3PYHA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pyhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pyhA02
4ZXYH 1SR5C 6GCHG 2ZFQH 1DY9A 5AHGH 3A82A 3GICB 1WQSA 5EOKA 2PUQH 1A0JA 1GVZA 1TQ0B 2H5DA 5DGJA 2G4UA 1A0HB 1ZGVA 3ZV8A 3RP2A 4AG1A 4YT7H 3A86A 1BRCE 3D49H 2BDAA 3QZQA 3K9XB 1C1UH 1SOTA 2BY6X 4JCNA 3Q77A 1UK4A 3MO9A 4PROA 1GJ7B 1O30A 1O31A 1W14U 3E8LA 5DP9A 1P57B 1T4UH 1G3DA 1GMHG 3PM3A 4NZLA 1UCYH 1INCA 1O0DH 1YYY1 2OQ5A 1RFNA 3R0FA 5C5NA 1RTFB 2BX4A 2P3UB 1B0FA 1S0QA 2SNWA 1KXEA 1TNJA 1G2LA 4X1SU 3LJOA 2RA3A 1G9IE 4ZKSU 2PKSC 4BNRA 1ELFA 3RM2H 4Q7YA 2BOHB 2ZGHA 2C8WB 3E0NB 1F2SE 2FESH 2BY5X 2WPIS 1HJ8A 1TGCA 2HRVA 3RXGA 4AYVB 5JPMH 4CHAC 3ZZCA 1SOZA 4MPWA 1G3CA 2Z6BD 1TIOA 3TNTA 2BD2A 1NU7B 1C1VH 1QA0A 5L2YH 1PPBH 2OXSA 4R8TB 1RD3B 2B7DH 1C5MD 1L1GA 2B8OH 2ZZUH 4Z6AH 1DX5M 3DD2H 2R9PA 2UUYA 4O97A 1TGTA 2A45B 1V3XA 1O5CB 3UNSA 1JRTA 4M7GA 1V2MT 1FONA 3QUMP 4WY3A 1F0TA 4X1NU 1TX6A 1C5RA 3SORA 4Q7XA 1TGSZ 3SU5A 3M37A 1S0RA 1FDPA 1MQ5A 1SG8B 4XE4A 2H1UA 2R2MB 1EJAA 1ANEA 1VJ9U 5CE1A 5AF9H 2H9TH 3ATKA 3SU3A 4IMQA 3BEUA 5T3HA 1O2XA 1VCPA 4A1TA 4H4FA 4D7FA 4U30A 1QA7A 1ELCA 3UPEA 1C5SA 1NESE 2FOFA 4ISLA 2JETC 1D3TB 2TPIZ 5GWZA 1ELTA 2QF3A 3E16B 4MNVA 3TH3H 2VWOA 4WXVA 9ESTA 1S85A 1RRKA 1W10U 3HGPA 1EUFA 3B8JA 5LPRA 1CHOG 3BTGE 4D8NA 1LQEA 1TALA 2GMTC 2LNCA 4ZXXH 1SSXA 1P03A 2HNTE 1L2EA 4X6MA 2FLRH 1GJBB 1GJ9B 2R0LA 2A32A 3GYLB 3RXLA 4ISNA 4BTIB 1GJ5H 4B2AA 2ZU4A 2ZU5A 1J8AA 3U1JB 4UFDH 3RLYH 2HPPH 3MH6A 1H9HE 1UTNA 1HAYB 3FZDA 4IC5A 3RUOA 3ZZAA 1QB9A 1EAUA 4AFUA 2VNTA 1HV7A 1C5NH 1JIMA 1P3CA 2GCTC 1BA8B 1GPZA 4O3TA 2R0KA 3MYWA 4VGCB 2QF0A 3SU6A 1MKXH 1A0LA 1L4ZA 1WYKA 1ZSKA 1SLWB 2IJOB 2VB0A 3SGBE 2BVXH 3SU0A 1Y5UT 1ELEE 1AN1E 5JBCS 4Q2KA 3TJUA 3VB6A 3BTKE 4IN2A 4DGJA 1YBWA 1C4U2 2CGAA 3SV6A 3EGKH 1UCYE 3SZNA 1THSH 1XVMA 2P94A 3KNXA 2UWPA 1BCUH 3P70B 1LVBA 1KY9A 2FOGA 2VINA 1C2MA 3UIRA 3Q3YA 2CHAB 3BSQA 5JB9S 3CS7A 1AQ7A 1MKXK 2JETB 1DPOA 3R3GB 1HAPH 4A7IB 4RKJB 1OWEA 3NUMA 3MFJA 4Y79A 1ID5H 2GMTB 4X6PA 1SPJA 1TFXA 2FTMA 2BQWB 5GIBA 3RXDA 1P9SA 3EA8A 2K1QA 4CRFA 4I8KA 3PMHB 1EZXC 1LHFH 1H8IH 2G4TA 2FP7B 2VIQA 5DP6A 2NU0E 5E2OA 1G32B 2ZFSA 3SHCH 3LONA 2QA9E 1E35B 1GBJA 1V2RT 4I32A 3VB7A 1E38B 4YM9A 2VWMA 3HATH 1C1QA 1ELAA 3ZZBA 1O2OA 2M5TA 4ZKNU 4BTUB 3SUDA 1BJUA 4JYTA 2OC7A 3F68H 3PO1C 4X8UH 1NRRH 3TU7H 4LZ1H 1O2VA 1P10A 2F9UA 2FOMB 3BTWE 1TMUH 1C5PA 2OBQA 1GI0A 1BOQA 1NY22 3GY4A 3M7QA 2SGQE 5ABWA 2NU3E 5JBTA 2GT8A 1QL9A 2QCYA 1IQLA 2BVRH 3MH4A 3UNQA 4DW2U 3B23B 1YLCA 2BB4A 3A7TA 1NT1A 4CHAB 3MHWU 3KCGH 4YZUA 1OSSA 2UWOA 3ATWA 1IQEA 1O3LA 1LKAA 2AMDA 3E90B 2QV1A 3RXEA 1O2KA 2BLWA 3ZZ5A 1QL7A 1P01A 1CA0B 1MTNC 5HGGA 1C1WH 3ODDA 5EW2H 1LVYA 1QHRB 2UUFB 1FZZA 1LDTT 5A8XA 2QXJA 1LPGB 2LPRA 1DE7H 3M3SA 3MH7A 1BTHH 4ZKOU 3QGJA 5C5OA 2ZNKH 1GDQA 1K22H 4B74A 3SJOA 5BPEA 1FQ3A 4BAKB 2BXTH 1C5YB 5FAHA 1EQ9A 1PPCE 3TGIE 1GMDG 1AGJA 3W95A 3BG4C 1IQJA 4I8GA 2JH6D 2WYGA 3PTNA 3E91A 5EPNA 1D3DB 3PTBA 3TJNA 1GI6A 2JKHA 4FUFA 3M5OA 2A5AA 2FX6A 3RMNH 1GCTC 5EXLA 2BD3A 3ZYEA 2OD3B 5C1XA 4X2WA 1LHDH 5T6DA 2KAIA 3BIVH 1E36B 1YGCH 5FCRA 2R3YA 3PYHA 4KKDA 1UVSH 4KELA 1SI5H 2H6MA 1OP8A 2J9NA 1XKAC 4B2CA 3UWJH 1DANH 3PLPA 5EQQA 3ENSB 3RXUA 2FMJA 3KN2A 3RXHA 1GBKA 3QGNB 3A8BA 1V2NT 1OWKA 1YPKH 4FU7A 3RXVA 3TK6A 1Y3YA 1SGNE 4BTTB 6CHAB 1THRH 2TGPZ 1AIXH 1UTPA 1HYLA 2PTNA 4U01A 4NFEA 1IQMA 3MTYA 1O3GA 2ZQ2A 3UQVA 4CREA 1TNIA 4GHQA 2BX3A 1XMNB 1SGIB 1UHBB 3HK6B 2VGCC 3PB1E 1K1JA 4XFQA 3BEFB 1UO6A 5HYOA 1A3BH 4I8LA 4CRAA 4AYYB 2FDAA 5A8ZA 2V0BA 1MZDA 1TGBA 2VIDA 1GBEA 2W7UA 3HPTB 3E6PH 1GBLA 4KTUA 1MBQA 3GCOA 3A84A 3STJA 1TABE 3TK9A 3MNCA 2GKVE 1AO5A 1UTJA 2OCVB 2PHBA 3SQHE 2VGCB 1W0YH 2AS9A 4KGAA 5GJ4B 2GX4A 3A8AA 3AAVA 3P8GA 4XBBA 1BBRE 1GJ6A 2W7SA 4BOHA 2BDHA 1O2WA 2ZHQH 5AFYH 3A80A 1S6FA 