CGIA 3PO4A 3AD7C 1S1WA 3ENQA 2AGQA 2IYIA 2NYHA 4ZCIA 1VQLS 4MU0A 2CPZA 4FW5A 1XBWA 5L9XA 3EXYA 2MQLA 4P71A 4ZPAA 2UVUA 3POTB 4N76A 4IFDF 1Q86T 3EVOA 4TVAB 4Y00A 3VHQA 4B3TI 2Y3YA 1U48A 2W24A 1N36J 3G96A 3ZM7A 3FCWA 4PG5A 5KFPA 5FLXU 1DQ8A 1A7GE 4C8KA 1NK6A 1NUEA 1NHVA 5EX3A 2VV5A 2AWZA 4E8UA 1RWVB 1QSLA 1CBKA 4KE5A 4IOCQ 1IBKE 4L3KA 5KG4A 4URLA 2HVDA 4FVCA 3M2RA 2G2OA 4J9NA 1YKWA 4TU7A 2FHKA 4OZ5A 2RILA 3KUGA 2O1VA 4IDKB 3FMBA 1HNVB 3DMJA 3M6WA 3DLLQ 4DPWA 3OSPA 1JLAB 3QJJA 4LIWA 1RT4B 4PG6A 3BBCA 4ES1A 2O1WA 1IVZA 5M2UA 5D3GB 1RWKB 1N56A 1L3UA 1WSRA 2FJDB 1RT2A 4JI8F 1HWJA 4DUTA 4IRDA 3Q8SB 2NR0A 1JJ2R 3R5BA 3ZZ0A 2M9KA 1HPZB 4URSA 1J5EE 4JI6E 3I0RB 4Y3CA 4CWBA 2HQDA 3IM8A 5LXYA 2V63A 3TX8A 3PW5A 2NN6D 4PWDA 4JBCA 5L1LA 1GMWD 2R7RA 1KTQA 3E2EA 4ECWA 5DLGA 4BLGA 1S1VA 2YNGA 2WVFA 2Q43A 1IKXA 1KOHA 2IM0A 5HO4A 3H4DA 4DUYF 4ECUA 3W64A 1UPMB 3M7VA 3D3CJ 3M85G 3MHYA 3T9NA 1PKPA 1FO1A 1CJUA 5KFRA 4DR1I 3KLGA 4ZCKA 2BR2A 1Q8LA 4K4SA 4BS2A 2VD3A 4CLTA 5RUBA 1NHKL 1OYPA 1R89A 2BANA 3Q6MA 3UCZP 2F4FA 4NXNJ 4OZ2A 2Q3PA 3MMAA 1UKUA 3JSRA 3E8OA 1PGZA 4OI3A 4FNIA 2OHDA 2KXFA 2Z30B 5HN0A 4Y2KA 2AU0A 4YFUA 2Q66A 5DS7A 1HNIB 2NZ4A 3V6DB 4YY3I 2VA3A 1Q8KA 3QAEA 4H4OA 2DY1A 4IR9A 2OD6A 4AQYE 3OUYB 1IKVB 1OJ4A 1CPZA 3J7Z5 2CADA 5B0AA 2E5LI 1J2VA 4K0KE 3CCQS 2BRKA 4NLDA 3PYDA 2ZBKB 1W25A 1TK8A 5IT9Q 2Z2MA 4URGA 1HA1A 1X5SA 4FW9A 4JI3I 2G2ZA 2CFXA 3TANA 3POTA 1FKPB 4PRXA 4JV5F 1R31A 2OMOA 4TNOA 1FF2A 3CJ5A 2AJ1A 5EKWA 4IKAA 1ZOTA 2WB1D 3G86A 5GMDA 3EZ5A 1YJNS 2VPZB 4EFAC 4UQTA 3BB5A 3B54A 3CMAS 4ECZA 1M5OC 3KLEB 4OYMA 3WDOA 1VQ9S 1UWBB 3HZEA 3M7ND 3M2VB 3CD6S 5THWA 3KJVB 1YQHA 3WZ0A 3FK4A 2ACMA 7FDRA 1W2BR 4OX9F 3BGRB 2PNMA 4IDKA 1Z0CA 3V6JA 1HNVA 2ALZA 3DHXA 4OO1D 1JLAA 3TVZA 3T5HA 1RT4A 1VQPS 2YNFA 4K50A 2YH0A 2ZKUA 3MPYA 1D8YA 5D0RA 2R8JA 5D3GA 2Y1RI 3HFKA 3VGVA 1FFGB 1L3VA 1DTQB 4UUXA 3CCTA 4UY8T 1Z0GA 3NNHA 3PX4A 4DX7A 3WU6A 4W4MA 2WVDA 1HPZA 2OPQB 4CO2A 1FNXH 1F5AA 4WFNQ 3IGNA 2CQDA 1S1UB 2XBPA 3I0RA 2EKNA 5IV4A 3HULA 1ZPVA 2OPSB 2B9EA 4XDCA 1OY8A 2YWWA 2H65B 4JI8J 1NSAA 4ZVEA 3MD1A 3SIPB 2EFOA 4X4UA 1SIWB 4C3LA 5D4NA 3WX8A 3Q23A 2R8GA 4RKUC 2C2DA 1X4FA 3AODA 2UXDE 4RWWA 1DURA 2HWIA 3TJAA 5B0CA 1N54B 3E51A 3LUYA 3HSGA 3BPSP 3ZKDA 4IH6A 2ZBIA 3MFHA 3DHWC 3P96A 4FF3A 2HSEB 1SJRA 4F3QA 2JEFA 1FJGJ 4ECXA 2FHOB 2GVDB 4DQQA 4A4JA 1IBMF 3QBCA 3JQKA 1NB2A 2HVEA 4DUYJ 3CULA 1S7IA 4RU9A 4IG3B 4JI2J 3P3GA 2W4CA 4EU0A 3ZZOA 4DSKA 4WU3A 4DR7I 1AFJA 2QO3A 1RA7A 4O3OA 5CD4H 5BYRA 1HNIA 4ZJOA 3V6DA 4MIAA 1VHFA 3C19A 4S0MA 3H8YA 3Q8QB 2ASLA 4IZJB 4P7VA 3OUYA 1IKVA 1HD1A 2GGPB 5T14A 3HCXA 2JT2A 3PW4A 5KG0A 3UN5A 4DV1I 4DR5I 3VZHA 1IR0A 1X0FA 3JSBA 3W5ZA 2E66A 2CDRB 2L9WA 4IQMA 1XEZA 1HYSB 4I67A 4LMZA 4X4NA 2M8HA 2NXUA 3QIPB 4OYIA 4YDDB 2Y8WA 2VQEE 2FHJA 2BYCA 1J27A 2OFGX 1FDAA 3HF5A 2ZBQA 2UXCF 2F9JA 3KMQA 1NH7A 5HBMB 3MR7A 4DV0I 4RWXA 3S6EA 3F41A 1JLBA 2PFFB 2F3JA 1TAQA 2K06A 5K36C 3DOMB 1NJXA 3HHKA 2MXYA 2RDDA 3MM9A 4LQ3A 2BQUA 2NPIA 1DQ9A 1ZYQA 2EFNA 3GJTB 4KGZB 2MZQA 2B9YA 4JP8A 2M70A 3CIMA 3KLEA 4JV5J 5ETRA 1QJHA 5E3QA 3M2VA 3KJVA 2CKWA 2IOQA 2ZNZA 2QC3A 1I51B 2R9LA 2RDJA 1EETB 5JVHQ 1HNZE 4C4WA 1RTHB 2MKCA 3NKYA 2F4VE 2VG5A 4LRAA 3MM5B 3R6LB 4ALZA 4B9NA 2W1BA 2HWTA 4M5MA 2DHAA 2HRUA 3CO0P 4RW9B 2RSQA 3CDWA 1DTQA 3VALA 1Y3JA 2KM8C 1LXJA 2RH3A 4X4QA 2W9AA 2F9DA 4AL6A 2OPQA 2RIJA 3VV2B 1RTDA 4JYAI 1S1UA 4DV3J 3RBEA 5D78A 1RYRA 4USTA 2OPSA 2YPZA 5IV3A 4OHYA 4AYBD 1IKWB 4RNOA 2MQPA 3NS6A 1VI7A 4ZPTR 4CLUA 3I5AA 2UUAE 4JI5E 2P6SA 1NSPA 2MZRA 4MT1A 5IT0A 1S49A 1C0TB 1Y4SA 3ZZYA 5CA5A 1HL6A 3F73A 4MYUA 3I87A 2O3DA 4K4TA 1I6JA 3CUNA 2QG9B 4EMDA 4HACB 1UEVA 2IM3A 1SL2A 2HK2A 3I4HX 3ULHA 4NLGA 3FBFA 1Q4RA 2GVDA 2V8HA 2CNNB 2IJFA 4PG8A 8AT1B 3MF5A 3ZZTA 5EX0A 1X5PA 1VIOA 3OVBA 3EPGA 1W7WA 4IG3A 3IS9B 4P2FA 3CC7S 4Q8EA 1QVGR 4GVBA 4X4PA 3HK2A 2W8LA 4KHMA 3KLVA 3GV8B 2ERRA 4M8LA 2VJUA 1TQLA 4F4WA 2HHWA 1TELA 1S7HA 5A0YB 4ED6A 2DKOB 4CLZA 1NSKL 3BR9A 2GGPA 1I1GA 4DWIA 3T5JA 3UPFA 1VBYA 1HIYA 4F4AA 2W2OP 4QWEA 3AQPA 4RBTA 1V3RA 5GVQA 3SCIE 3QIPA 1UA1A 1V3ZA 1YRTA 5L9NA 4F0KA 2BA9A 1LK7A 4RLEA 4DV2J 4MH8A 3IC1A 2B43A 2E44A 4B3RJ 5HBMA 1YH8A 3U02A 4X65I 3TA0A 3PFEA 5H1SV 4I2PB 1N33I 2K2PA 2IMOA 3DOMA 3EGWB 3WQPA 3DGVA 1JLQA 4LF7F 1QUVA 4BA2B 5LMUE 4CH1A 2YKMB 2KN4A 1S57A 4KKOB 5DG9A 3G2XA 1NZ8A 2U2FA 3EM1A 5HVFA 3U27A 4KSEB 2EW9A 2VIHA 4DCPB 4JI7I 4QYZK 5KFSA 1S48A 2GJIA 1U2FA 1VBZA 2HK3A 1EETA 2DNMA 3I55S 3QGPA 1YK9A 5KFGA 1RTHA 4I69A 3CC2S 3JYTB 3VGTA 2AEJA 3K5PA 4PR6A 1S4EA 3BSNA 4MAKA 4X66J 3DU5A 4CLYA 4RW9A 4X62E 3QYYA 1LWFB 2VQFE 3JTOA 4WBFA 3EJMA 4PQUB 4J9OA 2EI5A 3C6TB 3NCQA 2G4BA 3Q83A 2U1AA 4PEOA 4BC9A 1HKAA 5K9FA 1ZM9A 2ILZA 1M1GA 4IFVB 4LSNB 1S1TB 4X64J 1HR0E 4NLWA 5ITHA 4HY1A 2GO8A 5K8MA 2AQ4A 3OXFA 2D41A 1B7FA 1R8HA 3M8SA 5KG1A 5KT3A 3J81Y 2LYVA 2HHHJ 1IKWA 1X4BA 2AJ0A 2BQ3A 1AT1B 1TTHB 5H9FK 4AL7A 