3PYDA

Crystal structure of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) from mycobacterium tuberculosis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
298
structure length
298
Chain Sequence
SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 84
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pydA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pydA01
1IBME 2UU9I 1H72C 1EA6A 1XHKA 1ZM2A 3B8HA 4DR3I 3QT7A 2HHHI 1FI4A 4DPTA 3OTOE 1S4EA 1FNMA 4EMDA 4OX9I 3QT6A 4X66E 1DARA 4RPFA 1WUUA 4NXNE 1PKPA 1HNWE 4LF5E 5FLXQ 4YHHE 4DV4I 2AJ4A 4DPWA 1BKNA 3WU4A 2DEIA 3LPSA 4LFCE 4DR4E 1ZM3A 3V2UC 2F4VI 4JI8I 2XEXA 4DPUA 4DUZE 4LF6E 4NXME 3B78A 4DV6E 1XMOI 1XMQI 2HK3A 5A2QQ 2DEJA 1I94E 4LF7I 4X62E 4JI7E 1U2RA 2UXBE 4LF4I 4HYMA 1KIJA 3QT8A 4B3SI 2HKJA 1N33I 5IWAI 2NPFA 2UUCI 4DV3E 2R3VA 4DV7I 4FW9A 2ZM6I 1B63A 4WUCA 4B3SE 5IT9Q 5LMNI 2V2QA 1XMQE 1Z0VA 1XNRI 4X65E 3ZZTA 1I94I 1N32E 5FLXC 1VISA 4JI5I 3K1JA 1RREA 4MYUA 1N36I 2UXBI 4JG4A 1Z0BA 3J81C 1XMOE 4JI0I 1H7SA 4GKKI 5LMUE 4B3TI 4DR1E 4DR2I 1Z0EA 2UUAE 4Z7YA 3PYDA 4I3HA 1Z0GA 1KTVA 4JI4E 2F4VE 3B82A 4JI1I 4GKJE 2HK2A 4JYAE 2ZITA 5LL6R 4JI5E 1Z5BA 1HNXE 1N36E 4JI2I 1H73A 2V2VA 4LFBI 1FJGI 4LF8E 4KHPI 2E1RA 4K0KE 4LF7E 3PYFA 1N34E 5LMNE 2UUBI 3HULA 4PRXA 4PU9A 1HNWI 4JI2E 4DXLA 1XNQE 4JI1E 4GKJI 1UEKA 1MG7A 4X65I 4YHHI 2VQFI 1IBKI 4JV5I 4DR3E 5BR8E 1NZ0A 4R1FA 4AQYI 4B3RE 4HY1A 3F0NA 5GMDA 4FWDA 4X66I 2UUCE 1ELOA 5A2QC 4LF5I 4P7AA 2ZBKB 2EFGA 3ZKBA 2X7IA 3CWVA 3WU3A 1IBLI 4B3ME 2LJPA 3ZZ0A 1XNRE 4JI6I 4DPXA 3H4LA 4DV2I 4JV5E 2CZ9A 4DPYA 2UUBE 1ZM9A 4AQYE 4B3RI 4X64E 1A6FA 2J7KA 2E5LE 2VQFE 4LF9E 2A2DA 4LFAI 4DR5E 3J80C 1S16A 4LFCI 5L3JA 3Q1QA 3J80Q 3JAMC 2VQEI 2E5LI 2X36A 4DV2E 1ZXNA 4DV5E 4LFAE 4MYTA 4JI3I 1PIEA 3GONA 4DU8A 4USMA 1N0VC 1MX0A 1N32I 1ZM4A 1Z0WA 1IBLE 1D6TA 4GKKE 4B3MI 4JI8E 1RR9A 2WW4A 1NHIA 2UXDE 4DV7E 4ED4A 1IBMI 2HKEA 4P52A 3WU6A 4DV0E 2BM0A 4X62I 3PYEA 4KHPE 3QT5A 4HACB 1Z59A 4NXNI 4DV1I 1K47A 4YY3E 4URLA 1J5EE 5IT9C 4KQVA 2OI2A 1EI1A 1PVGA 2HFSA 2ZM6E 1FWLA 3OTOI 3ZKDA 2V8PA 3ZZUA 3T1YI 5BR8I 1QZRA 4JI0E 3WU5A 1HNXI 2UXCE 1HNZI 4JI3E 1NHJA 4X64I 3LTOA 1OJ4A 1NHHA 4DUYE 1KKHA 4JI7I 4DU7A 1FWKA 4DR1I 4XTJA 2UXCI 3ZM7A 1Z5CA 2HFUA 4DR2E 3J7AM 3K17A 2UUAI 1FJGE 1J5EI 3T1YE 4DR4I 3LNUA 3J81Q 3V5RA 3PYGA 1MU5A 4YY3I 4DUZI 5IWAE 4HXZA 4WUBA 1N0UA 4JI6E 3J7AG 1KVKA 2Q2EB 4LF4E 4DV0I 2UXDI 2R42A 2V34A 1Z0CA 1IBKE 4DV3I 4OX9E 1N33E 1XNQI 1Z0TA 4ZVIA 4FWHA 2UU9E 2BV3A 1ZXMA 2HHHE 4FWGA 4UT4A 4Z7CA 2A2CA 2VF3A 4DUYI 4PRVA 3JAMQ 1FKAE 3T1HI 4DV5I 2BM1A 1HNZE 1HR0I 2VQEE 4LF8I 4UTGA 4DR7I 4K0KI 4DR6I 4USKA 1N34I 4JYAI 5GMEA 3M6AA 1Z5AA 4JI4I 1H74A 4LFBE 1B62A 4DV6I 4LF9I 4FN5A 2GS8A 4DR7E 5LMUI 4LF6I 4NXMI 4DR6E 4HACA 3D4JA 1HR0E 4M1KA 4DV4E 2V2ZA 4WUDA 4DR5I 3T1HE 4B3TE 1H7UA 4DV1E
chains in the Genus database with same CATH superfamily
1N36F 3DLLQ 2UU9I 3KLHA 4O44A 2W9AA 1B7FA 1EP4B 2VFTA 2CJXB 4FPRA 3KLGA 3PO4A 1S49A 1U0SA 2VOOA 4LVOP 1OQ6A 1IQZA 5D78A 1Q8KA 1TL7A 3HCXA 4K4WA 4OQJA 4GKKF 4QIVA 2CJYB 2HFVA 3MAAA 4OLPA 4NOHA 1RKJA 5GVQA 2R4FA 2F3JA 3EGNA 1U1LA 3J7A1 5FLXC 1E6VB 4CLUA 3PZPA 4JYAJ 1VC5A 4CCHA 4KIAA 3MPDA 1JWWA 1LK5A 1JLEA 4ED5A 1N5VA 1AA1B 4ID8A 1GMUA 1R6MA 3CDEA 4LFCJ 1APSA 4I4BA 4QWCA 3ADAC 2KM8C 2ZHAA 3JXOA 2QO3A 1FNMA 1S12A 4A8XA 4OX9I 4YDXA 2HWHA 5DNXA 2KYXA 1BLUA 5L8RC 3HHLC 1RBAA 5G4DA 2HG4A 2FDNA 2ACYA 3GTYX 3TRGA 2ALYB 5AXNA 4NXMJ 4OI2A 4NEYA 4NLQA 3HFKA 2XB2D 4ED3A 5L1IA 1FNOA 3I0RA 1BUXA 4RPFA 5CCMA 1C4CA 3P5BP 2J7UA 3QFWA 1NJXA 4DL5A 5CYMB 2CPXA 3MAAB 1PKPA 1UDNA 1ROFA 1SJ1A 1TU0B 1MROB 3N6LA 3NS7B 4PXBA 4DSEA 4PG4A 4LF5E 2FZKB 1NJYA 4NRUA 1YJUA 1TK5A 2G0CA 3O44A 4FYWB 1HI0P 2Z58B 3FEYB 3NBPB 4ZKAA 1HFEL 2B9WA 4XAKA 2CPDA 2ZBCA 1RTDB 1UVMA 1A7GE 1ZZFA 4X64J 2B7CB 2Q6BA 1RAIB 1BKNA 5K36E 2QX0A 4CLPA 3R6LB 1TFYA 2DEIA 2K06A 4JI8J 1QJHA 5JEAC 1R8BA 2IYIA 2DNZA 3KFWX 3AD9C 3CSKA 4HDGA 4CLZA 4QW9A 1KR4A 2LFVA 3LUYA 2Q6CA 3MUVP 2JSXA 5HQMA 2QZ8A 1B3TA 4Q2MA 3V2UC 4ZVHA 4E98A 2D7SA 4ZMMA 3J80U 1JX4A 4DPUA 1WEZA 4KAIA 2MQMA 3VHQA 5LMNJ 1X9SA 3R5DA 5HQLA 4O0IA 3CCSS 4NXME 3A13A 1TUWA 2E1PA 1RCOB 3MHYA 4FKYA 3KOAA 3M7VA 4IR9A 1AW0A 3PO5A 4QIWD 5HAOA 2CIMA 2J0WA 3O8WA 3T6BA 1NSKL 4RNNA 2IIHA 4ALZA 5LJ3Y 1WF1A 1KHWA 1WNEA 1VIOA 1VK8A 1YBTA 3IM9A 4RUHA 3OVSA 3M2RA 2DITA 2ZH3A 2QLWA 3V6HA 4WBFA 4ED7A 1LK7A 4DI6A 3GE9A 1IBKF 1DJ0A 2ILZA 5FWKA 2L48A 1RT7A 1OSDA 2PT0A 3W9HA 4ILMA 1YVFA 2AMCB 2FHOB 2HQDA 3FNNA 3PRDA 2K8GA 2OPQA 3N6MA 4F7VA 5A2QY 1SL0A 1IBMJ 4H4OA 2XZTB 4KR0B 1ZH5A 3HK2A 3JYTB 1WI6A 4YMEA 4DL3A 1SC6A 2MB0B 2IOPA 2DY9A 2VICA 3SQGA 3KJQB 5KFQA 4J9LA 4ICLB 3M32A 4V1Ak 4LSZB 1R8CA 3SIPB 2VFSA 1R6VA 1FDDA 4U8VA 2IVFB 2XLKA 4M5MA 4OYZA 3QMQA 1IKYB 3PHTA 1VR6A 2V9KA 2VG7B 4USUA 3PKMA 2QYCA 3V4MA 1MN7A 2DR9A 2CADA 1KTQA 3EGWB 3HPOA 4DV3E 5IC6B 3BSNA 3I5BA 2LECA 2R3VA 3VAMA 5LM7E 3NZKA 2QL9B 1H98A 4Y28C 4LSLA 1J5EF 3MCMA 3MOZA 3HD2A 3TJAA 1RT3A 2HGMA 2Z5BB 3GJTB 1TK8A 3BJYA 4LJMA 3IG1B 2ZM6I 4CLYA 4ZN3A 2F4VJ 5IT9Q 1XNRJ 2VUGA 1RABB 3FFIB 1RAAB 1RBOB 2VBXA 1I94J 2BJ7A 4DWIA 1W26A 3JS9A 1TL3A 5E3CA 2FGCA 3VAKA 4RW4A 2BJ1A 4W4MA 3PX4A 2CQ3A 5LXRA 2WTFA 5JEAE 5DROA 2UXBJ 4JI0F 4RBTA 2VODA 1VISA 2XMTA 1NH8A 3KG4A 1EETB 3K1JA 1T03B 1RREA 3OR1B 4MYUA 2PFDA 1N36I 4K5RA 3Q23A 4EYHB 2BR0A 3FCHA 1C2PA 3GQCA 4JG4A 2KHCA 2Z30B 1FJEB 4YB1P 1HNIB 4RLEA 1X31C 2NS1B 2R9LA 2DVIA 1EKSA 2RHQB 1M5KC 4IFDE 3M8WA 4QR1A 1NU4A 1AROP 1UMJA 2ILYA 4GKKI 3UR3C 2RHSB 2YXLA 5HVFA 2CZ4A 2DJWA 4GMKA 3AD8C 3MR2A 3CC2S 3OW2R 2OKQA 2W4CA 1EAYC 4QWAA 3M9MB 4DR2I 3WBZA 2QFJA 4UUXA 4IFDA 3SDEB 4NL5A 1NCLA 1S1VA 1YQHA 5F9LA 2EG2A 5KFOA 2IC3B 4IH5A 5EUHA 3CJRA 2F4VE 1N33J 4DR1I 4WIIA 2UUWA 2EWHA 3AAWB 3KJFB 4WE1A 1U7LA 5DLGA 1S1XA 2PC6A 4DV0J 1HHTP 5HMXA 1RACB 2ZH4A 1FRKA 1C4AA 2DNHA 3FCVA 4S0MA 3VGVA 2B43A 4J9UE 3KJVA 1IBMF 1PILA 1HNXE 4JI2I 4JI7J 4PXDA 2VPZB 4QWDA 3MEDB 3M8RA 2R7UA 1CLFA 2HNZA 1P1TA 1IBLJ 2E1RA 1SUQB 1V3ZA 3RJMB 1VMBA 1S9FA 3PYFA 1L3UA 1J5EJ 2AGPA 2Y1RI 5LMNE 4M5IA 5IT0A 1SBRA 4OI6A 3OT9A 2EVZA 1EZZB 4LFBF 2KZMA 1RHYA 4DOZA 4DV2J 4FW6A 2X3DA 4FYVB 2Y9HA 1JJCB 2VPWB 4DV7E 2JEBB 2XCAA 3CC7S 3J7AN 4BC9A 2QA1A 4JI1E 3FSXA 1RK8A 2G2ZA 2JT2A 2VQFI 3TQEA 4DSKA 1X4FA 4ES3A 2XZWA 2HLTA 4JI0J 3G87A 4H4MB 4X66F 4ITSA 4LMZA 4L3KA 4ICLA 4LFAJ 2J8AA 3L7UA 4YFUA 3FC9A 4AQYI 3M2UA 1UJ6A 2HURA 4C97A 1RSCA 2R7RA 4HXZA 2X1FA 3EDQB 3JYTA 4UUWA 1C0TB 3F0NA 4J9MA 3NGTA 1NK8A 1W2BR 4QYZK 3CCZA 2IM0A 3DRRB 4RJVA 3TUIC 1Y60A 1RB0A 3UD4P 2RE1A 2KHDA 2XMWA 1E3PA 1NSAA 1RAHB 1P27B 2DXFA 4HTIA 4LF5I 2MHEA 1WDDA 1D9FA 5K36D 2HHSA 3AH6A 2XHCA 1RHRB 2XMMA 3OR1A 3MM9A 4MMOA 3KHGA 5HP1A 3O5TB 1AUDA 4IFVB 4ZCLA 1KLNA 4KV8B 2VJUA 4O23A 2X7IA 