3PYHA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pyhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pyhA02
2PW8H 3L33A 3SJ9A 1AD8H 5AVDA 1F92A 4CHAC 2AGEX 2KAIB 4MTBA 2ANWA 2D26C 1HXEH 1KYNA 1WSSH 3F1SB 1FZZA 3VXFH 2RG3A 1C4Y2 1XKBC 2AFQB 2C8XB 3GDSA 1IQHA 4I33A 1LKAA 1NM6A 3EA8A 2Q6GA 4XE4A 1C9PA 1AGJA 1NO9H 3RU4T 1D3QB 2ZPQA 4D9QA 3QZQA 4FUHA 2BX3A 2ZTYA 4BXSA 1TIOA 2ESTE 3T62A 1GJ5H 1P03A 5EOKA 1KDQB 1SLXB 1AQ7A 3QZRA 2OTVA 4IN1A 3LDXH 2A45B 4OS7A 1BTUA 4B76A 1NU7B 1CO7E 2BOHB 4JZ1A 1C4V2 2F9UA 1O3MA 1BMNH 2XBWA 1QRXA 3A85A 3HK6B 5JB8S 2GZ9A 5E2OA 2AEIH 4DY7B 3LIWA 9LPRA 2O8UA 3MOCA 1FONA 2F83A 4THNH 4LZ1H 2TRMA 1N6XA 3DUXH 4XFQA 3BG4B 5C67A 2WPLS 5AFYH 4LXBH 1O3OA 2HALA 4O3UA 2ZFQH 1GI2A 2A4OA 1A4WH 1K1LA 1MTNB 4JCNA 1UTPA 2Z9IA 2VB0A 2FOBA 5C1YA 1NFUA 3MU1A 3URCA 1SGNE 3MTYA 2TPIZ 1ZHRA 1SGFG 1SGCA 3I77A 3LH1A 2BD3A 4XBBA 1C1VH 4K1TA 4CBNA 1GHVH 1Z8JB 4ISHH 1ZGIA 3PTNA 1P06A 1CT0E 3C27B 1ZRBA 4GSOA 3PV4A 2NU2E 1NRQH 1VJ9U 1F0TA 2A31A 4LZ4B 1EAIA 1EB1H 1C1WH 3M36A 4ZHMU 2WPMS 1P3EA 1RS0A 3F68H 3F9HA 1ZZZA 4CH8B 1M9UA 3LOXA 1LHFH 1SR5C 2VVVA 2OC1A 1C2DA 8GCHG 1EQ9A 2C3SA 1SQAA 4KTSA 1HPGA 3RXPA 1WBGB 3MYWA 3UIRA 1EZXC 1RTLA 4H6TA 1C1MA 4KTUA 1HJAB 4A92A 1IQKA 1BMMH 3DFLA 1QFKH 3VB6A 4FU9A 1HAIH 4FUJA 1YPEH 2ZP0H 1LQEA 1YCPH 2F9VA 1OWIA 3ZZ3A 3TGKE 1ZRKA 3SU5A 3TJOA 1Q31A 4FUIA 4D7FA 1A5IA 2BM2A 2FIRH 4ABEA 1LVOA 3QN7A 1SC8U 1W13U 3R0FA 3SUDA 1C5TA 1K1MA 4MPWA 5C1XA 3Q3YA 2G5VA 4KKDA 2Y81A 3I78A 2BLVA 4BNRA 1WAYB 1LVYA 1K1PA 5FBIA 3VEQB 5HXFA 3T29A 2XC5A 1G9IE 1WQSA 1S6FA 1G30B 1EJMA 4NSVA 2UUFB 2Z9GA 1T8MA 4H42U 2VIPA 1OWHA 1VCPA 4YESB 4KGAA 3TPIZ 4CHAB 4MG3A 4WJG2 3BSQA 1A46H 1AFEH 1RD3B 4NSYA 2BY8X 1C4U2 2FX6A 3A7VA 3SU1A 3SGBE 3EA9A 1HNEE 1E35B 1QCPA 2R2MB 1NZQH 1ZHPA 3SJKA 1S83A 2ZEBA 2JH0D 3VB5A 1G36A 3T28A 1A1RA 3E0NB 2GCHG 1CGHA 1C2EA 1O2PA 1C2FA 2ZI2H 1T8LA 4JZEH 3SNAA 4Z6AH 1KY9A 3M3SA 2FOCA 1DITH 4F49A 4BTTB 1JRTA 1K9OE 1SLWB 3UQVA 1CSOE 1S0QA 3RXDA 1A3BH 1ELDE 1W14U 4NIWA 1UMAH 1QR3E 5K0HA 5HGGA 1W7GH 1EB2A 5EPNA 5FPYA 3U1JB 2R9PA 3E90B 1Z71A 2PTNA 1ZTKA 3KGPA 6ESTA 1F0RA 1EP5A 3SI3H 2BLWA 1O3NA 1PPGE 2ZFRH 1XVOA 1XMNB 1QQUA 2EEKA 4X1QU 1ESAA 1GJDB 1O35A 2V3HH 2ZGCA 5GIBA 2BD8A 5EXNA 1ACBE 4AFQA 3PMJA 4OS1A 3ATMA 1IQEA 1Y5UT 2PGQB 3MNBA 2SGPE 1UTNA 5ETXA 2B5TB 2Z9JA 4VGCB 1P3CA 3M3TA 3P17H 3LJJA 4NGAH 1CGIE 1O5FH 2G52A 1DPOA 1S6HA 1AKSB 1Z1JA 2BB4A 1DX5M 1QRZA 1ORFA 4ISLA 4MPUA 1DSUA 4JZIA 1OP0A 2ZPSA 2XC0A 2GDDA 1QL7A 1J15A 3LGVA 4K8YA 4J2YB 5T6GA 3ZV9A 2AGIX 1ZJDA 1EZQA 4FUBA 1F5RA 1MQ6A 1Y3UA 1Y3WA 4NFEA 3RXBA 1SL3A 3GOVB 5GCHG 1W7XH 3LH3A 4ZXYH 3SU6A 2QN5T 3SUFA 1HGTH 1GBLA 4E7NA 1O2OA 1J16A 2GZ7A 2H5DA 3BTTE 4Y7AA 3A89A 3SNCA 2I6SA 1O5AB 4B75A 3RXUA 2FOMB 4NA8A 2XCNA 3IWMA 3TU7H 3SU4A 2ZDKA 3UQOA 4CRAA 2GKVE 1U6QA 1NESE 1LDTT 4Y6DA 2FOEA 3UWIA 1ARCA 5FHTA 1DXWA 1DANH 3ESTA 1TNIA 4ABAA 1E34B 4U2WA 1A2CH 3PYHA 1C5YB 4IN2A 5H4IB 3VGCC 1YM0A 1O3JA 2NWNA 3D23A 1HUTH 1YYY1 1OWKA 4B2BA 5A09A 2NU4E 1BBRH 1LVMA 4AGKA 1LHGH 1LPKB 2ZHWH 2AERH 3LGUA 1DUAA 2O8LA 2OC7A 1WTGH 1VITG 2A5AA 1WTHD 1G32B 3RXOA 1BT7A 4R0IA 1CBWC 1UVSH 3OTJE 4DG4A 1TQ7B 4I32A 1O2SA 1OX1A 2QC2A 3BTFE 4K3JA 2ZFFH 4K8BA 1O3GA 3EAJA 3JZ2B 4DIIH 1EPTC 4AORA 1K1NA 1SPJA 2HPQH 3RXHA 4NZQA 1MTNC 4YOIA 4Y0YE 1V2VT 5GWZA 1RXPA 5A0AE 1GPZA 5DKMA 1A7SA 3MNCA 1HAYB 3P95A 1P9UA 3M35A 2B7DH 1A0JA 3TNTA 1P57B 4NIXA 1MKWH 4B2AA 4ISOA 4WXVA 2Y5HA 2OQUA 2BY6X 2FO9A 2BVRH 3PTBA 5AHGH 2J9NA 3GICB 2Q6FA 2Z3DA 1F0SA 3A82A 4MPVA 1IAUA 3OSYA 3RUOA 2AMDA 3ZVAA 4OS5A 3QLPH 3MFJA 1O5EH 3NWUA 3A8BA 3Q00A 1XVMA 1CA8B 4X2WA 2ZC9H 2WUCA 1O2GH 4BOHA 2VH6A 5EW2H 1SHYA 2VH0A 4HGCA 2ZPRA 1VZQH 3TGIE 3PLBA 5JB9S 1TLDA 1LPGB 3M5NA 1J9CH 1HYLA 4ABHA 2P16A 3B23B 3UTUH 1SQTA 1TMBH 1JMOH 2FI4E 3G01A 3UFAA 1JOUB 2PKAA 1GI7B 1GCTC 3Q3KA 3RXFA 1NRPH 2CXVA 4ABFA 5ABWA 1Y3XA 4NA9H 3DD2H 3MU5A 3FVFB 2F9PA 4K1EA 4X1NU 1NFYA 1TGTA 1P9SA 3K6ZA 2QXHA 3GDUA 4TY7A 1D4PB 3BTDE 1BTHH 3PMHB 1MBQA 2FZZA 1ZMNA 2FPZA 1UK3A 5LGOA 2QF3A 4CRCA 5K7RA 1T4UH 3FAOA 1H4WA 3F9GA 2STAE 2BDBA 1D9IA 1FPHH 4WH8A 1FV9A 1MBMA 1K28D 3F6UH 4YM9A 5AFZH 3SV2H 1LHCH 1XX9A 3VB4A 2KAIA 1VCQA 3KEEA 2PHBA 4WXIA 4OS2A 1AWFH 2FLBH 3M7QA 1V2KT 3SV7A 3AVZA 1LTOA 5TJXA 1B7XB 1EZUC 3UOUA 1QA7A 1KSNA 4X6PA 1NROH 2V3OH 1BB0B 1RJXB 3SNDA 2FLRH 3U8RH 1E36B 2RA0A 4JZDH 1YKTA 2FMJA 2UWLA 1FY3A 3OY6U 1F2SE 1O38A 2QXIA 2ZFSA 4X6NA 1AU8A 4X6MA 2ODYB 3EYDA 3AW0A 3BTEE 2NU3E 3I29A 4ABJA 1CT4E 3V13A 1HAVB 1C1QA 5C3NA 2VGCB 1AHTH 2BLOA 2ZQ1A 2BD2A 4WMFA 3JZ1B 3PMAB 8KME2 5EU8A 1AVXA 1HLTH 1YPGH 1TMTH 4IBLH 1C5VA 4AFZA 1CT2E 3SNEA 5L6NH 2Z7FE 1SGPE 1H1BA 4INLA 3HKJB 4ABGA 1G3EA 1C1SA 1HAVA 3MO9A 3D65E 1IHSH 1D6RA 5AF9H 4GHTA 1A3EH 1KXFA 1UTOA 2HVXA 2XBXA 2GD4B 1TBQH 2UWOA 3SZNA 2G51A 2ZDAH 3S9BA 1AVWA 2A7CA 1O3CA 2Z9KA 3RXQA 3KCGH 3RP2A 1GBKA 3CENA 4JK6A 4U30A 2QXJA 1ELTA 1C1OA 1GJ7B 2F91A 1LKBA 1JWTA 1TYNA 2W26A 1O3HA 1C5OH 2J92A 3ZZ7A 4E06H 1P2KA 4ZKSU 2HOBA 1O2XA 1E37B 1PQ8A 5C2ZA 1V6DA 