4LF8I 1C0TA 3VAHA 4HKQA 4F7VA 3KHLA 4B02A 1TKXB 4DEZA 4CH0S 3TAPA 3ELHA 5MLCV 3OTOF 3D0GE 4A47A 2IJNA 4HACA 3ZXWA 3WU3A 3AOCA 1Q8BA 3BSAA 1L3TA 3MFIA 3IP0A 4MU4A 4J5OA 3IO1A 2AV5A 4E0DA 3EICA 1WEYA 1WC5A 4H4KA 5KFDA 3CC4S 4KFBB 2CNOB 2X7IA 1FA0A 2WBMA 2UU9F 2QJ3A 1YX2A 1AA1B 2R3VA 2QL9B 3KK1B 4M5LA 4D3HA 1XR6A 2NQPA 1TL7B 2VFVA 1U09A 5A0YA 2YWGA 2HS4A 4O3NA 2CPDA 2QYCA 2A10A 4LBHA 3LP1B 1YJ7A 4HR2A 5F41A 1WJ9A 4NLXA 3NGDA 3PDNA 4EZ9A 3B6BA 4UF4A 1X7VA 3PFOA 4KGMA 1UZHA 4ZVFA 5HANA 4DR2E 1Y10A 1N32F 5KT4A 4LF5I 1MROB 5I4MA 1YSJA 4QYZJ 2L9DA 5C0XF 1ZA2B 4FW4A 1R0CB 2HQ3A 4AT1B 4I2PA 3GYGA 2NXJA 3VAMA 2PNLA 4BA2A 2R4FA 3ZTSA 2R7SA 3K89A 4XPEA 4O0NA 2YKMA 1RWWB 4KKOA 2R7WA 4QR2A 2HQGA 1HNWE 3K85A 4FVMA 1WKLA 3AH6A 3OXLA 3FNNA 1GXLA 1PYSB 1SC4B 2XZTB 2MSTA 3LOUA 3SFUA 3AD8C 3D2WA 2OEKA 1N48A 4Q7AA 2NCKL 2WHOA 3JYTA 3KRNA 4NYOA 3D68A 4R5PB 5GAHI 2NUHA 3WU4A 2YNIB 2QZ8A 2DXFA 3BKFA 2HMIB 2MMYA 3CD7A 4CO5A 2GFFA 1F6TA 1LWFA 2ZHAA 3FSYA 5H9FJ 1HWLA 4PQUA 4QIEA 2HLTA 4NCBA 2ATCB 1URRA 1F0XA 2RD5C 3C6TA 1CQNA 3H5SA 2IFXA 6FDRA 2AW0A 3UO0A 3TX0A 1BWVA 4B9TA 4I7FB 4LSNA 2DYAA 3MPUB 1S1TA 3PEHA 3PO5A 2GO9A 3BZQA 4FYYB 4DV7J 1TVRB 2XMUA 2M88A 1NZAA 1MMLA 4DV5E 5DJBA 3G9CA 4UUWA 3KDNA 3HDSA 3HD2A 4MTPA 1FD8A 4H4MB 1SH3A 1TKXA 2FJWA 4PXDA 1VBXA 3KK2B 4GO5X 1UJ6A 1VR6A 2W2QP 3HHLB 3TP2A 3OJUA 2F8EX 4DR6I 1YG0A 2LQBA 4J9SA 1VQ7S 1Y4ZB 2MY7A 4ECTA 2AYBA 2QA4S 2DBBA 5A8WB 2HGNA 3JXOA 4KFBA 4ZP8A 2XZDB 2XULA 3FEYB 5HROB 3OTOJ 3KK1A 2VASA 1S6QB 2E1PA 3OFFA 1PG5B 1Y11A 2D1CA 2JL9A 2FGCA 5EDWA 1TL7A 4ECQA 4OYXA 3GV5B 1GNKA 3LP1A 4OLOA 2YQ1A 4K59A 3SSSA 4JI1J 4OV1A 2R8KA 1REVB 2ZWOA 4J91A 2XS2A 2CA9A 4LFAI 2X3DA 1KLNA 1HNXI 1T3NA 3SI8A 4ZOSA 1SQGA 2J6UA 1F60B 1MROA 2CXEA 3UW1A 5JEAB 1KBRA 4USUA 1RWNB 1EJ7L 1H0HB 3N6LA 3PIPQ 2R8HA 1IBKF 3I32A 5FDLA 1BE4A 1UP1A 4AIDA 3GR0A 2R8IA 4IZJD 3P6YC 5ETQA 3ISNC 3TEHB 1RT3B 3GSIA 1N32J 1Q0NA 2V2ZA 5BR8J 4CYUB 1DZ5A 1GQEA 3AOBA 3PEJA 3J7A1 2JJ4D 1REGX 2ZD1B 2OKQA 3MTJA 2YVSA 1Y0HA 2DNHA 3UHMA 2CPHA 4B3MI 2MJUA 5F8NA 2WNRB 2CJKA 2V9KA 1VGYA 4C8YA 1N5YA 2ZBRA 4RNNA 2C3UA 2VESA 2ALYB 2GMJA 4PPZA 2JEBB 2YNIA 1IUJA 1G3OA 1J5EF 4JI6F 4CNZA 4CNYA 2JH3A 2HMIA 4U7CA 2BRLA 5IT9Y 5IC4B 5I3UB 2PO0A 3IR6B 2CQGA 2R42A 1XNQJ 4AXIA 2RMLA 7FD1A 2XYGB 1WOPA 2IM1A 3JS9A 1DQAA 2RQ4A 3U1LA 3KLFB 4C3MA 1P1TA 2DGTA 1E3HA 1T95A 4DZ6A 2YWKA 4J9RA 4I7FA 3QMQA 3VTIA 2FJXA 1U0SA 2CQ0A 3BYPA 4PQAA 2KJWA 2HZCA 4DUZJ 2VFUA 2GMHA 4NPOA 1RKIA 3FRYA 4DF8A 1TVRA 4GC7A 2OPRB 3UDLA 2GIFA 4WE1B 1NCLA 4O4GA 2KT2A 4ECRA 5BYQA 2W4DA 4H4MA 2RRAA 3BN4A 3EGVA 5AJ3F 3KK2A 4O44B 4YB7A 2F8MA 3HHLA 1UDNA 4GKJI 2XWXA 1ZAWA 2A6MA 4UTGA 3TZYA 2CVEA 2Z2ZA 4URQU 2FDNA 1A9NB 2X1FA 3IAM9 2XC9A 3TUJC 5A8WA 1AUSL 1Q16B 4USHA 3BQ2A 4BWJA 3TNVA 4AQYF 2V8PA 4QR0A 5F9LA 3G6VA 2K7JA 5HROA 3K5OA 1RT1B 3T1YI 5GAHU 1S6QA 4K0KF 1N0UA 2GC8A 4F36A 3DYAA 1VDHA 4LPFA 2DTJA 2RHSB 3T1HE 2DH8A 4C8OA 2WOMB 2QMXA 4X2BA 4J9VA 4V19X 2AX0A 1REVA 3IM9A 3G4SS 1RSCA 4ZHRB 1VJQA 3P4UB 4ER8A 2H5EA 4B9SA 3NGRA 1RAIB 2O5DA 1XNRE 4OKGA 4RW8B 2NN6C 2CZVC 4LQ9A 4ILRA 4AM3A 2XS7A 3RB0A 5DNLA 1RTIA 1R6LA 2DCUB 3EDRB 4ZDNA 1N36I 2BE7D 2P9GA 1RT3A 3VQTA 3QFHA 4CYUA 4A8KA 3M7NG 2C3MA 2QLJB 2V4JA 2ZD1A 1JIHA 1B7YB 2KDOA 1IBKJ 2ZJPQ 3QNWB 3LGNA 2FJBB 1NDPA 1SJ4P 2XYPB 2EG2A 1T3OA 3NGKA 4TKTA 1FDBA 5F3TA 2WNRA 3J81C 4W98A 1R7IA 5A8RB 4WKYA 2YPYA 1RHJB 5LSOA 3T6JA 2ZH8A 3R2CJ 2UV8G 5J2NB 4EBDA 1SB6A 5HLFB 1NSQA 4HT7A 1WG4A 5I3UA 2WSFC 3F56A 1NZ0A 2GV1A 3KLFA 5KFQA 3G71S 5J1EB 2YWFA 5DRRA 1LK5A 1J5EJ 2UXDF 2E5LJ 2UUBE 3BH7B 2ADCA 1MU5A 1RT5B 1VISA 1IM4A 2HFVA 5AXKA 1X0PA 3QIDA 1GFWB 4ZS6A 5DG7A 3RR7A 4WE1A 3M05A 2FLOA 1APSA 2M3DA 3DRSB 2POKA 4PG7A 2R7QA 1H2TZ 4O44A 3W65A 5CABA 4FYVB 1OO0B 1EQ0A 3RBXA 4KPYA 1N34I 3GP9A 4Q0BB 1BHNA 3OR1B 4BWMA 5H9EK 3IG1B 1XR5A 1FVSA 3CDAA 2MEWA 2XQCA 5ETPA 4FF1A 3C14B 4K4WA 2GIRA 1WG1A 3H4BA 3QZ8A 1UEUA 3L95X 4PU9A 2ZVSA 3BDPA 1UVJA 4XK8C 3TAQA 2LKZA 1HBNB 4HYMA 1KSPA 4OFZA 1BKNA 4USKA 2HQCA 2VQEF 2NN6E 1B0TA 3QPIA 3IA0A 1ZZNA 2B4OA 5DRQA 2WOMA 3M32B 5KFHA 4AQYJ 4NLSA 1TKTB 1IJEB 1VYAA 3NXZA 5A2QQ 2KJVA 2FGOA 5CYQB 1JNZB 4LFCE 1P42A 2H9ZA 4FYWB 4ZHRA 3HT0A 3EGNA 3KJQB 1WORA 4LJMA 4DL0C 2ASJA 1VQKS 3GB0A 2B56A 3HSZA 3MMBB 1YHCA 1LOUA 1SC1B 2J8SA 4KT0C 4WP3A 3H40A 2FC9A 3GLJA 5A76A 4MFBB 1TFWA 3ZC4A 3R7NB 4J9KA 5KG3A 3OW2R 4G1PA 1KONA 4U67Q 4NZ0A 4OHVA 1HNZF 1UAWA 4N8OA 2D3UA 2F4VF 3RU0A 1PCAA 4NLOA 1UVMA 2QLWA 2HKJA 4J3DA 2P6TA 1XMOE 1VBKA 1S6UA 3OPKA 3EE3A 3I82A 4JV2A 2DNQA 1LWEB 1U2CA 1UW9A 4ELTA 5A8RA 4FW3A 4FZVA 5E5NA 4X4SA 5F3ZA 3UR0A 1KIJA 4E98A 3M6AA 2FVPA 1O5JA 4KTQA 4M63A 4PKDB 5J2NA 3R5DA 4L74A 5GMEA 1MMDA 4YHHE 3MOJB 3HVWA 2A0FB 1K8AT 2E1AA 3Q22A 2OSQA 2UUAF 1N5VA 4JI5F 1LKZA 3D1OA 1TMMA 5J1EA 1H7UA 2LDYA 2K1RB 2DB1A 3B4MA 2B8PA 3PRDA 4MIWA 1Z5BA 4O3QA 5KFXA 1ZM4A 2E7VA 2Q79A 1RT5A 2N4CA 3VQSA 3MPVA 4JI8I 