5L1JA 2NN6C 2MGZB 4IZJB 2XS7A 4IH6A 4A8WA 3CWVA 3OUYA 3CC4S 2CVEA 1VQYA 1QTNB 2OFGX 4FXWA 1O8BA 4RW4B 3SSRA 4KHRA 2XSJB 3GFHA 4KE5A 4KQZA 4LQ9A 3ZZ0A 4DF8A 2X3GA 2RRAA 4O3RA 4JI6I 1CJKA 1VRQC 2PO1B 4OI4A 2W4PA 3AA8A 1Q78A 3H4LA 2CFXA 3PS3A 2XMKA 4ZVOB 3WC0A 5EHHA 3TYTA 1RHKB 1XMBA 4TY8B 5C42A 5D6GA 1FXRA 5IT9U 1KQKA 2DT9A 3DU6A 3K8VA 5L1LA 4DV4J 2EK1A 2FZCB 2UVRA 2CJBA 3D28A 4XTTA 5I42B 1RTDA 5EL9A 3BM7A 4KPCA 4B3RI 1Q81T 2NREA 1UTAA 5FIIA 2CDQA 3Q8SB 1A6FA 2E5LE 1IKYA 2JVRA 2VQFE 2A2DA 2D74B 4FS1A 3OVBA 1SIZA 1FD8A 1MROA 2DGOA 1UJ5A 2PEBA 3QIDA 3QLHB 4H4KA 1U8SA 4OYXA 5AT1B 2EPIA 3SQGB 4U67Q 5L3JA 3A3NB 3K57A 1UDQA 3Q1QA 1WTBA 4ATNA 2GW8A 3U1LA 2CJQA 1LW2A 3DDNA 1YJRA 1GMWA 1YZ6A 5E41A 2BZ2A 2YNIB 3CCRS 5E3AA 1JKHA 3TEHB 3HT0A 3TZYA 4ED6A 1FCAA 2WSEC 1GXLA 1WKJA 4JI3J 3L09A 4K4YA 2EBGA 4JI4J 4OFZA 3I5AA 2DGUA 2F8MA 2EFVA 4EEYA 2JVOA 2WZ1A 1V5IB 3LGHA 3TJ8A 4DV6J 1QAYA 4LFCF 2HQGA 1Z2ZA 2HWIA 3EGVA 1HQUA 4MYTA 5KFRA 5HMYA 3MF5A 5M2UA 2LQBA 1MMLA 2ATCB 3EZUA 3IBCB 4GVLA 3NG8A 5DETA 1F9EB 3NS5A 5IQ6A 2FLLA 1NHKL 2YX7A 2HFNA 4K4XA 2IRYA 3DYAB 2JOQA 1Y5IB 3EYZA 1VQMS 2AEMA 1FTRA 4IFYB 4LVNP 4RL1A 5LJ5Y 3GP9A 1UWAA 2AT1B 1RWXB 3IP0A 4ZCIA 2J6TA 5LSLA 1FRIA 1QM9A 4I2QA 5K8OA 3TOQA 2V9WA 3QAEA 3TVKA 2F63A 1F3FA 1X4GA 2NZ4A 1Q79A 3IAS9 5LL6d 5D3GB 2MQNA 2EC0A 1N32F 2W01A 1NPKA 5THWA 4ZCMA 4DFKA 2ROPA 1UZDA 4ED4A 1G4CA 1Y4ZB 1K44A 2AV5A 3A3OB 3E3XA 1IBMI 2YKPA 2GMHA 3OHAA 4ECTA 5HSPA 5D3GA 2PDAA 4IZKB 5DS7A 1BXNA 3OD2A 3UDEA 1HR0F 4F2RA 5EKWA 3WU6A 2BM0A 4IS9A 5BJRA 1SKUB 2WVBA 4I2QB 4DV4F 1UPMB 4C0BA 2QA4G 3SFUA 1YHQS 1YHCA 2WSCC 3M6UA 2DR6A 5CCLA 2XGQA 1YJNS 2ACMA 1DTTB 1N5YB 2Z2LA 1NBEB 3M2VA 4MFBB 4PPZA 3AB2B 5KG6A 2F8EX 2FHKA 5EDWA 1SKRA 1MU5A 4NXNI 3HHLB 2FPHX 4X62J 2NPIA 4TLQA 4DV1I 3BSAA 3R27A 5EX3A 3MXHP 4KKOB 4URLA 1XIQA 3CW2C 2DIVA 3MZIA 3ZXWA 2DH8A 2BDPA 3I9ZA 5IQQA 2DYAA 4FF1A 4TU9A 3FZ2A 5B0GA 1NB2A 3CF5Q 4TLRA 3PFOA 1N54B 5LSOA 2HHHJ 1QAXA 2I6WA 2VG6B 2CQHA 3IO1A 4I68A 5ADZA 2ZH2A 3CD5A 5IT4A 4DLEA 4N8OA 3V81B 2HFSA 1C1BB 4B3OA 4OKGA 1WC3A 1W25A 4GRSA 9ATCB 2YNIA 3ZKDA 2XYHB 3NWRA 3HJVA 3DRYA 4DCJB 3PRBA 5CD4A 1HA1A 4LF8F 2YWEA 3UNYA 1QZRA 1XR6A 1L5UA 4JI0E 4HH1A 4CZCA 3EGZA 4FNHA 1HNXI 1N34F 1XBWA 3MM8A 1Q53A 3ICLA 2PO2B 3WHIA 3X3UA 4DZDA 3L95X 3O3LA 3LQVA 3OTCA 3OFEA 4OYIA 1LW0B 4JB8B 4O4GB 3QO9A 2N4DA 4UF4A 3TX8A 3T5HA 4B3SJ 2HW3A 4X64I 3TAPA 1WWHA 2VL1A 3H2LA 4C7QA 4DUYE 5KFIA 3PTWA 1WHWA 5C42B 3OXGA 1FKOB 1GXUA 3KK3A 1R27B 4I6YA 3DXBA 2NR0A 4DR3F 1VLYA 4USVA 1JQGA 7FDRA 3QRPA 2UUAE 3DFEA 5KG3A 3J7AM 2OSQA 3D6HB 4ZVGA 4Q45A 4ANEA 2IMOA 1SXLA 3D68A 3HLUA 5DDOC 3RTVA 1G1XA 3HO1A 2VOPA 1FJGE 3PS2A 2HPUA 3BN4A 4IQMA 2RRBA 2MTLA 2J76E 5JEAD 3B54A 2BKPA 4F36A 1PBAA 3MEEA 1P9YA 4MKYA 4IZJA 3J81Q 1Q5YA 2HLUA 3MEKA 4HDHA 1Q86T 4I0WA 4OV1A 1OIAA 5KTQA 3MM9B 4ECVA 5HP1B 2A1BA 3NS6A 4M5KA 2FLOA 2GAGC 3N4WA 2MQ8A 4X84A 3CDIA 1NUEA 3MM5B 4U9RA 2W25A 3BH7B 4WUBA 1N0UA 1NJIT 2LP4A 3MR5A 5KFXA 4JV5J 3C16B 1E6YB 4NWBA 5AJ3J 1RBLA 4MTPA 1S6QA 2B6AA 1REVB 2VBWA 2ZBRA 3HSZA 4WYLA 3J7AG 1KP6A 5F8IA 2NSCA 2QMWA 3CD7A 2OMLA 4LF4E 2G4BA 2VG5B 4ILLA 5LXYA 3D1HA 3M2UB 1JLFB 3HKWA 4JI2F 1Q8LA 2Y0BB 1S1UA 2BANA 4ZDNA 1S6QB 4DL2A 2HHWA 4X4NA 1RHQB 2QGFB 3NP5A 3TUJC 1X4EA 2OPPA 1F5CA 4JOUA 1S6OA 2MZ1A 2L3MA 3BPDA 5E7OB 2R7OA 3G2XA 1OYPA 3HDSA 3V6DB 2CWKA 3GU0A 4UY85 3HF5A 2VD3A 2E9ZA 2V94A 3UI3A 1VIXA 4HYMA 3HHDA 3SXLA 3TEGA 2DBBA 4OZLA 4ETXA 4KHMA 2DB1A 1VFJA 3N5BA 4N8NA 2ERRA 4OO1F 1BQNB 4OYMA 4GO5X 1S1TA 1HNWJ 2IERA 1WC1A 4LF1A 1F1BB 3DHXA 4R5PB 1FERA 3IM8A 4MU1A 2OPSA 3IWXA 3UPFA 3J81U 2CG9A 5C24B 1IR0A 1GX5A 3Q6NA 1ZS6A 2YKNA 2P6SA 4P73A 3WDOA 1BD6A 2A2CA 3A1YG 5ETOA 3SI8A 3JAMQ 6AT1B 4LCHA 5F8GA 3NNAA 5C0XB 1DLOB 1FF2A 4YEAA 8ATCB 1SQGA 2BVZA 2CNLB 1FWPA 2PO0B 3CVKA 2PO2A 4DV5I 4K0KJ 4OYAA 3QFHA 3RBEA 1UVJA 3MMCA 2Y8YA 1HR0I 4ECYA 4G6VB 1DFDA 3RRHA 5IWAE 2VQEE 1CS4B 2MEWA 5ETTA 3GWCA 1CJVB 3QJLA 4X66J 3FSIA 3DLHA 3AJ1A 4DR2J 2DIUA 4IDKB 2U2FA 1LV5A 1VQ9S 2GO4A 1UZHA 1W7WA 2W2MP 4USKA 4WFXA 4DUTA 2DISA 3CIMA 3TA1A 1TK0A 5GMEA 3M6AA 4B3OB 3R5JB 1Z5AA 5KFJA 1KHVA 3A8KA 3SV4A 1WC5A 3NOCA 2KRBA 2I5JB 2MKYA 2DNRA 2AEFA 4NCGB 5A6WA 1FRLA 2Y1JA 2KVIA 4DL6A 2CYYA 1OPZA 4OZ1A 3HVTA 3LP0A 4OYBA 3UNGC 2AGOA 1L3TA 4K4SA 2M3DA 2D3OR 1RAOA 1RTIB 2LLZA 3GJQB 3H8YA 4KH0B 1OQ3A 4ZLNA 3PR5B 2DR5A 5LMUI 2GO3A 4M94A 2GMJA 1VQSA 4P7TA 1T9VA 1J2VA 3HHLD 3W7BA 1KBRA 3KDOA 5D0RA 4CP5A 4DR1F 4OI0A 2Q79A 1XERA 4UOHA 1YBAA 2DNPA 2YNFA 1V3SA 2H4WB 2RJZA 3M2VB 5ETPA 1G2EA 4DV4E 3ILJA 2QFIA 4K5SA 3NRBA 4WYWA 3UDVA 4Y6IA 4PWWA 2UUAF 4B3RF 3CDBA 4TYBA 5KT5A 4MU0A 4WUDA 4BA2A 3ET6B 4ZOSA 3PR4A 1SV5A 2YWFA 1U6FA 2XS2A 1BMQB 2H9ZA 4NA3A 3CCJS 4U3DA 4IG0A 3S6EA 2UVWA 3KLIB 2C2RA 1P9QC 3FVYA 3WX4A 4K4TA 3Q2TC 2PNZA 2QMUB 2UUCF 2HFOA 3GIIA 2RQCA 4B9VA 2XWYA 3ISZA 3DOMA 2DGTA 2XMUA 2H54B 1VQOS 2ZVSA 2KTQA 1EA6A 3VZHA 3UWTA 1S79A 2V69A 2E9TA 2F8HA 1TZ0A 4MH8A 2B4UA 4ZHRA 3P96A 1I51B 1T05A 3DRSB 4YS2A 3P8BB 2ZD1A 1ZM2A 4DR3I 1DAXA 1Y5LB 1XMOI 2BQ3A 5LMNF 2ZHOA 1HBMB 3CEDA 2BACA 1RT5B 4IFYA 3SSSA 3JB9k 2DNOA 2VFRA 3KUEA 4H4OB 5KFGA 2PMWA 4DPTA 2LA4A 4U95A 1X0FA 2DPIA 1KFSA 4YN3B 2KO1A 1SI9A 3NEKA 1R31A 3CT9A 3BZQA 1TTHB 3GYNA 3DGVA 2FC8A 5B0FA 3W62A 2UP1A 5K36C 3GLJA 4N3OA 3MCOA 3RRKA 1NJZA 3D5MA 4QCLA 1YJTA 3M2RB 3OR2A 3DDKA 1RLDA 3W64A 3P06A 4DV4I 2R2TA 1SC1B 4X66E 1G6BA 3PDNA 3K89A 1P8GA 2FJBB 3HKZD 2ZHBA 3CCVS 4F8RA 4NMLA 1DARA 2FB0A 3DRPA 2C3YA 5J2QB 2CNOB 2E5LF 3KLVA 5IOLA 5IM0A 1M5PC 4DFMA 4CO3A 4NXNE 2JEAB 1UP1A 4KFBA 4O3QA 2QLFB 4F3QA 4HTJA 2YNGB 2DNQA 3AJ2A 3CB4A 4CT9A 1RHMB 5KFMA 1S0OA 1TV6B 2KVQE 2GHWA 3DOLB 2ZNYA 3LALA 1DTQB 3N0VA 4NZ7A 1HNVB 2CA9A 3AHPA 2AJ4A 3H42A 1S97A 5E0OA 4DPWA 2BRKA 2FZGB 4GQUA 2MQOA 3HP6A 4OL8A 4NCBA 5J2NA 3KHRA 3BS9A 2N4CA 4J91A 2WCXA 3EZ5A 2VJVA 4LFCE 1NNDA 2UZAA 4BLGA 4CRJA 2I9SA 5GAGU 4DCOB 4XPCA 5JVGQ 2RU3A 2IDEA 2DXDA 2JFDA 3L7PA 5ETKA 2PD1A 3W9JA 2EXUA 3UVJA 3ZZRA 1Q4RA 4QWEA 2Z2YB 3OL6A 5K36B 3BYRA 1TUVA 2BABA 3FGVA 1RCXB 3KLFA 5F9NA 2ADBA 3I0RB 3B78A 1FVQA 3AJDA 4OI1A 2Z5CA 1RT4B 3ENAA 2MGZA 1RWUA 4NLWA 5F0WA 3M7ND 4ES2A 4QBUA 2BE9B 2JEGA 4JI8F 4PCQA 3W5XA 1EHWA 2G2OA 4X4TA 2FJXA 1I94E 1RWMB 1X4AA 5F41A 4JI7E 3IS9A 4LF9F 1YTYA 3DLBA 4C11B 1XK8A 5CH7B 4B9SA 2MZQA 1FK9B 2QSFA 3G6ES 2D1CA 2PA3A 4CM0A 4A47A 3BSOA 2IBOA 1E6VA 4BC7A 4OO1B 4QIGA 1HBMA 4MU3A 1E3HA 3QT8A 1HWLA 4L75A 3NCPA 3G6YA 3UHMA 3VQSA 4LF4J 1DQAA 1TL7B 2LEPA 2YX1A 1N88A 2CDRB 3IWLA 5F0UA 4B08A 3PKYA 2L41A 2XO6A 4ECUA 3T1YJ 2ATLA 2UXDJ 5AE1A 3L4BC 1S6PA 5E3QA 1CJTB 4IRKA 3PW7A 1JLGB 3LOUA 5JJBA 4KRWA 1WOOA 2ZM6J 5HI7A 3T5KA 1NDLA 1KLMB 5IWAJ 3D54A 1WI8A 3P4UB 4CWBA 1ICEB 3IR5B 3NGDA 1XNQJ 3KK1A 4WFYA 1IBLF 3ET6A 