5C5NA 1AO5A 1EPTB 1MD7A 5JBCS 1GHAG 3GCOA 1ELEE 1GJAB 2ALPA 4B73A 1VITF 1GBAA 3P92A 3GY4A 1HAXB 1XUFA 1THPB 1GL0E 1NS3A 3ZZDA 2A7JA 5T3HA 1W12U 1HJ9A 2ANKH 1N8OC 1GG6B 1XXFA 1FDPA 1DSTA 3KQDA 1JIMA 3SOSA 2FI5E 3P8FA 4X6OA 2W3KA 1HIAA 2WYJA 1Z8RA 2VGCC 1E0FD 4ABDA 1O2VA 1P11E 4D7GA 3BTHE 1UTQA 1DWEH 2H9EH 2W7UA 4YLQH 3Q76A 2FODA 1FAKH 1W2KH 1HXFH 1NTPA 2Q1JA 4Q2KA 5EQRA 1O0DH 1P02A 3GCHB 3KIDU 4ZKRU 4FVDA 4A6LA 3QX5H 1EOLA 4YT7H 2ANYA 1GI0A 2XWAA 2FYQA 1XM1A 3TJNA 6GCHF 3ELAH 1TGSZ 1VITH 5G4BA 1EX3A 3GY8A 1A0LA 4Q7YA 1EAWA 2OC8A 1QJ1B 5DP7A 1YF4A 3LPRA 4AB8A 4Z0KA 3LC5A 1GGDC 5LPEA 3M5MA 3VB7A 1EAXA 4ZKNU 1TGNA 1EJNA 2GMTB 1C1TA 1TABE 3L6PA 1S84A 3RXEA 2XTTB 4NIYA 3T2NA 2AMPA 4YZUA 3S9AA 1L4ZA 3BIUH 3T25A 1CGJE 3A7YA 1UTMA 1MCVA 1O2LA 1C1UH 4B2CA 3O8RA 1KXAA 1S85A 1O5CB 3SHAH 2P95A 3O8DA 3ENSB 4GCHF 1G2LA 1KTSB 4UONA 5A8XA 1XUIA 1MAXA 1C5LH 1V2OT 4UFGH 3IG6B 4ESTE 1O31A 1CA0B 5FPSA 4YO9A 1SGFA 3GCNA 2CHAB 3K65B 4BANB 3EGKH 1TGBA 3KQEA 3W95A 1HB0B 5DP6A 3S7KB 1C1RA 4CBOA 4WVPE 4AFSA 2FX4A 1ABJH 2OINA 1OWJA 4X2VA 1YC0A 2ZU4A 1GL1A 1BHXF 3ITIA 3MWIU 4A1TA 5BPEA 1AB9C 1P8VC 1ZPZA 3L3TA 4Y8YA 1W10U 3AAVA 3TNSA 2Y5FA 1TAWA 1BTXA 1NRSH 4K5ZA 2B9LA 5F6MA 1C2LA 4GAWA 2VWLA 1O2ZA 1NY22 3RM0H 2I6QA 7ESTE 1FI8A 1CQQA 3S9CA 3MH6A 1BBRK 1P04A 3VB3A 3A8DA 1Z8GA 2R3YA 4Y10E 1OWDA 3QUMP 1PQAA 5FPTA 4Y8ZA 5EGMA 1GBEA 2BQ6B 1MTVA 5HM9A 4TWWA 2O8TA 2EI7A 1FNIA 1MCTA 3RXVA 2CGAA 4MPXA 2V6NA 3BG8A 3RXAA 1C1NA 1ZTJA 1NC6A 2ILNA 1RGQA 4RSPA 1EATA 2P8OC 4ZH8A 2PUXB 1TONA 2J94A 3BIVH 1FJSA 4O03A 3PLPA 1GHYH 4Y79A 1ETSH 1O2NA 1A5GH 4Y71A 1GI9B 1QL8A 1GBHA 2BHGA 2W7SA 2H6MA 1X7AC 5JBTA 1GWAA 5IYTA 1P10A 1B0FA 1GJ4H 2CHAC 1MQ5A 1KLJH 3RMNH 3GY7A 1O39A 5A8ZA 1TBRH 5JDUB 2BY7X 3SJ8A 4UD9H 1LO6A 1WV7H 4MNYA 2ZU2A 3RXLA 1GCDA 1HAPH 1YPLH 1ZSLA 2A5IA 2WYGA 3GYMA 3LGIA 2ZGHA 4DT7B 4Y11E 1EJAA 1NT1A 3MU0A 1Z7KA 1GI5A 1KDQA 4UFFH 3RXSA 3RXMA 7LPRA 1C5WB 1GI1A 2JKHA 1IQMA 4Y76A 3ZVCA 1XUGA 1BMAA 1GJCB 1TOMH 2F9NA 1CE5A 1VCWA 3KF2A 3SBKA 2G55A 2J34A 3VPKA 3ODDA 4XSKU 1MKXH 1UVPA 2H9TH 3KQBA 2QV1A 1XUJA 5GCHF 3D49H 1NFWA 4IC5A 4JK5A 3SQHE 3OY5U 4CH2B 2OBOA 4ZKOU 1MU6B 1O3PB 1GJBB 2PWXA 1AI8H 1TMUH 1H9HE 1LPZB 1ELVA 5GJ4B 1ELFA 2FI3E 1GI4A 3U98H 3H7TA 5E8EH 1ZYOA 4HFPB 1DM4B 1GMCG 4WMDA 5DJ7A 1IQJA 1O3DA 1OP8A 3B9FH 2FTMA 4MDSA 1Y5BT 3O8CA 5DP3A 1TFXA 2VIQA 3RM2H 3RC6A 3VXEH 2PUQH 5F8TA 2ODQA 5ESTE 2ZZUH 2QYIA 2Y7ZA 2R0LA 1V2LT 2ZDLA 2C8WB 2ZA5A 1ETRH 3MHWU 2CN0H 5F8XA 2SGDE 4GPGA 5A2MH 1TNHA 1TALA 1ZOMA 2JH5D 1MKWK 3LT3A 3VFEA 5SGAE 4X1PU 2ZGXH 1RTKA 3MU8A 3QGNB 2P8OB 2QIQA 3A86A 2ZGBH 4SGBE 1DY8A 2D2DA 1T8OA 1QNJA 1SOZA 1O30A 1ZLRA 1THSH 3RC5A 4WF8A 1JIRA 1UVOA 1VGCB 1AZZA 3QWCH 1JRSA 4AZ2B 4YT6H 2SGQE 1KLTA 5DGJA 2FYRA 1QY6A 1GMDF 3BEUA 1H8IH 1IQLA 2BLQA 4DW2U 5FXLA 1SB1H 1MKXK 4ZMAH 2DE8A 3F9FA 3P6ZB 1OKXA 3HATH 1ZPBA 2VIOA 3A7XA 4KP0A 1QTFA 2P94A 4B71A 1NPMA 5C5OA 3MO6A 5DK1A 1ZR0A 1N8OB 1P2QA 2TGTA 3ZZ6A 3SJOA 1CVWH 1TB6H 2A2XH 3V7TA 1BJUA 2P3TB 4KTCA 1C2IA 3FP8E 1GI8B 3SJIA 1DICA 1GJ6A 1YPJH 1BHXB 1O2JA 2ZIQH 4AN7A 2CJIA 1ELAA 2BOKA 1SSXA 3E1XB 3RC4A 3LC3A 1C1PA 2PKAB 3Q77A 1C2KA 1TX6A 3STIA 1S0RA 1UHBA 1GVKB 1GMCF 2QY0B 3AAUA 5ESBA 2SNVA 1SOTA 2EI8A 2ZDMA 2BD7A 3SW2B 1HAGE 4CR5A 4B74A 3MMGA 1V2MT 1D3PB 2UUKB 1P2NA 1A0HB 5DO4H 2ZTXA 1MTSA 3A87A 2A2QH 2WPKS 1BTYA 1P2OA 2FS8A 3AW1A 3FFGA 1KIGH 5E2PA 1O2KA 4IMQA 2PFEA 4O97A 3V0XA 4MNVA 5LPRA 1L1NA 1BTZA 1MUEB 2GCHF 4YOJA 3WY8A 2PKSC 4AG2A 3QGJA 2ULLA 1OOKB 4FU7A 2C8ZB 5L2ZH 1N6YA 4MQAA 1DWBH 4Y0ZE 1UO6A 3A7ZA 4Y8XA 2DE9A 4BXWA 2Y82A 3UPEA 3SO3A 1GBBA 2Q6DA 3A8CA 1IHTH 1PFXC 1S81A 2A4RA 5FAHA 1H8DH 2BVSH 2FWWA 4FUGA 1L1JA 5IDKA 3PM3A 5TCAA 4R8TB 4XBDA 1TNJA 3SUGA 1QB6A 5LPFA 1W11U 1QQ4A 2HNTE 4OS4A 3EA7A 3PO1C 1HAOH 1BZXE 1BIOA 3SV8A 2C90B 1T31A 4JYTA 1DLEA 1G3BA 5T6FA 2CF8H 1CU1A 4LOYH 5F03A 3TK6A 2P3FH 2BDCA 3PMBB 4DOQA 4D9RA 1ABIH 2OUAA 3CS0A 2UUJB 2IOTA 3MH4A 4DJZB 1AFQC 3SV9A 5BRRE 1G3CA 3EDXB 2G8TA 2RDLA 4XBCA 4X1SU 1QHRB 4CRFA 1C5XB 1QJ6B 3M3VA 2TGPZ 2D1JA 3M5LA 1F0UA 3TH4H 1K21H 4ZHAA 2OBQA 4NCYA 1IQGA 2Z9LA 2YNBA 5E0HA 2PSXA 2GCTB 1ZJKA 2OQ5A 3LGYA 2RA3A 2QGRA 3CS7A 1C2GA 1T32A 3PLKA 4J1YA 2AMQA 1O2IA 1IQNA 1UTKA 2GDEH 1J17T 2WINI 3PB1E 2VWNA 2XBVA 3P70B 2Y6TA 2ZDVH 1K1OA 1S5SA 5FX5A 4MVNA 3A7WA 1D6WA 1GHXH 2JETB 1P09A 4NA7A 4X1RU 4DCDA 2ALVA 4ABBA 2ODPA 2BDYA 2R0KA 1AVGH 1WYKA 3TJUA 3TLOA 5CE1A 5FCKA 3B8JA 1ELBA 2BY5X 4I8KA 5CMXH 1JBUH 1N1LA 3RU4E 4E7RG 3EE0B 3LONA 1QB9A 2NU0E 2CV3A 3SORA 2OD3B 4IGDA 3ATLA 5F8ZA 1SFQB 3SI4H 3Q3XA 2FOAA 1L1GA 4X2YA 1SGYE 2EI6A 4K1SA 1EKBB 1P2MA 2BZ6H 1AMHA 3ZZ5A 5EQSA 1CBWB 4AG1A 3NUMA 4XDEA 2BDIA 2VIDA 1XUHA 1TX7A 1NN6A 1VR1H 3SN8A 3RXJA 5C20A 3TGJE 2CMYA 1O37A 2XYAA 3ZZ4A 1VJAU 1G3DA 4GLYA 2XBYA 2VWOA 1DT2A 4D8NA 1V3XA 2FS9A 5HYOA 1NU9A 1C5UA 1SVPA 1Z8IB 1OXGA 1WOFA 3NKKA 1L0ZA 1O3KA 2DUCA 3URDA 4OGXA 3P8GA 1KXBA 1OYTH 1BMLA 1LHDH 1D3DB 1TQ0B 3HGPA 4A7IB 1O2YA 1EPTA 1B5GH 1B0EA 1ZSKA 3TH2H 1OPHB 2BDGA 4YLUA 1TA6A 1IQFA 