4IFYB 4F25A 2UVVA 3GQCA 2IERA 3DRSA 4R0EA 4DV4F 2YKQA 3O1LA 2VHGA 3N79A 1RB0A 1V5IB 1EKRA 1NJZA 3D6TB 1LFPA 1Q5YA 2EK1A 3U1NA 2YKNB 4OO1E 1VS3A 2UVRA 2A1BA 1BC6A 2AHOB 1VJWA 2E7XA 1FJCA 4DL6A 1EKSA 5C42B 2N7YA 4Q0BA 3OR1A 3UNGC 3IG1A 1QE1B 1QSYA 3KLHB 4P9SA 1WKJA 3DRYA 4AFFA 1YJTA 3OTBA 4DUYI 3W9JA 3C15B 3GYXB 1IWGA 2JEIA 2RHQB 4A8SA 2ROPA 1GEHA 1WACA 3MR6A 5E3RA 4YP3A 2HFSA 1HBNA 2WTFA 2RS8A 3HHLD 1H7WA 1CJKB 3M32A 1RAHB 1TKTA 4OYPA 3F44A 3ZTQA 1F9EB 5IFMA 2AMCB 2JEGA 4C6AA 5ETKA 3HP6A 2GJFA 5CYQA 3R2DJ 2H4YB 4ZPVR 2J9DA 2UUWA 3P8BB 4HDHA 4ED8A 2NXNA 1X8DA 1N0VC 3A12A 1SJ1A 3VAIA 4C0OC 4EUVA 1WHVA 5GADI 2VQEJ 3T19A 1L3KA 5LMUF 5KFUA 1GT8A 5E41A 3BREA 3VZIA 1K47A 2BOAA 4JB8B 3MMBA 2PI5A 4FPRA 2CRLA 4ZA1A 3VAGA 3T5LA 1CS4B 3AQOA 2ZNYA 2MQQA 5D77A 4MFBA 2DGWA 2A18A 4R25A 1WEZA 2LA6A 3FSIA 5IT9C 4NA1A 3M1VB 2AYGA 2G0JA 1FKOB 3W5YA 3NGUA 4JV5I 3BGLA 4PRFA 2ZEJA 4X62F 2VQFF 2F1FA 5JEAD 1LWEA 4CT8A 4GKKE 1VQOS 1A0OB 3KUHA 1C1CA 2Z2LA 1FEEA 5DZ6A 2PA3A 2F4VJ 4WU2A 4L75A 4KH1B 1HR0F 3K8VA 5HVGA 3PYEA 2VG6B 1S0VA 4OX9I 2XSJB 1KNZA 4DF4A 2OP5A 1OS5A 4KV8B 2RB7A 1YBTA 3D4JA 2HVZA 3R97A 3HFZB 2G13A 2C37B 1LWCB 3ZO7A 2K1RA 5HATA 4V1Ak 1O8BA 1EARA 3LPSA 1S72S 5KG7A 3VAJA 2L08A 5DETA 3OTEA 2ZITA 1HW9A 4IFYA 3CJ3A 2RU3A 2IRXA 2IY5B 1MWYA 1Q53A 1DJ0A 3UDEA 3DLKA 2UUAJ 1DHMA 4JI5J 1WC1A 5DG8A 3NRBA 5SZTA 2QSWA 1RWMB 3UVJB 3VVUA 1S5ZA 1GH8A 4L6V3 1WOSA 1U7LA 2RS2A 1HBMB 1NBEB 3HD1A 1U45A 2HVHA 3O6QA 2YKNA 1QDUB 1SC3B 4JI4E 1IWAA 4W92B 5C42A 1U25A 2QGFB 4NCAA 4DV6F 1QE1A 1X4AA 3KLHA 5C24A 2M8DB 3R3TA 3V4IB 5KFBA 2BXJA 2I9SA 1JLEB 3C15A 1JJCB 2BKOA 4JI7J 3CJ4A 4KAIA 2FJEB 2CPJA 1SUQB 4NL5A 4RBUA 4CTAB 4WFZA 2QLXA 1CSJA 1X4GA 3K7RA 2UUCE 3BM7A 3H5YA 3P3CA 2AJQA 4WFXA 1IBMI 1WUUA 5KT2A 1U1PA 2J6TA 1NK4A 2W7OA 1FE4A 1FFWB 3IBWA 3LP2B 2I6WA 4HHUA 3H59A 1R6VA 3UFCX 4IO1A 5GMKa 3DLEB 4ZPCA 2LFVA 4I6AA 2DR8A 1P9YA 3GCMA 5J1NA 3J7AN 1QY7A 4WKRA 1T03A 3MMCB 3AT1B 3J81U 2OTJS 1CS4A 4OI1A 2DD8S 1HNWF 4QU7A 2KU7A 3U7JA 2MGZB 4P2XA 2QA2A 2VH7A 2PN6A 3M1VA 1HW8A 5HVHA 2V0NA 1JWWA 5LMUJ 1GTEA 1FKOA 2UXCI 1RADB 1AB8A 2LQ9A 1VMBA 1H7XA 2KG0A 4IS9A 3MAAB 1JJ4A 1T11A 2XM3A 5IZHA 4Z7CA 2F65A 2JRSA 3RBZA 3SYZA 4RZRA 2DHGA 2CQBA 5K5MA 4C48A 3HSJA 2LCWA 1NXIA 5ADZA 4M5DA 1IBCB 2DITA 2DEJA 1IQTA 1M5SA 1AXQA 2QT7A 2PC6A 2J65A 2WW4A 3DN9A 2B7BB 4X62J 2RJZA 2RU9A 4YMEA 3UD3P 1RACB 2DK2A 2XSJA 4M94A 5K36B 4DV5F 1ELOA 2C37A 4ES2A 1LWCA 4F02A 5B0EA 1Q7YT 2DIUA 1HR0J 1QTMA 3J80U 2EFGA 4DX5A 5GADU 1C0UA 3M6UA 1P6TA 2QMWA 2V2KA 2HHHI 1LFWA 2CNLB 4LF5J 3JAMY 4MK7A 2DRDA 4RNHA 5L39A 1X9WA 3BS9A 1UVNA 3UVJA 1RBOB 3J7ZT 1QD1A 3O8WA 1NPPA 1HBMA 2BM1A 2Y1IA 3QAUA 4P74A 2V34A 3L7UA 4B9MA 2ZM6E 4GMKA 2X1GA 1KVKA 1M1KT 3O44A 1UVLA 4OJ1A 3HLUA 1U02A 2AEMA 2WW8A 2KM8B 2J7UA 4PYAA 1C4AA 2NLWA 1JLEA 3QWPA 3NWGA 5C7PA 1SUQA 2DGOA 3TEGA 3ZZUA 4CTAA 3C16B 4WUCA 1Z0WA 5D4PA 5D4LA 1HQUB 3CJTA 2H4WB 2O3ZA 3NY0A 2PT0A 2JFDA 4ZK7M 2XMAA 2HLUA 2XHCA 4YB6A 3OTDA 4DR3E 3NGSA 5T7LB 4OHXA 5C0XC 5AXNA 1FHTA 1JKHB 3LP2A 4AIMA 4J90A 3TJ8A 1F9HA 3ICLA 3W63A 2CQHA 3GIKA 2VOOA 3TYTA 1BY9A 4DR2J 3QT6A 3PYGA 1SH2A 2BVZA 2Z8QA 3M8QB 3MMCA 4LSZB 3HPOA 3AJ2A 3LH2S 4O3RA 2WSCC 1D9FA 1OYEA 3JQJA 4PUOB 3ISZA 2XLKA 3BV8A 2MGZA 4FYDA 3VGSA 1KWMA 2I5JB 1S10A 5G0RB 4K4VA 3D66A 3MAAA 4A8QA 1BQMB 1FKAE 3B8HA 3W8PA 1HNWJ 1FNMA 4NE9C 1OMSA 2R2SA 1RR9A 3OQ2A 4Y2MA 4OL8A 3TQ1A 1L5UA 4LF7I 4DFPA 1AROP 1JLCB 3FQKA 2AD9A 2MKIA 3RW6A 4BA1B 1MWZA 4RBVA 1QLNA 4F0HA 5J2PA 4ANDA 4RUHA 1HHQA 4JI0E 2GQCA 2OLWA 4J9MA 1YVFA 4IRKA 4A8YA 1NK9A 4OHZA 2B0GA 4WFYA 4FNHA 3RYLA 1PC4A 2DNPA 2MTLA 3AXMA 2CG8A 4J9QA 2VOPA 3MDFA 4OYOA 4C97A 4CLPA 3A8EA 1KVIA 4NLUA 1S77D 3HFVA 1YI2S 2ZBPA 3ZTOA 1SJQA 3M6XA 1G4CA 2CG4A 2OIHA 4DV5J 1SIZA 2QA1A 1B3TA 1Z0TA 4F3MA 3R5JB 5D0EA 1VK3A 5CXTA 1PKUA 4OO1A 2X1BA 1U26A 2CZ4A 1I94E 4P10A 4B3SE 4CRJA 2FVCA 5FLXY 3W61A 1YGYA 4NXME 4ED5A 1OY9A 4TQRA 4ETZA 5B09A 3T1HF 1DAXA 5EHHA 3PRBA 4CM0A 2ZUGA 2Q2EB 3OTOI 5E3PA 4GVLA 2EVZA 2DGVA 3C16A 4B3OB 1HBOB 2XNQA 3G8QA 1U2RA 1HQUA 2PMHA 3SZ2A 3GJQB 2KI2A 4LR7A 1ZPWX 4G3IA 1FESA 2DH9A 5L38A 4DQRA 4ITSA 3CJ0A 3THPA 5IT9U 2VC1A 1XNRF 2UU9I 2H48B 5T7LA 4HTJA 5EL9A 3KK3B 4ILMA 5LJ5Y 1JKHA 2EBEA 5DZ7A 2IVFB 3FBEA 5F8MA 1RE1B 3FVYA 2AGPA 2IMWP 2DRAA 4ILLA 3OVSA 3PY8A 2FJAB 4ICLB 2GS8A 3P5BP 3E3XA 3UDVA 3M8QA 2DISA 1NM2A 4MMOA 4U7UK 4PUOA 4LCFA 4KGXB 1F5CA 1K1QA 4E2FB 4OZLA 4FWHA 4HT5A 3W60A 4QYRA 1PJ6A 2I5JA 4UZCA 3PW2A 1N32I 5HQLA 3MEGB 5G0RA 1D9AA 1MX0A 3LWMA 5K20B 2XGPA 1BQMA 3EUNA 3D7SB 1NDCA 3NEKA 4AUKA 4TU9A 2XCAA 3OLAA 2C2ZB 4NLQA 1IJFB 1A6FA 2LQ5A 3ILOA 1HQEB 1S1XB 2KB2A 3TUZC 3UE2A 1JLCA 5A2QY 3FQLA 2HGMA 4C0HA 1Z4UA 3CXCR 4BA1A 4QNKA 5DQIA 2BX6A 2LU2A 4A8FA 2E1RA 2QEXS 1WDTA 1WKKA 3T1YJ 3IMQJ 2UUBF 2HYIB 3QSIA 1YRXA 3KHGA 2ZWPA 1YBUA 2V8DA 5B0GA 3NS7B 3JQMA 3N6MA 2YWHA 4RUCA 4JYAF 5SUHA 1U24A 3PS3A 3Q2TC 1RAAB 1KFDA 