1B63A 3ZTOA 4WUCA 2IYGA 3Q6MA 3M8QB 3ZZPA 5HVGA 4Y0FA 4DV7I 2V0NA 3TNVA 1B7YB 2JZ5A 3G8TA 2UXDE 1J5OA 3TAQA 5K8PA 3CMES 3KWMA 5DG7A 2NN6F 4LF9I 3R3TA 4X65E 5D4NA 4OX6A 2Z4PA 2C3PA 3J7YU 2J0SD 4USIA 1VQPS 3D2WA 5C5JA 3U02A 5DQIA 3F73A 3CCLS 1D1UA 2BA1D 2P9GA 4I7FB 4OX9F 3QGHA 3D0IE 3GIMA 3HVTB 2XMVA 4DUYJ 1VQ8S 2C37A 3C6TB 3CDUA 5ETVA 5JEAA 1U1RA 4NCGA 1PYTA 3J81C 1Y3JA 2JL9A 5B0AA 1R3NA 4IOAQ 2DXEA 2DGVA 3SDEA 4HHHA 4KGKA 2VFUA 4PZVA 1SVDA 3KDNA 4J9VA 4F0KA 4ISAA 4DR1E 1ULRA 2CG4A 2LCWA 3CE8A 1N4LA 4B3TI 1ZBTA 1N33F 2LEAA 3MD3A 3Q83A 1CJVA 1F5BA 2C42A 2RVJA 3QWUA 1CS4A 4PWUA 3KG1A 4N47A 4C48A 1FESA 3POTB 1T94A 2PMHA 3PYDA 4Z7YA 3T5LA 3IC1A 4F26A 3AD7C 2LMIA 4F4YA 2N3OA 3T5JA 3Q8QB 1N6QB 4B9MA 2BR2A 2QG9B 2F5GA 1VRTB 4GKJE 1Y3KA 4RUBA 1NRKA 2HK2A 4WK3A 4JYAE 1LXNA 4JI5E 1LEOA 1T03A 1VC6A 2GVDB 3HZEA 5CD4H 2M88A 1RAEB 3ZO7A 4MU4A 3ETMA 1RT6A 1TKXB 1VDHA 2ZBQA 3IGNA 3EPGA 1GK8A 2V2VA 4WXWA 2FHJD 4F25A 2D3O1 4C8YA 1MMNA 1FJGI 1S48A 5C25B 3QGIA 1NSPA 2RAQA 2KXHA 3BSCA 3G96A 3CGIA 1I5OB 4R5PA 2N7YA 3R5CA 3FSYA 4WFZA 1UA1A 3JTOA 2XG8A 4LF7E 2CQ0A 1FDNA 1N34E 1VQ5S 1BWEA 1TUGB 1I6JA 2UUBI 4IRCA 2CPIA 3IG1A 4M5JA 4MQYA 1FX2A 2YNHB 4PRXA 4PU9A 5B7WA 3KYLA 2VBZA 2CQCA 2P8IA 2RKIB 1GQEA 4ZITA 2BJDA 5ETQA 1XNQE 3H2VE 2WVFA 4BWJA 4GKJI 4ED1A 1RISA 4J9OA 4YHHI 1RKIA 3TANA 3DLEB 2XLIA 4C4WA 1IBKI 3GPAA 4X2BA 4DUZI 4JV5I 5CZVA 1A6LA 2FY8A 4OJ3A 3I6PA 4HT7A 4ZVRB 4R8UB 2KFYA 4DX8H 1U0HB 1U48A 1HD1A 4X65J 2C39A 1NZ0A 4R1FA 4PXCA 3FDSA 1X9MA 1JLFA 4G1PA 2OH2A 3K0JA 1UPPA 3QBCA 1UEUA 2Q3PA 1CG2A 2ZBPA 1JLCA 4P75A 3I4PA 1RZMA 3D0HE 5GMDA 1OYEA 2OHDA 2B6AB 4IOBA 2MDAA 3CCMS 1D9AA 2UUCE 3KUHA 1ELOA 4Y2AA 1U47A 5A2QC 1NO8A 1DZ5A 4U7CA 4QWBA 1KD1T 1QSYA 2NCKL 2APOA 1HWJA 3LF0A 2PMZD 4NLGA 4PQUB 5D4OA 1Y5NB 3T1AA 3ZKBA 2JEBA 5A76A 4HHUA 3TQ1A 3M8PA 1FKAF 3P49B 2XY7A 3TWZA 4LOMA 1YWXA 5JMNA 3PJXA 3QSYB 3W5ZA 2M2BA 2XHWA 3OSPA 1HL6A 3KNGA 2R7SA 1RT1A 2MY7A 3M30B 5B08A 1SKWA 5HROA 2ZE2B 3P76A 1FTCA 3OLBA 1HMVB 3OTEA 4ZVEA 2HNYB 3GCXP 4HHJA 4DEZA 4L73A 5HLFB 3I96A 4NXMF 2FUG9 3BKTA 1FKOA 5DLFA 4B3RJ 2CPHA 1JLAA 3J7YI 4Y2MA 2JC1A 4QR0A 3D6TB 4OZ5A 3K58A 4DPYA 1QY7A 1D0EA 1RGVA 3BF4A 1DQ8A 4ED8A 3S01A 4IFDD 3KMSA 3KTQA 3W8GA 4LF9E 1RAGB 3LW5C 5L9NA 1HWKA 2PO4A 3C66A 3TUZC 2IOQA 3H20A 2KJWA 3J80C 1KRPA 2JX2A 1VI7A 2JLFA 2YY3A 1RHUB 2AX0A 2J8SA 4UZBA 1RDRA 4W98A 1S16A 3DCAA 3GCWP 2V8GA 3IMQJ 3EVOA 1RWPB 2AW0A 4FDFA 4NLTA 2HSEB 2V2KA 3DOKA 5A8KB 1FJCA 2GQ0A 2CQ4A 4I6AA 2KB2A 2KG1A 2BA0G 3J80Q 1TMMA 1WC6A 4W92B 2QJ3A 1BQMB 2ZUGA 3JAMC 4LF6I 2OGUA 3C6UB 3RBXA 1HLWA 4OI3A 3HT3A 3Q22A 2YWKA 1C1BA 3CDAA 4DQIA 2AWZA 5K36F 2E5LI 2Q1LA 4LR9A 4KO0B 2X36A 1KQSR 2NN6A 4DV5E 2Y3YA 5KFCA 2IESA 5I4MA 4DV3F 2MKHA 2DO0A 3VZIA 2ASYA 3EX7B 4DZ6A 2R2RA 1F9FA 4O4RA 4DU8A 4USMA 1JLEB 1REGX 3OTOJ 2Z2ZA 1BE4A 3HHLA 1MX0A 4AIDA 2CKWA 4U7UK 1SJ4P 1TQLA 4M5GA 2VFVA 2BOPA 1NDKA 1PGZA 4XPEA 1NPPA 1PYSB 1S0VA 4HLBA 3THPA 4A48A 5K14B 3C8YA 2MZRA 2FVPA 2ZZMA 1RR9A 1T11A 3JSMA 4IZKA 4MKAA 1WSVA 2RNEA 2B9XA 3J7ZT 1VBKA 2ZH8A 1WC4A 1NH7A 1F3VA 1X4BA 5B09A 1UJ4A 4O44B 4DQSA 2FVSA 4DV6I 2BW7A 4NEZA 4B3MJ 4CO1A 2AJQA 5KOXA 3HHKA 4FW3A 3A8EA 2MKKA 5KFPA 2R8GA 3WIVA 4DN9A 2GJFA 2ZC3A 2DNYA 2HKEA 1IKXA 1P6TA 5BYRA 5C7PA 3S8SA 4AFFA 2C22A 1VHFA 1VJQA 3FJ2A 2W4DA 1JXVA 1JNRB 1YG0A 4NXNJ 3THTA 3ZZZA 3KK2B 4C8ZA 4X62I 4ELVA 1S76D 3VAGA 3SYZA 1QUPA 1GMVA 3VTIA 2YKOA 3PYEA 5EWGA 2IFXA 6FD1A 4BHQA 4LCFA 1FKAE 1HD0A 5I3QA 1IKVB 3D3BJ 3ZTSA 4FKXA 4RU2A 1U02A 2WAQD 4DR4J 4KB7A 4X4PA 4NYZA 2BMBA 1K47A 2C2OB 4LF7J 2OAUA 4MIAA 4WP3A 2H5EA 2DRDA 4PEOA 4WK1A 5KT3A 4LF5F 2F4VF 4JV5F 4PQUA 1J5EE 1MW7A 2C2KB 3TW0A 1QVGR 5IT9C 3EICA 4GKJF 1RI7A 1O6XA 2D3UA 4YHHF 3EVWA 2OI2A 3CO0P 4I56A 2XMJA 2HRUA 3ENVA 2ZJQQ 2O3DA 5M2RA 2ZH5A 5C0XC 2GX8A 1FWLA 3NY0A 1AUSL 5A0YB 3DC2A 3OVAA 1VCTA 1CC7A 1JKHB 1RTJB 2AHOB 5F3ZA 2N82B 5DDPC 5IT9Y 3DD6A 3B6BA 2FJWA 3KXDA 4M5HA 1FKPA 2I1RA 2OEMA 4D3HA 2VHGA 5A8WA 4IFDC 2BYCA 3DLGB 5CYQB 1X5TA 3OJUA 2FVRA 1U0HA 1HBOB 2IPOB 3ULHA 2DD8S 4OLOA 4CDIA 1PG5B 3DM2A 3OTOF 1ZTWA 1L3SA 5HL7Q 1TKTA 4USHA 4LSNB 2B9EA 5KG1A 2GQCA 4A8OA 1RT2A 1HBUA 3B4MA 4CTAA 4DS5A 5KG0A 5I42A 2HMIA 1NHHA 2MY8A 4C8LA 3DMJA 4RUAA 3H7HB 4MT1A 2C2EA 1JJ4A 3TUPA 3RAXA 4OYWA 4ZK7M 1UWBB 3HZGA 4DU7A 3IRXA 2F65A 2LDIA 1T9WA 4XTJA 4LUBA 4NLPA 4AL7A 2ZVIA 2HFUA 1IWGA 2NUHA 3C2PA 1OY9A 4I6WA 3K17A 2J5AA 4DR2E 4EI2A 2XSJA 2XWXA 2V4QA 1AB8A 2E7VA 2M7SA 5CXTA 1QSSA 1S7IA 2HZCA 2RB7A 2JEFA 4IO1A 2EW9A 1PAUB 2Z57B 3LPEA 3QYYA 2BQUA 4G1QB 3PYGA 2GVDA 4YUDA 1ITPA 4HI2A 2AYBA 2EC2A 3NGSA 3C46A 2RT3A 3GFXA 2PA8D 4X4QA 2MZSA 4YP3A 1VRTA 2MYFA 5HANA 1LKZA 3UD5A 4DR4F 2BR2B 2POKA 1EKRA 2QLBB 2J0QD 1K0VA 1Y7PA 4EFAC 3N28A 1FX4A 3CJ0A 4OZNA 1OS5A 1R8HA 1WC0A 3LAKA 3Q8VA 1AT1B 1LWEA 2QTWA 2RD5C 3EXYA 3I0SB 3OTDA 2JE6A 4MK8A 2O67A 2LXUA 2HHVA 1KVKA 4IG3B 4WJBA 3T9NA 1F0XA 3U1MA 5F8HA 5BR8J 3HXMA 4JV1A 2IA0A 4ZCKA 4U7UD 4RBVA 3BKFA 3H2UB 3H1CA 2ASJA 5GAHI 2MXYA 2DH7A 4EZ9A 5F8LA 3BQ1A 1EX8A 1U2FA 2UXDI 3NNCA 3UR0A 2V34A 1FD2A 4UW2A 1OWXA 1NKEA 5A8RB 3NOGA 1PSDA 1UVNA 1IBKE 2JHEA 1R8PA 1U1MA 4DV3I 3R5GA 2O3ZA 2UUBF 2B4PA 2HHXA 1HPZB 1S59A 4OX7A 3GZ7A 1WOSA 1XNQI 3M1VA 3EDRB 4ZVIA 4F3OA 1XTZA 5DRKA 2UXCJ 2HZVA 4NA2A 3H40A 4YR0A 3MM7B 4JI2J 2WONA 1H2TZ 2CQPA 3ITHA 3MM6A 5KFZA 1TAQA 1D3WA 1Y9OA 2RSQA 3ZFVA 1J27A 5M2PA 4DS4A 3PX0A 2VA3A 1U1OA 1HK7A 3E01B 4CLKA 1NB7A 4ELUA 1HI8A 3QGGA 5KFBA 2LEBA 2HHHE 5HVHA 1G3OA 4FWGA 1X4DA 4AXJA 2HBYB 1JIHA 1HPZA 1F5AA 1GEHA 2LQJA 2RRNA 2I0XA 4I2PA 5E5NA 1S0MA 3U1YA 4DUYI 2HVHA 3QJJA 1VLOA 4AUKA 1SL2A 4DL0C 5A8RA 2R7QA 1S6PB 3CJSA 3C14A 3MGJA 1FFGB 4UZCA 2ZH1A 2BM1A 2C2DA 2C1EB 2BOAA 3PW2A 1B0TA 1TMJA 3SSQA 2VQFJ 1VQKS 4DBQA 4B3TJ 4KYZA 2M8HA 4LF8I 2B7BB 4IFDB 1K1SA 4UTGA 4DR7I 2M4MA 1O51A 4X65F 3RU0A 1C0UA 3D1OA 4ANDA 4FYDA 4DR6I 1S9GB 4JYAI 2GIQA 3M6VA 1M1GA 1NAQA 1FK9A 1QE1B 3DLKA 2F9DA 2M52A 5L9XA 4C11A 5LSRA 3VAIA 3Q8PB 2XMAA 3TARA 3MURP 3IS9B 4DL7A 1TL4A 4F4WA 3C15B 3MI7X 1HYSB 4X64F 4LFBE 1CPZA 1FFWB 5LOQA 4Q5VA 2BJ9A 1IJEB 4HR2A 3GV8B 1EETA 4DR5F 4P6QA 4ZLJA 3GLLA 2GS8A 3OTBA 4IFDF 4DR7E 4DG1B 4F2SA 4NXMI 4ETZA 1HQ2A 1X60A 2QMXA 1DY3A 2YKAA 4DR6E 3SCLE 4HACA 1U1PA 2RDDA 3OL7A 5DRRA 1R0AB 2OELA 2VV5A 4M1KA 3R97A 2V2ZA 2E5JA 3W2WA 3UCZP 3P3EA 3BH6B 3KLEA 2UUBJ 3OXFA 4OJHA 2NXNA 3D6FB 5KFNA 3SCJE 3WC2A 2AYGA 1HARA 1RT3B 3PHEA 3P6YC 1UW9A 1ZETA 4JV2A 4JI5F 3CJ3A 3OSNA 1IKWA 4YY3F 1GH8A 2J0XA 1DURA 4B17A 2CQ1A 1IBME 3H59A 3R7NB 1KONA 4LIRA 1FXLA 4FBUA 1FRJA 2WK4A 4LBHA 4DR3J 1YJWS 4DX6A 4GVBB 1ZPVA 4QOTA 3FUYA 3N6NA 4G65A 4ZVFA 3WQPA 3BO4A 1HBOA 4GC6A 4MK9A 3B8HA 4PYAA 3K5PA 1TKZB 3UE2A 4UOGA 4KFBB 3H0PA 5DQHA 2OFHX 1LWCA 3W3SA 2EFQA 3ISND 5C2GA 2FY1A 5J2MA 