1UHBA 4ZAEA 1BB0B 3O8RA 3RXQA 2ZC9H 2ZGCA 1TPSA 2ZHEH 1AD8H 1O3IA 2V3HH 3GY3A 1BMAA 1O3PB 1QNJA 3A7VA 1T31A 2G00A 2GV6A 1FUJA 1P0SH 2Z3EA 1BDAA 5A09A 3RM0H 1NM6A 1W8BH 2ZU1A 2CF9H 2OP9A 5GCHF 5DP3A 4ISIH 1AMHA 1S5SA 1C2JA 5SGAE 2ZKSA 4GPGA 1GVKB 4JYUH 1PPHE 1PPZA 4YO9A 4IC6A 4K3JA 1SLUB 3U98H 1FMGA 1FJSA 5ESBA 1BRAA 4GHTA 2FPZA 1MTUA 9LPRA 2FI5E 3P95A 3S69A 1BT7A 1NRPH 3UY9A 1IQIA 1WTHD 4Y76A 2GCTB 1LMWB 2Q6FA 1UJ1A 2FOBA 8LPRA 1C5WB 1KIGH 4RKOB 4HI3A 2Z3DA 3F6UH 4ZROA 4LK4A 1SQAA 2WINI 1T8LA 4X2VA 3SI4H 3M7TA 2FODA 3MH5A 1BQYA 3VXFH 1V2VT 1KTSB 1RIWC 3MU5A 2CF8H 3SV8A 2ZGJA 1LTOA 3UOPA 3RXTA 1CSOE 3SN8A 4ABAA 2EA3A 1TPAE 2J95A 2BOKA 1ESTA 2PGQB 2THFB 2ALPA 3S9CA 3ZVDA 5CHAB 3KQEA 3SQEE 1FN6A 1TBZH 1WQVH 1SGFA 3FANA 1L0ZA 1YPHC 1OX1A 2HVXA 1AZZA 4D7GA 3PMBB 1HUTH 2GDDA 1BTPA 1NPMA 4Y8YA 2V3OH 2OLGA 1JMOH 1EX3A 1FN8A 1QBVH 3DHKH 1ZTJA 2Y82A 1GHVH 3ZVAA 4CH2B 1IQFA 4O3UA 4XBDA 4JZDH 1L1JA 1TBRH 4ISHH 1AU8A 3VFEA 2PKSB 5FPSA 2XWAA 3TJVA 5EPYA 3QDZB 1MTSA 1DSTA 2ANWA 4UE7H 3EAJA 1C5XB 3RU4T 1GHYH 1IQKA 2W3KA 3M5MA 4GVUA 1Y59T 3T25A 1GI1A 1TOCB 3O8BA 5F8TA 4FU8A 3RXAA 3P17H 1PQ8A 2ANYA 3GCTF 1YM0A 3ESTA 4X6OA 1O3FA 4AFSA 4FVDA 2YOLA 1HAZB 5LPEA 2F9BH 2ZF0H 4NWLA 2VJ1A 2PTCE 4DCDA 1KXAA 5A8YA 1XKBC 3S7HB 1TA6A 2QXIA 3RXRA 1CU1A 1DDJA 1CT4E 1Q3XA 3BEIB 1S81A 4O03A 2STAE 3UWIA 2Z9GA 2AIQA 5T6GA 1O3BA 4K1SA 2ZDNA 1ARCA 3PMAB 3M5NA 2C3SA 1AFEH 4X2YA 1IHSH 2XXLA 1O3CA 1O2PA 2ZU3A 1OKXA 1WOFA 2G81E 1GG6C 3OU0A 1PQ5A 1V2KT 2BD5A 2W5EA 1O2NA 5B6OA 1AUTC 1TQ7B 1TRMA 4BAHB 1B7XB 2EI7A 2P59A 4IMZA 4CBOA 2A5KA 4KP0A 1EATA 2XBWA 3RC6A 1HJ9A 3U9AH 2HNTC 3O8DA 2Y7XA 2SGFE 1P2QA 2PKAB 3HGNA 1P05A 4BXSA 4OGYA 3TH2H 4ASHA 1SGPE 4Y7AA 5BRRE 1W0ZU 1FY8E 2W3IA 1VITH 1Y5AT 2ANMH 2Z3CA 3KQBA 7GCHG 1U6QA 1ZHMA 1QFKH 3ZV9A 1TE0A 3GCTG 2Q1JA 2ZHWH 2F91A 3EDXB 1O2LA 1T8OA 3IWMA 3EYDA 1O3EA 5E0JA 4NIWA 3MO6A 1KXCA 5DG6A 1GBDA 1E37B 1O2TA 4BANB 3KHVA 4UEHH 2BHGA 2RDLA 1YPJH 1C2LA 3RLWH 1O39A 1CA8B 1W11U 3LGUA 1EPTA 3PO1B 3E1XB 3I78A 1SGEE 2P8OC 5F6MA 1AUJA 1C5OH 3LC3A 3RXFA 1DVAH 1GHBF 1K1IA 2FOAA 4X6NA 2PSYA 1A5GH 3LU9B 1Q31A 1KXBA 2FTLE 1C2HA 5FBEA 3I77A 3GDUA 1Z1JA 3LOXA 3AASA 1FY3A 2A5IA 3MMGA 1XUJA 3VGCC 1MD7A 3GY5A 3U69H 2BXUH 1TRNA 1UVUH 2D8WA 3B9FH 2FI4E 5EXNA 4WH8A 1H9IE 3E0PB 4ZUHA 4RN6A 1GG6B 1RIWB 3EA7A 1RXPA 5EQSA 1UCYK 1ZSJA 1HPGA 2BTCE 1J15A 3M7UA 3QK1A 4MG3A 1THPB 2PSXA 1XUKA 1DWDH 1YPGH 1J14A 1A5HA 1D9IA 4IGDA 4X0WU 3VB4A 1EOLA 5GDSH 1GCDA 3NKKA 4MNWA 1DLEA 1ELVA 1EOJA 1AKSB 2ZFRH 1ZSLA 1AY6H 3D62A 3IITA 1ZMLA 2RCEA 3F9HA 4K5ZA 3ZZ7A 1ZTLA 2ZDAH 4F4OC 1MAYA 3MU8A 3M5LA 4NIXA 4THNH 1TMTH 2XBVA 3TGKE 4TPYA 3ZYDA 4UFFH 4YT6H 3T29A 3ZVGA 1IAUA 8GCHF 5CHAC 3DFLA 2WPMS 3F9EA 7LPRA 1LO6A 5JBBS 3VXEH 4CH8B 1UMAH 1O3OA 2GCHG 4CBNA 4K60A 1YCPH 1ABJH 1O36A 2A4GA 3RDZA 1T8NA 2VVVA 3S9BA 1BIOA 3ATLA 5GCHG 1AVXA 4OS7A 1MQ6A 5EU8A 3BV9B 1O5FH 2H2ZA 2P3TB 3FFGA 2OC1A 1O2RA 1N8OB 1XX9A 1RJXB 1QB6A 2B0FA 4TY6A 1BJVA 1TMBH 2C93B 1SVPA 1ZGIA 1Z8IB 1Z8JB 3ZZ3A 2A2XH 3LJJA 1GMCF 1O3MA 4ESTE 5H4IB 2AMPA 2IPHA 1NZQH 3NPSA 1GI9B 1V2OT 3UFAA 2XTTB 4I8HA 2OUAA 3O8CA 1ZR0A 4ABHA 4A92A 2BZ6H 4UFGH 4BXWA 2WPKS 2P3FH 1WU1A 2ILNA 2BY7X 1EKBB 2WUBA 1RTLA 2C4FH 1KLTA 3KGPA 2V35A 4DIHH 2WV5A 3TITA 1O34A 3AW1A 1NO9H 3TGJE 1JBUH 7ESTE 2BDCA 1TX8A 5C3NA 1VITF 3KIDU 3NCLA 2NU1E 3FZZA 3VB3A 2A7HA 1XUGA 1NFWA 3GY7A 1O35A 1MU8B 5FPTA 3TJOA 2ALVA 1G37A 2GCHF 1EJNA 2J94A 1DWBH 5EQRA 2H9EH 1BHXB 2TBSA 3BTME 1SFIA 3F1SB 3FP6E 2WYJA 4NIVA 2G55A 2ZO3H 1ZPZA 4Y11E 1RGQA 5TJXA 4K8BA 3MU4A 1TGNA 2G8TA 2PLXA 1GL1A 1EP6A 1P12E 4OS1A 3TNSA 3V0XA 3N7OA 3DFJA 2OQUA 3ATMA 3PMJA 3SNBA 1BMNH 4TWWA 1X7AC 1JOUB 4YLQH 2P93A 2NU2E 4U32A 4X2XA 1MU6B 1TWXB 1Z6JH 2ZA5A 1BRBE 4INHA 1AB9C 1MBMA 1UK2A 5DPAA 1P11E 1OPHB 1VZQH 1DITH 1GJDB 1QR3E 3SNEA 3V12A 2QGRA 4XDEA 