2WPJS 2H2ZA 4I8HA 4UFEH 4CRGA 3RXCA 2HNTC 1P01A 1DWCH 3MH7A 2ZHFH 2XXLA 1UVTH 4FUEA 2F3CE 1AB9B 1TX8A 3M37A 4M7GA 3TK9A 3NXPA 4RN6A 4GUXA 2YOLA 4CRDA 3UWJH 1F5KU 2Y7XA 1TRYA 3E8LA 3HPTB 1MZDA 1OWEA 2D8WA 4CRBA 1BQYA 3A88A 2QCYA 1QJ7B 1GBTA 1KLIH 1TNKA 1NRRH 2UUYA 3LKWA 4TPYA 1XKAC 4FVBA 1QBVH 6GCHG 3U69H 1C2MA 4DURA 3LJOA 3NPSA 4MNWA 1S82A 1GVLA 3STJA 5LH8A 5I25A 1DE7H 1FXYA 1LVBA 1MAYA 4SGAE 3HKIB 1C2HA 3A84A 4NFFA 3GDVA 1Q3XA 3BTQE 2PLXA 4JZFH 4FUCA 2YNAA 1UJ1A 1DDJA 2HGTH 2Y80A 2H9HA 4VGCC 1T8NA 2C8YB 2GP9B 2P59A 1HRTH 4Q80A 1FPCH 1YCPK 1O2RA 3GY2A 1DY9A 2OXSA 7KMEH 1DUEA 1ID5H 8ESTE 1ANCA 1BUIA 2XRCA 6CHAB 1P05A 1C5NH 1O33A 1O2HA 1G37A 2GV7A 1KXEA 1GHBF 1PPCE 1BRAA 3ODFA 3FP7E 2TBSA 1C5SA 3TK5A 1EXFA 3UOPA 1FY8E 4HI3A 1WU1A 4Q7ZA 4X8UH 2XW9A 4AX9H 1IQIA 2AIPA 1FIZA 3RDZA 1SMFE 3EQ0H 1C9TA 7GCHF 1V2ST 1SG8B 1GDQA 1ZHMA 2A32A 1IOEA 1TRMA 1DWDH 4FUDA 1P2JA 1ESBA 1AKSA 2V0BA 2JETC 3UNQA 1BBRE 1P2IA 3BN9A 1AY6H 3KQCA 5GPIB 3GISB 5JBAS 4X8VH 1SBWA 2Z94A 2G4UA 3GY5A 1H9LB 2BQWB 2BMGB 4ISNA 5A0CA 1RIWC 2HNTF 4IW4E 1O5BB 2TGAA 3LU9B 3BEIB 4GVUA 4WMEA 3IITA 3P8NA 3KNXA 3MNXA 1A61H 3SU3A 4PROA 4YOGA 3GYLB 1O3EA 2ZFPH 1JXPA 1V2RT 4LK4A 1NFXA 5DPAA 2O8MA 1QIXB 1TPAE 2FOHA 3ZZBA 1AFQB 3OX7U 1O2TA 1LQDB 1QBOA 3TH3H 1YBWA 2M5TA 3A81A 3DT0H 5EW1H 5EPYA 3RU4D 2QF0A 3TITA 2AS9A 4YTAA 1OYQA 3GY3A 4HTCH 2B0FA 1TNLA 1OS8A 3DFJA 1SHHB 5PTPA 1H9IE 2QXGA 1BCUH 3ZVGA 2Z3EA 1QB1A 1K1IA 3AASA 3M7UA 5EXLA 2ZO3H 3PO1B 3UUZA 1EAUA 4I7YH 2HRVA 2FEQH 5T6DA 2GZ8A 2GMTC 2GCTC 1PPFE 1MZAA 2BYAX 2Y5GA 1GJ8B 1LCYA 1OSSA 1HFDA 2THFB 2VIWA 1W0YH 5DG6A 1FIWA 4E05H 1GDUA 1GGDB 3RXGA 4NG9H 3ZYDA 1SGEE 1C5RA 3S7HB 2VJ1A 3RXTA 2HWLB 3UNSA 2ASUB 5HM2A 3HK3B 4NZLA 2A1DB 4AYVB 2WUBA 1F5LA 2IN2A 1Y5AT 1V2NT 2GX4A 4NIVA 2VVCA 3A80A 4UE7H 4IS5A 3GCHC 3MNSA 2BZAA 1J14A 1TPPA 1PYTC 1NRNH 4DGJA 2SGFE 4BTUB 2QA9E 2VNTA 2OLGA 1GHWH 1AE5A 1AUJA 2ZKSA 1E38B 1SGIB 1ELGA 2AH4X 1Z6EA 3ATIA 6LPRA 4RKJB 3KHVA 4K69A 1BDAA 3FANA 9ESTA 2J4IA 3M7TA 3GCTG 1SLUB 1V2QT 1AIXH 1W8BH 3A83A 4CREA 5DP5A 4I31A 1DLKB 4FU8A 3ZZ9A 4A5TS 4K60A 2LNCA 4JYVH 4HZHA 4F4OC 2ANMH 2FXRA 3SNBA 3SU2A 4OS6A 2XCFA 2PSYA 4ZUHA 5C1UA 2Z6BD 2ZDNA 2OP9A 2FDAA 5JYIA 3SGAE 1PPHE 4RKOB 3NCLA 1Y59T 4DVAU 3NZIA 1SQOA 4INKA 1BRCE 2F9BH 4D76A 1T7CA 1QRWA 1W3CA 3U8TH 2SNWA 2ZCKP 3H5CB 2A5KA 1UCYE 7GCHG 4WY3A 1O2UA 2CF9H 1MMJN 4TPIZ 4TYDA 1MTUA 1XXDA 1WCZA 2K1QA 4X8TH 1BJVA 5EQQA 4UEHH 4JYUH 1GBDA 1UVUH 1FQ3A 4AB9A 2GT7A 1C5MD 2V35A 2P93A 1FY1A 1C5PA 1EASA 3BTGE 3BTWE 4U01A 1FN8A 3QTVH 1DS2E 2FOGA 2H5CA 4TY6A 4Y7BA 2XWBI 1O3AA 2A0QB 2BDHA 1UTLM 1YLCA 2HLCA 2WV5A 1O5GH 5L2YH 1UTJA 2R3UA 2VVUA 3KN2A 3D62A 3ZVEA 3MO3A 2SGAA 5TCCA 3SU0A 3T27A 1C5ZB 1K22H 1TA2A 1L2EA 1KXDA 2VIVA 3RLYH 3BEFB 1EZSC 3UREA 2ZU3A 4IC6A 3RXRA 1ELCA 4AFUA 1BRBE 3MU4A 1O2WA 4NWKA 4NWLA 2BD9A 2H1UA 1Y3YA 1RTFB 3ZZ8A 3K6YA 2ZU1A 3ZVFA 3SV6A 4UFDH 3N7OA 1AUTC 3U9AH 4GHQA 2G00A 3BF6H 1DFPA 3PROA 1V2UT 5EG4A 1ZGVA 2ZWLH 1Z6JH 3ZVDA 3GY6A 2AGGX 3RMOH 5GDSH 1YPHC 2ZU5A 4O3TA 2J95A 3M61U 2EC9H 3VGCB 1ZMLA 3RXKA 5DP8A 4DIHH 1HDTH 1UK2A 3RLWH 1F7ZA 1EOJA 3W94A 4ZHLU 4K2YA 2ZQ2A 1AN1E 4UDWH 4KELA 1QBNA 1FN6A 5E0GA 3ZVBA 2OCVB 2ZTZA 2ZNKH 5A8YA 2O9QA 5EXMA 1O3LA 2ZFTA 2TGDA 8LPRA 1HJAC 2RCEA 3U8OH 4FXGH 2GGVB 3F9EA 1UCYK 1UHBB 3ATWA 3ZYEA 2ZECA 3DHKH 3NK8A 1ZPCA 4ZAEA 1C5QA 3CP7A 3C1KA 3S0NA 5GXPA 5CHAC 1ANEA 2G4TA 2VWMA 1ESTA 1TE0A 4H4FA 3K2UA 1O3IA 3P8OA 3SQEE 2BTCE 2IJOB 1AE8H 1TOCB 2VU8E 1GCTB 2ZGJA 2WPHS 4MNXA 1HJ8A 2SFAA 2A4QA 2AIQA 1V2JT 2XC4A 3LGTA 3T26A 4H6SB 4BAHB 1O32A 5J4QA 5E0JA 4X2XA 3FZDA 1O36A 4AYYB 2BDAA 2WPIS 5JBBS 2P3UB 4GCHG 1FUJA 1MTWA 4X8SH 2G5NA 4A1VA 1AZ8A 1TBZH 1TNGA 2BD5A 2PKSB 1ZSJA 5L30H 1P12E 3RMMH 1BOQA 1GBMA 1K1JA 3UNRA 1SGTA 2A7HA 3E91A 4BTIB 3V12A 1ANDA 1W0ZU 1PPZA 3OU0A 1RFNA 2J38A 2TIOA 3U1IB 2ZHEH 1Z1IA 4Q7XA 1FMGA 3BV9B 1MD8A 1O3FA 1BITA 1CHOG 1XUKA 1GBIA 4WWYA 2ZF0H 2W3IA 1Q2WA 1O5DH 1Y3VA 4WH6A 4OGYA 3MI4A 1HBTH 1O3BA 2OC0A 3T5FH 3TVJB 1GBFA 2BX4A 3RXIA 1DXPA 1GG6C 3FZZA 3GCTF 1YCPM 3A7TA 5FCRA 1HCGA 1A5HA 3UR6A 1HAHH 2BD4A 2BVXH 3DA9B 1KXCA 5FBEA 3TJVA 1UK4A 4BAOB 1WUNH 2LPRA 4ZXXH 4BAMB 5A0BA 1SGRE 2EA3A 4XOJA 2XNIA 1RIWB 2C4FH 2R2WU 4BAQB 1P0SH 4QT8C 1Y8TA 1HIAB 2BY9X 1GI6A 2WV4A 5JPMH 1BA8B 2GV6A 3MH5A 1O34A 2F9OA 1AWHB 1GBCA 4ISIH 1GDNA 1T4VH 1WQVH 4BAKB 5I46H 1ETTH 2PTCE 3R3GB 1GVZA 1PPBH 3E3TA 4ABIA 1PPEE 3SHCH 1D3TB 1BTWA 1GMHF 2Z3CA 3UR9A 2FM2A 1FLEE 1KTTB 1YPHE 2G81E 3QO6A 3UY9A 1GI3A 3ZZAA 3H7OA 1GMHG 4A1XA 1THRH 5J4SA 2AYWA 1V2WT 4I8JA 2PGBB 4INHA 3M5OA 1SI5H 5B6OA 1TPOA 2ZHDA 2VINA 1BTPA 1YGCH 1ARBA 2FTLE 1BRUP 3ZV8A 4AOQA 2IPHA 3V3MA 3BTME 3TIUA 1TWXB 3HGNA 1K2I1 3PWCA 4ASHA 3A8AA 1V2TT 4MLFB 4JMYA 2J2UA 2FP7B 2ZCLP 4I8GA 1GBJA 2FOFA 2ZHQH 2NU1E 1DOJA 6CHAC 3O8BA 4B1TA 3SUEA 1YLDA 2PV9B 4TWYA 1SGQE 1MH0A 2BQ7B 4FUFA 1CA0C 1CHOF 4O9VA 1DVAH 5DP9A 2O8WA 5CHAB 1FY5A 2W5EA 2GT8A 2ZG0H 1YP9A 3SGQE 1QL9A 3PWBA 1ZMJA 4X0WU 1YPKH 2HPPH 1ZTLA 4U32A 1TRNA 1PYTD 1LMWB 1RRKA 4I8LA 1GMDG 3QDZB 3K9XB 3E16B 1EP6A 1FY4A 2QAAA 1GJ9B 4CR9A 1HAZB 1J8AA 2BXTH 1QURH 5HMAA 1INCA 1UCYH 1GHBG 1G2MA 1GHZA 2A4GA 3OYPA 1YPMH 1GHAF 3QTOH 1HV7A 4AGJA 1LHEH 1TGCA 1O2MA 3LGWA 3BG4C 2PR3A 3ZZCA 4ZROA 5DP4A 2SGEE 3FP6E 1VGCC 3ATKA 3QK1A 2GTBA 1PJPA 2GVFA 4IMZA 1MU8B 3BTKE 3E0PB 2ZCHP 3RMLH 1ANBA 1PQ7A 1QGFA 3E6PH 2FESH 3S69A 1QA0A 2STBE 5EODA 1SGDE 1OP2A 2C93B 2BXUH 2B8OH 1FAXA 2UWPA 3KL6A 1CHGA 1O2QA 1C2JA 1L4DA 1TPSA 8GCHF 1PQ5A 1EUFA 2JH6D 1SFIA 1V2PT 1SLVB 5FX6A