4Y2IA 1QAJA 3AODA 2HS3A 4L6V3 4B02A 1WF2A 3OJSA 1XNRF 2OPQB 3BQ2A 2DNMA 1M5HA 2BBEA 3CDWA 2ALZA 3PNIA 4YB6A 2IVYA 2FYXA 1K1QA 2VKRA 5D15A 3V6KA 4LRBA 2COLA 1S4EA 4TNOA 4XK8C 4EMDA 4ES1A 2W9CB 1NKCA 4JI1F 3OTOE 3QT6A 1G7CB 2UUTA 1FEHA 2CJ9A 2C3UA 3DI6A 2W9CA 3IWNC 4M5DA 3CULA 2NSBA 1ZTTA 3UDLA 2GVZA 4HEA9 4LF6J 3QGPA 4F3MA 1YJVA 4IH7A 1K0TA 2CGEA 2MSSA 4KHPF 4CI0B 5E3PA 3JQKA 2BJ3A 2CPYA 3W5YA 3PW5A 4O3NA 2GQ2A 2X1BA 4BWMA 1WOPA 2ZBIA 2V4JA 3KK2A 4EWTA 1D8YA 5FLXQ 1T05B 4OJ1A 2O5DA 4DDFA 1UL3A 2GNKA 2ROEA 3DDIA 4C3MA 3K5LA 4F50A 1U4BA 4MDTA 3V6JA 4OO1C 3HSDA 5GAEI 1B64A 4YHHE 1N5TA 4XIUA 3EJMA 3TO8A 1TL5A 3E8OA 2KL8A 4MAKA 3VAJA 5KT7A 2XNRA 3I5CA 2JH3A 3LGMA 3WU4A 1RP5A 1JLQB 1FXDA 4DV5F 5AE3A 2CPFA 3NBPA 5DZ6A 4ECZA 3P45B 4B3MF 3PV8A 2CNNB 2IAJB 1ZM3A 2MQLA 4J90A 2F4VI 1B70B 2XEXA 2P2CB 5J1PA 3AQPA 5DJBA 3SZ2A 1CQNA 1Z2LA 2N3LA 5CYMA 1R0AA 3NL0A 1C1CA 4LF6E 1UFKA 2I38A 4X4RA 1U6ZA 4LR7A 2CNKB 5ETSA 2HS4A 4DV6E 1HW8A 2H65B 2E5IA 2K1RA 4OYOA 2DNLA 5B0BA 2HAIA 7FD1A 4DUYF 2DEJA 5A2QQ 2V8DA 3VV2B 1NEEA 3Q0AA 2I5JA 1MNEA 3OFFA 4DV1J 2V68A 3MPWA 4ILRA 1K8AT 5C0XD 1UW4A 2K7JA 1DHMA 4PABA 1XMQJ 3EVMA 3PJ9A 3EWGA 3GG1A 4Q43A 1U2RA 2OPRA 3R8YA 5F8NA 4OJGA 2HIQA 5L46A 3THVA 1U1KA 2LU2A 4LF4I 4MKVA 3BO2A 2UXBE 3GCMA 1MMDA 4PWDA 3W66A 4GKKJ 4A8QA 4DSIA 2HHTA 5I3UA 5KFYA 3SBMA 1OSCA 4ANCA 1H38A 1HNZJ 4RW8A 3CO9A 2IMWP 1WDTA 4N76A 3QWPA 2RF2A 2VU5A 2WOMB 2HGLA 1SC4B 1RWNB 4KH1B 3PVXA 2C28A 4LPFA 3JTPA 1M5SA 5KFKA 4DV2F 1D9DA 3SQOP 4F04B 5B0DA 1N33I 5IWAI 1DLOA 1L3VA 2JWNA 3S1TA 1EP4A 5A2QU 1KC8T 2UUCI 2YH0A 2HHUA 1Q16B 5FDLA 2WRMA 1QAIA 1UVKA 5HMWA 4I2PB 3PJWA 3GIKA 3GSDA 1GMWD 5KFLA 5T14A 1EJ7L 3K5OA 1S1WA 1VJWA 3QIPB 2GHPA 1FE0A 1NHVA 3EMTA 4FW9A 2HFZA 1D8ZA 2ZFHA 5HBMB 2D41A 3K7RA 3NCQA 5C24A 4FYXB 2RQKA 4RNOA 1NK4A 1KVIA 2XM3A 4B3SE 3PS1A 3ITHB 3MM6B 2HNYA 2RUSA 4ZPVR 4ZVSB 5LMNI 1WG5A 1VQ7S 2ZE2A 3FMBA 3MM7A 4A4JA 3Q8RB 3HM9A 4TN2A 1XMQE 3OV7A 1Y4SA 2AJFE 1Z0VA 4B9TA 3ZZTA 4F02A 2H1YA 1IM4A 1IUJA 3ILOA 1IWAA 1KDNA 1RA6A 2A0FB 5HATA 1ZA1B 3G82B 3G86A 2MPUA 2IJFA 2RH3A 2AZ3A 3ZC4A 2A6OA 4JI5I 3R9LA 1NK0A 2CPEA 5T7LB 2PFFB 2P9EA 1RTZA 4RNHA 4P72A 2MHNA 2ZH9A 3CIZA 5ETLA 3V6DA 5DGAA 3ISNC 1SJRA 2IRUA 2HWTA 2HZAA 3FQLA 3UW1A 3T3FA 4Q8FA 5EN1A 1YX2A 2D9PA 4JI0I 4OYPA 2W9BA 3Q24A 1WHVA 3I55S 3FBBA 2YQ3A 5K8NA 5LMUE 1UA0A 1RAJA 2M5YA 3IBFB 3MMBA 2CAJA 2WBMA 3QPIA 1KOOA 4LRFA 1F2HA 1NDPA 2YQ0A 3BGUA 4ZVTB 1EQMA 4ID5B 4ZIWA 2JE6B 5ETNA 1Z0EA 3I9V9 1OYDA 5D4PA 3WX8A 3AOBA 1KTVA 4IYQA 4BA1B 1F2GA 3V81A 1R0CB 2NUUG 3GB0A 2VZ9A 3MR7A 5KG4A 4JI1I 5AE2A 3HVRA 3CPWR 1U1QA 4G1QA 1N36E 1KOHA 2E1MC 3G82A 1H73A 4RW6B 2WNRB 4O0NA 3GG0A 5DNLA 1EB0A 3GJRB 2J6UA 4FF2A 4LFBI 4LF8E 2HQ3A 4KHPI 1JLBA 3MEGB 4WCEQ 5DG9A 2X1AA 4RW9B 2KN4A 2OMOA 2HRYA 3LP1B 2JEJA 3UO0A 4CLSA 3O6QA 2IA6A 2NN6D 2AYEA 4KY3A 4NCAA 3FMWA 1AFJA 3LO3A 3AOCA 1I1GA 1SPBP 1NJWA 2I8EA 4ZVQB 2GJ2A 5HBMA 3HULA 3TR5A 3CD6S 1HNWI 1N52B 1UWBA 4JI2E 2BA0D 1IBKJ 2HRTA 3VWSA 3R7BB 1FO1A 3BBCA 3MAQA 4BA2B 4RW7A 4DR7F 2NXJA 4QIFA 2G0JA 1MG7A 1UEKA 1LW0A 4O4GA 1H7XA 4J9SA 2OTLS 3GILA 4X65I 3BQ0A 4DR6F 3NNHA 1WG1A 2VDHA 3K5NA 3MM8B 2LQ5A 2XS5A 2Z56B 1SH0A 2QL5B 4LREA 5SZTA 2RF2B 2WOMA 3IXQA 1N6QA 2FIUA 1PYOB 3EM1A 5K20B 5BR8E 3JTNA 4HY1A 3CNQP 3ILIA 5A8WB 2DR7A 3IBWA 1YSJA 3MMBB 3ZTQA 2E66A 5HQ8A 1HR0J 1U2CA 1UVLA 4IO9Q 2OP5A 3JSYA 4ZLPA 4PRFA 1JB0C 4CH0S 5DG8A 3PIPQ 2W9BB 1N48A 2O1UA 2QV6A 4FWDA 4X66I 1M5OC 3TJ9A 2WVEA 2H4YB 1LXJA 4EU0A 2CWXA 3GIJA 2IVMA 1JK9B 1MLAA 1IVZA 1IM6A 1CULB 5DZ7A 4TYAA 1B4SA 2UV8A 1WKKA 4JI6F 1PKUA 2XC9A 1T9XA 4DV3J 2FJVA 2EFGA 2ZBKB 2MLZA 2YKQA 3UQSA 3W2VA 2C38A 2ZWPA 5DM6Q 1NZAA 4Q2LA 4FF4A 4O3OA 4QPXA 4WZQA 3NGKA 5IV4A 3SMZA 1IBLI 1HWUA 4WXOA 4LF4F 1W2IA 1M5VC 1XNRE 1URRA 5LMUJ 3M85G 1NPRA 3MR6A 2DPJA 4P7VA 2VONA 5DRPA 3F44A 4DPXA 2BEFA 2L9WA 4O3SA 3M8QA 1LWFA 1B0VA 1BHNA 2CQIA 3GV7B 1GT8A 3OL8A 1FFSB 1HHSA 2DCUB 3KK1B 4GO7X 3JAMU 1IKXB 3VF0B 2MJUA 4ECSA 3A8JA 1B99A 2RDIA 3BBFA 1JLQA 1KLMA 3I32A 4ZPDA 2IM2A 3TVZA 3D0GE 4YDDB 1WELA 1XR7A 2CXEA 5D0HA 3LP2A 4KGXB 1VOMA 3NGUA 1KQGB 2JRSA 5H9FK 2UUBE 1JLGA 3BGOP 1ZM9A 4QZVB 1V9OA 3RB4A 4UOCA 5F8JA 1M90T 3MECB 1YIJS 4N41A 4X64E 3OL9A 4JI7F 3JSMB 2WSFC 3M6WA 3I82A 5DDQC 4LFAI 4CQ1A 4X4VA 3RBZA 2SXLA 4LF8J 2W2NP 2HHPA 3FBEA 2C3OA 2RIJA 1TVRB 3KJNB 3W60A 3BDPA 4LFCI 4TQRA 4CNZA 4CYUB 4PWDB 1UKUA 2AJ2A 3PRYA 5CABA 5RUBA 2K3IA 3RUBL 5DDRC 2VC0A 4OHYA 1FRMA 2L08A 4NA1A 1KN6A 2LA6A 4MIBA 3H4DA 3TVYA 4O3PA 2ZUAA 2ZDOA 1U24A 3AXMA 1X4CA 4JUZA 1BWVA 3OFHA 1KSPA 2UVVA 1HQUB 2MSTA 4DV2E 2AJ1A 2RUGA 3BPSP 4LFAE 3ZZOA 2BXJA 1WTFA 1VQNS 3GYXB 1Q82T 2K1RB 2DO4A 1NK5A 5GADU 3RR8A 2PEHA 3GONA 1BQMA 3G8SA 1N0VC 2GAHC 1Z1ZA 3KRNA 1N32I 1U09A 1C1CB 1ZM4A 1VBXA 4F4KA 1Z0WA 1IBLE 4KC5A 1RXOB 3F56A 4NMXA 3QZ7A 2WVDA 4NYOA 4OHVA 2VA2A 3FRYA 3QLHA 3PACA 1D6TA 2CUYA 2GV1A 1FT8A 2BX6A 3VGUA 2NXUA 4JI8E 1V5VA 4B3MI 5KT6A 4NZ6A 2V67A 4Q0BA 4C6AA 1QDUB 1X0PA 4CH1A 1UEVA 3LANA 4LT6A 2GZOA 4RR5A 5KT2A 4BCAA 1NHIA 2YWGA 5J2NB 5E3RA 1RWVB 1X8DA 3GR0A 3IRWP 4ECQA 2XULA 1SKSA 4P10A 2KT2A 1IKWB 2KT5A 3IGVA 2DGQA 3N79A 3GFYA 1P1LA 4RU9A 1RQ0A 4TY8A 1NM2A 3D1QA 5J2PB 3KHHA 3DOLA 2HYIB 3LH2S 3M7NG 3R2DJ 1IBCB 2IBKA 4DV0E 2HVEA 4USWA 4RWXA 2ASDA 2Z2MA 2YNGA 3A4TA 3W2WB 2V4JB 1U45A 2L9NA 1VBYA 3UN5A 2PI5A 3KNAA 2JEAA 3IR6B 2G9OA 5KFFA 2Z8QA 2PSZA 4HACB 4YY3E 5IFMA 2CQBA 3SEOA 1Y10A 2GIFA 3Q8YA 4EYIB 3QAUA 4IQXA 1AYEA 1HNWF 2QIFA 4A8YA 1TAUA 2JLEA 4UQGA 1T3NA 1SH3A 2ZNZA 4IFVA 2D69A 2E5GA 3B4TA 1RHJB 3S7RA 3UN2A 2XSFA 4DUZJ 4DF4A 3CJ2A 1FHTA 3N9UC 3X1LB 3CJ5A 5CQGA 1Y4UA 1RWKB 3U1NA 4L74A 2ZH6A 2J9EA 1HNXF 3PM9A 2V8VA 4WPAA 1ACMB 1WKLA 2CZVC 4AL6A 3GIRA 3GMGA 3PY8A 1ZA2B 5KFUA 3MDFA 3DGPA 1Y00A 3CMAS 3DRRA 1JLCB 2NQPA 1S57A 2XO7A 1XMQF 5B0CA 1CBKA 1RT5A 2WP8B 4CO0A 1TVRA 4MJKA 4K0KF 2G1HA 4LF7F 1O0PA 4WWSA 5DO2A 2B5JB 5T41A 4CLFA 2RU9A 1VS3A 4RUCA 5JUMA 1HW9A 4H4MA 2J6SA 2UXCE 1HIYA 5BYQA 2W2OP 3C14B 4FYYB 4J9NA 3ZZYA 1HQEA 4ZPWR 2BE2B 2MQQA 4CO5A 1A9NB 3DOMB 1SJ3P 4FP9A 3LTOA 5ETMA 2OD6A 3QZ8A 2XQCA 3LWMA 4DV6F 4GC7A 4BDPA 2AE8A 3H90A 3O1LA 1X5PA 4LBIA 2EFNA 2QL7B 1KKHA 4IG0B 3VAHA 3H5UA 4Q0BB 4CLTA 1FWKA 4PUOA 2FJDB 3MD1A 3E01A 1NLKL 1IXKA 1RJJA 2E7XA 2VPYB 1LFPA 2XTJP 3AFGA 3MMAA 4OX8A 4OZ0A 2DNNA 4Q44A 1DRZA 1Z5CA 2Z5EA 3ZM7A 2WONB 1F9HA 4A8SA 1S72S 4OZEA 4Z2XA 7AT1B 1PC4A 3MPYA 5GAGI 3T1YE 3GYGA 4FW4A 4YB5A 2E9RX 1PBUA 4WTYA 3G71S 4A46A 3K8WA 2B0GA 1WG4A 2FTRA 1CC8A 2ZKTA 1TL1A 3LNUA 5LT5A 4WIQA 2DTJA 3KJVB 3G6XA 3V5RA 2C38B 1R6YA 2G13A 3N01A 2LKZA 1S1XB 2RQ4A 2M70A 2OSRA 2P6TA 3DNCA 4WE1B 1CULA 4ZIVA 2R8JA 3M85D 4JI6E 4DPOA 1Q7LB 4U8YA 4NLUA 4C3KA 2N7CA 4KSEB 4QQBA 3I56S 4C3LA 1PO6A 4IRDA 2Y1LB 4ECWA 2J7WA 