1ARBA 5EW1H 2AH4X 6GCHF 2BQ6B 1Z8RA 4YTAA 3T62A 2P16A 3BTQE 3MOCA 1C2IA 1P06A 1O5EH 1EZUC 1BTZA 4NCYA 2ZCKP 3T27A 2C90B 2SNVA 1BRUP 2WV4A 1NROH 1AB9B 1HCGA 3GCNA 1P8VC 3SNCA 3LGVA 4UFEH 1ETTH 4X1PU 1OS8A 1DXPA 2F9VA 4TPIZ 3V7TA 3P8FA 1AE8H 3A85A 2GGVB 4WH6A 3BIUH 5C2ZA 3SUGA 2BVSH 4TY7A 1TB6H 1Y3WA 1F0SA 1CVWH 1CT2E 2BLQA 1O38A 1CBWB 2PWXA 1HLTH 2VVUA 2GZ9A 1C5TA 1S84A 1DUAA 4OS4A 2XBXA 1PPEE 3F9FA 1HB0B 4ABJA 3S7KB 2ZECA 1K21H 3K2UA 1N1LA 2ZDLA 1OOKB 2A7CA 2QN5T 3DUXH 4ZHMU 3UREA 3ODFA 2HPQH 2GP9B 1WTGH 1SQTA 1ZMNA 3JZ2B 1NS3A 1GWAA 1O3DA 2C8ZB 3L6PA 3LIWA 1H4WA 2I6SA 3SV2H 1CGHA 3EE0B 3MNSA 1O2JA 1ESAA 2O8MA 3H7TA 4OS6A 3ZVCA 5A0CA 1OXGA 1T8MA 3MO3A 3C27B 5EG4A 4K1EA 4AB9A 3SNAA 4BAMB 3HKIB 3URDA 5DP7A 4GUXA 1C4V2 4WMEA 1J17T 2VWNA 2ZDVH 4B75A 1V6DA 3RU4D 2FWWA 1SGYE 4ZMAH 1C1NA 2PGBB 4AN7A 4FUHA 3RC4A 2F3CE 2ZPQA 3TLOA 1O5GH 3PROA 1BHXF 5LPFA 1EAXA 3ZZ4A 1OWJA 1ZMJA 2CXVA 1F0UA 2XWBI 4DG4A 1KYNA 4AG2A 2J2UA 4DURA 2ZU2A 3ZZ9A 3RMOH 1BUIA 5L6NH 1BTYA 2ZEBA 4CRGA 3PV4A 1EPTB 3PLBA 1FPHH 4MNXA 1XUHA 4X8TH 2ZFPH 3DA9B 1KXFA 1NN6A 1HAOH 8GCHG 2QXHA 1EJMA 2H5CA 2IN2A 4JK6A 2AERH 2XCFA 4Y8ZA 1FI8A 1QGFA 1YP9A 1C5ZB 1ORFA 3A81A 4WXIA 4IS5A 1LHCH 3V13A 1YCPM 3STIA 1EAWA 1TPPA 4NWKA 1NRNH 4JZEH 1GI7B 1GBCA 3RXCA 4I31A 4A1VA 2QC2A 5DP4A 1UVTH 2DUCA 5FX6A 1SGRE 2QIQA 5FXLA 1GI2A 1FAKH 1G3BA 1J16A 1GI4A 5I46H 1C4Y2 5EXMA 3M36A 4TWYA 2XRCA 2A4QA 2BY9X 2SGEE 3NXPA 1AZ8A 2Z94A 3AW0A 2FM2A 3GOVB 1Z1IA 1BTWA 1ZOMA 3RXIA 3OTJE 1HAVA 2BYAX 4E05H 4AFZA 1HFDA 1GI8B 2ZPSA 1O2IA 1UTOA 5K0HA 1GVLA 3EA9A 1GHBG 2ODYB 2Y7ZA 1FLEE 1HAHH 1MD8A 3OSYA 4FVBA 4OGXA 1P2MA 3FP7E 4FUDA 1YKTA 1NFUA 4B1TA 2TIOA 1IQGA 5GXPA 4I33A 4HZHA 3T28A 1KXDA 2B9LA 5A2MH 4NGAH 1TYNA 1SFQB 6CHAC 2Q6GA 3L33A 1XUFA 1KLIH 1P09A 1UTQA 2GVFA 2W26A 2ZTYA 2FIRH 4ABFA 1IQNA 4DJZB 1YC0A 4XSKU 1CBWC 2Y5GA 7GCHF 4NSYA 1NRSH 4NFFA 2FS8A 1OP2A 1KDQA 1C2EA 3C1KA 3GY6A 4U2WA 4MPVA 5IDKA 2BD4A 4DOQA 4O9VA 2P8OB 1AVGH 2ZGBH 4MPUA 2ZG0H 4JZFH 2Y80A 4OS5A 1SGDE 2EI8A 4WF8A 3RXBA 1K1OA 2G5NA 1O3HA 2GD4B 2FEQH 3SU1A 1RTKA 3A7WA 1ZLRA 4OS2A 1C1PA 4K69A 4K8YA 1ESBA 5TCAA 2ASUB 4X1RU 1QCPA 4NG9H 4D9RA 2TGAA 4IW4E 3A88A 1XXFA 4INKA 4DY7B 4NSVA 3Q3XA 4UDWH 4J1YA 4JK5A 2B5TB 5LGOA 1GI5A 5GPIB 1Z71A 3T5FH 1HDTH 2AMQA 2P95A 2OC8A 2EC9H 1W3CA 2ZFFH 4E7RG 3Q3KA 1QBOA 1GBAA 1A1RA 3ZZ6A 2ZTXA 2J38A 5JYIA 3OX7U 1T7CA 4BAOB 2DE8A 3LGTA 1DLKB 3GY8A 1OYQA 3SJIA 1O2MA 4NA7A 1AWFH 8ESTE 2D26C 4QT8C 1DT2A 1SHHB 3TIUA 4ZHLU 1V2LT 4E7NA 1P2OA 2ZTZA 1YPHE 1GBHA 1F0RA 3LPRA 1C5UA 1EPTC 1KDQB 1ELBA 1FY1A 3LGWA 3LT3A 1BBRH 3WY8A 4FUGA 1EB1H 2GDEH 1CGJE 3LGIA 4TYDA 2XC0A 2ZI2H 3VPKA 2ZDKA 4LOYH 1ANCA 3T26A 3OYPA 1HXEH 3M61U 1K1NA 2PW8H 1ZRBA 2OINA 3SOSA 2JH0D 4YOJA 3FAOA 3A87A 4Y0ZE 4H42U 1PPFE 1Y3VA 1Z7KA 2BLVA 3TPIZ 4SGAE 4Q7ZA 5ETXA 4AZ2B 1SGTA 1GJAB 2Y5HA 1H1BA 4K2YA 4ZKRU 1GI3A 2BZAA 3UOUA 4A5TS 3P6ZB 4E06H 1EZSC 1DXWA 1C5VA 1QB1A 1WBGB 2Y6TA 1SBWA 2J4IA 4AB8A 1ZPCA 4MQAA 2CN0H 2RG3A 2ZGXH 2VH6A 3GISB 1TOMH 1AVWA 2EEKA 1A5IA 1W7GH 4ZH8A 4H6SB 1C2KA 1W12U 2C8YB 1M9UA 5JBAS 3VEQB 3BG4B 2A4OA 1DUEA 1A3EH 2FLBH 2PKAA 3S0NA 5AVDA 1QRXA 3H5CB 1ABIH 5E0HA 5G4BA 2GTBA 4KTSA 1G36A 4I8JA 1XXDA 2O8UA 3HKJB 4Y10E 2F9PA 2A4RA 2VIPA 1PQ7A 1V2PT 4LZ4B 1GHXH 2IOTA 3QTVH 4VGCC 2ULLA 3TK5A 1AFQC 4X8SH 2TRMA 2WPHS 1XVOA 1A46H 5FX5A 1FAXA 1ACBE 2F9OA 3RXKA 1ZHRA 1YCPK 3IG6B 1LHGH 1FNIA 1EZQA 2VU8E 1HNEE 1MUEB 1GGDC 2A31A 1BTXA 2BLOA 1UK3A 4CR5A 3CP7A 3QLPH 1G3EA 1FPCH 2FS9A 1C2FA 1P2NA 4Y8XA 3TVJB 2SGDE 1Y8TA 3GYMA 4ABGA 1HIAB 1LHEH 2F83A 3Q76A 3LH1A 5EODA 2FYQA 3F9GA 3RMMH 2CMYA 4GCHG 5F8XA 2A2QH 3PLKA 1QJ7B 3EQ0H 2Z9IA 8KME2 1KSNA 1CGIE 5T6FA 2G51A 1NC6A 3SI3H 2VWLA 1AHTH 4NA8A 2FXRA 2O8LA 1IHTH 1SGQE 2F9NA 5CMXH 1GDUA 5J4SA 3QWCH 4B2BA 1GHAF 3AAUA 4WVPE 4AGKA 5E8EH 2ZCHP 3ZVBA 1FY4A 