chains in the Genus database with same CATH superfamily
2PW8H 3L33A 3SJ9A 1AD8H 3DSGA 5AVDA 1F92A 4CHAC 2AGEX 2KAIB 4MTBA 2ANWA 2D26C 1HXEH 1KYNA 1WSSH 3F1SB 1FZZA 3VXFH 2RG3A 1C4Y2 1XKBC 2AFQB 2C8XB 3GDSA 1IQHA 4I33A 1LKAA 1NM6A 3EA8A 2Q6GA 4XE4A 1C9PA 1AGJA 1NO9H 3RU4T 1D3QB 2ZPQA 4D9QA 3QZQA 4FUHA 2BX3A 2ZTYA 5F53A 4BXSA 1TIOA 2ESTE 3T62A 1GJ5H 1P03A 3GS9A 5EOKA 1KDQB 1SLXB 1AQ7A 3QZRA 2OTVA 4IN1A 3LDXH 2A45B 4OS7A 1BTUA 4B76A 1NU7B 1CO7E 2BOHB 4JZ1A 1C4V2 2F9UA 1O3MA 1BMNH 2XBWA 1QRXA 3A85A 3HK6B 5JB8S 2GZ9A 5E2OA 2AEIH 4DY7B 3LIWA 9LPRA 2O8UA 3MOCA 1FONA 2F83A 4THNH 4LZ1H 2TRMA 3N7DA 1N6XA 3DUXH 4XFQA 3BG4B 5C67A 2WPLS 5AFYH 4LXBH 1O3OA 2HALA 4O3UA 2ZFQH 1GI2A 2A4OA 1A4WH 1K1LA 1MTNB 4JCNA 1UTPA 2Z9IA 2VB0A 2FOBA 5C1YA 1NFUA 3MU1A 3URCA 1SGNE 3MTYA 2TPIZ 1ZHRA 1SGFG 1SGCA 3I77A 3LH1A 2BD3A 4XBBA 1C1VH 4K1TA 4CBNA 1GHVH 1Z8JB 4ISHH 3N7EA 1ZGIA 3PTNA 1P06A 4RI0A 1CT0E 3C27B 1ZRBA 5HKKD 4GSOA 3PV4A 2NU2E 5KECA 1NRQH 1VJ9U 1F0TA 2L74A 2A31A 4LZ4B 1EAIA 1EB1H 1C1WH 3M36A 4ZHMU 2WPMS 1P3EA 1RS0A 3F68H 3F9HA 1ZZZA 4CH8B 1M9UA 3LOXA 1LHFH 1SR5C 2VVVA 2OC1A 1C2DA 8GCHG 1EQ9A 2C3SA 1SQAA 3F2FA 4KTSA 1HPGA 3RXPA 1WBGB 3MYWA 3UIRA 1EZXC 1RTLA 4H6TA 1C1MA 4KTUA 1HJAB 4A92A 1IQKA 2QE7D 1BMMH 3DFLA 1QFKH 1SQRA 4FU9A 3VB6A 1HAIH 4FUJA 1YPEH 2ZP0H 1LQEA 1S6LA 1YCPH 2F9VA 1OWIA 3ZZ3A 3TGKE 1ZRKA 3SU5A 3TJOA 1Q31A 4FUIA 4D7FA 3FKSD 1A5IA 2BM2A 2FIRH 4ABEA 1LVOA 3QN7A 1SC8U 1W13U 4RT1A 3R0FA 3SUDA 1C5TA 1K1MA 1WDIA 4MPWA 5C1XA 3Q3YA 2G5VA 4KKDA 2Y81A 3I78A 2BLVA 4BNRA 1WAYB 1LVYA 1K1PA 5FBIA 3VEQB 3F2HA 5HXFA 3T29A 1G9IE 1WQSA 2XC5A 1S6FA 1G30B 1EJMA 4NSVA 2UUFB 2Z9GA 1T8MA 4H42U 2VIPA 1OWHA 1VCPA 4YESB 4KGAA 3TPIZ 4CHAB 4MG3A 4WJG2 3BSQA 1A46H 1AFEH 1RD3B 4NSYA 2BY8X 1C4U2 2FX6A 3A7VA 3SU1A 3SGBE 3EA9A 1HNEE 3EE7A 1E35B 1QCPA 3CNRA 2R2MB 1NZQH 1ZHPA 3SJKA 1S83A 2ZEBA 2JH0D 3VB5A 1G36A 3T28A 1A1RA 3E0NB 2GCHG 1CGHA 1C2EA 1O2PA 1C2FA 2ZI2H 1T8LA 4JZEH 3SNAA 4Z6AH 1KY9A 3M3SA 2FOCA 1DITH 4F49A 4BTTB 1JRTA 1K9OE 1SLWB 3UQVA 1CSOE 1S0QA 3RXDA 1A3BH 1ELDE 1W14U 4NIWA 1UMAH 2AHME 1QR3E 5K0HA 5HGGA 1W7GH 1EB2A 5EPNA 5FPYA 3U1JB 2R9PA 3E90B 1Z71A 2PTNA 1ZTKA 3KGPA 6ESTA 1F0RA 1EP5A 3SI3H 2BLWA 1O3NA 2WZQA 1PPGE 2ZFRH 1XVOA 1XMNB 1QQUA 2EEKA 4X1QU 1ESAA 1GJDB 1O35A 2V3HH 2ZGCA 5GIBA 2BD8A 5EXNA 1ACBE 4AFQA 3PMJA 4OS1A 3ATMA 3F3BA 1IQEA 1Y5UT 2PGQB 3MNBA 5KEDA 2SGPE 1UTNA 5ETXA 2B5TB 2Z9JA 3FOAA 4VGCB 1P3CA 3M3TA 3P17H 3LJJA 4NGAH 1CGIE 3DSOA 1O5FH 2G52A 1DPOA 1S6HA 1AKSB 1Z1JA 2BB4A 1DX5M 1QRZA 1ORFA 4ISLA 4MPUA 1DSUA 4JZIA 1OP0A 2ZPSA 2XC0A 2GDDA 1QL7A 1J15A 3LGVA 4K8YA 4J2YB 5T6GA 3ZV9A 2AGIX 1ZJDA 1EZQA 2WHXA 4FUBA 1F5RA 1MQ6A 1Y3UA 1Y3WA 4NFEA 3RXBA 1MABB 1SL3A 3GOVB 5GCHG 1W7XH 3LH3A 4ZXYH 3SU6A 2QN5T 3VG8A 3SUFA 1HGTH 1GBLA 4E7NA 1O2OA 5EJZA 1J16A 2GZ7A 2H5DA 3BTTE 4Y7AA 3A89A 3SNCA 2I6SA 1O5AB 4B75A 5CHBA 3RXUA 2FOMB 4NA8A 2KR7A 2XCNA 3IWMA 3TU7H 3SU4A 2ZDKA 3UQOA 4CRAA 2GKVE 5C0TA 1U6QA 1NESE 1LDTT 4Y6DA 2FOEA 3UWIA 1ARCA 5FHTA 1DXWA 1DANH 3ESTA 1TNIA 4ABAA 1E34B 4U2WA 4F55A 1A2CH 3PYHA 1C5YB 4IN2A 5H4IB 3VGCC 1YM0A 1O3JA 2NWNA 3D23A 1HUTH 1YYY1 1OWKA 4B2BA 4TSFD 5A09A 2NU4E 1BBRH 1LVMA 4AGKA 1LHGH 1LPKB 2GJGA 2ZHWH 2AERH 3LGUA 1DUAA 2O8LA 2OC7A 1WTGH 1VITG 2A5AA 1WTHD 1G32B 3RXOA 1BT7A 4R0IA 1CBWC 1UVSH 3OTJE 4DG4A 1TQ7B 2QF5A 4I32A 1O2SA 4B6EA 1OX1A 2QC2A 2V7QD 3BTFE 2ZFFH 4K3JA 4K8BA 1O3GA 3EAJA 3JZ2B 4DIIH 1EPTC 5EJ1A 3PRBA 4AORA 1K1NA 3OFND 1SPJA 2HPQH 3RXHA 2JJ2D 4NZQA 1MTNC 4YOIA 4Y0YE 1V2VT 5GWZA 1RXPA 1WXRA 5A0AE 1GPZA 5DKMA 1A7SA 3MNCA 1HAYB 3P95A 1P9UA 3M35A 2B7DH 1A0JA 3TNTA 1P57B 4NIXA 1MKWH 4B2AA 3FN8A 4ISOA 4WXVA 2Y5HA 1YY3A 2OQUA 2BY6X 2FO9A 2BVRH 3PTBA 5AHGH 2J9NA 3GICB 2Q6FA 2Z3DA 1F0SA 3A82A 4MPVA 1IAUA 3OSYA 3RUOA 4Z1MD 2AMDA 3ZVAA 4OS5A 3QLPH 3MFJA 1O5EH 3NWUA 3A8BA 3Q00A 1XVMA 1CA8B 4X2WA 2ZC9H 2WUCA 1O2GH 4BOHA 2VH6A 5EW2H 1SHYA 2VH0A 4HGCA 2ZPRA 1VZQH 3TGIE 3PLBA 5JB9S 4DT4A 1TLDA 1LPGB 3M5NA 1J9CH 1HYLA 4ABHA 2P16A 3B23B 3UTUH 1SQTA 2LP6A 1TMBH 1JMOH 2FI4E 3G01A 1JOUB 3UFAA 2PKAA 1GI7B 1GCTC 3Q3KA 3RXFA 1NRPH 2CXVA 4ABFA 5ABWA 1Y3XA 4NA9H 3DD2H 3MU5A 3FVFB 2CK3D 2F9PA 2KCPA 4K1EA 2KFWA 1NFYA 4X1NU 1TGTA 1P9SA 3K6ZA 2QXHA 3GDUA 4TY7A 1D4PB 3BTDE 1BTHH 3PMHB 5B6LA 1MBQA 2FZZA 1ZMNA 2FPZA 1W0KD 1UK3A 5LGOA 2QF3A 4CRCA 5K7RA 3OEHD 1T4UH 2IJD1 3FAOA 1H4WA 3F9GA 2STAE 2BDBA 1D9IA 1FPHH 4WH8A 1FV9A 1MBMA 1K28D 3F6UH 4YM9A 5AFZH 3SV2H 1LHCH 1XX9A 3VB4A 2KAIA 1VCQA 3KEEA 2PHBA 4WXIA 4OS2A 1AWFH 2FLBH 3UAIC 3M7QA 1V2KT 