3HFZB 2XY6A 4FW5A 2B56A 2CPZA 2W24A 4PG6A 4E0DA 4DUZF 3FZBA 1QVFR 5KFDA 3HVAA 3J81Y 3PW0A 1KS2A 3RG6A 4M5LA 1KQFB 1KVJA 3MTJA 2YVSA 3M6XA 2QRRA 1LWEB 3I0SA 5GADI 2DHGA 3M8SA 3GV5B 4DV0I 3WIUA 3CCQS 3QJPA 2M9KA 3R7SB 4G3IA 2VB6A 1HKAA 1KFDA 1L3KA 2MLXA 2J9CA 3G8QA 3UFCX 3EUNA 1URNA 2VKZG 1Z0CA 2UUCJ 2LU1A 4F0HA 3C6TA 5K9FA 3HI9A 2IDLA 3CUNA 3BV8A 3M9NB 1XR5A 4FW7A 4NZ0A 1FEEA 2AF6A 2IRXA 4C9DA 1TL1B 4C8OA 2CJKA 1RYSA 1Y5YA 3HKMA 4NLDA 1NK7A 2BQRA 3CJTA 1D09B 2HBQB 4M5NA 3CCES 3ELHA 1JJ2R 5DQGA 3CJKB 2KG0A 2K3KA 1T9YA 3RZAA 3CJ4A 3FFIA 3ZTPA 3MUTP 1YRXA 4RW9A 4FWHA 1YK9A 3MEGA 4AIMA 5F8MA 2BV3A 1USUA 1ZAXA 4PUOB 1S0NA 1ZXMA 4L3NA 2Z5BA 4K4ZA 4UT4A 1SQFA 5KT4A 1H7WA 2WNRA 5AXMA 4YR2A 3IA0A 1ZAVA 1Q8IA 3DMJB 2KH9A 2RILA 2R7WA 4L72B 4ZPBA 2E44A 2QA2A 1EI1A 1FNXH 2MZTA 4PRVA 1HBUB 4CTAB 5C0XE 1PJ5A 4D3GA 1M1HA 2BJEA 2VH7A 1CJTA 5IC4B 3V4IB 4V19X 2PN6A 2QLXA 1VYAA 3A8IA 2J9DE 4P2XA 1TKTB 3TZWA 2BA1G 2PO0A 2R2UA 3PEJA 1HNZE 4BA1A 1HBNB 1KNZA 2RDJA 3M32B 1JNZB 2B5JA 2BANB 4EUVA 3DLGA 3DKDA 2JC0A 4ZJQA 3GSIA 1ZAWA 5BYSA 4ZP9A 9RUBA 4QU6A 4WF9Q 1FKPB 2VG5A 3PFEA 1Y0HA 1CSJA 2MZJA 4J37A 1CQMA 3JQJA 1NKBA 4LF5J 2GMLA 5JEAF 2QLJB 1QTMA 3DGPB 4IR1A 5L39A 2YH1A 1N34I 2C3MA 1RT7B 4RNFA 4QU7A 3RW7A 4ZP8A 3AT1B 4K7QA 1H74A 3T19A 2A10A 1V6HA 2B8QA 4A8KA 1B62A 4QW8A 2K2PA 2DHXA 1X5OA 4DV7F 1BGXT 4X4UA 1AFIA 4FN5A 3OHBA 2V6AA 1AZSB 2DKOB 2Z5CB 2W2QP 1N56A 3OBIA 4L76A 1OYRA 4TU8A 3R1HA 1IKVA 2AGQA 3D4JA 3BN7A 1HR0E 1F6TA 4KHPE 2ZJRQ 3ZNJ1 2E1CA 3JSRA 4PYDA 3VALA 3T6JA 3IRXB 4TQSA 3Q86A 4LFAF 3ZTRA 3T1HE 4B3TE 3EXCX 1M1KT 4W90B 1SCJB 4KJIA 2HAFA 4KT0C 3HFVA 1RYRA 1TFWA 1NDCA 2HBZB 4USJC 3GMEA 4DV1E 2HMIB 1VGYA 5FDLB 1H72C 1YI2S 4KTQA 3CDJA 2FVQA 4EO8A 4DV5J 1DTQA 1U8WA 5GMKa 4AYBD 2DHAA 1JXLA 4DR3E 2IJNA 4JV0A 3DM2B 1Q1KA 4WU3A 2G1DA 2ZM6F 2AQ4A 4DHVA 2UU9J 1WSRA 3P3GA 3RB0A 1SC3B 4MK7A 1UAWA 2GJIA 4WU2A 2AJ0A 3QT7A 3QRRA 2F40A 3HVWA 5I3UB 2HHHI 1FI4A 1OY8A 4NPOA 3VQTA 5J2QA 2IM1A 2EKYA 2LXFA 3UDCA 5FLXU 4X4SA 5CHCB 3SCKE 1QD1A 2YTCA 2KYZA 1LNQA 2UXDF 2H5JB 3HJFA 2O1WA 4NI2B 4PG7A 3MPVA 5G0RB 6FDRA 5FJ4A 3LAMA 3MAHA 4XDDA 3MMJA 2XI3A 3K2YA 3EE3A 3OR2B 4C8NA 4CM2A 2VQEJ 2JEIA 4HH0A 4QYRA 3W1YC 3OPKA 3JAMY 2FQQB 1VRUB 3AQOA 3NWGA 4TKTA 3L7OA 2CJAA 1RAFB 3C6UA 4FXVA 4TVAB 2EFPA 3W9IA 3CCTA 2W7OA 4EBEA 4QJVA 2CQDA 3G4SS 2HVIA 1R89A 4CNYA 5KG2A 1TKDA 3RBDA 4CYUA 4FXDA 2QEXS 2EK6A 2H48B 3K59A 1H2VZ 2XY5A 1IJFB 1WUUA 2IM3A 3BB5A 3ZNUA 5H9EK 2ASLA 1YRTA 1IR1A 2JFKA 4DR2F 1HNWE 1GTEA 4RX6A 4ZN1A 4ZJOA 1XJWB 1MN9A 2HVZA 2JJ4D 2V8HA 3C19A 3DRSA 3RYLA 5MAOA 2JNJA 4ZJLA 4U6PA 4X4OA 1M0SA 4WKYA 4N56A 3CJ8A 3KLGB 3CTRA 3NMAA 1OYSA 2ZWOA 4OHXA 3HX9A 5CYJA 2RMLA 3UCUP 3MPUB 4ZVUB 3BR8A 4QIEA 3KLIA 1LQ9A 1H6KX 2OD4A 3ONQA 5CZXA 3R2CJ 2WBRA 3TX0A 2YWWA 3LPSA 4IZJD 4DR4E 5ETRA 2ABYA 2DHHA 2V50A 1A0OB 2GGPA 2PIIA 5K14A 1NHUA 3MWBA 5EWEA 4DR1J 4CLLA 4UOFA 5K5MA 1WHXA 1SJFA 1XEZA 3FQKA 1K9MT 4JI8I 2VQEI 1SH2A 4KGMA 4LF2A 2YNFB 3M30A 2XLJA 3K5MA 4DUZE 5MLCV 1RT1B 2L9DA 1K73T 2UUAJ 5B0EA 2BW2A 3IN5A 5L1KA 3BBBA 2C2ZB 2KKHA 1SJQA 1RTIA 2GVZB 3QATA 2EG1A 1VRUA 4J9PA 4M5DB 5D0EA 2JLGA 4UQTA 3LP0B 1HYSA 3HJCA 2HK3A 2VBYA 4CO2A 4LCGA 3RGIA 1XMQI 4DX7A 4DLGA 2IJRA 2NLWA 4LF7I 2KJVA 2VQFF 4X62E 4KO0A 3RB6A 4NI2A 5G0RA 1FJ7A 4MIWA 2GO9A 4NASA 4NLSA 3U7JA 2WHOA 2UVUA 2KDOA 5JVHQ 1N32J 2PNLA 1EARA 2X51A 3FBCA 3KG0A 1X9WA 3J7Z5 4IDKA 1HNXJ 1LW2B 2F9JA 3DOKB 2E1AA 2FJAB 4ZS6A 2VPXB 3J81j 1KIJA 1WJ9A 2CPJA 1WEYA 2FLNA 3M9OB 2HGNA 3I31A 2AEJA 5H1SV 2XI2A 4B3SI 2DGWA 3MMCB 1N5SA 3D7SB 4NRTA 4R8UA 1RA7A 2HKJA 1I3OB 2PE8A 2NPFA 4NE9C 4Y2KA 1FRXA 1S99A 4RW7B 3PIOQ 2HHQA 2WB1D 3PRVA 1WHYA 2CG8A 3AY0A 4J3DA 1XWLA 4F4ZA 1V3RA 1H2UX 4R0EA 5E33A 3M8ZA 2RKIA 1MU2B 4EO6A 5C0XF 1JLAB 5D4LA 3SV3A 2OUGA 2YNHA 3FRZA 4OV6A 5I3PA 2A6MA 3PG9A 3RAQA 2OPSB 1HNZF 1R43A 2FC9A 3KLEB 2PO1A 1CJKB 1PAEX 2B9YA 1HMVA 3QQCD 4ZVPB 2V2QA 2KU7A 5AXKA 3PXGa 3C3LA 3L7ZA 1KEKA 1R6LA 1JLBB 4DSLA 3BREA 5C25A 4YY3J 1TELA 2OJ3A 4FF3A 2NXCA 1XNRI 1I94I 4FNIA 4C8KA 1N32E 4K59A 3VR1A 4RW6A 1AZSA 1PC5A 3EZOA 1RT6B 1TKXA 2XBPA 5KG5A 4YY3I 2UXCF 4PG8A 4QNJA 4Y00A 1VQLS 1VBZA 2UXBI 1DQ9A 4JI3F 1UETA 3C15A 4ZA1A 3T1HJ 1Z0BA 2CRLA 2I2YA 2UV8G 4DV0F 1WD6A 1HI1A 3LPYA 3U1KA 3HSJA 1XMOE 1QE1A 2HS0A 3DLKB 2ZH7A 3RAMA 2FD2A 2W1BA 3FBFA 3ILLA 2GO8A 4IKAA 2QYGA 1H7SA 1UDSA 4P9SA 2RS8A 3BGRA 5HJYA 3G6VA 3EPIA 1C0TA 2E5HA 4CO4A 4ECRA 2HHHF 2HNDA 1MWZA 2VDIA 2O66A 4Y34A 1IQTA 3P3CA 2QC3A 4NX9A 2BRLA 3BDEA 3FK4A 4I67A 2C39B 4I3HA 1FDAA 1RTHB 1HBNA 4ZPCA 1Z0GA 4JI4E 2HIYA 4M63A 3C16A 1RWWB 4Q8EA 1FJGF 3NKYA 3B82A 3IR7B 1YBUA 2P5VA 3MM5A 1SQEA 2B51A 5J1EB 3V4IA 4B3TF 4LQ3A 1ZYQA 2W8KA 2ZITA 3D67A 3O2IA 4ENOA 1Z5BA 1T02A 3E51A 2R7XA 5LL6R 5JEAB 1HWIA 4PR6A 4IUFA 3G9CA 5JXSA 4LF9J 3NCRA 5J2MB 3NMRA 5KFAA 2HQCA 3SFGA 3VVTA 4NLYA 4R0JA 3DHWC 2V4RA 4U96A 1R0BG 4OHZA 4F0MA 4EZ6A 1NK9A 2X1GA 4K0KE 1VK3A 1Y11A 3W8PA 4OO1D 4JBCA 4URQU 2M0GB 3W63A 2YKMB 3CJKA 5ITHA 3FEXB 3CXCR 2RS2A 2O1VA 1CJUA 4DR5J 2HNZB 4FVMA 4HL9A 5AJ3F 3M1VB 4OZ3A 4FVCA 3T41A 1S1WB 3LWLA 4DXLA 4EK2A 2LXIA 2EEYA 4E8UA 2QA4S 4KGZB 4DV2I 4FS2A 2M8DB 3MOJB 3US5A 4WZMA 2QN6B 2Q66A 3OFGA 4PG5A 1QSLA 4K50A 1GNKA 1S4FA 1DBDA 2A18A 2F7VA 2IC3A 2YBVA 4K2JA 1S1VB 5H9FJ 3A3PB 3POTA 3MR3A 2ZJPQ 1OPIA 1RU2A 2OLWA 1ZOTA 4LRCA 4RW8B 4AT1B 1N36J 2F1DA 4B3RE 3T1YF 4URGA 5EGYA 2O1PA 3IFEA 4IG3A 5L38A 3T1HF 1YJ9S 4NXNF 2GC8A 5K8MA 2OPRB 4DV1F 4Z37A 2CQ2A 4ED0A 4DR7J 2LDYA 5A6PA 5AXLA 5IWAF 2KFNA 4RBUA 2NZCA 2VG6A 2OEJA 4DL4A 4OX9J 1S9EA 3A12A 2DRAA 2HQIA 4N77A 4AL5A 3CCWA 1Y6ZA 2C37B 4P7AA 2BA9A 1BC6A 1XHKA 1S6UA 2DHSA 4ZPAA 4TU7A 1AXQA 4E2FB 2KZZA 2KM8B 3Q2SC 1HHQA 1RT4A 4ZPTR 3J80Y 1FJGJ 3RW6A 1GFWB 1S5ZA 3WU3A 4URSA 4B3ME 2GHVC 2NXEA 4CT8A 4K4UA 2BE7D 4MFBA 2LJPA 1FE4A 1DTTA 2OEKA 1N5YA 2MKJA 2YPYA 4PAAA 2GFFA 4YB7A 2Q43A 2K7KA 2KRRA 2IHR1 1OO0B 1T9UA 2IAJA 3MMAB 1UVIA 2W7AA 2W2PP 1ZPWX 4EBDA 4LF6F 1NMEB 2DNKA 4RO0A 4JI6J 1YGYA 2EFOA 2XNQA 3DXSX 2CZ9A 4LSLB 3MTKA 4DMZA 1VQ6S 3TA2A 3DRXA 2MKIA 4GKJJ 2E29A 2BKOA 4FBTA 4BBYA 3D9BA 4AQYE 2BE2A 1KWMA 4F67A 1HQEB 2DGSA 2J7KA 4LSNA 5SUHA 1PVGA 1U26A 4I69A 4OMFG 1BY9A 4P2SA 4OO1E 4DR5E 2ZC4A 2FVCA 4LBPA 3R5AA 3PX6A 2YWHA 3KMQA 3TP2A 2AZ1A 2WP8A 3RR7A 4OZ2A 2UU9F 1XN9A 2LYVA 4OO1A 3DYAA 4NLOA 1T0TV 3DRPB 1N34J 3IAM9 4DQPA 5HN0A 4Y3CA 4TY9A 5A0YA 2FGOA 1FRHA 2QSWA 1S10A 2R8KA 3GJSB 2HBRB 4N5SA 2J65A 5HJXA 1YDLA 2Y8WA 1YITS 3K85A 3DI6B 1ZXNA 3M4XA 1EQ0A 5FLXY 2MLYA 4CIOA 4YOEA 5DRQA 5KFSA 4AE5A 3JQMA 1SIWB 2YPZA 4NYPA 3W61A 1SL1A 4JI3I 2ZOFA 1PIEA 3Q8UA 5HK4A 5GAHU 2DRBA 2ROGA 2DR8A 2VQEF 4RWWA 5IV3A 2OIHA 3H5SA 2B3TB 3KLFB 4DR6J 1LWXA 1LWCB 2MKSA 4HI1A 2OTJS 3Q89A 1TKZA 3UVJB 4C0OC 5IS2A 2W8LA 2PNMA 1LFWA 