1MN7A 3EZOA 2DPJA 4H4KC 3NP5A 4MQYA 1I3OB 2FZGB 4FW6A 4N3OA 1P1LA 3H2VE 5KT5A 1ZTWA 4DQSA 2FTRA 1Y5YA 5M2RA 3GIIA 1HD0A 2FLPA 4CDIA 4Q2LA 3NMAA 1N6QA 2Y8YA 3C2PA 1U4BA 2JDJA 4ED7A 2KFZA 1SXLA 2KHDA 4EK2A 4M1KA 2NN6F 4UZBA 4ZCMA 1OYRA 2FVSA 4DQPA 2MKYA 1RBLA 3LWLA 4LFCF 4U95A 4B3OA 1HBOA 3W1YC 1FJGE 3UNYA 2XEXA 1P27B 3PR5B 2ZOFA 4C11A 4NLPA 2VPXB 2GJ2A 3OL9A 4ZVOB 3T1HJ 4JI2E 2J9CA 5ETNA 4KQVA 1HWKA 1YDLA 2DR6A 3FDSA 2XI3A 2UXBE 2J0SD 5K14B 3KMSA 3KK3A 2V68A 2MQOA 4J9UE 5DRKA 2GAGC 4G1IA 3E01B 4MIBA 3S1TA 2VICA 1WC6A 4EO6A 4TYBA 4ICLA 4PXCA 3QRRA 2IIHA 2L3MA 1N33F 1RAOA 4QBUA 2ZJQQ 3OHAA 3IWLA 3PNIA 5DM7Q 1XMOF 2FLLA 4OHWA 1NLKL 3GONA 1Y00A 4FF2A 4HH1A 3CCSS 2V4RA 3BGOP 2B8QA 3K5NA 4KHPF 3MEGA 3D28A 3L7PA 2O66A 1CULB 4NEYA 1RHYA 3I96A 3J7AM 1M1HA 3HHDA 1FTRA 4FYXB 3C66A 1IBKI 1NKEA 4ZIVA 3P06A 2BA1D 4YHHF 1N34J 2EC2A 1H2VZ 3MCOA 1ZETA 4DPUA 4LBPA 1HQEA 1S1XA 4N77A 5DDRC 5LMNE 1UWAA 4WXWA 4NASA 3GFZA 1GXTA 3QJLA 3HT3A 3JAMC 2YQ3A 1SQFA 2HG4A 2O1TA 4CO1A 1M0SA 3W2WB 1ZAXA 2BA0D 2M2BA 3OL6A 2KZMA 1FRJA 5F8IA 4LF4E 1R6YA 2V67A 2VBZA 2AYEA 5EUHA 3IFEA 4DS4A 4MK9A 3TO8A 4LT6A 1J5EI 4JI6I 2UUBJ 5DM6Q 2NS1B 3KYLA 4X4VA 1KN6A 2B51A 4OO1F 2ZFHA 4DX8H 4DL3A 1VC6A 3L7ZB 2ZOGA 1HWIA 5U47A 4DV3E 5IWAE 2BE2B 4P72A 3J7AG 4TU8A 3MTKA 1Y5IB 1XMQE 5K36D 3QQCD 4X4RA 1YIJS 2A3JA 1U1KA 1FERA 1MSWD 2LLZA 2O1PA 4WK1A 4JG4A 1WHYA 3FUYA 1TL3B 5JMNA 1PJ5A 1PAUB 4M5HA 3ENVA 2JX2A 4N5SA 1M5PC 5L8RC 4BCAA 3GYNA 4RNMA 2GHWA 2R7UA 1S0MA 5KFFA 4U8YA 3V6HA 3LA0A 4ES3A 2VODA 4GC6A 5L3JA 1HMVB 2WAQD 1FNOA 2V4QA 1Y60A 5DDQC 4AQYI 3PX6A 2ZBCA 2EFQA 1JX4A 5K14A 3TOQA 3K58A 4LFCJ 5LL6d 3CDBA 3LQVA 4K4YA 4K0KI 2BJ8A 3KJNB 1FJEB 3E01A 2BJDA 3T6BA 3V5RA 1X4DA 2E7WA 2CAJA 2HHUA 2GA7A 4LVOP 4IRCA 3DOLB 2JSXA 1XMBA 5D8HB 4PZVA 1KFSA 3SQOP 3QT5A 4EYHB 4B9LA 1T8EA 4XTJA 1PYOB 4DV2E 2QFIA 1Y6ZA 1V5VA 4J9LA 4GKKF 1UFWA 1ICEB 4B3RE 2D69A 5HI7A 1CULA 4O3PA 1S0OA 4WF9Q 5KOXA 3V2UC 3HVTB 4EBCA 3PS2A 1Q78A 4DS5A 1TV6B 5HAOA 3LW5C 1F9FA 3G8SA 3IRXB 3RB6A 2P8IA 2GNKA 4P6QA 5C2GA 1T9WA 5T41A 4IFDB 2C3YA 4OV6A 2GX8A 1SKUB 4A8MP 2MQNA 3NG8A 4QOTA 4ED4A 4G6VB 2OGUA 2XMKA 3H98A 3RGIA 3T1AA 2D3O1 1P9QC 3PACA 3WC0A 3PKYA 4LRFA 3W2WA 2IVYA 2YTCA 3R1HA 5BJRA 3HHLC 1UMJA 4BC7A 2V9WA 4C0BA 1V9OA 3OL8A 2FHMA 5FLXC 4ZPWR 4K5SA 4X66E 3DRPB 2BJ9A 4G1QB 3SFGA 2BW7A 3PTWA 3WIVA 1T0TV 5DROA 4QIVA 2J0WA 1N8RT 1D6TA 3H90A 4QNJA 4I4BA 4QIWD 4JI4F 5KFKA 3L7ZA 3TUPA 1KR4A 4YR0A 1ZAVA 4I6YA 4X64E 3K5LA 2JLEA 2BE2A 3A3NB 1FKPA 4O23A 2OO4A 2K8GA 4U3DA 4LF6E 2QSFA 3BBFA 2UXDI 3K0JA 4HYKA 5LSLA 1VOMA 3JSMB 2N3LA 3SV3A 2V50A 4DR4E 1V6HA 2HHTA 5LOQA 5KT6A 2ZH7A 2UUCF 1TL3A 3K8WA 1JLFB 3QGHA 2BE9B 3CDJA 2YWEA 1UWBA 4PXBA 3F0NA 3G6ES 3CIZA 3LF0A 2JE6B 1TL5A 1FRHA 1HI1A 5CCMA 5B0DA 1HHTP 4R8UB 3BGRA 2HBYB 2PE8A 1NPKA 3PJXA 2HNDB 4KRWA 2JVRA 5LJ3Y 2NPFA 3TZWA 3FBCA 3TW0A 4HHHA 4C8MA 2R2UA 4RW7B 1HNXF 4OX9J 1CC7A 5IT4A 1KS2A 4DPOA 2IHR1 2C2RA 4YQWA 2R7VA 2YXLA 2VQEI 4RUBA 1EX8A 3CDEA 1S6PB 3CD0A 2FZKB 2Y0SD 1QAXA 5A2QC 3PJWA 5HK4A 2RNEA 3DOLA 4OI4A 2L41A 5KFCA 1PILA 1Z2ZA 3GCWP 2AEFA 1JXLA 2WVEA 3PX0A 1FWPA 4QZVB 1IQZA 3T3FA 2PA8D 3ZNJ1 3NNCA 1CJVB 4IOAQ 1PIEA 2CWKA 2JZ5A 3R7SB 2HVIA 1RWOB 5CHCB 3Q89A 3HVTA 2UP1A 2OSRA 2ZVIA 2DXDA 3DCAA 1TV6A 2D9OA 2KHCA 4B3MF 3IRXA 1HQ2A 2KVIA 3CO9A 2HFZA 1ZH5A 1DY3A 4DN9A 5KG5A 4IFDA 2E5HA 2RKIB 4DV4E 1HNZI 1RHMB 3QGIA 1E6YB 3SXLA 2F4VI 4L72B 3MUVP 4KC5A 5IQQA 3KXDA 1MWQA 4R0JA 2VFSA 2QMUB 1IBLE 5JXSA 1CJTB 3CJSA 3HX9A 1Q81T 1QAYA 4DHVA 3NAIA 4CZCA 1IBMJ 4IZJA 2Z4PA 3HKZD 2XO7A 2D7SA 2PEHA 1UEKA 4QJVA 2CPYA 4F0MA 3TARA 1VC5A 4WP8A 4G1QA 3ZZRA 4LF9E 4DFKA 4LCGA 1WC3A 2W01A 2BJEA 2IC3B 2MJNA 5AE1A 4WTYA 3NLCA 6FD1A 1HYSA 1BQXA 2IYGA 2ZM6F 3D0IE 3WIUA 2MZTA 3GIMA 3K5MA 2UUAI 1FXDA 4JI5I 4GO7X 8ATCB 3X1LB 3THTA 2YKAA 5JEAE 4RW6B 4DV7E 1S0NA 3KHHA 3KLIB 2J6SA 2UUTA 3JSMA 2CJQA 2NXCA 4JI4J 4UQGA 1RABB 2R2RA 4XO0A 4NLVA 2UXCJ 2YX1A 4ECSA 2M0GB 3KNGA 4ZKAA 1NEEA 5E3CA 1RK8A 3A1YG 5F8HA 1JLFA 5KG6A 4TY9A 2C42A 4DR3F 2VL1A 1UTAA 2HAIA 2WSEC 3DFEA 2JE6A 2N7CA 2VONA 2Z5BB 4R8UA 2E29A 1YJUA 1S79A 1LNQA 2WRMA 2UUCJ 2XMWA 1YZ6A 2HNDA 4P2MA 1U49A 3MM5A 2EC0A 2HQFA 2BUNA 3S01A 4QPXA 4PWWA 4CM2A 4N8NA 3ONQA 1L3SA 2PIIA 2HS0A 4LFBE 1KHVA 2HIQA 4RW7A 2BW2A 1BXNA 1OWXA 2LQJA 3G6XA 8RUCA 2F63A 9RUBA 3RZAA 1RA6A 3M8RA 2KVQE 4LR9A 2PO4A 4JI1E 5A6PA 1YJ9S 1S6PA 2J0XA 3CD5A 4IH5A 3GIJA 4DI6A 2KH9A 4HEA9 4HVZA 4OX8A 1FKAF 4NYZA 2PSZA 1F1BB 4HL9A 3CWJA 1S4FA 2MQMA 2ZH6A 3CNQP 2BV3A 3QATA 3ILJA 1RZMA 4LUBA 1M5VC 5KFVA 1S76D 2PNZB 5LMUI 1CJVA 4QWCA 1R43A 3BJYA 1GAOA 5IM0B 1FE0A 2AKWB 5DQHA 1Z1ZA 5ETVA 4ZLJA 3GPAA 4EEYA 2ZH2A 1Q8IA 3BF4A 4JI0F 2RAQA 3AHPA 5BR8E 3L4BC 3D6HB 1FX2A 3NOGA 1F2HA 4ETXA 3BN7A 3HJFA 3M2UB 1XC9A 1ZTTA 2MB0B 1E6YA 1K73T 4DPXA 3IS9A 3VR1A 4ZVIA 2NUUG 2J9EA 2KXHA 4X62I 2VQFI 1WF1A 4DV6E 4PAAA 1CJTA 1HI8A 2HFNA 3MMJA 1DTTB 2GMLA 