1HRTH 1HXFH 3GY2A 3ELAH 4IN1A 1TONA 2Q6DA 5DJ7A 5E0GA 1C9PA 3RXOA 1LPKB 1EAIA 3RC5A 2CJIA 1VCWA 1SL3A 2BQ7B 5DO4H 1P9UA 5L2ZH 1QJ1B 3URCA 2AGEX 1OWDA 1F7ZA 4FUEA 3P92A 3BF6H 3U1IB 3QZRA 4CRDA 2PV9B 3LH3A 1C5QA 3KQDA 3PWBA 2BDIA 2TGDA 3KL6A 5DK1A 1ETRH 5AFZH 1G30B 1KTTB 3RXJA 2TGTA 1OP0A 1D6WA 1O2SA 2Y81A 3K6YA 1JIRA 3KF2A 2ANKH 1MKWK 1LPZB 4UD9H 2Z9KA 1NU9A 2OTVA 1P02A 1F5KU 1O2YA 4NIYA 1CO7E 1C2DA 2KAIB 3A83A 1KLJH 2EI6A 4MTBA 2ZIQH 2VVCA 3BTDE 3UUZA 5A0AE 3GDSA 4B76A 1DICA 1GBTA 1CA0C 1MTNB 4H6TA 3VGCB 2VIWA 1WV7H 1O2UA 4A1XA 1LVOA 1NFXA 2J92A 3M3VA 1O2ZA 3MNBA 1MTVA 1W7XH 1AWHB 3SUFA 1NFYA 1MCVA 1GMDF 3GCHC 4FUBA 3KEEA 4ISOA 1CHOF 1HAGE 4AOQA 2PUXB 1DWCH 5C1YA 4INLA 1O2HA 2FO9A 3SO3A 3Q00A 1NTPA 1EXFA 2Z7FE 3MI4A 4GAWA 5FBIA 3RXMA 3LKWA 1QQUA 4WMDA 3UQOA 3AVZA 1TRYA 2WPLS 1TA2A 1GCTB 1TAWA 1O5AB 2FX4A 4HFPB 1C1MA 2Y5FA 1VR1H 3JZ1B 2BDYA 1A2CH 1OWHA 3UNRA 2BDBA 4JZIA 1O5BB 4JMYA 4JYVH 1Z8GA 1AKSA 1F92A 3QX5H 2HGTH 2VIVA 3ZZ8A 3UTUH 1BZXE 2O8TA 4F49A 3OY5U 1EP5A 1Y3UA 4HGCA 3CS0A 2FOHA 2UUKB 5FHTA 1EB2A 2XCNA 1QURH 1V2UT 1HIAA 1DS2E 2J34A 1A61H 3D23A 1UTMA 2R2WU 1N8OC 5I25A 2I6QA 3SV9A 4RSPA 3PWCA 1SC8U 3SJ9A 3H7OA 1SGFG 2YNBA 4MVNA 5HXFA 1W13U 4CRCA 3BN9A 1ZZZA 5DP5A 1GDNA 1HBTH 3M35A 1PFXC 1ZJKA 1P2IA 3SBKA 1K9OE 1FV9A 2HWLB 2ZHDA 2ZP0H 1GGDB 3MNXA 1HAIH 3GCHB 1VJAU 1GBBA 5F8ZA 1XM1A 3FP8E 1DSUA 1K28D 2DE9A 5HM9A 1C1TA 3LDXH 4YESB 5F03A 1ELGA 1WCZA 4UONA 2AIPA 1CE5A 1H8DH 2A1DB 2WUCA 1V2WT 3QTOH 1P04A 4MPXA 5DP8A 4NA9H 2BD8A 2FI3E 1BMMH 1TPOA 1GMHF 1YPMH 4XOJA 1FIZA 5EGMA 3SUEA 4AX9H 1S6HA 5PTPA 2BMGB 2VIOA 5HMAA 4GCHF 5L30H 3I29A 1TLDA 3A7XA 3D65E 2WPJS 2FZZA 1PQAA 1JWTA 1IQHA 2XYAA 1D6RA 3P8NA 2ZCLP 2D1JA 1WAYB 2ZHFH 4Z0KA 2XW9A 1AE5A 2FYRA 1O2QA 1ZRKA 2ESTE 1C1SA 1PPGE 2UWLA 5LH8A 4DIIH 1GMCG 4WJG2 1UTKA 4X8VH 1TBQH 3SJ8A 3ZVEA 4B73A 1Y5BT 2STBE 4MDSA 3NWUA 1DWEH 4AGJA 1SLVB 2UUJB 3BTEE 3M3TA 4MNYA 3G01A 3E3TA 2BM2A 1K1MA 2AFQB 4B71A 2R3UA 1PJPA 4CRBA 1V2QT 4Y71A 3T2NA 1K2I1 2SGPE 3SU4A 2CV3A 1DM4B 2PFEA 3P8OA 1S83A 1O3KA 4WWYA 1PYTD 1QTFA 3UR9A 2BDGA 2QY0B 1C5LH 1LVMA 2A0QB 5FPYA 2QYIA 1A4WH 1C2GA 2XBYA 1ZHPA 5JDUB 1F5LA 1YLDA 1AFQB 1GHWH 4YOIA 2GV7A 3U8OH 5C1UA 1MCTA 1O32A 1CQQA 1UVPA 4JZ1A 3BTHE 4IBLH 1OWIA 3SHAH 4DVAU 3MWIU 2BD9A 3TH4H 6LPRA 1QIXB 1E0FD 2CHAC 2OBOA 3HK3B 1D3PB 1F5RA 2BY8X 1DFPA 1J9CH 3A89A 4WMFA 1SQOA 1GBFA 4FUCA 1HJAB 4R0IA 3SJKA 1YPLH 1GBMA 1O2GH 1L1NA 1QBNA 3S9AA 1BITA 2HLCA 3GDVA 2G52A 4Y0YE 2SGAA 1XUIA 1QL8A 5K7RA 2OC0A 1CHGA 1TNLA 2O8WA 1QRZA 2V6NA 1ZTKA 2G5VA 1E34B 1SB1H 1QY6A 2XC5A 4J2YB 1P3EA 3KQCA 1B0EA 3SW2B 1Y3XA 3SNDA 1H9LB 1O3NA 2HOBA 4DT7B 2AGGX 2ZWLH 1HJAC 1SGCA 2XNIA 3ATIA 3LC5A 2O9QA 3LGYA 1TX7A 3OY6U 3CENA 1UTLM 1D4PB 1O3JA 1V2ST 1TNHA 2C8XB 6ESTA 3ZZDA 1EASA 1GJCB 2JH5D 3RU4E 3NK8A 2ZQ1A 3NZIA 2RA0A 4BAQB 1MH0A 1N6YA 1WSSH 3MU1A 1Q2WA 4D76A 3BTTE 1SMFE 2GZ8A 3ZVFA 1ELDE 2ZFTA 1RS0A 1QRWA 1GHAG 5A0BA 1G2MA 2PR3A 1TNKA 2AYWA 1GBIA 2QAAA 5IYTA 4ABEA 1TNGA 3SGQE 2NWNA 3SU2A 3V3MA 4Y7BA 1O3AA 2ODPA 4SGBE 1C9TA 3SGAE 1ETSH 4CR9A 2GZ7A 5HM2A 2AGIX 3DT0H 7KMEH 1GHZA 4MLFB 1JXPA 1DY8A 1YF4A 1A7SA 1GL0E 4X1QU 1GJ4H 1AI8H 4Y6DA 3MU0A 1VITG 2GT7A 4D9QA 1OYTH 1ZYOA 2BD7A 2HALA 1L4DA 2FOCA 1YPEH 2H9HA 2Z9LA 1QQ4A 1LCYA 2YNAA 1C1RA 4ABDA 3A7ZA 3BTFE 1S82A 5DKMA 3SV7A 5FCKA 4FXGH 1K1PA 1MKWH 1WUNH 5J4QA 2Z9JA 2ZDMA 4ZHAA 2QXGA 2FOEA 1BBRK 1UVOA 4NZQA 5ESTE 5TCCA 1ZPBA 1FXYA 3UR6A 4HTCH 5C67A 1LQDB 3RXSA 4AFQA 2VH0A 1NRQH 2ZPRA 3QN7A 3RMLH 2ODQA 1Z6EA 3A7YA 4YOGA 4GSOA 3A8DA 4XBCA 2D2DA 3QO6A 1P2KA 4I7YH 4FUIA 1SHYA 1DOJA 1O33A 1P2JA 1O5DH 1C1OA 1PYTC 1K1LA 4A6LA 1D3QB 3U8TH 3K65B 2AEIH 4ABBA 1MTWA 1QJ6B 1MAXA 1BTUA 1LKBA 1B5GH 2SFAA 4FUJA 5JB8S 1VGCB 4YLUA 1JRSA 1IOEA 1N6XA 5C20A 3FVFB 1V2TT 4LXBH 4GLYA 3W94A 2NU4E 1ANDA 1O37A 4FU9A 3RXPA 1VCQA 1HAVB 4K1TA 1HAXB 1ZJDA 3VB5A 1MMJN 2XC4A 1T32A 1FY5A 1SLXB 3K6ZA 1HGTH 2HNTF 4KTCA 1V2JT 3U8RH 3ITIA 3A8CA 4AORA 1GJ8B 1BMLA 1T4VH 4ABIA 1CT0E 1VGCC 3BG8A 1ANBA 1MZAA 4Q80A 3L3TA 1W2KH 1FIWA 5E2PA 2A7JA