2QE5A 2ZD1B 3GFZA 2MJNA 1S77D 4GKKE 2AYMA 5C2CA 3CCUS 1JMTA 2W7PA 4Q7AA 2V5HG 4GVBA 4ZLLA 1FDBA 1T3OA 4ZHRB 1RADB 5J2PA 3KUGA 5KAKA 1GAOA 4USTA 4X62F 4DSFA 2KT3A 1H3DA 4M95A 2WW4A 3BGLA 4J9KA 2IY5B 1H7UA 5IZHA 3VGTA 4QPTA 1NZ8A 1X7VA 1YRUA 2PNZB 3OLAA 3MCNA 2E7WA 1HNVA 5FD1A 4P52A 2DCLA 4U3BA 4PXEA 3U27A 4CLWA 1MWYA 1TV6A 4IOCQ 5KFVA 1BQXA 2U1AA 1B0PA 2XGPA 3DN9A 1XMOF 3R5BA 4XDCA 3DU5A 1QUVA 2BUNA 4YQWA 2FLPA 4WP8A 5IXUA 1JJHA 3BR9A 3QT5A 2GQQA 5IM0B 1PJ6A 2ZZTA 5D77A 1Z59A 3LA0A 4JP8A 3I4HX 3OUYB 4FZVA 1O5JA 2O01C 4NLXA 3RB3A 4AXIA 4DG1A 3QRQA 1UCNA 4OIXA 3BEGB 4ZP7A 5EX0A 3MUMP 3B4DA 3GR1A 2VC1A 4KV8A 1T8EA 2DY1A 4I1TA 2E5LJ 2PI4A 2XYPB 4OHWA 1MWQA 4JI4F 2XCPA 4M8LA 1S9EB 1WEXA 1Q7YT 4KQVA 2NN6B 4OZJA 3ETOA 3M8YA 1U1NA 4B3SF 4B9UA 3UCGA 4ELTA 2ZM6E 2KXFA 4J7CA 4J9QA 3OTOI 4DFJA 3BGFA 1S9GA 3H25A 2R8HA 2MKCA 1C0UB 1YZ7A 2C2MB 2ZZNA 1NSQA 5KG7A 4AM3A 2NN6E 2V8PA 5F3TA 3ZZUA 1N5QA 2EBEA 5A8KA 4ED2A 4Y65A 4QR2A 4ZP6A 1SB6A 5GAEU 1IR2A 4J9RA 3T1YI 5BR8I 1IN0A 3D66A 4G1IA 3AXKA 2R7VA 3WU5A 1R7IA 4WP9A 3NLCA 4DJBA 5EWFA 1T7PA 3FKBA 4ER8A 3T9ZA 4V19J 4EBCA 4TXSA 2AKWB 2AX1A 2BKNA 2RQMA 2CVIA 4UY8T 3MFIA 3MECA 1HNZI 4JI3E 1NHJA 5C0XA 4DFPA 3KLHB 1YH8A 2XZDB 4F4AA 3LP2B 1OJ4A 4A8MP 1WORA 2J9DA 2WB4A 3W65A 3H98A 4ECXA 2ZOGA 4EGLA 4ERDA 2YKNB 4JI7I 1I94F 5LMUF 1USVA 1OY6A 1NXIA 1XC9A 1SV5B 3FCWA 2G2YA 5CAAA 2OO4A 4Y2CA 1CJUB 3VVUA 2FJEB 2Y1IA 5HLFA 2AU0A 1LWFB 3HD1A 4PPDA 4WKRA 2YKMA 2UXCI 1CVJA 3QNWB 1S1TB 2UXBF 2B4OA 4P74A 5D8HB 5HROB 3L3CA 2VIHA 1SUQA 1BQNA 3AOAA 8AT1B 3VAFA 3UN3A 1J5EI 4XO0A 2UUAI 3E2EA 4DR4I 5J1NA 3MCSA 3MEDA 3TAMA 2KFZA 2GIRA 2VESA 2V63A 4HVZA 4C8MA 3M8PB 5BXIA 2NYIA 1XMOJ 3KHLA 1VQ4S 4K2XA 3W2VB 4B9LA 2XYGB 3NGRA 3JSBA 2C2NA 4HYKA 3HHNB 3NAHA 1MSWD 4N7TA 2GA7A 5J1EA 3AB4B 1ZZNA 1N8RT 5DM7Q 1RU1A 2NYHA 5DGBA 2ADCA 4JI5J 1U6BA 2DH9A 3PCOB 4RKUC 2H51B 5U47A 1QLNA 1RTHA 4H4KC 4QNKA 4A8FA 3AA9A 2F4FA 3L9ZA 1GX6A 5ELWA 2HNDB 4AQYJ 2ZKUA 3CJQA 1RE1B 1UFLA 4J5OA 4R25A 2Q2EB 4DSJA 2R7TA 3BGRB 1S7HA 3P5TL 4RNMA 2PGCA 2GCFA 3N5FA 1Q8BA 1RWOB 2YQ1A 2ZOMA 2YX4A 4NLRA 2ZDPA 1OMSA 5KFTA 3TZZA 4WFBQ 1HNIA 1E6YA 4WFAQ 1XNQF 2HQFA 1EIYB 2R42A 2D3ZA 1PCAA 2EKNA 3HHEA 1F60B 1RUSA 1Z4UA 5E2QA 3DLEA 3CD0A 4B9NA 3LGNA 4P71A 3KKFA 4DQQA 2O1TA 4DV7J 4OX9E 1PJ7A 1UDOA 3MEEB 2B8PA 3VCDA 4DN0A 4JI1J 2P9CA 1N33E 1Z0TA 2FHJA 4KBIA 4NLVA 2AIRB 1GXTA 2LQ8A 4C0HA 1WACA 4K4VA 3NXZA 1CEZA 1TL3B 3WZ0A 4PKDB 4WTOB 2D9OA 2QT7A 5KOWA 2H5IB 3L7ZB 2WVCA 2JDJA 2Z0GA 3TI0A 4LFBJ 3LP1A 5HO4A 4KHPJ 2UU9E 2DNGA 3KK3B 3SCIE 4F4XA 1Q95G 4YHHJ 1H0HB 1RLCL 2BJ8A 4NBQA 1MU2A 1X5SA 4KGVB 4AD6A 3M05A 4CH7A 4C98A 4Z7CA 2G0IA 3TA0A 3OXLA 2VF3A 1FA0A 1NK6A 1TR0A 3QO9B 1TP7A 1RT2B 1Q0NA 1Q5VA 3D3CJ 3OQ2A 4YR3A 3T1HI 1YJ7A 4FPIA 2VG7A 4JYAF 2OPPB 1T9TA 4DQRA 4BS2A 4LIWA 3RRGA 5CYQA 1S1UB 3H5XA 4ID5A 3BYPA 2KI2A 3R6GB 4LRAA 4HT5A 2H3EB 4QYZJ 4K0KI 4LRDA 1R8AA 4I64A 4P2MA 1YLXA 2DK2A 3HMJG 1RTJA 2R2SA 1UFWA 1REVA 5KFEA 5KFWA 1GTHA 4K8RA 3MFHA 2MQPA 4JI4I 1U49A 3H5YA 4AQYF 3DLJA 2ZEJA 3CMQA 5KFHA 2HVDA 3ENWA 3QSIA 4C2MA 4DCPB 3F41A 4DX5A 3PW4A 4MKBA 2HEKA 5T7LA 2Y0SD 3H4BA 2F1FA 2DGXA 1VHIA 2WW8A 4I7FA 4LR8A 3R1LA 3CWJA 2AD9A 4KKOA 4KPYA 1FVSA 3FEZA 1P42A 4JV5E 3PEHA 1X4HA 2EI5A 2AP6A 4P2FA 1LOUA 3HSGA 3TZXA 3P3DA 4PQAA 3UD3P 3TAMB 1JXEA 1T95A 2LQ9A 2MMYA 2CQGA 2R8IA 3ENQA 1J5OB 4WFNQ 2B4VA 5HMZA 3BKUA 5BR8F 5D0GA 5K36A 3I87A 2FHMA 1WF0A 3D6MB 2GGPB 4RZRA 4DR5I 1XXEA 4H54A 1XQIA 1U25A 2A3JA 2LVWA 8RUCA 2KXNB 5H9EJ 1VC0A 2VASA 4HKQA 3BO3A 3QIPA 3NAIA 5CA5A 1YKWA 3VGSA
chains in the Genus database with same CATH topology
1IBME 2UU9I 1H72C 1EA6A 1XHKA 1ZM2A 3B8HA 4DR3I 3QT7A 2HHHI 1FI4A 4DPTA 2O1WA 4N3OA 3OTOE 1S4EA 1FNMA 4EMDA 4OX9I 3QT6A 4X66E 2CGEA 1DARA 4RPFA 1WUUA 4NXNE 1PKPA 1HNWE 4LF5E 5FLXQ 1Y6ZA 4YHHE 4DV4I 2AJ4A 4DPWA 1BKNA 3WU4A 2DEIA 3LPSA 4IZJD 4LFCE 4DR4E 1ZM3A 3V2UC 2F4VI 4JI8I 2XEXA 4DPUA 4DUZE 4LF6E 4NXME 3B78A 2Z5CA 4DV6E 3HJCA 1XMOI 1XMQI 2HK3A 5A2QQ 2DEJA 1I94E 4LF7I 4X62E 4JI7E 5FWKA 1U2RA 2PNLA 2UXBE 4LF4I 4HYMA 1KIJA 3QT8A 2IOPA 4B3SI 2HKJA 1N33I 5IWAI 2NPFA 2UUCI 4DV3E 2R3VA 4DV7I 2Z5BB 4FW9A 2ZM6I 1B63A 4WUCA 4B3SE 5IT9Q 3Q6MA 5LMNI 2V2QA 1XMQE 1Y4SA 1Z0VA 1XNRI 4X65E 3ZZTA 1I94I 1N32E 5FLXC 1VISA 4JI5I 3K1JA 1RREA 4MYUA 1N36I 2UXBI 4JG4A 1Z0BA 3J81C 1XMOE 4JI0I 1H7SA 4GKKI 5LMUE 4B3TI 4DR1E 4DR2I 1Z0EA 2UUAE 4Z7YA 3PYDA 4I3HA 1Z0GA 1KTVA 4JI4E 2F4VE 3B82A 4JI1I 4GKJE 2HK2A 4JYAE 2ZITA 5LL6R 4JI5E 1Z5BA 1HNXE 1N36E 4JI2I 1H73A 2V2VA 4LFBI 1FJGI 4LF8E 4KHPI 2E1RA 4K0KE 4LF7E 2O1VA 3PYFA 1N34E 5LMNE 2UUBI 3HULA 4PRXA 4PU9A 1HNWI 4JI2E 4DXLA 1XNQE 4JI1E 4GKJI 1UEKA 1MG7A 4X65I 4YHHI 2VQFI 1IBKI 4JV5I 3P06A 4DR3E 5BR8E 1NZ0A 4R1FA 4AQYI 4B3RE 4HY1A 3F0NA 5GMDA 2O1UA 4FWDA 4X66I 2UUCE 1ELOA 5A2QC 4LF5I 4P7AA 2ZBKB 2EFGA 3ZKBA 2X7IA 4IZJB 3CWVA 3WU3A 1IBLI 4B3ME 2LJPA 3ZZ0A 1XNRE 4JI6I 4DPXA 3H4LA 4DV2I 4JV5E 2CZ9A 4DPYA 2UUBE 1ZM9A 4AQYE 4B3RI 4X64E 1A6FA 2J7KA 2E5LE 2VQFE 4LF9E 2A2DA 2IOQA 4LFAI 4DR5E 3J80C 1S16A 4LFCI 5L3JA 3Q1QA 2GQ0A 3J80Q 3PRYA 3JAMC 2VQEI 2E5LI 3K85A 2X36A 4DV2E 1ZXNA 4DV5E 4LFAE 4MYTA 4JI3I 1PIEA 3GONA 4DU8A 4USMA 1N0VC 1MX0A 1N32I 1ZM4A 1Z0WA 1IBLE 1D6TA 2PNMA 4GKKE 4B3MI 4JI8E 1RR9A 4IZKA 2WW4A 1NHIA 2UXDE 4DV7E 4ED4A 1IBMI 2HKEA 4P52A 4IZKB 3WU6A 4DV0E 2BM0A 4X62I 3PYEA 4KHPE 3QT5A 4HACB 1Z59A 4NXNI 4DV1I 1K47A 4YY3E 4URLA 1J5EE 5IT9C 4KQVA 1Y4UA 2OI2A 1EI1A 1PVGA 2HFSA 2ZM6E 1FWLA 3OTOI 3ZKDA 2V8PA 3ZZUA 3T1YI 5BR8I 1QZRA 4JI0E 3WU5A 1HNXI 2UXCE 1HNZI 4JI3E 1NHJA 4X64I 3LTOA 1OJ4A 1NHHA 4DUYE 1KKHA 4JI7I 4DU7A 1USVA 1FWKA 4DR1I 4XTJA 2UXCI 3ZM7A 2Z5EA 1Z5CA 2HFUA 4DR2E 3J7AM 3K17A 2UUAI 1FJGE 1J5EI 3T1YE 4DR4I 3LNUA 4IZJA 3J81Q 3V5RA 3PYGA 1MU5A 4YY3I 4DUZI 5IWAE 4HXZA 4WUBA 1N0UA 4JI6E 3J7AG 1KVKA 2Q2EB 4LF4E 4DV0I 2UXDI 2R42A 2V34A 1Z0CA 1IBKE 2O1TA 4DV3I 4OX9E 1N33E 1XNQI 1Z0TA 4ZVIA 4FWHA 1HK7A 2UU9E 1USUA 2BV3A 2CG9A 1ZXMA 2HHHE 3Q6NA 4FWGA 2Z5BA 4UT4A 4Z7CA 2A2CA 2VF3A 4DUYI 4PRVA 3JAMQ 1FKAE 3T1HI 4DV5I 2BM1A 1HNZE 1HR0I 2VQEE 4LF8I 4UTGA 4DR7I 4K0KI 4DR6I 4USKA 1N34I 4JYAI 5GMEA 3M6AA 1Z5AA 4JI4I 1H74A 4LFBE 1B62A 4DV6I 4LF9I 4FN5A 2GS8A 4DR7E 5LMUI 2Z5CB 4LF6I 4NXMI 4DR6E 4HACA 3D4JA 1HR0E 4M1KA 4DV4E 2V2ZA 4WUDA 4DR5I 3T1HE 4B3TE 1H7UA 4DV1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM E;  2UU9 I;  1H72 C;  1EA6 A;  1XHK A;  1ZM2 A;  3B8H A;  4DR3 I;  3QT7 A;  2HHH I;  1FI4 A;  4DPT A;  3OTO E;  1S4E A;  1FNM A;  4EMD A;  4OX9 I;  3QT6 A;  4X66 E;  1DAR A;  4RPF A;  1WUU A;  4NXN E;  1PKP A;  1HNW E;  4LF5 E;  5FLX Q;  4YHH E;  4DV4 I;  2AJ4 A;  4DPW A;  1BKN A;  3WU4 A;  2DEI A;  3LPS A;  4LFC E;  4DR4 E;  1ZM3 A;  3V2U C;  2F4V I;  4JI8 I;  2XEX A;  