1RHKB 4CCHA 3H1CA 5HMWA 5I3PA 1NKCA 1XNQE 1HR0I 3TJ9A 2C1EB 2IC3A 2BJ3A 1I94F 4B3SF 5D4OA 2ASYA 3M9MB 2KZZA 1IN0A 4LR8A 1G1XA 4C3KA 2C38B 4NXMF 2LQ8A 2LP4A 2NXEA 4OZJA 4DUZE 4NMLA 4PWDB 2GO4A 1RUSA 3MOZA 1SL0A 4RW6A 4XAKA 2FB0A 2G2YA 2P9EA 4I6WA 1SQEA 3PG9A 3H5XA 3VGUA 3PW0A 1S1VB 1U6ZA 3ISND 2MHNA 1X9MA 5E7OB 2I1RA 4B3TE 4NXNF 2XZWA 1D1UA 4F4YA 2HHSA 3FRZA 3IBFB 3HVRA 1CJUB 3LP0B 2WBRA 3FJ2A 1SJ3P 2GQ0A 4TN2A 3EGZA 2OI2A 4LF7J 4J7CA 5KFLA 1TUWA 1RHUB 4EGLA 3A8JA 2OFHX 1I5OB 5F0UA 4PCQA 2LU1A 2YH1A 1YTYA 2X1AA 2VC0A 3UWTA 3MMAB 5J1PA 1JMTA 4DR3J 4Q43A 3D6FB 4NEZA 1YWXA 2VKZG 3H2LA 4QWAA 2VG7B 2OMLA 4HDGA 2ZC3A 2LXFA 2MZSA 4QIGA 4XTTA 4WIIA 1JB0C 4IFVA 2RQMA 1RAGB 2C2KB 4DR2I 4DFMA 3Q86A 4UT4A 4IUFA 2P5VA 1FVQA 1NO8A 3Q8VA 1YLXA 4K7QA 3QGGA 2X3GA 4X4TA 2WONB 2WK4A 1KQFB 1U0HB 2PNZA 3BPDA 5BXIA 1QAIA 5IM0A 2HBRB 2W2MP 1FFSB 2JHEA 4RJVA 3QRQA 1FTCA 3AA9A 1HNWI 2G9OA 2CIMA 5CH7B 3GFXA 1HK7A 2LDIA 4IG0B 1U1LA 4UOGA 4FKYA 5IOLA 2B5JB 3KTQA 4FN5A 1SJFA 4ED2A 2BABA 1HHSA 3M2UA 1WEXA 4D3GA 2HZAA 2CJBA 3TI0A 3CVKA 3AAWB 4DR1E 3OSNA 1UVKA 4JI0J 3CDIA 2DNRA 2J8AA 1WC0A 3CF5Q 3LO3A 2AYMA 3ETMA 3K2YA 3FC9A 2ZOMA 1UVIA 2CJAA 4UOCA 5MAOA 3OJSA 2YNFB 1JQGA 5KT7A 2N82B 1DTTA 2OEMA 2KTQA 2UU9J 2FZCB 3QWUA 4NA3A 1LQ9A 4IFDD 3MI7X 4YY3E 3AJ1A 3SMZA 4FKXA 1OYSA 3W2VB 3DLHA 1RXOB 2PMWA 2IVMA 1YJVA 2J9DE 1FJ7A 4WUBA 1WHWA 4DV5I 3N5BA 4L76A 2C38A 3I0SB 2E5LE 1OYDA 3CW2C 1BWEA 3I5BA 2J7WA 2DNOA 1I94J 2VBWA 4B3SJ 1FEHA 2MKSA 3BBBA 2DNNA 4JI3E 2LA4A 1T9YA 3UR3C 1FJGF 2RRNA 4Z2XA 1KKHA 3BO4A 4CH7A 2XTJP 1EP4B 1W2IA 3EVMA 5JUMA 4NXMJ 6AT1B 3DDKA 4JI2F 2LJPA 2B9XA 2AJ2A 3JAMQ 3L9ZA 2D9PA 3ADAC 2UXBF 2UZAA 3LP0A 3IN5A 3GTYX 3W9HA 4F8RA 5A2QU 3OVAA 4R5PA 3JB9k 3OT9A 4QR1A 1VQ4S 4OZ0A 1VRUB 2GCFA 2HZVA 1ZXMA 4U9RA 1UFKA 2VG7A 5L1KA 2BEFA 5EWEA 1CC8A 1VLOA 1GMUA 3HJVA 3TRGA 1ITPA 3I6PA 2IRYA 2OELA 1F3VA 4U3BA 2FQQB 1Y7PA 3I4PA 3MCSA 1M5HA 3ITHB 1RLDA 5AXLA 1Y5LB 3I31A 3CMES 2WONA 4CLLA 1U0HA 1KOOA 1T9XA 1VQNS 4U8VA 3A13A 1FRMA 1YJRA 4C7QA 5LMNF 3BH6B 2DHHA 3AD9C 2DT9A 1JLBB 2BA1G 2OJ3A 1T7PA 2CJ9A 2QE5A 1LW0B 3ZKBA 3MM9B 4ZJQA 1Q82T 3T41A 4CLFA 1K9MT 3CJQA 4IG0A 5C0XB 4LF4F 2B5JA 3IBCB 4F4ZA 2XYHB 3N01A 5IC6B 4O3SA 2OEJA 2KYXA 2FVRA 4J9PA 2IBOA 2BA0G 2MZJA 3RW7A 3TR5A 3PVXA 2AZ1A 3MR2A 5D15A 1KD1T 2ZZMA 1OQ3A 1T9TA 2WVBA 4M5IA 3W62A 2GQ2A 2O1UA 4L3NA 1RU2A 3VAKA 2WP8B 2XLIA 1KC8T 5FD1A 3PS1A 3H2UB 2VG5B 5M2PA 2HHVA 3I5CA 5IWAF 4DV3F 4DR7E 1H2UX 3EPIA 4ISAA 2GIQA 1Z0EA 1PBUA 5HP1B 1TR0A 1TZ0A 3W2VA 1URNA 1XMQF 2XG8A 2B4UA 3PHEA 3LGMA 1CQMA 1R6MA 1RTDB 5JEAA 3I0SA 1WSVA 2XI2A 2KYZA 2LEPA 4YOEA 4DV1E 4DR5E 3RB4A 1VQ5S 1X4HA 2A2CA 3MXHP 1C2PA 2DCLA 5FIIA 2FD2A 2JWNA 1H98A 1CEZA 4C98A 2IM2A 4WPAA 5DDPC 4WUDA 1EP4A 4DV0E 4B17A 4XDDA 4CLWA 4DOZA 4FW7A 2MDAA 2VDHA 5I3QA 2HBZB 1USVA 4Y2IA 2EK6A 1D8ZA 2CPEA 2RT3A 2MLYA 2R7XA 1CVJA 2HW3A 5HQ8A 2NSBA 4LRDA 4IR1A 2YX7A 1U8SA 1U1QA 2CJXB 4ZP6A 1M5KC 1FDNA 1CLFA 4ELVA 5FLXQ 3OR2B 2JEBA 3T1HI 4Y65A 4GVBB 2CPXA 2FJVA 2UXBJ
chains in the Genus database with same CATH topology
3T1YI 2UU9E 1Z59A 1N0UA 4FWDA 1PKPA 4LF9E 2DEJA 2GS8A 4LF5E 1HNWI 2Z5CA 2PNLA 3T1HE 1HK7A 2WW4A 4DR1I 4DV7I 4JI8E 3WU5A 3T1YE 4FN5A 2J7KA 4FWHA 2UUAI 1B63A 4JYAI 3Q6MA 4JI5I 4DPTA 1XNRI 1HNWE 3K85A 5L3JA 1FWKA 1N32I 1ZM3A 3Q1QA 4DR1E 4AQYI 1MX0A 4DV7E 1ELOA 2HFUA 1Z5AA 1FI4A 4YY3I 2UUAE 4JYAE 4JI5E 1XNRE 4DUYI 2EFGA 4DU8A 1Y4SA 3WU4A 1N32E 4K0KI 1A6FA 4MYUA 3V5RA 4DU7A 2A2DA 3J81Q 4AQYE 4PRVA 2HHHI 1N36I 1OJ4A 4DV2I 2HFSA 4YY3E 2X36A 3K17A 2ZM6I 2E5LI 4DUYE 4FWGA 4EMDA 4HACB 1USUA 4B3RI 2HK2A 4K0KE 2E1RA 3QT5A 2CGEA 3PYDA 2ZBKB 4IZKA 4WUBA 2BM1A 2Z5BB 2HHHE 4XTJA 4RPFA 1N36E 5IT9Q 4P7AA 2Z5EA 3H4LA 4DV5I 4DV2E 4LFBI 3ZZTA 4FW9A 4JI3I 2V34A 1Y6ZA 1DARA 2CZ9A 2ZM6E 2E5LE 1KVKA 2IOPA 4B3RE 1H72C 1N0VC 4PRXA 1Z0BA 4JI1I 3J81C 3V2UC 4USMA 4DV5E 4LFBE 4JI3E 3K1JA 1K47A 5GMDA 1KKHA 1FWLA 4MYTA 4DR3I 3ZZUA 4WUCA 1Z0WA 4JI1E 4N3OA 2LJPA 4DR6I 4ED4A 3JAMQ 5IT9C 1NZ0A 2UUBI 4X66I 4DR3E 4GKKI 2BV3A 2PNMA 1Z0CA 5FWKA 4JV5I 4DR6E 1Y4UA 4HXZA 3CWVA 2UUBE 5LMUI 1NHIA 1MU5A 3J80Q 4Z7YA 5BR8I 1VISA 4X65I 5FLXC 4X66E 1FJGI 4GKKE 1N33I 4M1KA 3QT6A 3PYGA 4JV5E 4X64I 1ZXMA 2Z5CB 1ZM2A 1NHHA 4JI2I 5LMUE 1Z0GA 4LF6I 3QT8A 5BR8E 1D6TA 4X65E 2UXBI 2Z5BA 1FJGE 2XEXA 3PYEA 1N33E 3WU6A 4DV6I 1MG7A 4X64E 4DR4I 3HULA 4JI7I 4OX9I 4DPXA 1N34I 4JI2E 3LNUA 4ZVIA 4LFAI 4LF6E 4KQVA 2UXDI 1HNXI 2HK3A 3D4JA 2UXBE 4X62I 1FKAE 4KHPE 2VQFI 3B8HA 1XNQI 4DV6E 1FNMA 3HJCA 3LPSA 1RR9A 4DR4E 4JI7E 3PRYA 4OX9E 1S4EA 1N34E 3QT7A 4LFAE 2ZITA 1KTVA 2UXDE 2DEIA 2VF3A 4JI0I 1HNXE 4LF7I 4PU9A 4X62E 4IZJD 2VQFE 1XNQE 1H74A 4HYMA 1HR0I 4LFCI 3ZKDA 3ZKBA 3F0NA 4JI4I 4NXNE 1Z5CA 1BKNA 3LTOA 4USKA 4DUZI 2V2ZA 1ZXNA 4JI0E 4LF7E 4IZKB 1ZM9A 3GONA 5A2QQ 1HR0E 4LFCE 4HY1A 4JI4E 4DUZE 3B78A 3PYFA 2NPFA 4B3TI 4DR7I 4B3MI 3J7AM 2O1UA 3ZM7A 1H7SA 2AJ4A 5LMNI 1IBKI 