chains in the Genus database with same CATH superfamily
4ZXYH 1SR5C 6GCHG 2ZFQH 1DY9A 5AHGH 2KM0A 3WWFA 3A82A 3GICB 1WQSA 5EOKA 2PUQH 1A0JA 1GVZA 1TQ0B 2H5DA 5DGJA 2WHXA 3VG8A 2G4UA 1A0HB 1ZGVA 2KR7A 3ZV8A 3RP2A 4AG1A 4YT7H 2EY4C 3A86A 1BRCE 3D49H 2BDAA 3QZQA 3K9XB 1C1UH 1SOTA 2BY6X 4JCNA 3Q77A 1UK4A 3MO9A 4PROA 1YY3A 1GJ7B 2J5UA 1O30A 1O31A 1W14U 3E8LA 3N7EA 1P57B 5DP9A 1T4UH 1G3DA 1GMHG 3PM3A 4NZLA 1UCYH 1INCA 1O0DH 1YYY1 2OQ5A 1RFNA 3R0FA 5C5NA 1RTFB 2BX4A 2P3UB 1B0FA 1S0QA 2SNWA 1KXEA 1TNJA 1G2LA 4X1SU 3LJOA 2RA3A 1G9IE 4ZKSU 2PKSC 4BNRA 2WV9A 1ELFA 3RM2H 4Q7YA 2BOHB 2ZGHA 2C8WB 3E0NB 1F2SE 2FESH 2BY5X 2WPIS 1HJ8A 1TGCA 2HRVA 3RXGA 4AYVB 5JPMH 4CHAC 3ZZCA 1SOZA 4MPWA 1G3CA 2Z6BD 1TIOA 3OFND 3TNTA 5F53A 2BD2A 1NU7B 1C1VH 1QA0A 5L2YH 1PPBH 2OXSA 4R8TB 1RD3B 2B7DH 1C5MD 1L1GA 2B8OH 2ZZUH 4Z6AH 1DX5M 3DD2H 2R9PA 2UUYA 4O97A 1TGTA 2A45B 1V3XA 1O5CB 3F2FA 3UNSA 1JRTA 4M7GA 2KCYA 1V2MT 3UB0A 1FONA 3QUMP 4WY3A 1F0TA 4X1NU 1TX6A 1C5RA 3SORA 4Q7XA 1TGSZ 5HIYA 3SU5A 3M37A 1S0RA 1FDPA 1MQ5A 1SG8B 4XE4A 2H1UA 2R2MB 1EJAA 1ANEA 1VJ9U 5CE1A 5AF9H 2H9TH 3ATKA 3SU3A 4IMQA 3BEUA 5T3HA 1O2XA 1VCPA 4A1TA 4H4FA 4D7FA 4U30A 1QA7A 1ELCA 3UPEA 1C5SA 1NESE 2FOFA 4ISLA 2JETC 1D3TB 1WDIA 2TPIZ 5GWZA 1ELTA 2QF3A 3E16B 4MNVA 3TH3H 2VWOA 4WXVA 9ESTA 1S85A 1RRKA 1W10U 1VKYA 3HGPA 1EUFA 3B8JA 5LPRA 1CHOG 3BTGE 4D8NA 1LQEA 1TALA 2GMTC 2LNCA 4ZXXH 1SSXA 1P03A 2HNTE 2W6ID 2WSSD 1L2EA 4X6MA 2FLRH 1GJBB 1GJ9B 2R0LA 2A32A 3GYLB 3RXLA 4ISNA 4BTIB 1GJ5H 4B2AA 2ZU4A 2ZU5A 4P00A 1J8AA 3U1JB 4UFDH 3RLYH 2HPPH 3MH6A 1H9HE 1UTNA 1HAYB 3FZDA 4IC5A 3RUOA 3ZZAA 1QB9A 4RT1A 1EAUA 4AFUA 2VNTA 1HV7A 1C5NH 1JIMA 1P3CA 2GCTC 1BA8B 1GPZA 4O3TA 2R0KA 3MYWA 4VGCB 2QF0A 2XNDD 3SU6A 1MKXH 1A0LA 1L4ZA 1WYKA 1ZSKA 1SLWB 2IJOB 2VB0A 3SGBE 2BVXH 3SU0A 1Y5UT 1ELEE 1AN1E 5JBCS 4Q2KA 3TJUA 3VB6A 3BTKE 4IN2A 4DGJA 1YBWA 3ZIAD 1C4U2 2CGAA 3SV6A 3EGKH 1UCYE 3SZNA 1THSH 1XVMA 2P94A 3KNXA 2UWPA 1BCUH 3P70B 1LVBA 1KY9A 2FOGA 2VINA 1C2MA 3UIRA 3Q3YA 2CHAB 3BSQA 5JB9S 3CS7A 2LELA 1AQ7A 1MKXK 2JETB 3PRDA 1YWUA 1DPOA 3R3GB 1HAPH 4A7IB 4RKJB 1OWEA 3NUMA 3MFJA 4Y79A 1ID5H 2GMTB 4X6PA 1SPJA 1TFXA 2FTMA 2BQWB 5GIBA 3RXDA 1P9SA 3EA8A 2K1QA 4CRFA 4I8KA 3PMHB 1EZXC 1LHFH 1H8IH 2G4TA 2FP7B 2VIQA 5DP6A 2NU0E 5E2OA 1G32B 2ZFSA 3SHCH 3LONA 2QA9E 1E35B 1GBJA 1V2RT 4I32A 3VB7A 1E38B 4YM9A 4I86A 2VWMA 3HATH 1C1QA 1ELAA 3ZZBA 1O2OA 1NBMD 2M5TA 4ZKNU 4BTUB 3SUDA 1BJUA 4JYTA 2OC7A 3F68H 3PO1C 4X8UH 1NRRH 3TU7H 4LZ1H 1O2VA 1P10A 2F9UA 2FOMB 3BTWE 1TMUH 1C5PA 2OBQA 1GI0A 1BOQA 1NY22 3GY4A 3M7QA 2SGQE 5ABWA 2NU3E 5JBTA 2GT8A 1QL9A 2QCYA 1IQLA 2BVRH 3MH4A 3NRLA 3UNQA 4DW2U 3B23B 1YLCA 2BB4A 3A7TA 1NT1A 4CHAB 3MHWU 3KCGH 4YZUA 1OSSA 2UWOA 3SYJA 1W0JD 3ATWA 1IQEA 1O3LA 1LKAA 2AMDA 3E90B 2QV1A 2YMSB 3RXEA 1O2KA 2BLWA 3ZZ5A 1QL7A 1P01A 1CA0B 1MTNC 5HGGA 1C1WH 3ODDA 5EW2H 1LVYA 1QHRB 2UUFB 1FZZA 1LDTT 5A8XA 2QXJA 1LPGB 2LPRA 1DE7H 3M3SA 3MH7A 1BTHH 4ZKOU 3QGJA 5C5OA 2ZNKH 1GDQA 1K22H 4B74A 3SJOA 1KMHB 5BPEA 1FQ3A 4BAKB 2BXTH 1C5YB 5FAHA 1EQ9A 1PPCE 3TGIE 1GMDG 1AGJA 3W95A 3BG4C 1IQJA 4I8GA 2JH6D 2WYGA 3PTNA 3E91A 5EPNA 1D3DB 3PTBA 3TJNA 1GI6A 2JKHA 4FUFA 3M5OA 3MQKC 2A5AA 2FX6A 3RMNH 1GCTC 5EXLA 2BD3A 3ZYEA 2OD3B 5C1XA 4X2WA 1LHDH 5T6DA 2KAIA 3BIVH 1E36B 1YGCH 5FCRA 2J97A 2R3YA 3PYHA 4KKDA 1UVSH 4KELA 1SI5H 2H6MA 1OP8A 2J9NA 1XKAC 4B2CA 3UWJH 1DANH 3PLPA 5EQQA 3ENSB 3RXUA 2FMJA 3KN2A 3RXHA 5KGOA 1GBKA 3QGNB 3A8BA 1V2NT 1OWKA 1YPKH 3F2GA 4FU7A 3RXVA 3TK6A 1Y3YA 1SGNE 4BTTB 6CHAB 1THRH 2VBCA 2TGPZ 1AIXH 1UTPA 1HYLA 2PTNA 4U01A 4NFEA 1IQMA 3MTYA 1O3GA 2ZQ2A 3UQVA 4CREA 1TNIA 