3SV7A 3AVZA 1LTOA 5TJXA 1B7XB 1EZUC 3UOUA 3PV2A 1QA7A 4FETA 1KSNA 4X6PA 1NROH 2V3OH 1BB0B 1RJXB 3SNDA 2FLRH 3U8RH 1E36B 2RA0A 4JZDH 1YKTA 2FMJA 2UWLA 1FY3A 3OY6U 2XNDD 1F2SE 1O38A 2QXIA 2ZFSA 4X6NA 1AU8A 4X6MA 2ODYB 3EYDA 3AW0A 3BTEE 2NU3E 3I29A 4ABJA 1CT4E 3V13A 1HAVB 1C1QA 5C3NA 2VGCB 1AHTH 2BLOA 2ZQ1A 2BD2A 4WMFA 3JZ1B 3PMAB 8KME2 5EU8A 1AVXA 1HLTH 1YPGH 1TMTH 4IBLH 1C5VA 4AFZA 1CT2E 3SNEA 5L6NH 2Z7FE 1SGPE 1H1BA 4INLA 3HKJB 4ABGA 1G3EA 1C1SA 1HAVA 3MO9A 3D65E 2HLDD 1IHSH 1D6RA 5AF9H 4GHTA 1A3EH 1KXFA 1UTOA 2HVXA 2XBXA 2GD4B 1TBQH 2UWOA 3SZNA 2G51A 2ZDAH 3S9BA 1YWUA 3W1EA 1AVWA 2A7CA 1O3CA 2Z9KA 3RXQA 3KCGH 3RP2A 1GBKA 1COWD 3CENA 4JK6A 4U30A 2QXJA 1ELTA 4TT3D 1C1OA 1GJ7B 2F91A 1LKBA 1JWTA 1TYNA 2W26A 1O3HA 1C5OH 2J92A 3ZZ7A 4E06H 1P2KA 4ZKSU 2HOBA 1O2XA 1E37B 1PQ8A 5C2ZA 1V6DA 5C5NA 1AO5A 1EPTB 1MD7A 5JBCS 1GHAG 3GCOA 1ELEE 2M2AA 1GJAB 2ALPA 4B73A 1VITF 1GBAA 3P92A 3GY4A 1HAXB 1XUFA 1THPB 1GL0E 1NS3A 3ZZDA 2A7JA 5T3HA 1W12U 1HJ9A 3OEED 2ANKH 1N8OC 1GG6B 1XXFA 1FDPA 1DSTA 3KQDA 1JIMA 3SOSA 2FI5E 3P8FA 4X6OA 2W3KA 1HIAA 2WYJA 1Z8RA 2VGCC 3H09A 1E0FD 4ABDA 1O2VA 1P11E 2HVYB 4D7GA 4XD7D 3BTHE 1UTQA 1DWEH 2H9EH 2W7UA 4YLQH 3UB0A 3Q76A 2FODA 1FAKH 1W2KH 1HXFH 1NTPA 2Q1JA 4Q2KA 5EQRA 1O0DH 1P02A 3GCHB 3KIDU 4OM9A 4ZKRU 4FVDA 4A6LA 3QX5H 1EOLA 4YT7H 2ANYA 1GI0A 2XWAA 2FYQA 1XM1A 3TJNA 6GCHF 3ELAH 1TGSZ 1VITH 5G4BA 1EX3A 3GY8A 1A0LA 4Q7YA 1EAWA 2OC8A 1QJ1B 5DP7A 1YF4A 3LPRA 4AB8A 3WWBA 4Z0KA 3LC5A 1GGDC 5LPEA 3M5MA 3VB7A 1EAXA 4ZKNU 4XRNA 1TGNA 1EJNA 2GMTB 1C1TA 1TABE 3L6PA 1S84A 3RXEA 2XTTB 4NIYA 3T2NA 2AMPA 4YZUA 3S9AA 1L4ZA 3BIUH 3T25A 1CGJE 3A7YA 1UTMA 5IK2D 1MCVA 1O2LA 1C1UH 4B2CA 3O8RA 1KXAA 1S85A 1O5CB 3SHAH 5C94A 2P95A 3O8DA 3ENSB 4GCHF 1G2LA 1KTSB 4UONA 5A8XA 1XUIA 1MAXA 1C5LH 1V2OT 4UFGH 3IG6B 4ESTE 1O31A 1CA0B 2JIZD 5FPSA 4YO9A 1SGFA 3GCNA 2CHAB 3K65B 4BANB 3EGKH 1TGBA 3KQEA 3W95A 1HB0B 3KQ5A 5DP6A 3S7KB 1C1RA 4CBOA 4WVPE 4AFSA 2FX4A 1ABJH 2OINA 1OWJA 4X2VA 1YC0A 2ZU4A 1GL1A 1BHXF 3ITIA 3MWIU 4A1TA 5BPEA 1AB9C 1P8VC 1ZPZA 3L3TA 2F4LA 4Y8YA 1W10U 3AAVA 3TNSA 2Y5FA 1TAWA 1BTXA 1NRSH 4K5ZA 2B9LA 5F6MA 1C2LA 4GAWA 2VWLA 1O2ZA 1NY22 3RM0H 2I6QA 7ESTE 1FI8A 1CQQA 3N99A 3MH6A 1BBRK 3S9CA 1P04A 3VB3A 3A8DA 1Z8GA 2R3YA 4Y10E 1OWDA 3QUMP 1PQAA 5FPTA 4Y8ZA 5EGMA 1GBEA 2BQ6B 1MTVA 5HM9A 4TWWA 2O8TA 2EI7A 1FNIA 1MCTA 3RXVA 2CGAA 4MPXA 2V6NA 3BG8A 3RXAA 1C1NA 1ZTJA 1NC6A 2ILNA 1FX0B 1RGQA 4RSPA 1EATA 2P8OC 4ZH8A 1H8ED 2YMSC 2PUXB 1TONA 2J94A 3BIVH 1KMHB 1FJSA 4O03A 3PLPA 1GHYH 4Y79A 1ETSH 1O2NA 1A5GH 4Y71A 1GI9B 1QL8A 1GBHA 2BHGA 2W7SA 2H6MA 1X7AC 2K0QA 5JBTA 1GWAA 5IYTA 1P10A 1B0FA 1GJ4H 2CHAC 1MQ5A 1KLJH 3RMNH 3GY7A 1O39A 5HIZA 5A8ZA 1TBRH 3KYGA 5JDUB 2BY7X 3SJ8A 4UD9H 1LO6A 1WV7H 4MNYA 2WV9A 2ZU2A 3RXLA 1GCDA 1HAPH 1YPLH 1ZSLA 2A5IA 2WYGA 3GYMA 3LGIA 2ZGHA 4DT7B 4Y11E 1EJAA 1NT1A 3MU0A 1Z7KA 1GI5A 1KDQA 2QF4A 4UFFH 3RXSA 3RXMA 7LPRA 1C5WB 1GI1A 2JKHA 1IQMA 4Y76A 3ZVCA 1XUGA 1BMAA 1GJCB 1TOMH 2F43B 2F9NA 1CE5A 1VCWA 3KF2A 3SBKA 2G55A 2J34A 3VPKA 3ODDA 1EFRD 4XSKU 2EY4C 1MKXH 1UVPA 2H9TH 3KQBA 2QV1A 3SZEA 1XUJA 5GCHF 3D49H 1NFWA 4IC5A 4JK5A 3SQHE 3OY5U 4CH2B 2OBOA 4ZKOU 1MU6B 1O3PB 1GJBB 2PWXA 1AI8H 1TMUH 1H9HE 1LPZB 1ELVA 5GJ4B 1ELFA 2FI3E 1GI4A 3U98H 3H7TA 5E8EH 1ZYOA 4HFPB 1DM4B 1GMCG 4WMDA 5DJ7A 1IQJA 1O3DA 1OP8A 3B9FH 2FTMA 4MDSA 1Y5BT 3O8CA 5DP3A 1TFXA 2VIQA 3RM2H 3RC6A 3VXEH 2PUQH 5F8TA 2ODQA 5ESTE 2ZZUH 2QYIA 2Y7ZA 2R0LA 1V2LT 2ZDLA 2C8WB 2ZA5A 1ETRH 3MHWU 2CN0H 1QZ8A 5F8XA 2SGDE 4GPGA 5A2MH 1TNHA 1TALA 1ZOMA 2JH5D 1MKWK 3LT3A 3VFEA 5SGAE 4X1PU 2ZGXH 1RTKA 2J5UA 3MU8A 3QGNB 2P8OB 2QIQA 3A86A 2ZGBH 4SGBE 1DY8A 2D2DA 4HG6A 1BMFD 1T8OA 1QNJA 1SOZA 1O30A 1ZLRA 1THSH 3RC5A 4WF8A 1JIRA 1UVOA 1VGCB 1AZZA 3QWCH 1JRSA 4AZ2B 4YT6H 2SGQE 1KLTA 5DGJA 2FYRA 1QY6A 1GMDF 3BEUA 1H8IH 1IQLA 2BLQA 4DW2U 5FXLA 1SB1H 1MKXK 4ZMAH 2DE8A 3F9FA 3P6ZB 1OKXA 3HATH 1ZPBA 2VIOA 3A7XA 4KP0A 1QTFA 2P94A 4B71A 1NPMA 5C5OA 3MO6A 4YXWD 5DK1A 1ZR0A 1N8OB 1P2QA 2TGTA 3ZZ6A 3SJOA 1CVWH 1TB6H 2A2XH 3V7TA 3WWFA 1NBMD 1BJUA 2P3TB 4KTCA 2KCYA 1C2IA 3FP8E 1GI8B 2J98B 3SJIA 1DICA 1GJ6A 1YPJH 1BHXB 1O2JA 2ZIQH 4AN7A 2CJIA 1ELAA 2BOKA 1SSXA 3E1XB 3RC4A 3LC3A 1C1PA 2PKAB 3Q77A 1C2KA 1TX6A 3STIA 1S0RA 1UHBA 1GVKB 1GMCF 2QY0B 3AAUA 5ESBA 2SNVA 1SOTA 2EI8A 2ZDMA 2BD7A 3SW2B 1HAGE 4CR5A 4B74A 3MMGA 1V2MT 1D3PB 2UUKB 1P2NA 1A0HB 5DO4H 2ZTXA 2JJ1D 1MTSA 3A87A 2A2QH 2WPKS 1BTYA 1P2OA 2FS8A 3AW1A 3FFGA 1UW7A 1KIGH 5E2PA 1O2KA 4IMQA 2PFEA 4O97A 3V0XA 4MNVA 5LPRA 1L1NA 1BTZA 1MUEB 2GCHF 4YOJA 3WY8A 2PKSC 4AG2A 3QGJA 2ULLA 1OOKB 4FU7A 2C8ZB 5L2ZH 1N6YA 4MQAA 1DWBH 4Y0ZE 1UO6A 3A7ZA 4Y8XA 3OAAD 2DE9A 4BXWA 2Y82A 3UPEA 3SO3A 1GBBA 2Q6DA 3A8CA 1IHTH 1PFXC 1S81A 2A4RA 5FAHA 1H8DH 2BVSH 2FWWA 4FUGA 1E1RD 1L1JA 5IDKA 3PM3A 5TCAA 4R8TB 4XBDA 1TNJA 3SUGA 1QB6A 5C0UA 5LPFA 2WSSD 1W11U 1QQ4A 2HNTE 4OS4A 3EA7A 3PO1C 1HAOH 1BZXE 1BIOA 3SV8A 2C90B 1T31A 4P00A 4JYTA 1DLEA 1G3BA 5T6FA 2CF8H 1CU1A 4LOYH 5F03A 3TK6A 2P3FH 2BDCA 3PMBB 4DOQA 4D9RA 