4DPU A;  4DUZ E;  4LF6 E;  4NXM E;  3B78 A;  4DV6 E;  1XMO I;  1XMQ I;  2HK3 A;  5A2Q Q;  2DEJ A;  1I94 E;  4LF7 I;  4X62 E;  4JI7 E;  1U2R A;  2UXB E;  4LF4 I;  4HYM A;  1KIJ A;  3QT8 A;  4B3S I;  2HKJ A;  1N33 I;  5IWA I;  2NPF A;  2UUC I;  4DV3 E;  2R3V A;  4DV7 I;  4FW9 A;  2ZM6 I;  1B63 A;  4WUC A;  4B3S E;  5IT9 Q;  5LMN I;  2V2Q A;  1XMQ E;  1Z0V A;  1XNR I;  4X65 E;  3ZZT A;  1I94 I;  1N32 E;  5FLX C;  1VIS A;  4JI5 I;  3K1J A;  1RRE A;  4MYU A;  1N36 I;  2UXB I;  4JG4 A;  1Z0B A;  3J81 C;  1XMO E;  4JI0 I;  1H7S A;  4GKK I;  5LMU E;  4B3T I;  4DR1 E;  4DR2 I;  1Z0E A;  2UUA E;  4Z7Y A;  3PYD A;  4I3H A;  1Z0G A;  1KTV A;  4JI4 E;  2F4V E;  3B82 A;  4JI1 I;  4GKJ E;  2HK2 A;  4JYA E;  2ZIT A;  5LL6 R;  4JI5 E;  1Z5B A;  1HNX E;  1N36 E;  4JI2 I;  1H73 A;  2V2V A;  4LFB I;  1FJG I;  4LF8 E;  4KHP I;  2E1R A;  4K0K E;  4LF7 E;  3PYF A;  1N34 E;  5LMN E;  2UUB I;  3HUL A;  4PRX A;  4PU9 A;  1HNW I;  4JI2 E;  4DXL A;  1XNQ E;  4JI1 E;  4GKJ I;  1UEK A;  1MG7 A;  4X65 I;  4YHH I;  2VQF I;  1IBK I;  4JV5 I;  4DR3 E;  5BR8 E;  1NZ0 A;  4R1F A;  4AQY I;  4B3R E;  4HY1 A;  3F0N A;  5GMD A;  4FWD A;  4X66 I;  2UUC E;  1ELO A;  5A2Q C;  4LF5 I;  4P7A A;  2ZBK B;  2EFG A;  3ZKB A;  2X7I A;  3CWV A;  3WU3 A;  1IBL I;  4B3M E;  2LJP A;  3ZZ0 A;  1XNR E;  4JI6 I;  4DPX A;  3H4L A;  4DV2 I;  4JV5 E;  2CZ9 A;  4DPY A;  2UUB E;  1ZM9 A;  4AQY E;  4B3R I;  4X64 E;  1A6F A;  2J7K A;  2E5L E;  2VQF E;  4LF9 E;  2A2D A;  4LFA I;  4DR5 E;  3J80 C;  1S16 A;  4LFC I;  5L3J A;  3Q1Q A;  3J80 Q;  3JAM C;  2VQE I;  2E5L I;  2X36 A;  4DV2 E;  1ZXN A;  4DV5 E;  4LFA E;  4MYT A;  4JI3 I;  1PIE A;  3GON A;  4DU8 A;  4USM A;  1N0V C;  1MX0 A;  1N32 I;  1ZM4 A;  1Z0W A;  1IBL E;  1D6T A;  4GKK E;  4B3M I;  4JI8 E;  1RR9 A;  2WW4 A;  1NHI A;  2UXD E;  4DV7 E;  4ED4 A;  1IBM I;  2HKE A;  4P52 A;  3WU6 A;  4DV0 E;  2BM0 A;  4X62 I;  3PYE A;  4KHP E;  3QT5 A;  4HAC B;  1Z59 A;  4NXN I;  4DV1 I;  1K47 A;  4YY3 E;  4URL A;  1J5E E;  5IT9 C;  4KQV A;  2OI2 A;  1EI1 A;  1PVG A;  2HFS A;  2ZM6 E;  1FWL A;  3OTO I;  3ZKD A;  2V8P A;  3ZZU A;  3T1Y I;  5BR8 I;  1QZR A;  4JI0 E;  3WU5 A;  1HNX I;  2UXC E;  1HNZ I;  4JI3 E;  1NHJ A;  4X64 I;  3LTO A;  1OJ4 A;  1NHH A;  4DUY E;  1KKH A;  4JI7 I;  4DU7 A;  1FWK A;  4DR1 I;  4XTJ A;  2UXC I;  3ZM7 A;  1Z5C A;  2HFU A;  4DR2 E;  3J7A M;  3K17 A;  2UUA I;  1FJG E;  1J5E I;  3T1Y E;  4DR4 I;  3LNU A;  3J81 Q;  3V5R A;  3PYG A;  1MU5 A;  4YY3 I;  4DUZ I;  5IWA E;  4HXZ A;  4WUB A;  1N0U A;  4JI6 E;  3J7A G;  1KVK A;  2Q2E B;  4LF4 E;  4DV0 I;  2UXD I;  2R42 A;  2V34 A;  1Z0C A;  1IBK E;  4DV3 I;  4OX9 E;  1N33 E;  1XNQ I;  1Z0T A;  4ZVI A;  4FWH A;  2UU9 E;  2BV3 A;  1ZXM A;  2HHH E;  4FWG A;  4UT4 A;  4Z7C A;  2A2C A;  2VF3 A;  4DUY I;  4PRV A;  3JAM Q;  1FKA E;  3T1H I;  4DV5 I;  2BM1 A;  1HNZ E;  1HR0 I;  2VQE E;  4LF8 I;  4UTG A;  4DR7 I;  4K0K I;  4DR6 I;  4USK A;  1N34 I;  4JYA I;  5GME A;  3M6A A;  1Z5A A;  4JI4 I;  1H74 A;  4LFB E;  1B62 A;  4DV6 I;  4LF9 I;  4FN5 A;  2GS8 A;  4DR7 E;  5LMU I;  4LF6 I;  4NXM I;  4DR6 E;  4HAC A;  3D4J A;  1HR0 E;  4M1K A;  4DV4 E;  2V2Z A;  4WUD A;  4DR5 I;  3T1H E;  4B3T E;  1H7U A;  4DV1 E; 
#chains in the Genus database with same CATH topology
 1N36 F;  3DLL Q;  2UU9 I;  3KLH A;  4O44 A;  2W9A A;  1B7F A;  1EP4 B;  2VFT A;  2CJX B;  4FPR A;  3KLG A;  3PO4 A;  1S49 A;  1U0S A;  2VOO A;  4LVO P;  1OQ6 A;  1IQZ A;  5D78 A;  1Q8K A;  1TL7 A;  3HCX A;  4K4W A;  4OQJ A;  4GKK F;  4QIV A;  2CJY B;  2HFV A;  3MAA A;  4OLP A;  4NOH A;  1RKJ A;  5GVQ A;  2R4F A;  2F3J A;  3EGN A;  1U1L A;  3J7A 1;  5FLX C;  1E6V B;  4CLU A;  3PZP A;  4JYA J;  1VC5 A;  4CCH A;  4KIA A;  3MPD A;  1JWW A;  1LK5 A;  1JLE A;  4ED5 A;  1N5V A;  1AA1 B;  4ID8 A;  1GMU A;  1R6M A;  3CDE A;  4LFC J;  1APS A;  4I4B A;  4QWC A;  3ADA C;  2KM8 C;  2ZHA A;  3JXO A;  2QO3 A;  1FNM A;  1S12 A;  4A8X A;  4OX9 I;  4YDX A;  2HWH A;  5DNX A;  2KYX A;  1BLU A;  5L8R C;  3HHL C;  1RBA A;  5G4D A;  2HG4 A;  2FDN A;  2ACY A;  3GTY X;  3TRG A;  2ALY B;  5AXN A;  4NXM J;  4OI2 A;  4NEY A;  4NLQ A;  3HFK A;  2XB2 D;  4ED3 A;  5L1I A;  1FNO A;  3I0R A;  1BUX A;  4RPF A;  5CCM A;  1C4C A;  3P5B P;  2J7U A;  3QFW A;  1NJX A;  4DL5 A;  5CYM B;  2CPX A;  3MAA B;  1PKP A;  1UDN A;  1ROF A;  1SJ1 A;  1TU0 B;  1MRO B;  3N6L A;  3NS7 B;  4PXB A;  4DSE A;  4PG4 A;  4LF5 E;  2FZK B;  1NJY A;  4NRU A;  1YJU A;  1TK5 A;  2G0C A;  3O44 A;  4FYW B;  1HI0 P;  2Z58 B;  3FEY B;  3NBP B;  4ZKA A;  1HFE L;  2B9W A;  4XAK A;  2CPD A;  2ZBC A;  1RTD B;  1UVM A;  1A7G E;  1ZZF A;  4X64 J;  2B7C B;  2Q6B A;  1RAI B;  1BKN A;  5K36 E;  2QX0 A;  4CLP A;  3R6L B;  1TFY A;  2DEI A;  2K06 A;  4JI8 J;  1QJH A;  5JEA C;  1R8B A;  2IYI A;  2DNZ A;  3KFW X;  3AD9 C;  3CSK A;  4HDG A;  4CLZ A;  4QW9 A;  1KR4 A;  2LFV A;  3LUY A;  2Q6C A;  3MUV P;  2JSX A;  5HQM A;  2QZ8 A;  1B3T A;  4Q2M A;  3V2U C;  4ZVH A;  4E98 A;  2D7S A;  4ZMM A;  3J80 U;  1JX4 A;  4DPU A;  1WEZ A;  4KAI A;  2MQM A;  3VHQ A;  5LMN J;  1X9S A;  3R5D A;  5HQL A;  4O0I A;  3CCS S;  4NXM E;  3A13 A;  1TUW A;  2E1P A;  1RCO B;  3MHY A;  4FKY A;  3KOA A;  3M7V A;  4IR9 A;  1AW0 A;  3PO5 A;  4QIW D;  5HAO A;  2CIM A;  2J0W A;  3O8W A;  3T6B A;  1NSK L;  4RNN A;  2IIH A;  4ALZ A;  5LJ3 Y;  1WF1 A;  1KHW A;  1WNE A;  1VIO A;  1VK8 A;  1YBT A;  3IM9 A;  4RUH A;  3OVS A;  3M2R A;  2DIT A;  2ZH3 A;  2QLW A;  3V6H A;  4WBF A;  4ED7 A;  1LK7 A;  4DI6 A;  3GE9 A;  1IBK F;  1DJ0 A;  2ILZ A;  5FWK A;  2L48 A;  1RT7 A;  1OSD A;  2PT0 A;  3W9H A;  4ILM A;  1YVF A;  2AMC B;  2FHO B;  2HQD A;  3FNN A;  3PRD A;  2K8G A;  2OPQ A;  3N6M A;  4F7V A;  5A2Q Y;  1SL0 A;  1IBM J;  4H4O A;  2XZT B;  4KR0 B;  1ZH5 A;  3HK2 A;  3JYT B;  1WI6 A;  4YME A;  4DL3 A;  1SC6 A;  2MB0 B;  2IOP A;  2DY9 A;  2VIC A;  3SQG A;  3KJQ B;  5KFQ A;  4J9L A;  4ICL B;  3M32 A;  4V1A k;  4LSZ B;  1R8C A;  3SIP B;  2VFS A;  1R6V A;  1FDD A;  4U8V A;  2IVF B;  2XLK A;  4M5M A;  4OYZ A;  3QMQ A;  1IKY B;  3PHT A;  1VR6 A;  2V9K A;  2VG7 B;  4USU A;  3PKM A;  2QYC A;  3V4M A;  1MN7 A;  2DR9 A;  2CAD A;  1KTQ A;  3EGW B;  3HPO A;  4DV3 E;  5IC6 B;  3BSN A;  3I5B A;  2LEC A;  2R3V A;  3VAM A;  5LM7 E;  3NZK A;  2QL9 B;  1H98 A;  4Y28 C;  4LSL A;  1J5E F;  3MCM A;  3MOZ A;  3HD2 A;  3TJA A;  1RT3 A;  2HGM A;  2Z5B B;  3GJT B;  1TK8 A;  3BJY A;  4LJM A;  3IG1 B;  2ZM6 I;  4CLY A;  4ZN3 A;  2F4V J;  5IT9 Q;  1XNR J;  2VUG A;  1RAB B;  3FFI B;  1RAA B;  1RBO B;  2VBX A;  1I94 J;  2BJ7 A;  4DWI A;  1W26 A;  3JS9 A;  1TL3 A;  5E3C A;  2FGC A;  3VAK A;  4RW4 A;  2BJ1 A;  4W4M A;  3PX4 A;  2CQ3 