2UUCI 3B82A 2BM0A 1EI1A 4LF8I 3P06A 1S16A 4IZJB 4DPUA 4DPYA 4B3TE 4DR7E 4B3ME 2VQEI 1I94I 4B3SI 2CG9A 2R42A 5LMNE 1Z0TA 1IBKE 2UUCE 5A2QC 1Z0EA 4LF4I 1XMOI 4DV1I 4DR5I 4URLA 4HACA 3WU3A 3JAMC 4LF8E 1IBMI 1WUUA 2GQ0A 4NXMI 2O1TA 2OI2A 2VQEE 1QZRA 2O1VA 4KHPI 1I94E 2HKJA 4B3SE 1B62A 2X7IA 4LF4E 1XMOE 4DPWA 4DV1E 4DR5E 2V2QA 2R3VA 1IBME 2O1WA 1PIEA 4DV0I 2A2CA 4NXME 3J80C 4DV4I 4YHHI 1Z0VA 4DV3I 5IWAI 1J5EI 1RREA 4JI6I 4NXNI 1KIJA 3M6AA 4WUDA 2Q2EB 3OTOI 4I3HA 4DV0E 1NHJA 2HKEA 4DXLA 3ZZ0A 5GMEA 4DV4E 4YHHE 1USVA 4DR2I 1XMQI 4GKJI 1HNZI 1U2RA 1IBLI 4P52A 5IWAE 4DV3E 1J5EE 4JI6E 4UTGA 4UT4A 2F4VI 3J7AG 2IOQA 5LL6R 2UXCI 3OTOE 1XHKA 2UU9I 1H7UA 1XMQE 4DR2E 4GKJE 1HNZE 1PVGA 4LF9I 1EA6A 1Z5BA 4LF5I 1IBLE 3Q6NA 4Z7CA 2V8PA 2F4VE 2V2VA 1ZM4A 5FLXQ 3T1HI 4IZJA 2UXCE 4JI8I 1H73A 4R1FA 4JG4A 1UEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y I;  2UU9 E;  1Z59 A;  1N0U A;  4FWD A;  1PKP A;  4LF9 E;  2DEJ A;  2GS8 A;  4LF5 E;  1HNW I;  3T1H E;  2WW4 A;  4DR1 I;  4DV7 I;  4JI8 E;  3WU5 A;  3T1Y E;  4FN5 A;  2J7K A;  4FWH A;  2UUA I;  1B63 A;  4JYA I;  4JI5 I;  4DPT A;  1XNR I;  1HNW E;  5L3J A;  1FWK A;  1N32 I;  1ZM3 A;  3Q1Q A;  4DR1 E;  4AQY I;  1MX0 A;  4DV7 E;  1ELO A;  2HFU A;  1Z5A A;  1FI4 A;  4YY3 I;  2UUA E;  4JYA E;  4JI5 E;  1XNR E;  4DUY I;  2EFG A;  4DU8 A;  3WU4 A;  1N32 E;  4K0K I;  1A6F A;  4MYU A;  3V5R A;  4DU7 A;  2A2D A;  3J81 Q;  4AQY E;  4PRV A;  2HHH I;  1N36 I;  1OJ4 A;  4DV2 I;  2HFS A;  4YY3 E;  2X36 A;  3K17 A;  2ZM6 I;  2E5L I;  4DUY E;  4FWG A;  4EMD A;  4HAC B;  4B3R I;  2HK2 A;  4K0K E;  2E1R A;  3QT5 A;  3PYD A;  2ZBK B;  4WUB A;  2BM1 A;  2HHH E;  4XTJ A;  4RPF A;  1N36 E;  5IT9 Q;  4P7A A;  3H4L A;  4DV5 I;  4DV2 E;  4LFB I;  3ZZT A;  4FW9 A;  4JI3 I;  2V34 A;  1DAR A;  2CZ9 A;  2ZM6 E;  2E5L E;  1KVK A;  4B3R E;  1H72 C;  1N0V C;  4PRX A;  1Z0B A;  4JI1 I;  3J81 C;  3V2U C;  4USM A;  4DV5 E;  4LFB E;  4JI3 E;  3K1J A;  1K47 A;  5GMD A;  1KKH A;  1FWL A;  4MYT A;  4DR3 I;  3ZZU A;  4WUC A;  1Z0W A;  4JI1 E;  2LJP A;  4DR6 I;  4ED4 A;  3JAM Q;  5IT9 C;  1NZ0 A;  2UUB I;  4X66 I;  4DR3 E;  4GKK I;  2BV3 A;  1Z0C A;  4JV5 I;  4DR6 E;  4HXZ A;  3CWV A;  2UUB E;  5LMU I;  1NHI A;  1MU5 A;  3J80 Q;  4Z7Y A;  5BR8 I;  1VIS A;  4X65 I;  5FLX C;  4X66 E;  1FJG I;  4GKK E;  1N33 I;  4M1K A;  3QT6 A;  3PYG A;  4JV5 E;  4X64 I;  1ZXM A;  1ZM2 A;  1NHH A;  4JI2 I;  5LMU E;  1Z0G A;  4LF6 I;  3QT8 A;  5BR8 E;  1D6T A;  4X65 E;  2UXB I;  1FJG E;  2XEX A;  3PYE A;  1N33 E;  3WU6 A;  4DV6 I;  1MG7 A;  4X64 E;  4DR4 I;  3HUL A;  4JI7 I;  4OX9 I;  4DPX A;  1N34 I;  4JI2 E;  3LNU A;  4ZVI A;  4LFA I;  4LF6 E;  4KQV A;  2UXD I;  1HNX I;  2HK3 A;  3D4J A;  2UXB E;  4X62 I;  1FKA E;  4KHP E;  2VQF I;  3B8H A;  1XNQ I;  4DV6 E;  1FNM A;  3LPS A;  1RR9 A;  4DR4 E;  4JI7 E;  4OX9 E;  1S4E A;  1N34 E;  3QT7 A;  4LFA E;  2ZIT A;  1KTV A;  2UXD E;  2DEI A;  2VF3 A;  4JI0 I;  1HNX E;  4LF7 I;  4PU9 A;  4X62 E;  2VQF E;  1XNQ E;  1H74 A;  4HYM A;  1HR0 I;  4LFC I;  3ZKD A;  3ZKB A;  3F0N A;  4JI4 I;  4NXN E;  1Z5C A;  1BKN A;  3LTO A;  4USK A;  4DUZ I;  2V2Z A;  1ZXN A;  4JI0 E;  4LF7 E;  1ZM9 A;  3GON A;  5A2Q Q;  1HR0 E;  4LFC E;  4HY1 A;  4JI4 E;  4DUZ E;  3B78 A;  3PYF A;  2NPF A;  4B3T I;  4DR7 I;  4B3M I;  3J7A M;  3ZM7 A;  1H7S A;  2AJ4 A;  5LMN I;  1IBK I;  2UUC I;  3B82 A;  2BM0 A;  1EI1 A;  4LF8 I;  1S16 A;  4DPU A;  4DPY A;  4B3T E;  4DR7 E;  4B3M E;  2VQE I;  1I94 I;  4B3S I;  2R42 A;  5LMN E;  1Z0T A;  1IBK E;  2UUC E;  5A2Q C;  1Z0E A;  4LF4 I;  1XMO I;  4DV1 I;  4DR5 I;  4URL A;  4HAC A;  3WU3 A;  3JAM C;  4LF8 E;  1IBM I;  1WUU A;  4NXM I;  2OI2 A;  2VQE E;  1QZR A;  4KHP I;  1I94 E;  2HKJ A;  4B3S E;  1B62 A;  2X7I A;  4LF4 E;  1XMO E;  4DPW A;  4DV1 E;  4DR5 E;  2V2Q A;  2R3V A;  1IBM E;  1PIE A;  4DV0 I;  2A2C A;  4NXM E;  3J80 C;  4DV4 I;  4YHH I;  1Z0V A;  4DV3 I;  5IWA I;  1J5E I;  1RRE A;  4JI6 I;  4NXN I;  1KIJ A;  3M6A A;  4WUD A;  2Q2E B;  3OTO I;  4I3H A;  4DV0 E;  1NHJ A;  2HKE A;  4DXL A;  3ZZ0 A;  5GME A;  4DV4 E;  4YHH E;  4DR2 I;  1XMQ I;  4GKJ I;  1HNZ I;  1U2R A;  1IBL I;  4P52 A;  5IWA E;  4DV3 E;  1J5E E;  4JI6 E;  4UTG A;  4UT4 A;  2F4V I;  3J7A G;  5LL6 R;  2UXC I;  3OTO E;  1XHK A;  2UU9 I;  1H7U A;  1XMQ E;  4DR2 E;  4GKJ E;  1HNZ E;  1PVG A;  4LF9 I;  1EA6 A;  1Z5B A;  4LF5 I;  1IBL E;  4Z7C A;  2V8P A;  2F4V E;  2V2V A;  1ZM4 A;  5FLX Q;  3T1H I;  2UXC E;  4JI8 I;  1H73 A;  4R1F A;  4JG4 A;  1UEK A; 
#chains in the Genus database with same CATH topology