4GHQA 2BX3A 1XMNB 1SGIB 1UHBB 1YLNA 3HK6B 2VGCC 3PB1E 1K1JA 4XFQA 1FX0B 1UO6A 3BEFB 5HYOA 1A3BH 4I8LA 4CRAA 4AYYB 3KYFA 2FDAA 5A8ZA 2V0BA 1MZDA 1TGBA 2VIDA 1GBEA 2W7UA 3HPTB 3E6PH 1GBLA 4KTUA 1MBQA 3GCOA 3A84A 3STJA 1TABE 3TK9A 3MNCA 1S6LA 2GKVE 1AO5A 1UTJA 2OCVB 2PHBA 2M2AA 3SQHE 2VGCB 1W0YH 2AS9A 4KGAA 5GJ4B 2GX4A 3A8AA 3AAVA 3P8GA 4XBBA 5C94A 1BBRE 1GJ6A 2W7SA 4BOHA 2BDHA 1O2WA 2ZHQH 5AFYH 3A80A 1S6FA 1UHBA 4ZAEA 1BB0B 3O8RA 3RXQA 2ZC9H 2ZGCA 1TPSA 2ZHEH 1AD8H 1O3IA 2V3HH 3GY3A 3SZEA 1BMAA 1O3PB 1QNJA 3A7VA 1T31A 2G00A 2GV6A 1FUJA 1P0SH 2Z3EA 1BDAA 5A09A 3RM0H 1NM6A 1W8BH 1NBME 2ZU1A 2CF9H 2OP9A 5GCHF 5DP3A 4ISIH 1AMHA 1S5SA 1C2JA 1WXRA 5SGAE 2ZKSA 4GPGA 1GVKB 4JYUH 1PPHE 1PPZA 4YO9A 4IC6A 4K3JA 1SLUB 3U98H 1FMGA 1FJSA 5ESBA 1BRAA 2JDID 4GHTA 2FPZA 1MTUA 9LPRA 2FI5E 3P95A 3S69A 1BT7A 1NRPH 3UY9A 1IQIA 1WTHD 3N99A 4Y76A 2GCTB 1LMWB 2Q6FA 3DSPA 1UJ1A 2FOBA 8LPRA 1C5WB 1KIGH 4RKOB 4HI3A 2Z3DA 3F6UH 4ZROA 4LK4A 1SQAA 2WINI 1T8LA 4X2VA 3SI4H 3M7TA 2FODA 3MH5A 1BQYA 3VXFH 4DT4A 1V2VT 1KTSB 5T1VA 1RIWC 4TSFD 3MU5A 2KCPA 2CF8H 3SV8A 2ZGJA 1LTOA 3UOPA 3RXTA 1CSOE 3SN8A 4ABAA 2EA3A 1TPAE 2J95A 1E79D 2BOKA 1ESTA 2PGQB 1EFRD 2ALPA 2THFB 3S9CA 3ZVDA 5CHAB 5C0TA 3KQEA 3SQEE 1FN6A 1TBZH 1WQVH 1SGFA 3FANA 1L0ZA 1YPHC 1OX1A 2HVXA 1AZZA 4D7GA 3PMBB 1HUTH 2GDDA 1BTPA 1NPMA 4Y8YA 2V3OH 2OLGA 1JMOH 1EX3A 1FN8A 3FN8A 1QBVH 3DHKH 1ZTJA 2Y82A 1GHVH 3ZVAA 1UW7A 4CH2B 1IQFA 4O3UA 3DCLA 4XBDA 4JZDH 1L1JA 1TBRH 3N7DA 4ISHH 1AU8A 3VFEA 2PKSB 5FPSA 2XWAA 4YXWD 3TJVA 5EPYA 3QDZB 1MTSA 1DSTA 2ANWA 4UE7H 3EAJA 1C5XB 3RU4T 1GHYH 1IQKA 2W3KA 3M5MA 4GVUA 1Y59T 3T25A 1GI1A 1TOCB 3O8BA 5F8TA 4FU8A 3RXAA 3P17H 1PQ8A 2ANYA 3GCTF 1YM0A 3ESTA 2K0QA 4X6OA 1O3FA 4AFSA 4FVDA 2YOLA 1HAZB 5LPEA 2F9BH 2ZF0H 3WWBA 4NWLA 2VJ1A 2PTCE 3UAIC 4DCDA 1KXAA 5A8YA 1XKBC 3S7HB 1TA6A 2QXIA 3RXRA 1CU1A 1DDJA 1CT4E 1Q3XA 3BEIB 1S81A 4O03A 2STAE 3UWIA 2Z9GA 2AIQA 5T6GA 1O3BA 1QZ8A 4K1SA 2ZDNA 1ARCA 3PMAB 3M5NA 2C3SA 1AFEH 4X2YA 1IHSH 2XXLA 1O3CA 1O2PA 2ZU3A 1OKXA 1WOFA 2G81E 1GG6C 3OU0A 1PQ5A 1V2KT 2BD5A 2W5EA 1O2NA 5B6OA 1AUTC 1TQ7B 1TRMA 4BAHB 1B7XB 2EI7A 2P59A 4IMZA 4CBOA 2A5KA 4KP0A 1EATA 2XBWA 3RC6A 1HJ9A 3U9AH 2HNTC 3O8DA 2Y7XA 2SGFE 1P2QA 2PKAB 3HGNA 1P05A 4BXSA 4OGYA 3TH2H 4ASHA 1SGPE 2F4LA 4Y7AA 5BRRE 1W0ZU 1FY8E 2W3IA 1VITH 1Y5AT 2ANMH 2Z3CA 3KQBA 7GCHG 1U6QA 1ZHMA 1QFKH 3ZV9A 2LP6A 1TE0A 3GCTG 2Q1JA 2ZHWH 2F91A 3EDXB 1O2LA 1T8OA 3IWMA 3EYDA 1O3EA 5E0JA 3EE7A 4NIWA 3MO6A 1KXCA 5DG6A 1GBDA 1E37B 1O2TA 2OK5A 4BANB 3KHVA 4UEHH 2BHGA 2RDLA 1YPJH 1C2LA 3RLWH 1O39A 1CA8B 1W11U 3LGUA 1EPTA 3PO1B 3E1XB 3I78A 1SGEE 2P8OC 5F6MA 1AUJA 1C5OH 3LC3A 3RXFA 1DVAH 1GHBF 1K1IA 2FOAA 2JIZD 4X6NA 2PSYA 1A5GH 3LU9B 1Q31A 1KXBA 2FTLE 1C2HA 5FBEA 3I77A 3GDUA 1Z1JA 3LOXA 3AASA 1FY3A 2A5IA 2XOKD 1XUJA 3MMGA 3VGCC 1MD7A 3GY5A 3U69H 2BXUH 1TRNA 1UVUH 2D8WA 3B9FH 2FI4E 5EXNA 4WH8A 1H9IE 3E0PB 4ZUHA 4RN6A 1GG6B 1RIWB 3EA7A 1RXPA 5EQSA 1UCYK 1ZSJA 1HPGA 2BTCE 1J15A 3M7UA 3QK1A 4MG3A 1THPB 2QF5A 2PSXA 1XUKA 1DWDH 1YPGH 1J14A 1A5HA 1D9IA 4IGDA 4X0WU 3VB4A 1EOLA 5GDSH 1GCDA 3NKKA 4MNWA 1DLEA 1ELVA 1EOJA 1AKSB 2ZFRH 4Q4LA 1ZSLA 1AY6H 3D62A 3IITA 1ZMLA 2RCEA 3F9HA 4K5ZA 3ZZ7A 1ZTLA 2ZDAH 4F4OC 1MAYA 3MU8A 3M5LA 4NIXA 4THNH 1TMTH 2XBVA 3TGKE 4TPYA 3ZYDA 4UFFH 4YT6H 3T29A 3ZVGA 1IAUA 8GCHF 5CHAC 3DFLA 2WPMS 3F9EA 7LPRA 1LO6A 5JBBS 3VXEH 4CH8B 1UMAH 1MABB 1O3OA 2GCHG 4CBNA 4K60A 1YCPH 1ABJH 1O36A 2A4GA 3RDZA 1T8NA 2VVVA 3S9BA 1COWD 1BIOA 3ATLA 5GCHG 1AVXA 4OS7A 1MQ6A 3AK5A 5EU8A 3BV9B 1O5FH 2H2ZA 2P3TB 3FFGA 2OC1A 1O2RA 1N8OB 1XX9A 1RJXB 1QB6A 2B0FA 2EQNA 4TY6A 1BJVA 1TMBH 2C93B 2CK3D 1SVPA 1ZGIA 1Z8IB 1Z8JB 3ZZ3A 2A2XH 3LJJA 1GMCF 1O3MA 4ESTE 4OM9A 5H4IB 2AMPA 2IPHA 1NZQH 3NPSA 1GI9B 1V2OT 3UFAA 2XTTB 4I8HA 2OUAA 3O8CA 1ZR0A 4ABHA 4A92A 2IPQX 2BZ6H 4UFGH 4BXWA 2WPKS 