A;  5LXR A;  2WTF A;  5JEA E;  5DRO A;  2UXB J;  4JI0 F;  4RBT A;  2VOD A;  1VIS A;  2XMT A;  1NH8 A;  3KG4 A;  1EET B;  3K1J A;  1T03 B;  1RRE A;  3OR1 B;  4MYU A;  2PFD A;  1N36 I;  4K5R A;  3Q23 A;  4EYH B;  2BR0 A;  3FCH A;  1C2P A;  3GQC A;  4JG4 A;  2KHC A;  2Z30 B;  1FJE B;  4YB1 P;  1HNI B;  4RLE A;  1X31 C;  2NS1 B;  2R9L A;  2DVI A;  1EKS A;  2RHQ B;  1M5K C;  4IFD E;  3M8W A;  4QR1 A;  1NU4 A;  1ARO P;  1UMJ A;  2ILY A;  4GKK I;  3UR3 C;  2RHS B;  2YXL A;  5HVF A;  2CZ4 A;  2DJW A;  4GMK A;  3AD8 C;  3MR2 A;  3CC2 S;  3OW2 R;  2OKQ A;  2W4C A;  1EAY C;  4QWA A;  3M9M B;  4DR2 I;  3WBZ A;  2QFJ A;  4UUX A;  4IFD A;  3SDE B;  4NL5 A;  1NCL A;  1S1V A;  1YQH A;  5F9L A;  2EG2 A;  5KFO A;  2IC3 B;  4IH5 A;  5EUH A;  3CJR A;  2F4V E;  1N33 J;  4DR1 I;  4WII A;  2UUW A;  2EWH A;  3AAW B;  3KJF B;  4WE1 A;  1U7L A;  5DLG A;  1S1X A;  2PC6 A;  4DV0 J;  1HHT P;  5HMX A;  1RAC B;  2ZH4 A;  1FRK A;  1C4A A;  2DNH A;  3FCV A;  4S0M A;  3VGV A;  2B43 A;  4J9U E;  3KJV A;  1IBM F;  1PIL A;  1HNX E;  4JI2 I;  4JI7 J;  4PXD A;  2VPZ B;  4QWD A;  3MED B;  3M8R A;  2R7U A;  1CLF A;  2HNZ A;  1P1T A;  1IBL J;  2E1R A;  1SUQ B;  1V3Z A;  3RJM B;  1VMB A;  1S9F A;  3PYF A;  1L3U A;  1J5E J;  2AGP A;  2Y1R I;  5LMN E;  4M5I A;  5IT0 A;  1SBR A;  4OI6 A;  3OT9 A;  2EVZ A;  1EZZ B;  4LFB F;  2KZM A;  1RHY A;  4DOZ A;  4DV2 J;  4FW6 A;  2X3D A;  4FYV B;  2Y9H A;  1JJC B;  2VPW B;  4DV7 E;  2JEB B;  2XCA A;  3CC7 S;  3J7A N;  4BC9 A;  2QA1 A;  4JI1 E;  3FSX A;  1RK8 A;  2G2Z A;  2JT2 A;  2VQF I;  3TQE A;  4DSK A;  1X4F A;  4ES3 A;  2XZW A;  2HLT A;  4JI0 J;  3G87 A;  4H4M B;  4X66 F;  4ITS A;  4LMZ A;  4L3K A;  4ICL A;  4LFA J;  2J8A A;  3L7U A;  4YFU A;  3FC9 A;  4AQY I;  3M2U A;  1UJ6 A;  2HUR A;  4C97 A;  1RSC A;  2R7R A;  4HXZ A;  2X1F A;  3EDQ B;  3JYT A;  4UUW A;  1C0T B;  3F0N A;  4J9M A;  3NGT A;  1NK8 A;  1W2B R;  4QYZ K;  3CCZ A;  2IM0 A;  3DRR B;  4RJV A;  3TUI C;  1Y60 A;  1RB0 A;  3UD4 P;  2RE1 A;  2KHD A;  2XMW A;  1E3P A;  1NSA A;  1RAH B;  1P27 B;  2DXF A;  4HTI A;  4LF5 I;  2MHE A;  1WDD A;  1D9F A;  5K36 D;  2HHS A;  3AH6 A;  2XHC A;  1RHR B;  2XMM A;  3OR1 A;  3MM9 A;  4MMO A;  3KHG A;  5HP1 A;  3O5T B;  1AUD A;  4IFV B;  4ZCL A;  1KLN A;  4KV8 B;  2VJU A;  4O23 A;  2X7I A;  5L1J A;  2NN6 C;  2MGZ B;  4IZJ B;  2XS7 A;  4IH6 A;  4A8W A;  3CWV A;  3OUY A;  3CC4 S;  2CVE A;  1VQY A;  1QTN B;  2OFG X;  4FXW A;  1O8B A;  4RW4 B;  3SSR A;  4KHR A;  2XSJ B;  3GFH A;  4KE5 A;  4KQZ A;  4LQ9 A;  3ZZ0 A;  4DF8 A;  2X3G A;  2RRA A;  4O3R A;  4JI6 I;  1CJK A;  1VRQ C;  2PO1 B;  4OI4 A;  2W4P A;  3AA8 A;  1Q78 A;  3H4L A;  2CFX A;  3PS3 A;  2XMK A;  4ZVO B;  3WC0 A;  5EHH A;  3TYT A;  1RHK B;  1XMB A;  4TY8 B;  5C42 A;  5D6G A;  1FXR A;  5IT9 U;  1KQK A;  2DT9 A;  3DU6 A;  3K8V A;  5L1L A;  4DV4 J;  2EK1 A;  2FZC B;  2UVR A;  2CJB A;  3D28 A;  4XTT A;  5I42 B;  1RTD A;  5EL9 A;  3BM7 A;  4KPC A;  4B3R I;  1Q81 T;  2NRE A;  1UTA A;  5FII A;  2CDQ A;  3Q8S B;  1A6F A;  2E5L E;  1IKY A;  2JVR A;  2VQF E;  2A2D A;  2D74 B;  4FS1 A;  3OVB A;  1SIZ A;  1FD8 A;  1MRO A;  2DGO A;  1UJ5 A;  2PEB A;  3QID A;  3QLH B;  4H4K A;  1U8S A;  4OYX A;  5AT1 B;  2EPI A;  3SQG B;  4U67 Q;  5L3J A;  3A3N B;  3K57 A;  1UDQ A;  3Q1Q A;  1WTB A;  4ATN A;  2GW8 A;  3U1L A;  2CJQ A;  1LW2 A;  3DDN A;  1YJR A;  1GMW A;  1YZ6 A;  5E41 A;  2BZ2 A;  2YNI B;  3CCR S;  5E3A A;  1JKH A;  3TEH B;  3HT0 A;  3TZY A;  4ED6 A;  1FCA A;  2WSE C;  1GXL A;  1WKJ A;  4JI3 J;  3L09 A;  4K4Y A;  2EBG A;  4JI4 J;  4OFZ A;  3I5A A;  2DGU A;  2F8M A;  2EFV A;  4EEY A;  2JVO A;  2WZ1 A;  1V5I B;  3LGH A;  3TJ8 A;  4DV6 J;  1QAY A;  4LFC F;  2HQG A;  1Z2Z A;  2HWI A;  3EGV A;  1HQU A;  4MYT A;  5KFR A;  5HMY A;  3MF5 A;  5M2U A;  2LQB A;  1MML A;  2ATC B;  3EZU A;  3IBC B;  4GVL A;  3NG8 A;  5DET A;  1F9E B;  3NS5 A;  5IQ6 A;  2FLL A;  1NHK L;  2YX7 A;  2HFN A;  4K4X A;  2IRY A;  3DYA B;  2JOQ A;  1Y5I B;  3EYZ A;  1VQM S;  2AEM A;  1FTR A;  4IFY B;  4LVN P;  4RL1 A;  5LJ5 Y;  3GP9 A;  1UWA A;  2AT1 B;  1RWX B;  3IP0 A;  4ZCI A;  2J6T A;  5LSL A;  1FRI A;  1QM9 A;  4I2Q A;  5K8O A;  3TOQ A;  2V9W A;  3QAE A;  3TVK A;  2F63 A;  1F3F A;  1X4G A;  2NZ4 A;  1Q79 A;  3IAS 9;  5LL6 d;  5D3G B;  2MQN A;  2EC0 A;  1N32 F;  2W01 A;  1NPK A;  5THW A;  4ZCM A;  4DFK A;  2ROP A;  1UZD A;  4ED4 A;  1G4C A;  1Y4Z B;  1K44 A;  2AV5 A;  3A3O B;  3E3X A;  1IBM I;  2YKP A;  2GMH A;  3OHA A;  4ECT A;  5HSP A;  5D3G A;  2PDA A;  4IZK B;  5DS7 A;  1BXN A;  3OD2 A;  3UDE A;  1HR0 F;  4F2R A;  5EKW A;  3WU6 A;  2BM0 A;  4IS9 A;  5BJR A;  1SKU B;  2WVB A;  4I2Q B;  4DV4 F;  1UPM B;  4C0B A;  2QA4 G;  3SFU A;  1YHQ S;  1YHC A;  2WSC C;  3M6U A;  2DR6 A;  5CCL A;  2XGQ A;  1YJN S;  2ACM A;  1DTT B;  1N5Y B;  2Z2L A;  1NBE B;  3M2V A;  4MFB B;  4PPZ A;  3AB2 B;  5KG6 A;  2F8E X;  2FHK A;  5EDW A;  1SKR A;  1MU5 A;  4NXN I;  3HHL B;  2FPH X;  4X62 J;  2NPI A;  4TLQ A;  4DV1 I;  3BSA A;  3R27 A;  5EX3 A;  3MXH P;  4KKO B;  4URL A;  1XIQ A;  3CW2 C;  2DIV A;  3MZI A;  3ZXW A;  2DH8 A;  2BDP A;  3I9Z A;  5IQQ A;  2DYA A;  4FF1 A;  4TU9 A;  3FZ2 A;  5B0G A;  1NB2 A;  3CF5 Q;  4TLR A;  3PFO A;  1N54 B;  5LSO A;  2HHH J;  1QAX A;  2I6W A;  2VG6 B;  2CQH A;  3IO1 A;  4I68 A;  5ADZ A;  2ZH2 A;  3CD5 A;  5IT4 A;  4DLE A;  4N8O A;  3V81 B;  2HFS A;  1C1B B;  4B3O A;  4OKG A;  1WC3 A;  1W25 A;  4GRS A;  9ATC B;  2YNI A;  3ZKD A;  2XYH B;  3NWR A;  3HJV A;  3DRY A;  4DCJ B;  3PRB A;  5CD4 A;  1HA1 A;  4LF8 F;  2YWE A;  3UNY A;  1QZR A;  1XR6 A;  1L5U A;  4JI0 E;  4HH1 A;  4CZC A;  3EGZ A;  4FNH A;  1HNX I;  1N34 F;  1XBW A;  3MM8 A;  1Q53 A;  3ICL A;  2PO2 B;  3WHI A;  3X3U A;  4DZD A;  3L95 X;  3O3L A;  3LQV A;  3OTC A;  3OFE A;  4OYI A;  1LW0 B;  4JB8 B;  4O4G B;  3QO9 A;  2N4D A;  4UF4 A;  3TX8 A;  3T5H A;  4B3S J;  2HW3 A;  4X64 I;  3TAP A;  1WWH A;  2VL1 A;  3H2L A;  4C7Q A;  4DUY E;  5KFI A;  3PTW A;  1WHW A;  5C42 B;  3OXG A;  1FKO B;  1GXU A;  3KK3 A;  1R27 B;  4I6Y A;  3DXB A;  2NR0 A;  4DR3 F;  1VLY A;  4USV A;  1JQG A;  7FDR A;  3QRP A;  2UUA E;  3DFE A;  5KG3 A;  3J7A M;  2OSQ A;  3D6H B;  4ZVG A;  4Q45 A;  4ANE A;  2IMO A;  1SXL A;  3D68 A;  3HLU A;  5DDO C;  3RTV A;  1G1X A;  3HO1 A;  2VOP A;  1FJG E;  3PS2 A;  2HPU A;  3BN4 A;  4IQM A;  2RRB A;  2MTL A;  2J76 E;  5JEA D;  3B54 A;  2BKP A;  4F36 A;  1PBA A;  3MEE A;  1P9Y A;  4MKY A;  4IZJ A;  3J81 Q;  1Q5Y A;  2HLU A;  3MEK A;  4HDH A;  1Q86 T;  4I0W A;  4OV1 A;  1OIA A;  5KTQ A;  3MM9 B;  4ECV A;  5HP1 B;  2A1B A;  3NS6 A;  4M5K A;  2FLO A;  2GAG C;  3N4W A;  2MQ8 A;  4X84 A;  3CDI A;  1NUE A;  3M