1ABIH 2OUAA 3CS0A 2UUJB 2IOTA 3MH4A 4DJZB 1AFQC 3SV9A 5BRRE 1G3CA 2KCOA 2G8TA 2RDLA 3EDXB 4X1SU 1QHRB 4XBCA 4CRFA 1C5XB 1QJ6B 3M3VA 2TGPZ 2D1JA 3M5LA 1F0UA 3TH4H 1K21H 4ZHAA 2OBQA 4NCYA 1IQGA 2Z9LA 2YNBA 5E0HA 2PSXA 2GCTB 1ZJKA 2OQ5A 3LGYA 4Q63A 2RA3A 2QGRA 3CS7A 1C2GA 1T32A 3PLKA 4J1YA 2AMQA 1O2IA 2KX4A 1IQNA 1UTKA 2GDEH 1J17T 2WINI 3PB1E 2VWNA 2XBVA 3P70B 2Y6TA 2ZDVH 1K1OA 1S5SA 5FX5A 4MVNA 3A7WA 1D6WA 1GHXH 2JETB 1P09A 4NA7A 4X1RU 4DCDA 2ALVA 4ABBA 2ODPA 2BDYA 2R0KA 1AVGH 1WYKA 3TJUA 3TLOA 5CE1A 2PP6A 5FCKA 3B8JA 1ELBA 2BY5X 4I8KA 5CMXH 1JBUH 1N1LA 3RU4E 4E7RG 3EE0B 3LONA 1QB9A 2IPQX 2CV3A 2NU0E 2OD3B 3SORA 4IGDA 3ATLA 5F8ZA 1SFQB 3SI4H 3Q3XA 2FOAA 1L1GA 4X2YA 1SGYE 2EI6A 4K1SA 1EKBB 1P2MA 3NRLA 2BZ6H 5FL7D 1AMHA 3ZZ5A 5EQSA 1CBWB 4AG1A 3NUMA 4XDEA 2BDIA 2VIDA 1XUHA 1TX7A 1NN6A 1VR1H 3SN8A 3RXJA 5C20A 3TGJE 2CMYA 1O37A 2XYAA 3ZZ4A 1VJAU 1G3DA 5HIYA 4GLYA 2XBYA 2VWOA 1DT2A 1K0HA 4D8NA 1V3XA 2FS9A 5HYOA 1NU9A 1C5UA 1SVPA 1Z8IB 1OXGA 1OHHD 1WOFA 3NKKA 1L0ZA 1O3KA 2DUCA 3URDA 4M9FA 4OGXA 3P8GA 1KXBA 1OYTH 1BMLA 1LHDH 1D3DB 1TQ0B 3HGPA 4A7IB 1O2YA 1EPTA 1B5GH 1B0EA 1ZSKA 3TH2H 1OPHB 2BDGA 4YLUA 1TA6A 1IQFA 2WPJS 2H2ZA 4I8HA 4UFEH 4B6FA 4CRGA 3RXCA 2HNTC 1P01A 1DWCH 3MH7A 2ZHFH 4ZCNA 3OE7D 2XXLA 1UVTH 4FUEA 2F3CE 1AB9B 1TX8A 3M37A 4M7GA 3TK9A 3NXPA 4RN6A 4GUXA 2YOLA 4CRDA 3UWJH 1F5KU 2Y7XA 1TRYA 3E8LA 3HPTB 1MZDA 1OWEA 2D8WA 4I86A 4CRBA 1BQYA 3A88A 2QCYA 1QJ7B 1GBTA 1KLIH 1TNKA 1NRRH 2UUYA 3LKWA 4TPYA 1XKAC 4FVBA 1QBVH 6GCHG 3U69H 1C2MA 2XOKD 4DURA 3LJOA 3NPSA 4MNWA 1S82A 1GVLA 3STJA 5LH8A 5I25A 1DE7H 1FXYA 1LVBA 1MAYA 4SGAE 3HKIB 1C2HA 3A84A 4NFFA 3GDVA 1Q3XA 3BTQE 2PLXA 4JZFH 4FUCA 2YNAA 1UJ1A 1DDJA 2HGTH 2Y80A 2H9HA 4VGCC 1T8NA 4ACBA 2C8YB 2GP9B 2P59A 1HRTH 4Q80A 1FPCH 1YCPK 1O2RA 3GY2A 1DY9A 2OXSA 7KMEH 1DUEA 1ID5H 8ESTE 1ANCA 1BUIA 2XRCA 6CHAB 1P05A 1C5NH 1O33A 1O2HA 2YMSB 1G37A 2GV7A 3AK5A 1KXEA 1GHBF 1PPCE 1BRAA 3ODFA 3FP7E 2TBSA 1C5SA 3TK5A 1EXFA 3UOPA 1FY8E 4HI3A 1WU1A 4Q7ZA 4X8UH 2XW9A 4AX9H 1IQIA 2AIPA 1FIZA 4RT0A 3RDZA 1SMFE 3EQ0H 1C9TA 7GCHF 1V2ST 2W6JD 1SG8B 1GDQA 1ZHMA 2A32A 1IOEA 1TRMA 1DWDH 4FUDA 1P2JA 1ESBA 1AKSA 2V0BA 2JETC 3UNQA 1BBRE 1P2IA 3BN9A 1AY6H 3KQCA 5GPIB 3GISB 4ASUD 5JBAS 4X8VH 1SBWA 2Z94A 2G4UA 3GY5A 1H9LB 2BQWB 2BMGB 2K8IA 4ISNA 5A0CA 1RIWC 2HNTF 4IW4E 1O5BB 2TGAA 3LU9B 4P02A 3BEIB 4GVUA 4WMEA 3IITA 3P8NA 3KNXA 3MNXA 1A61H 3SU3A 4PROA 4YOGA 3GYLB 1O3EA 2ZFPH 1JXPA 1V2RT 4LK4A 1NFXA 5DPAA 2O8MA 1QIXB 1TPAE 2FOHA 3ZZBA 1AFQB 3OX7U 1O2TA 1LQDB 1QBOA 3TH3H 1YBWA 2M5TA 3A81A 3DT0H 3FO8D 5EW1H 5EPYA 3RU4D 2QF0A 3TITA 2AS9A 4YTAA 5DN6D 1OYQA 3GY3A 4HTCH 2B0FA 1TNLA 1OS8A 3DFJA 1SHHB 5PTPA 1H9IE 2QXGA 1BCUH 3ZVGA 2Z3EA 1QB1A 1K1IA 3AASA 3M7UA 5EXLA 2ZO3H 3PO1B 3U28C 3UUZA 1EAUA 4I7YH 2HRVA 2FEQH 5T6DA 2GZ8A 2GMTC 2GCTC 1PPFE 1MZAA 2BYAX 2Y5GA 1GJ8B 1LCYA 1OSSA 1HFDA 2THFB 2VIWA 1W0YH 5DG6A 1FIWA 4E05H 1GDUA 1GGDB 3RXGA 4NG9H 3ZYDA 1SGEE 1C5RA 3S7HB 2RDEA 2VJ1A 3RXTA 2HWLB 1YLNA 3UNSA 2ASUB 5HM2A 3HK3B 4NZLA 2A1DB 4AYVB 1SKYE 2WUBA 1F5LA 2IN2A 1Y5AT 1V2NT 2GX4A 4NIVA 2VVCA 3A80A 4UE7H 4IS5A 3GCHC 3MNSA 2BZAA 1J14A 1TPPA 1PYTC 1NRNH 4DGJA 2SGFE 4BTUB 2QA9E 2VNTA 4F48B 2OLGA 1GHWH 1AE5A 1AUJA 2ZKSA 1E38B 1SGIB 1ELGA 2AH4X 1Z6EA 3ATIA 6LPRA 4RKJB 3KHVA 3PRDA 4K69A 1BDAA 3FANA 9ESTA 2J4IA 3M7TA 3GCTG 1SLUB 1V2QT 1AIXH 1W8BH 3A83A 4CREA 5DP5A 4I31A 1DLKB 4FU8A 3ZZ9A 4A5TS 4K60A 2LNCA 4JYVH 4HZHA 4F4OC 2ANMH 3F2GA 2FXRA 3SNBA 3SU2A 3SYJA 4OS6A 2XCFA 2PSYA 4ZUHA 5C1UA 2Z6BD 2ZDNA 2OP9A 2FDAA 5GNDA 5JYIA 3SGAE 1PPHE 4RKOB 3NCLA 1Y59T 4DVAU 3NZIA 1SQOA 4INKA 1BRCE 2F9BH 4D76A 2KCAA 5EIYA 1T7CA 1QRWA 1W3CA 3U8TH 2SNWA 5T1VA 2ZCKP 3H5CB 2A5KA 1UCYE 7GCHG 4WY3A 3F0PA 1O2UA 2CF9H 1MMJN 4TPIZ 4TYDA 1MTUA 1XXDA 1WCZA 2K1QA 4X8TH 1BJVA 5EQQA 4UEHH 4JYUH 1GBDA 1UVUH 1FQ3A 4AB9A 2GT7A 1C5MD 2V35A 5C17A 2P93A 1FY1A 1C5PA 1EASA 3BTGE 3BTWE 4U01A 1FN8A 3QTVH 1DS2E 2FOGA 1H8HD 2H5CA 4TY6A 4Y7BA 2XWBI 1O3AA 2A0QB 2BDHA 1UTLM 1YLCA 2HLCA 4FOUC 2WV5A 1O5GH 5L2YH 1UTJA 2R3UA 2VVUA 3KN2A 3D62A 3ZVEA 3MO3A 2SGAA 5TCCA 3SU0A 3T27A 1C5ZB 1K22H 2WPDD 1TA2A 1L2EA 1KXDA 2VIVA 3RLYH 3BEFB 1EZSC 3UREA 2ZU3A 4IC6A 3RXRA 1ELCA 4AFUA 1BRBE 3MU4A 1O2WA 4NWKA 4NWLA 2BD9A 2H1UA 1Y3YA 1RTFB 3ZZ8A 3DCLA 3K6YA 2ZU1A 3ZVFA 3SV6A 4UFDH 3N7OA 1AUTC 3U9AH 2EQNA 3KYFA 4GHQA 2G00A 3BF6H 1DFPA 3PROA 1V2UT 5EG4A 1ZGVA 2ZWLH 1Z6JH 3ZVDA 3GY6A 2AGGX 3RMOH 5GDSH 1YPHC 2ZU5A 4O3TA 2J95A 3M61U 2EC9H 3VGCB 1ZMLA 3RXKA 5DP8A 4DIHH 1HDTH 1UK2A 3RLWH 1F7ZA 1EOJA 3W94A 4ZHLU 4K2YA 2ZQ2A 1AN1E 4UDWH 5EJLA 4KELA 1E79D 1FN6A 1QBNA 5E0GA 3ZVBA 2OCVB 2ZTZA 2ZNKH 5A8YA 2O9QA 5EXMA 1O3LA 2J98A 2ZFTA 2TGDA 8LPRA 1HJAC 2RCEA 3U8OH 4FXGH 2GGVB 3F9EA 1UCYK 1UHBB 3ATWA 3ZYEA 2ZECA 3DHKH 3NK8A 1ZPCA 4ZAEA 1C5QA 3CP7A 3C1KA 3S0NA 5GXPA 5CHAC 1ANEA 2G4TA 2VWMA 1ESTA 1TE0A 4H4FA 3K2UA 1O3IA 3P8OA 3SQEE 2BTCE 2IJOB 1AE8H 1TOCB 2V3MA 2VU8E 1GCTB 2ZGJA 2WPHS 1W0JD 4MNXA 1HJ8A 2SFAA 2A4QA 2AIQA 1V2JT 2XC4A 2KZ4A 3LGTA 4H6SB 3T26A 4BAHB 1O32A 