2P3FH 1WU1A 2ILNA 2BY7X 1EKBB 2WUBA 1RTLA 2C4FH 1KLTA 3KGPA 2V35A 4DIHH 2WV5A 3TITA 1O34A 3AW1A 1NO9H 3TGJE 1JBUH 7ESTE 2BDCA 4B6FA 2RFKC 1TX8A 1E1QD 5C3NA 1VITF 3KIDU 3NCLA 2NU1E 3FZZA 3VB3A 2A7HA 1XUGA 2WPDD 1NFWA 3GY7A 1O35A 1MU8B 5FPTA 3TJOA 2ALVA 1G37A 2GCHF 1EJNA 2J94A 1DWBH 5EQRA 2H9EH 1BHXB 2TBSA 3BTME 1SFIA 3F1SB 3FP6E 2WYJA 4NIVA 2G55A 2ZO3H 1ZPZA 4Y11E 1RGQA 5TJXA 2GJGA 4K8BA 3MU4A 1TGNA 2G8TA 2PLXA 1GL1A 1EP6A 2L6OA 1P12E 4OS1A 3TNSA 3V0XA 3N7OA 3DFJA 2OQUA 3ATMA 3PMJA 3SNBA 1BMNH 4TWWA 1X7AC 1JOUB 4YLQH 2P93A 2NU2E 4U32A 4X2XA 1MU6B 1TWXB 1Z6JH 2ZA5A 1BRBE 4INHA 1AB9C 1MBMA 1UK2A 5DPAA 1P11E 1OPHB 1VZQH 1DITH 1GJDB 1QR3E 3SNEA 3V12A 2QGRA 4XDEA 1ARBA 5EW1H 2AH4X 6GCHF 2BQ6B 1Z8RA 2RDEA 4YTAA 3T62A 2P16A 3BTQE 3MOCA 1C2IA 1P06A 2WZQA 1O5EH 1EZUC 1BTZA 4NCYA 2ZCKP 3T27A 2C90B 2SNVA 1BRUP 5DSFA 2WV4A 1NROH 1AB9B 1HCGA 3GCNA 1P8VC 3SNCA 3LGVA 4UFEH 1ETTH 4X1PU 1OS8A 1DXPA 2F9VA 4TPIZ 3V7TA 3P8FA 1AE8H 3A85A 2GGVB 4WH6A 3BIUH 5C2ZA 3SUGA 2BVSH 4TY7A 1TB6H 1Y3WA 1F0SA 1CVWH 1CT2E 3GS9A 2BLQA 1O38A 1CBWB 2PWXA 1HLTH 2L74A 2VVUA 2GZ9A 1C5TA 1S84A 1DUAA 4OS4A 2XBXA 4P02A 1PPEE 3F9FA 1HB0B 1SQRA 4ABJA 3S7KB 2ZECA 1K21H 3K2UA 1N1LA 2ZDLA 1OOKB 2A7CA 2QN5T 3DUXH 4ZHMU 3UREA 3ODFA 2HPQH 2GP9B 2YMSD 1WTGH 1SQTA 1ZMNA 3JZ2B 1NS3A 1GWAA 1O3DA 2C8ZB 3L6PA 3LIWA 1H4WA 2I6SA 3SV2H 1CGHA 3EE0B 3MNSA 2QE7D 1O2JA 1ESAA 2O8MA 3H7TA 4OS6A 3ZVCA 5A0CA 1OXGA 1T8MA 3MO3A 3C27B 5EG4A 4K1EA 4AB9A 3SNAA 4BAMB 3HKIB 3URDA 5DP7A 4GUXA 1C4V2 4WMEA 1J17T 2VWNA 2ZDVH 4B75A 1V6DA 3RU4D 2FWWA 5FL7D 1SGYE 4ZMAH 1C1NA 2PGBB 2JJ1D 4AN7A 5CDFE 4FUHA 3RC4A 2F3CE 2ZPQA 3TLOA 1O5GH 3PROA 1BHXF 5LPFA 1EAXA 3ZZ4A 1OWJA 1ZMJA 2CXVA 1F0UA 2XWBI 4DG4A 1KYNA 4AG2A 2J2UA 3F0OA 4DURA 2ZU2A 3ZZ9A 3RMOH 4TT3D 1BUIA 5L6NH 1BTYA 2ZEBA 4CRGA 3PV4A 1EPTB 3PLBA 1FPHH 4MNXA 1XUHA 4X8TH 2ZFPH 3DA9B 1KXFA 1NN6A 1HAOH 8GCHG 2QXHA 1EJMA 2H5CA 2IN2A 4JK6A 2AERH 2XCFA 4Y8ZA 1FI8A 1QGFA 1YP9A 1C5ZB 1ORFA 3A81A 4WXIA 4IS5A 1LHCH 3V13A 1YCPM 3STIA 5GNDA 1EAWA 1TPPA 4NWKA 1NRNH 4JZEH 1GI7B 1GBCA 3RXCA 4I31A 4A1VA 2QC2A 5DP4A 1UVTH 2HVYB 2DUCA 5FX6A 1SGRE 2QIQA 5FXLA 1GI2A 1FAKH 1G3BA 1J16A 1GI4A 5I46H 1C4Y2 5EXMA 3M36A 4TWYA 2XRCA 4F55A 2A4QA 2BY9X 2SGEE 3NXPA 2KCOA 1AZ8A 2Z94A 3AW0A 2FM2A 3GOVB 1Z1IA 1BTWA 1ZOMA 2J98B 3RXIA 3OTJE 1HAVA 2BYAX 3FO8D 4E05H 4AFZA 1HFDA 5KEDA 1GI8B 2ZPSA 1O2IA 1UTOA 5K0HA 1GVLA 3EA9A 1GHBG 2ODYB 2Y7ZA 1FLEE 1HAHH 1MD8A 1H8HD 3OSYA 4FVBA 4OGXA 1P2MA 3FP7E 4FUDA 1YKTA 1NFUA 4B1TA 2TIOA 1IQGA 5GXPA 4I33A 4HZHA 3T28A 1KXDA 2B9LA 5A2MH 4NGAH 1TYNA 1SFQB 6CHAC 2Q6GA 3L33A 1XUFA 1KLIH 1P09A 1UTQA 2GVFA 2W26A 2ZTYA 2FIRH 4ABFA 5B6LA 1IQNA 4DJZB 3U28C 1YC0A 4XSKU 1CBWC 2Y5GA 7GCHF 4NSYA 1NRSH 4NFFA 2FS8A 1OP2A 1KDQA 1C2EA 3C1KA 3GY6A 4U2WA 4MPVA 5IDKA 2BD4A 4DOQA 4O9VA 2P8OB 1AVGH 2ZGBH 3OE7D 4MPUA 2ZG0H 4JZFH 4RI0A 2Y80A 4OS5A 5EJZA 1SGDE 2EI8A 4WF8A 3RXBA 1K1OA 2G5NA 1O3HA 2GD4B 2FEQH 3SU1A 1RTKA 4FOUC 3A7WA 1ZLRA 4OS2A 1C1PA 4K69A 4K8YA 1ESBA 5TCAA 2ASUB 4X1RU 1QCPA 4NG9H 4D9RA 2TGAA 4IW4E 3A88A 1XXFA 4INKA 4DY7B 4NSVA 3Q3XA 4UDWH 4J1YA 4JK5A 2B5TB 5LGOA 1GI5A 5GPIB 1Z71A 3T5FH 1HDTH 2AMQA 2P95A 2OC8A 2EC9H 1W3CA 2V7QD 2ZFFH 4E7RG 3Q3KA 1QBOA 3WW7A 1GBAA 1A1RA 3ZZ6A 2ZTXA 2J38A 5JYIA 3OX7U 1T7CA 4BAOB 2DE8A 3LGTA 1DLKB 3GY8A 1OYQA 3SJIA 1O2MA 4NA7A 1AWFH 8ESTE 2D26C 4QT8C 1DT2A 1SHHB 3TIUA 4ZHLU 1V2LT 4E7NA 1P2OA 2ZTZA 1YPHE 2KCAA 1GBHA 1F0RA 3LPRA 1C5UA 1EPTC 1KDQB 1ELBA 1FY1A 3LGWA 3LT3A 1BBRH 3PV5A 3WY8A 3OEED 4FUGA 1EB1H 1H8ED 2GDEH 1CGJE 3LGIA 4TYDA 2XC0A 2ZI2H 3VPKA 2ZDKA 4LOYH 1ANCA 3T26A 3OYPA 1HXEH 3M61U 1K1NA 2PW8H 1ZRBA 2OINA 3SOSA 2JH0D 4YOJA 3FAOA 3A87A 2AHME 4Y0ZE 4H42U 1PPFE 1Y3VA 1Z7KA 2BLVA 3TPIZ 4SGAE 4Q7ZA 5ETXA 4AZ2B 1SGTA 1GJAB 2Y5HA 1H1BA 4K2YA 4ZKRU 3KYGA 5EIYA 1GI3A 2BZAA 3UOUA 4A5TS 