 1F3F A;  2VBY A;  1RIS A;  3OFH A;  1VRU A;  2QX0 A;  2E5J A;  2HHP A;  4ZVH A;  2KG1 A;  2C2M B;  2SXL A;  2ZHB A;  1FT8 A;  4DMZ A;  4DV2 F;  1EIY B;  3DDN A;  4DL4 A;  1KP6 A;  3KJF B;  2MSS A;  1O0P A;  4B3R F;  4WTO B;  4NBQ A;  3ITH A;  2Z57 B;  5JJB A;  3MAQ A;  2E1C A;  4JI6 J;  1XNR I;  3MM6 B;  4TLQ A;  1KLM B;  1HBU B;  1LEO A;  2OPR A;  3R9L A;  1FI4 A;  1OSC A;  3TUI C;  1VC0 A;  4JYA E;  4NZ7 A;  1AFI A;  3CCV S;  4DU8 A;  1RP5 A;  1OPZ A;  5DNX A;  4DU7 A;  3MPW A;  1VIX A;  4ZLL A;  3QRP A;  1LW0 A;  2XSF A;  3QJP A;  3MWB A;  1UW4 A;  2IPO B;  1JLQ B;  2RF2 B;  4TY8 B;  2IA6 A;  5C0X A;  1TMJ A;  4HLB A;  2XB2 D;  4RPF A;  5LMN J;  4K4U A;  3T5K A;  5AJ3 J;  5KFI A;  4X66 F;  3OBI A;  4MU3 A;  4FXV A;  4RUA A;  4F04 B;  4MJK A;  4H54 A;  1WC4 A;  1YHQ S;  1RT1 A;  3NBP B;  4ATN A;  3IWX A;  2ACY A;  2WP8 A;  5A6W A;  1TK5 A;  3PCO B;  4OO1 C;  3NGT A;  4WZQ A;  3DRX A;  4LF4 J;  3DGP B;  1SPB P;  1NND A;  3ZTP A;  1RQ0 A;  2ZH9 A;  3ZFV A;  4X64 F;  2EFP A;  1WOO A;  4OZE A;  2DHX A;  4G65 A;  2FY1 A;  4LF6 F;  2C2O B;  2E5I A;  1B99 A;  2UUB I;  2ZZN A;  5HP1 A;  1M90 T;  2HHH F;  4KQZ A;  4OMF G;  3NCR A;  4K0K J;  2XMM A;  1OY6 A;  3KFW X;  3KG1 A;  2EFV A;  4Y34 A;  4CQ1 A;  3I9Z A;  1FRL A;  4PWU A;  1R27 B;  4DR4 F;  2VPY B;  3PM9 A;  5IWA J;  2QLF B;  2I38 A;  1RT7 B;  3US5 A;  4RW8 A;  2WVC A;  3M8Z A;  4RL1 A;  2DGU A;  1XMQ J;  2ZH1 A;  4JOU A;  2VA2 A;  3EXC X;  2MYF A;  5F8J A;  3MCN A;  3DXS X;  1RT6 B;  2MPU A;  2G0I A;  4X65 E;  4ED3 A;  1N33 E;  1KEK A;  2DGS A;  4NMX A;  2CJY B;  1H38 A;  1AZS B;  1FRI A;  4DCJ B;  2VBX A;  4MKB A;  4OI0 A;  4KR0 B;  4MKV A;  4OYB A;  2QLB B;  4KHP E;  4FBU A;  1QVF R;  4KO0 B;  4USW A;  3HJC A;  2Y0B B;  4K4X A;  4JI7 E;  3OR2 A;  2J76 E;  2B3T B;  2YKP A;  3QT7 A;  3W66 A;  2W2P P;  4FBT A;  4QWB A;  5HLF A;  4A8W A;  5LT5 A;  2V69 A;  4QPT A;  4LFC I;  3KHR A;  4FDF A;  3UN2 A;  3LTO A;  1RAJ A;  5ETL A;  4DJB A;  1Y9O A;  1NKB A;  2WCX A;  5K36 E;  4DSE A;  2ILY A;  1TK0 A;  3KG0 A;  1HAR A;  3MM6 A;  5GAG I;  1KLM A;  3B78 A;  1LWX A;  1RWU A;  1TKD A;  1ROF A;  4TYA A;  1HBU A;  3BGU A;  1KQS R;  3TQE A;  2YX4 A;  5H9E J;  4CI0 B;  5D0G A;  4FXW A;  4KB7 A;  3EZU A;  5F8L A;  3EDQ B;  4B9V A;  1EI1 A;  2L48 A;  2H5I B;  2DNK A;  2UXD J;  2C2N A;  2E9Z A;  1R8P A;  1X9S A;  4WFB Q;  5IS2 A;  3NL0 A;  1XMO I;  1RLC L;  2ZH5 A;  4LF8 E;  2RF2 A;  4TY8 A;  4EWT A;  3CE8 A;  3MAH A;  1IBL F;  2CQP A;  4KHP I;  2DGQ A;  2VUG A;  1NHU A;  1UJ5 A;  1B62 A;  3C14 A;  2K3K A;  2V2Q A;  1TP7 A;  2BKP A;  1GXU A;  4LF9 F;  1RU1 A;  1S99 A;  2JEA B;  3NBP A;  1U6B A;  4YHH I;  2W9C B;  2IJR A;  3MUR P;  4UOF A;  3DGP A;  3MM7 B;  3TA1 A;  3WBZ A;  1KRP A;  5AT1 B;  4Q44 A;  1FCA A;  1VQY A;  3ZTR A;  3GWC A;  1U6F A;  2LEC A;  3BQ1 A;  1SV5 B;  5B08 A;  5JEA F;  4DV7 F;  4Q5V A;  3SQG B;  5KFE A;  3FCH A;  2JC0 A;  4ZVQ B;  2ZH4 A;  1J5O B;  2DO4 A;  1PVG A;  2C28 A;  1RT7 A;  2V2V A;  4LF6 J;  1XER A;  1H73 A;  4WCE Q;  1N88 A;  1FRX A;  2GVZ B;  1MLA A;  3VVT A;  4CO0 A;  1Q79 A;  3PZP A;  4LF5 E;  4DR4 J;  4KGV B;  5DGB A;  1RT6 A;  1IXK A;  1A6L A;  5K8O A;  2C2E A;  3CSK A;  2J5A A;  3FZB A;  1IM6 A;  4P73 A;  2AIR B;  4DL5 A;  4IOB A;  4BDP A;  1AZS A;  4ZPB A;  3MUT P;  4LFB F;  4HTI A;  1T94 A;  4HHJ A;  4QU6 A;  3N28 A;  1HNZ J;  4PYD A;  4GRS A;  4KO0 A;  5D6G A;  2LVW A;  4JI1 F;  5F9N A;  3CCM S;  3MD3 A;  1WTB A;  3ZNU A;  3I56 S;  4WIQ A;  1S9E B;  2XCP A;  3OTC A;  3M4X A;  5KAK A;  2RVJ A;  2HS3 A;  2X51 A;  4RNF A;  2B4V A;  4YUD A;  1WDD A;  2OUG A;  2Z5E A;  1N5Q A;  3AA8 A;  3J81 j;  2V94 A;  2ROE A;  3CCE S;  3J80 Y;  2KFN A;  5LM7 E;  3V81 B;  1U1M A;  5BR8 F;  3MGJ A;  3BKT A;  3HHE A;  4UOH A;  1SC6 A;  2Q1L A;  1R0A B;  2MHE A;  5FDL B;  4MDT A;  2E1M C;  1MNE A;  4OJH A;  2K3I A;  1U8W A;  5HJY A;  5CYM B;  1NJY A;  3QSY B;  5HMX A;  2HBQ B;  4OIX A;  1YIT S;  3R6G B;  4GKK I;  3BO3 A;  4DV4 J;  4A8O A;  3HO1 A;  4DR6 E;  3CMQ A;  4YB5 A;  1JXV A;  3TZZ A;  1U1O A;  2FHJ D;  4NLR A;  2DRB A;  1XNQ F;  2MY8 A;  5ELW A;  3MM8 B;  2JEA A;  2W9C A;  4UY8 5;  1IBL J;  3QZ7 A;  1H3D A;  3MM7 A;  1N5Y B;  2VDI A;  3B4D A;  2QL5 B;  2PEB A;  1CJK A;  3FFI B;  5HMZ A;  3N0V A;  3K57 A;  3FEX B;  4B08 A;  4DUZ F;  3DLB A;  2PO0 B;  1SV5 A;  4LF9 J;  3OFG A;  1UDS A;  5C0X D;  4KH0 B;  1WNE A;  1Q1K A;  5C25 B;  1XK8 A;  3SQG A;  5KFJ A;  2BDP A;  3DU6 A;  4YN3 B;  2H54 B;  2CPF A;  1K0V A;  2XGQ A;  2C39 B;  5GAG U;  1JNR B;  1N5T A;  2HNY B;  1J5O A;  3VF0 B;  1NU4 A;  2PDA A;  2W2N P;  3M8Y A;  1JK9 B;  2DPI A;  4B3T F;  4AD6 A;  5IQ6 A;  4LFA E;  4M5K A;  3MUM P;  4JV1 A;  1HNX E;  1OPI A;  2GVZ A;  1PJ7 A;  4MK8 A;  2H5J B;  4RW4 B;  3NOC A;  4JI4 I;  1F5B A;  5AE3 A;  4O4G B;  2DJW A;  5KFM A;  4PPD A;  3V4M A;  3SSR A;  3GJS B;  4P7T A;  4LRE A;  2KFY A;  3BQ0 A;  1T9V A;  3SCK E;  2V8V A;  4LBI A;  2Y1J A;  1BQN B;  3SCL E;  4IYQ A;  2KRB A;  3JSY A;  4NOH A;  1GX5 A;  2HUR A;  2W8K A;  1VQM S;  2GO3 A;  2UUC I;  3B82 A;  2Y9H A;  3GG0 A;  2BM0 A;  1XQI