5J4QA 5E0JA 4X2XA 3FZDA 1O36A 4AYYB 1NBME 2BDAA 2WPIS 5JBBS 2P3UB 4GCHG 1FUJA 1MTWA 4X8SH 2G5NA 4A1VA 1AZ8A 1TBZH 1TNGA 2BD5A 2PKSB 1ZSJA 5L30H 1P12E 3RMMH 1BOQA 1GBMA 1K1JA 3UNRA 1SGTA 2A7HA 3E91A 4BTIB 3V12A 1ANDA 3PV5A 5DSFA 1W0ZU 1PPZA 3OU0A 1RFNA 2J38A 2TIOA 3U1IB 2ZHEH 1Z1IA 4Q7XA 1FMGA 3BV9B 1MD8A 1O3FA 1BITA 1CHOG 1XUKA 1GBIA 2YMSD 4WWYA 2ZF0H 2W3IA 1Q2WA 4ACAA 1O5DH 1Y3VA 4WH6A 3WW7A 4OGYA 3MI4A 1HBTH 1O3BA 2OC0A 3T5FH 3TVJB 1GBFA 2BX4A 3RXIA 1DXPA 1GG6C 3FZZA 3GCTF 2OK5A 1YCPM 3A7TA 5FCRA 1HCGA 1A5HA 3DSPA 3UR6A 5KGOA 1HAHH 2BD4A 2BVXH 3DA9B 1KXCA 5FBEA 3TJVA 1UK4A 4BAOB 1WUNH 2LPRA 4ZXXH 4BAMB 5A0BA 1SGRE 2RFKC 2EA3A 4XOJA 2KM0A 2XNIA 1RIWB 2C4FH 2R2WU 4BAQB 1P0SH 4QT8C 1Y8TA 1HIAB 2BY9X 4AC9A 1GI6A 3ZIAD 2WV4A 5JPMH 1BA8B 3F0OA 2GV6A 3MH5A 1O34A 2F9OA 1AWHB 1GBCA 4ISIH 1GDNA 1T4VH 1WQVH 4BAKB 5I46H 1ETTH 2PTCE 3R3GB 1GVZA 1PPBH 3E3TA 4ABIA 1PPEE 3SHCH 1D3TB 1BTWA 1GMHF 2Z3CA 3UR9A 2FM2A 1FLEE 1KTTB 1YPHE 2G81E 3QO6A 3UY9A 1GI3A 3ZZAA 3H7OA 1GMHG 4A1XA 1THRH 5J4SA 2AYWA 1VKYA 1V2WT 4I8JA 2PGBB 4INHA 3M5OA 1SI5H 5B6OA 3OTPA 1TPOA 2ZHDA 2VINA 1BTPA 1YGCH 1ARBA 2FTLE 2VBCA 1BRUP 3ZV8A 4AOQA 2IPHA 2L6OA 3V3MA 3BTME 2J97A 1TWXB 3HGNA 3TIUA 1K2I1 3PWCA 4ASHA 3A8AA 1V2TT 4MLFB 4JMYA 2J2UA 2LELA 2FP7B 2ZCLP 4I8GA 1GBJA 2FOFA 2ZHQH 2NU1E 1DOJA 6CHAC 3O8BA 4B1TA 3SUEA 1YLDA 2PV9B 4TWYA 1SGQE 1MH0A 2BQ7B 5CDFE 4FUFA 1CA0C 1CHOF 4O9VA 1DVAH 5DP9A 2O8WA 5CHAB 1FY5A 2W5EA 2GT8A 2ZG0H 1YP9A 3SGQE 1QL9A 3PWBA 1ZMJA 4X0WU 1YPKH 2HPPH 1ZTLA 4U32A 1TRNA 1PYTD 1LMWB 1RRKA 4I8LA 1GMDG 3QDZB 3K9XB 3E16B 1EP6A 1FY4A 2QAAA 4Q4LA 1GJ9B 4CR9A 1HAZB 1J8AA 2BXTH 1QURH 5HMAA 1INCA 1UCYH 1GHBG 1G2MA 1GHZA 2A4GA 3OYPA 1YPMH 1GHAF 3QTOH 1HV7A 4AGJA 1LHEH 1TGCA 1O2MA 3LGWA 3BG4C 2PR3A 3ZZCA 3MQKC 4ZROA 5DP4A 2SGEE 3FP6E 1VGCC 2JDID 3ATKA 3QK1A 2GTBA 1E1QD 1PJPA 2GVFA 4IMZA 1MU8B 3BTKE 3E0PB 2ZCHP 3RMLH 1ANBA 1PQ7A 1QGFA 3E6PH 2FESH 3S69A 1QA0A 2STBE 5EODA 1SGDE 1OP2A 2C93B 2BXUH 2B8OH 1FAXA 2UWPA 3KL6A 1CHGA 1O2QA 1C2JA 1L4DA 1TPSA 8GCHF 2W6ID 1PQ5A 1EUFA 2JH6D 1SFIA 1V2PT 1SLVB 5FX6A
chains in the Genus database with same CATH topology
2PW8H 3L33A 3SJ9A 1AD8H 5AVDA 1F92A 4CHAC 2AGEX 2KAIB 4MTBA 2ANWA 2D26C 1HXEH 1KYNA 1WSSH 3F1SB 1FZZA 3VXFH 2RG3A 1C4Y2 1XKBC 2AFQB 2C8XB 3GDSA 1IQHA 4I33A 1LKAA 1NM6A 3EA8A 2Q6GA 4XE4A 1C9PA 1AGJA 1NO9H 3RU4T 1D3QB 2ZPQA 4D9QA 3QZQA 4FUHA 2BX3A 2ZTYA 4BXSA 1TIOA 2ESTE 3T62A 1GJ5H 1P03A 5EOKA 1KDQB 1SLXB 1AQ7A 3QZRA 2OTVA 4IN1A 3LDXH 2A45B 4OS7A 1BTUA 4B76A 1NU7B 1CO7E 2BOHB 4JZ1A 1C4V2 2F9UA 1O3MA 1BMNH 2XBWA 1QRXA 3A85A 3HK6B 5JB8S 2GZ9A 5E2OA 2AEIH 4DY7B 3LIWA 9LPRA 2O8UA 3MOCA 1FONA 2F83A 4THNH 4LZ1H 2TRMA 1N6XA 3DUXH 4XFQA 3BG4B 5C67A 2WPLS 5AFYH 4LXBH 1O3OA 2HALA 4O3UA 2ZFQH 1GI2A 2A4OA 1A4WH 1K1LA 1MTNB 4JCNA 1UTPA 2Z9IA 2VB0A 2FOBA 5C1YA 1NFUA 3MU1A 3URCA 1SGNE 3MTYA 2TPIZ 1ZHRA 1SGFG 1SGCA 3I77A 3LH1A 2BD3A 4XBBA 1C1VH 4K1TA 4CBNA 1GHVH 1Z8JB 4ISHH 1ZGIA 3PTNA 1P06A 1CT0E 3C27B 1ZRBA 4GSOA 3PV4A 2NU2E 1NRQH 1VJ9U 1F0TA 2A31A 4LZ4B 1EAIA 1EB1H 1C1WH 3M36A 4ZHMU 2WPMS 1P3EA 1RS0A 3F68H 3F9HA 1ZZZA 4CH8B 1M9UA 3LOXA 1LHFH 1SR5C 2VVVA 2OC1A 1C2DA 8GCHG 1EQ9A 2C3SA 1SQAA 4KTSA 1HPGA 3RXPA 1WBGB 3MYWA 3UIRA 1EZXC 1RTLA 4H6TA 1C1MA 4KTUA 1HJAB 4A92A 1IQKA 1BMMH 3DFLA 1QFKH 3VB6A 4FU9A 1HAIH 4FUJA 1YPEH 2ZP0H 1LQEA 1YCPH 2F9VA 1OWIA 3ZZ3A 3TGKE 1ZRKA 3SU5A 3TJOA 1Q31A 4FUIA 4D7FA 1A5IA 2BM2A 2FIRH 4ABEA 1LVOA 3QN7A 1SC8U 1W13U 3R0FA 3SUDA 1C5TA 1K1MA 4MPWA 5C1XA 3Q3YA 2G5VA 4KKDA 2Y81A 3I78A 2BLVA 4BNRA 1WAYB 1LVYA 1K1PA 5FBIA 3VEQB 5HXFA 3T29A 2XC5A 1G9IE 1WQSA 1S6FA 1G30B 1EJMA 4NSVA 2UUFB 2Z9GA 1T8MA 4H42U 2VIPA 1OWHA 1VCPA 4YESB 4KGAA 3TPIZ 4CHAB 4MG3A 4WJG2 3BSQA 1A46H 1AFEH 1RD3B 4NSYA 2BY8X 1C4U2 2FX6A 3A7VA 3SU1A 3SGBE 3EA9A 1HNEE 1E35B 1QCPA 2R2MB 1NZQH 1ZHPA 3SJKA 1S83A 2ZEBA 2JH0D 3VB5A 1G36A 3T28A 1A1RA 3E0NB 2GCHG 1CGHA 1C2EA 1O2PA 1C2FA 2ZI2H 1T8LA 4JZEH 3SNAA 4Z6AH 1KY9A 3M3SA 2FOCA 1DITH 4F49A 4BTTB 1JRTA 1K9OE 1SLWB 3UQVA 1CSOE 1S0QA 3RXDA 1A3BH 1ELDE 1W14U 4NIWA 1UMAH 1QR3E 5K0HA 5HGGA 1W7GH 1EB2A 5EPNA 5FPYA 3U1JB 2R9PA 3E90B 1Z71A 2PTNA 1ZTKA 3KGPA 6ESTA 1F0RA 1EP5A 3SI3H 2BLWA 1O3NA 1PPGE 2ZFRH 1XVOA 1XMNB 1QQUA 2EEKA 4X1QU 1ESAA 1GJDB 1O35A 2V3HH 2ZGCA 5GIBA 2BD8A 5EXNA 1ACBE 4AFQA 3PMJA 4OS1A 3ATMA 1IQEA 1Y5UT 2PGQB 3MNBA 2SGPE 1UTNA 5ETXA 2B5TB 2Z9JA 4VGCB 1P3CA 3M3TA 3P17H 3LJJA 4NGAH 1CGIE 1O5FH 2G52A 1DPOA 1S6HA 1AKSB 1Z1JA 2BB4A 1DX5M 1QRZA 1ORFA 4ISLA 4MPUA 1DSUA 4JZIA 1OP0A 2ZPSA 2XC0A 2GDDA 1QL7A 1J15A 3LGVA 4K8YA 4J2YB 5T6GA 3ZV9A 2AGIX 1ZJDA 1EZQA 4FUBA 1F5RA 1MQ6A 1Y3UA 1Y3WA 4NFEA 3RXBA 1SL3A 3GOVB 5GCHG 1W7XH 3LH3A 4ZXYH 3SU6A 2QN5T 3SUFA 1HGTH 1GBLA 4E7NA 1O2OA 1J16A 2GZ7A 2H5DA 3BTTE 4Y7AA 3A89A 3SNCA 2I6SA 1O5AB 4B75A 3RXUA 2FOMB 4NA8A 2XCNA 3IWMA 3TU7H 3SU4A 2ZDKA 3UQOA 4CRAA 2GKVE 1U6QA 1NESE 1LDTT 4Y6DA 2FOEA 3UWIA 1ARCA 5FHTA 1DXWA 1DANH 3ESTA 1TNIA 4ABAA 1E34B 4U2WA 1A2CH 3PYHA 1C5YB 4IN2A 5H4IB 3VGCC 1YM0A 1O3JA 2NWNA 3D23A 