A;  3P5T L;  4IH7 A;  5DRP A;  2AZ3 A;  4XIU A;  2AGO A;  4DG1 B;  3GJR B;  4B3M E;  2CNK B;  5B0F A;  2ASD A;  1NDK A;  2Q6C A;  1E3P A;  2VQF J;  4P75 A;  1S9E A;  4LFB J;  3EYZ A;  2VG6 A;  3DYA B;  4RX6 A;  1X4E A;  3CB4 A;  2E9R X;  4KV8 A;  3MEE B;  2NSC A;  3WX4 A;  2Q6B A;  4EI2 A;  4ECV A;  2BBE A;  2F40 A;  3P3D A;  3D1H A;  2IRU A;  1VQ8 S;  3HKW A;  4ZN3 A;  1FD2 A;  3O2I A;  1PC5 A;  3V81 A;  2UVW A;  2IES A;  2MLZ A;  3O5T B;  4RO0 A;  4A46 A;  1LW2 B;  4K2X A;  1XR7 A;  2EEY A;  4LVN P;  5CZV A;  1X5T A;  4I3H A;  2JLF A;  1NHJ A;  1R0A A;  1RTI B;  3UI3 A;  5DQG A;  2PO1 B;  2ZE2 B;  2QL7 B;  3K59 A;  2EBG A;  4ID8 A;  3UD4 P;  3PJ9 A;  4LF1 A;  4DR1 F;  3SEO A;  3U1K A;  1OIA A;  1IR2 A;  5CYM A;  3OHB A;  4DSJ A;  3ETO A;  2DNZ A;  3NMR A;  5LL6 R;  2ATL A;  3X3U A;  2AP6 A;  2V4J B;  2WB4 A;  2ZHO A;  2ZKT A;  4GKJ E;  1EA6 A;  1WF0 A;  3V4I A;  3NNA A;  4WYW A;  4M5G A;  4AL5 A;  2PFD A;  3R8Y A;  1BGX T;  4DDF A;  4DX6 A;  1NK8 A;  4YY3 F;  3MM8 A;  1QTN B;  3S8S A;  2YQ0 A;  4ENO A;  1N5S A;  4V19 J;  3VAF A;  4YDX A;  4DV6 J;  4FWD A;  5ETM A;  2YNH B;  1YRU A;  2JNJ A;  3PRV A;  2QA4 G;  2VU5 A;  3RAQ A;  9ATC B;  2DHS A;  1AYE A;  2G1H A;  3FFI A;  4OQJ A;  1EAY C;  2E5L F;  3T1Y E;  3D3B J;  2O67 A;  4Y2A A;  4KY3 A;  1DLO B;  2VFR A;  5C25 A;  2HWH A;  3NCP A;  2OD4 A;  4JI3 F;  4N56 A;  2C39 A;  1RKJ A;  3DLE A;  2HNY A;  1Z5A A;  2B7C B;  3BEG B;  4LRB A;  3S7R A;  5I42 B;  3HVA A;  3DNC A;  4OZ1 A;  4OZN A;  4C8L A;  4F4K A;  2BMB A;  5KFT A;  2R7T A;  4PRV A;  2I8E A;  5KFN A;  2HHX A;  3RTV A;  1PSD A;  3BSC A;  4RW4 A;  5BYS A;  3MEC B;  3K17 A;  1RAE B;  2ZM6 I;  3MCM A;  1KQG B;  4CO3 A;  2QN6 B;  4B3T J;  1RYS A;  2CUY A;  1N36 E;  4P7A A;  3DXB A;  4L73 A;  2CZ9 A;  1SBR A;  4NX9 A;  2IOP A;  4NLY A;  3GIL A;  1BQN A;  3KOA A;  2C22 A;  4ZIT A;  3PIO Q;  4OYW A;  1R8A A;  2DY9 A;  2C3O A;  3OFE A;  3EWG A;  1BD6 A;  4CLS A;  2QYG A;  3FSX A;  3D9B A;  1S97 A;  4DG1 A;  2FPH X;  3RRK A;  4DR3 I;  1G7C B;  3JTN A;  2CYY A;  2BJ1 A;  4O4R A;  2EPI A;  2M52 A;  2XMT A;  5CYJ A;  5K36 A;  1T05 B;  3MEE A;  3FEZ A;  2JLG A;  1WD6 A;  2JOQ A;  3MR5 A;  3DI6 B;  4IFD C;  1FDD A;  2XY5 A;  2XY7 A;  1Y4U A;  3CWV A;  2KXN B;  2NRE A;  4QWD A;  4ZPD A;  4F2S A;  2JVO A;  1B4S A;  3C8Y A;  3G87 A;  4KBI A;  2HRT A;  1LW2 A;  4EO8 A;  2IBK A;  1NHH A;  2FUG 9;  3GV7 B;  3C6U B;  2Y1L B;  3OD2 A;  1EHW A;  2PO1 A;  1SVD A;  2ZE2 A;  1FRK A;  2IDL A;  3RB3 A;  1TAU A;  1WF2 A;  5A8K B;  3DDI A;  1R8C A;  3KUE A;  4ED0 A;  1UZD A;  1RCX B;  2CWX A;  3GE9 A;  2FIU A;  1S6O A;  2DNY A;  3AXK A;  2LEA A;  4WK3 A;  4DR7 F;  2OTL S;  1B64 A;  1W26 A;  3PRY A;  2PGC A;  1N34 E;  2M4M A;  4DSI A;  4DR1 J;  4FP9 A;  2DEI A;  2VF3 A;  3CJ2 A;  4JI0 I;  3DD6 A;  1HWU A;  2M5Y A;  4C8Z A;  3BR8 A;  2B9W A;  2YNH A;  4CIO A;  1K1S A;  4NXN E;  1Z5C A;  3CCJ S;  1R3N A;  3O3L A;  1ZXN A;  4DSF A;  3DRR B;  2ZZT A;  3TZX A;  1O6X A;  4DV1 F;  4TQS A;  4DR5 F;  4F4X A;  4QQB A;  4YY3 J;  2CDQ A;  1DLO A;  4M95 A;  2DH7 A;  3NWR A;  3NZK A;  1T9U A;  4TLR A;  2XMJ A;  3PYF A;  4K2J A;  1R0B G;  1BLU A;  4OJ3 A;  1H7S A;  2O01 C;  4DV0 F;  5I42 A;  4ZVR B;  3UD5 A;  1PAE X;  3TWZ A;  2RE1 A;  1NDL A;  2V8G A;  4FPI A;  5G4D A;  3IRW P;  4I64 A;  2PO2 B;  1Q95 G;  1RDR A;  3D67 A;  1I94 I;  4B3S I;  2F8H A;  2B6A B;  3MZI A;  3MEC A;  3A8K A;  4JUZ A;  4JI3 J;  2M7S A;  3RAX A;  3BSO A;  4NXM I;  2QFJ A;  2DNG A;  3H25 A;  1WHX A;  1QZR A;  2DGX A;  1RTZ A;  1SI9 A;  3Q8U A;  2CQC A;  3CCL S;  2ZDO A;  3FMW A;  3P3E A;  4OYA A;  1LV5 A;  3J80 C;  4DLE A;  5JVG Q;  1X4C A;  4IFD E;  4F50 A;  4NXN I;  4WWS A;  2VFT A;  1EB0 A;  5ETT A;  1D9D A;  4P52 A;  4KPC A;  4ZVT B;  1T05 A;  3N5F A;  3GSD A;  1XHK A;  1OQ6 A;  4QCL A;  3GFH A;  5DLF A;  3DI6 A;  3J7Y I;  1U1N A;  2LXI A;  5B0B A;  3FGV A;  1RI7 A;  1HI0 P;  4BBY A;  1Q7L B;  1S9F A;  2JFK A;  3LGH A;  2MKK A;  4Z37 A;  4R1F A;  5KFO A;  1SKW A;  2KKH A;  1ZS6 A;  2N3O A;  3DOK B;  2CVI A;  1Z59 A;  4LIR A;  4OI6 A;  2ZH3 A;  3NAH A;  3DLG B;  3GG1 A;  1VQS A;  2EXU A;  3W8G A;  3C6U A;  2ADB A;  4JI8 E;  3U1Y A;  3H7H B;  2Z56 B;  3FKB A;  3RAM A;  2QTW A;  5C5J A;  2J7K A;  2HGL A;  2H3E B;  3M8W A;  4OYZ A;  4UW2 A;  3GIR A;  2Z2Y B;  5A8K A;  5LSR A;  1ZBT A;  1NRK A;  1FWK A;  4WP9 A;  1F2G A;  5KTQ A;  1XJW B;  3TA2 A;  4K4Z A;  2HFU A;  4I1T A;  2B4P A;  1E6V B;  3GU0 A;  4I2Q B;  2QV6 A;  1UET A;  2EKY A;  3HMJ G;  3QFW A;  1ACM B;  3DM2 B;  3M85 D;  2A2D A;  4IO9 Q;  3A3P B;  1Z2L A;  1UJ4 A;  2PI4 A;  5E3A A;  1C1C B;  2MZ1 A;  2GZO A;  2CQ4 A;  1TL1 B;  2AE8 A;  3CT9 A;  3LAN A;  1AUD A;  4DUY E;  4CLK A;  3QLH B;  2MKH A;  4NA2 A;  5F8G A;  2N4D A;  3DRR A;  2AF6 A;  4DR7 J;  4KJI A;  3H4L A;  1TFY A