1HUTH 1YYY1 1OWKA 4B2BA 5A09A 2NU4E 1BBRH 1LVMA 4AGKA 1LHGH 1LPKB 2ZHWH 2AERH 3LGUA 1DUAA 2O8LA 2OC7A 1WTGH 1VITG 2A5AA 1WTHD 1G32B 3RXOA 1BT7A 4R0IA 1CBWC 1UVSH 3OTJE 4DG4A 1TQ7B 4I32A 1O2SA 1OX1A 2QC2A 3BTFE 4K3JA 2ZFFH 4K8BA 1O3GA 3EAJA 3JZ2B 4DIIH 1EPTC 4AORA 1K1NA 1SPJA 2HPQH 3RXHA 4NZQA 1MTNC 4YOIA 4Y0YE 1V2VT 5GWZA 1RXPA 5A0AE 1GPZA 5DKMA 1A7SA 3MNCA 1HAYB 3P95A 1P9UA 3M35A 2B7DH 1A0JA 3TNTA 1P57B 4NIXA 1MKWH 4B2AA 4ISOA 4WXVA 2Y5HA 2OQUA 2BY6X 2FO9A 2BVRH 3PTBA 5AHGH 2J9NA 3GICB 2Q6FA 2Z3DA 1F0SA 3A82A 4MPVA 1IAUA 3OSYA 3RUOA 2AMDA 3ZVAA 4OS5A 3QLPH 3MFJA 1O5EH 3NWUA 3A8BA 3Q00A 1XVMA 1CA8B 4X2WA 2ZC9H 2WUCA 1O2GH 4BOHA 2VH6A 5EW2H 1SHYA 2VH0A 4HGCA 2ZPRA 1VZQH 3TGIE 3PLBA 5JB9S 1TLDA 1LPGB 3M5NA 1J9CH 1HYLA 4ABHA 2P16A 3B23B 3UTUH 1SQTA 1TMBH 1JMOH 2FI4E 3G01A 3UFAA 1JOUB 2PKAA 1GI7B 1GCTC 3Q3KA 3RXFA 1NRPH 2CXVA 4ABFA 5ABWA 1Y3XA 4NA9H 3DD2H 3MU5A 3FVFB 2F9PA 4K1EA 4X1NU 1NFYA 1TGTA 1P9SA 3K6ZA 2QXHA 3GDUA 4TY7A 1D4PB 3BTDE 1BTHH 3PMHB 1MBQA 2FZZA 1ZMNA 2FPZA 1UK3A 5LGOA 2QF3A 4CRCA 5K7RA 1T4UH 3FAOA 1H4WA 3F9GA 2STAE 2BDBA 1D9IA 1FPHH 4WH8A 1FV9A 1MBMA 1K28D 3F6UH 4YM9A 5AFZH 3SV2H 1LHCH 1XX9A 3VB4A 2KAIA 1VCQA 3KEEA 2PHBA 4WXIA 4OS2A 1AWFH 2FLBH 3M7QA 1V2KT 3SV7A 3AVZA 1LTOA 5TJXA 1B7XB 1EZUC 3UOUA 1QA7A 1KSNA 4X6PA 1NROH 2V3OH 1BB0B 1RJXB 3SNDA 2FLRH 3U8RH 1E36B 2RA0A 4JZDH 1YKTA 2FMJA 2UWLA 1FY3A 3OY6U 1F2SE 1O38A 2QXIA 2ZFSA 4X6NA 1AU8A 4X6MA 2ODYB 3EYDA 3AW0A 3BTEE 2NU3E 3I29A 4ABJA 1CT4E 3V13A 1HAVB 1C1QA 5C3NA 2VGCB 1AHTH 2BLOA 2ZQ1A 2BD2A 4WMFA 3JZ1B 3PMAB 8KME2 5EU8A 1AVXA 1HLTH 1YPGH 1TMTH 4IBLH 1C5VA 4AFZA 1CT2E 3SNEA 5L6NH 2Z7FE 1SGPE 1H1BA 4INLA 3HKJB 4ABGA 1G3EA 1C1SA 1HAVA 3MO9A 3D65E 1IHSH 1D6RA 5AF9H 4GHTA 1A3EH 1KXFA 1UTOA 2HVXA 2XBXA 2GD4B 1TBQH 2UWOA 3SZNA 2G51A 2ZDAH 3S9BA 1AVWA 2A7CA 1O3CA 2Z9KA 3RXQA 3KCGH 3RP2A 1GBKA 3CENA 4JK6A 4U30A 2QXJA 1ELTA 1C1OA 1GJ7B 2F91A 1LKBA 1JWTA 1TYNA 2W26A 1O3HA 1C5OH 2J92A 3ZZ7A 4E06H 1P2KA 4ZKSU 2HOBA 1O2XA 1E37B 1PQ8A 5C2ZA 1V6DA 5C5NA 1AO5A 1EPTB 1MD7A 5JBCS 1GHAG 3GCOA 1ELEE 1GJAB 2ALPA 4B73A 1VITF 1GBAA 3P92A 3GY4A 1HAXB 1XUFA 1THPB 1GL0E 1NS3A 3ZZDA 2A7JA 5T3HA 1W12U 1HJ9A 2ANKH 1N8OC 1GG6B 1XXFA 1FDPA 1DSTA 3KQDA 1JIMA 3SOSA 2FI5E 3P8FA 4X6OA 2W3KA 1HIAA 2WYJA 1Z8RA 2VGCC 1E0FD 4ABDA 1O2VA 1P11E 4D7GA 3BTHE 1UTQA 1DWEH 2H9EH 2W7UA 4YLQH 3Q76A 2FODA 1FAKH 1W2KH 1HXFH 1NTPA 2Q1JA 4Q2KA 5EQRA 1O0DH 1P02A 3GCHB 3KIDU 4ZKRU 4FVDA 4A6LA 3QX5H 1EOLA 4YT7H 2ANYA 1GI0A 2XWAA 2FYQA 1XM1A 3TJNA 6GCHF 3ELAH 1TGSZ 1VITH 5G4BA 1EX3A 3GY8A 1A0LA 4Q7YA 1EAWA 2OC8A 1QJ1B 5DP7A 1YF4A 3LPRA 4AB8A 4Z0KA 3LC5A 1GGDC 5LPEA 3M5MA 3VB7A 1EAXA 4ZKNU 1TGNA 1EJNA 2GMTB 1C1TA 1TABE 3L6PA 1S84A 3RXEA 2XTTB 4NIYA 3T2NA 2AMPA 4YZUA 3S9AA 1L4ZA 3BIUH 3T25A 1CGJE 3A7YA 1UTMA 1MCVA 1O2LA 1C1UH 4B2CA 3O8RA 1KXAA 1S85A 1O5CB 3SHAH 2P95A 3O8DA 3ENSB 4GCHF 1G2LA 1KTSB 4UONA 5A8XA 1XUIA 1MAXA 1C5LH 1V2OT 4UFGH 3IG6B 4ESTE 1O31A 1CA0B 5FPSA 4YO9A 1SGFA 3GCNA 2CHAB 3K65B 4BANB 3EGKH 1TGBA 3KQEA 3W95A 1HB0B 5DP6A 3S7KB 1C1RA 4CBOA 4WVPE 4AFSA 2FX4A 1ABJH 2OINA 1OWJA 4X2VA 1YC0A 2ZU4A 1GL1A 1BHXF 3ITIA 3MWIU 4A1TA 5BPEA 1AB9C 1P8VC 1ZPZA 3L3TA 4Y8YA 1W10U 3AAVA 3TNSA 2Y5FA 1TAWA 1BTXA 1NRSH 4K5ZA 2B9LA 5F6MA 1C2LA 4GAWA 2VWLA 1O2ZA 1NY22 3RM0H 2I6QA 7ESTE 1FI8A 1CQQA 3S9CA 3MH6A 1BBRK 1P04A 3VB3A 3A8DA 1Z8GA 2R3YA 4Y10E 1OWDA 3QUMP 1PQAA 5FPTA 4Y8ZA 5EGMA 1GBEA 2BQ6B 1MTVA 5HM9A 4TWWA 2O8TA 2EI7A 1FNIA 1MCTA 3RXVA 2CGAA 4MPXA 2V6NA 3BG8A 3RXAA 1C1NA 1ZTJA 1NC6A 2ILNA 1RGQA 4RSPA 1EATA 2P8OC 4ZH8A 2PUXB 1TONA 2J94A 3BIVH 1FJSA 4O03A 3PLPA 1GHYH 4Y79A 1ETSH 1O2NA 1A5GH 4Y71A 1GI9B 1QL8A 1GBHA 2BHGA 2W7SA 2H6MA 1X7AC 5JBTA 1GWAA 5IYTA 1P10A 1B0FA 1GJ4H 2CHAC 1MQ5A 1KLJH 3RMNH 3GY7A 1O39A 5A8ZA 1TBRH 5JDUB 2BY7X 3SJ8A 4UD9H 1LO6A 1WV7H 4MNYA 2ZU2A 3RXLA 1GCDA 1HAPH 1YPLH 1ZSLA 2A5IA 2WYGA 3GYMA 3LGIA 2ZGHA 4DT7B 4Y11E 1EJAA 1NT1A 3MU0A 1Z7KA 1GI5A 1KDQA 4UFFH 3RXSA 3RXMA 7LPRA 1C5WB 1GI1A 2JKHA 1IQMA 4Y76A 3ZVCA 1XUGA 1BMAA 1GJCB 1TOMH 2F9NA 1CE5A 1VCWA 3KF2A 3SBKA 2G55A 2J34A 3VPKA 3ODDA 4XSKU 1MKXH 1UVPA 2H9TH 3KQBA 2QV1A 1XUJA 5GCHF 3D49H 1NFWA 4IC5A 4JK5A 3SQHE 3OY5U 4CH2B 2OBOA 4ZKOU 1MU6B 1O3PB 1GJBB 2PWXA 1AI8H 1TMUH 1H9HE 1LPZB 1ELVA 5GJ4B 1ELFA 2FI3E 1GI4A 3U98H 3H7TA 5E8EH 1ZYOA 4HFPB 1DM4B 1GMCG 4WMDA 5DJ7A 1IQJA 1O3DA 1OP8A 3B9FH 2FTMA 4MDSA 1Y5BT 3O8CA 5DP3A 1TFXA 2VIQA 3RM2H 3RC6A 3VXEH 2PUQH 5F8TA 2ODQA 5ESTE 2ZZUH 2QYIA 2Y7ZA 2R0LA 1V2LT 2ZDLA 2C8WB 2ZA5A 1ETRH 3MHWU 2CN0H 5F8XA 2SGDE 4GPGA 5A2MH 1TNHA 1TALA 1ZOMA 2JH5D 1MKWK 3LT3A 3VFEA 5SGAE 4X1PU 2ZGXH 1RTKA 3MU8A 3QGNB 2P8OB 2QIQA 3A86A 2ZGBH 4SGBE 1DY8A 2D2DA 1T8OA 1QNJA 1SOZA 1O30A 1ZLRA 1THSH 3RC5A 4WF8A 1JIRA 1UVOA 1VGCB 1AZZA 3QWCH 1JRSA 4AZ2B 4YT6H 2SGQE 1KLTA 5DGJA 2FYRA 1QY6A 1GMDF 3BEUA 1H8IH 1IQLA 2BLQA 4DW2U 5FXLA 1SB1H 1MKXK 4ZMAH 2DE8A 3F9FA 3P6ZB 1OKXA 3HATH 1ZPBA 2VIOA 3A7XA 4KP0A 1QTFA 2P94A 4B71A 1NPMA 5C5OA 3MO6A 5DK1A 1ZR0A 1N8OB 1P2QA 2TGTA 3ZZ6A 3SJOA 1CVWH 1TB6H