3P6ZB 4E06H 1EZSC 1DXWA 1C5VA 1QB1A 1WBGB 5C0UA 2Y6TA 1SBWA 2J4IA 4AB8A 1ZPCA 4MQAA 2CN0H 2RG3A 2ZGXH 2VH6A 3GISB 1TOMH 1AVWA 2EEKA 1A5IA 1W7GH 2W6JD 4ZH8A 4H6SB 1C2KA 1W12U 2C8YB 1M9UA 4HG6A 5JBAS 3VEQB 3BG4B 2A4OA 1DUEA 1A3EH 2FLBH 2PKAA 4RT0A 5AVDA 3S0NA 1K0HA 1QRXA 2JJ2D 3H5CB 1ABIH 5E0HA 5G4BA 2GTBA 4KTSA 1G36A 4I8JA 1XXDA 2O8UA 3HKJB 4Y10E 4F48B 2F9PA 2A4RA 2VIPA 1PQ7A 1V2PT 3OAAD 4LZ4B 1GHXH 2IOTA 3QTVH 2PP6A 4FETA 4VGCC 2ULLA 3TK5A 1AFQC 4X8SH 2TRMA 3DSGA 2WPHS 1XVOA 1A46H 5FX5A 1FAXA 1ACBE 2F9OA 3RXKA 1ZHRA 1YCPK 3IG6B 1LHGH 1FNIA 1EZQA 2VU8E 1HNEE 1MUEB 3H09A 1GGDC 2A31A 1BTXA 2BLOA 1UK3A 3OTPA 4CR5A 3CP7A 3QLPH 1G3EA 3PRBA 1FPCH 2FS9A 1C2FA 1P2NA 4Y8XA 3TVJB 3F0PA 2SGDE 1Y8TA 3GYMA 4ABGA 1HIAB 1LHEH 2K8IA 2F83A 3Q76A 2J98A 3LH1A 5EODA 2FYQA 3F9GA 3RMMH 2CMYA 4GCHG 5F8XA 2A2QH 3PLKA 1QJ7B 3EQ0H 2Z9IA 8KME2 1KSNA 1CGIE 5T6FA 2G51A 1NC6A 3SI3H 2VWLA 1AHTH 4NA8A 2FXRA 2O8LA 1IHTH 1SGQE 2F9NA 5CMXH 1GDUA 5J4SA 3QWCH 4B2BA 1GHAF 3AAUA 4WVPE 4AGKA 5E8EH 2ZCHP 3ZVBA 1FY4A 1HRTH 1HXFH 3GY2A 3ELAH 4IN1A 1TONA 2Q6DA 5DJ7A 5E0GA 1C9PA 3RXOA 1LPKB 1EAIA 3RC5A 2CJIA 1VCWA 2IJD1 1SL3A 2BQ7B 5DO4H 1P9UA 5L2ZH 1QJ1B 3URCA 2AGEX 1OWDA 1F7ZA 4FUEA 3P92A 3BF6H 3U1IB 3QZRA 4CRDA 2PV9B 3LH3A 1C5QA 3KQDA 3PWBA 2BDIA 2TGDA 3KL6A 2V3MA 5DK1A 1ETRH 5AFZH 1G30B 1KTTB 4B6EA 3RXJA 2TGTA 1OP0A 1D6WA 1O2SA 2Y81A 3K6YA 1JIRA 3KF2A 2ANKH 1MKWK 1LPZB 4UD9H 2Z9KA 1NU9A 2OTVA 1P02A 1F5KU 1O2YA 4NIYA 1CO7E 1C2DA 2KAIB 3A83A 1KLJH 2EI6A 4MTBA 2ZIQH 2VVCA 3BTDE 3UUZA 5A0AE 3GDSA 4B76A 1DICA 1GBTA 1CA0C 1MTNB 4H6TA 3VGCB 2VIWA 1WV7H 1O2UA 4A1XA 1LVOA 1NFXA 2J92A 3M3VA 1O2ZA 3MNBA 1MTVA 1W7XH 1AWHB 3SUFA 1NFYA 1MCVA 1GMDF 3GCHC 4FUBA 3KEEA 4ISOA 1CHOF 1HAGE 4AOQA 2PUXB 1DWCH 5C1YA 4INLA 1O2HA 2FO9A 3SO3A 3Q00A 1NTPA 1EXFA 2HLDD 2Z7FE 3MI4A 1E1RD 4GAWA 5FBIA 3RXMA 3LKWA 1QQUA 4WMDA 3UQOA 3AVZA 1TRYA 2WPLS 1TA2A 1GCTB 1TAWA 1O5AB 2FX4A 4HFPB 1C1MA 2Y5FA 4AC9A 1VR1H 3JZ1B 2BDYA 1A2CH 1OWHA 3UNRA 2BDBA 4JZIA 1O5BB 4JMYA 4JYVH 1Z8GA 1AKSA 1F92A 3QX5H 2HGTH 2VIVA 3ZZ8A 3UTUH 1BZXE 2O8TA 4F49A 3OY5U 1EP5A 1Y3UA 4HGCA 3CS0A 5C17A 2FOHA 2UUKB 5FHTA 1EB2A 2XCNA 1QURH 1V2UT 1HIAA 1DS2E 2J34A 1A61H 3D23A 1UTMA 2R2WU 1N8OC 5I25A 2I6QA 3SV9A 4RSPA 3PWCA 1SC8U 3SJ9A 3H7OA 1SGFG 2YNBA 4MVNA 5HXFA 1W13U 4CRCA 3BN9A 1ZZZA 5DP5A 1GDNA 1HBTH 3M35A 1PFXC 1ZJKA 1P2IA 3SBKA 1K9OE 1FV9A 2HWLB 2ZHDA 2ZP0H 1GGDB 3MNXA 1HAIH 3GCHB 5CHBA 1VJAU 1GBBA 5F8ZA 1XM1A 3DSOA 3FP8E 1DSUA 1K28D 5EJ1A 2DE9A 5HM9A 1C1TA 3LDXH 4YESB 5F03A 1ELGA 2KZ4A 1WCZA 2QF4A 4UONA 2AIPA 1CE5A 1H8DH 2A1DB 2WUCA 3OEHD 1V2WT 3QTOH 1P04A 4MPXA 5DP8A 4NA9H 2BD8A 2FI3E 1BMMH 1TPOA 1GMHF 1YPMH 4XOJA 1FIZA 5EGMA 3SUEA 4AX9H 5EJLA 1S6HA 5PTPA 2BMGB 5KECA 2VIOA 5HMAA 4GCHF 5L30H 3I29A 4M9FA 1TLDA 3A7XA 3D65E 4XRNA 2WPJS 2FZZA 1PQAA 1JWTA 1IQHA 2XYAA 1D6RA 3P8NA 2ZCLP 2D1JA 1WAYB 3F3BA 4XD7D 2ZHFH 4Z0KA 2XW9A 1AE5A 3FOAA 2FYRA 1O2QA 1ZRKA 1SKYE 2ESTE 1C1SA 1PPGE 2UWLA 5LH8A 3CNRA 4DIIH 1GMCG 4WJG2 3FKSD 1UTKA 4X8VH 1TBQH 3SJ8A 3ZVEA 4B73A 1Y5BT 2STBE 4MDSA 3NWUA 1DWEH 4AGJA 1SLVB 2UUJB 3BTEE 3M3TA 4MNYA 3G01A 3E3TA 2BM2A 1K1MA 2AFQB 4B71A 2R3UA 1PJPA 4CRBA 1V2QT 4Y71A 3T2NA 1K2I1 2SGPE 3SU4A 2CV3A 1DM4B 2PFEA 3P8OA 1S83A 1O3KA 4WWYA 1PYTD 1QTFA 3UR9A 2BDGA 2QY0B 1C5LH 1LVMA 2A0QB 5FPYA 2QYIA 1A4WH 1C2GA 1ZHPA 2XBYA 5JDUB 1F5LA 1YLDA 1AFQB 1GHWH 4YOIA 2GV7A 3U8OH 5C1UA 1MCTA 1O32A 1CQQA 1UVPA 4JZ1A 3BTHE 4IBLH 1OWIA 3SHAH 4DVAU 3MWIU 2BD9A 3TH4H 6LPRA 1QIXB 1E0FD 2CHAC 2OBOA 3HK3B 1D3PB 1F5RA 2BY8X 1DFPA 1J9CH 3A89A 4WMFA 1SQOA 1GBFA 4FUCA 1HJAB 4R0IA 3SJKA 1YPLH 1GBMA 1O2GH 5DN6D 1L1NA 1QBNA 3S9AA 1BITA 2HLCA 3GDVA 4ASUD 2G52A 4Y0YE 2SGAA 1XUIA 1QL8A 5K7RA 2OC0A 1CHGA 1TNLA 2O8WA 1QRZA 1W0KD 2V6NA 1ZTKA 2G5VA 1E34B 1SB1H 1QY6A 2XC5A 4J2YB 1P3EA 3KQCA 1B0EA 3SW2B 1Y3XA 3SNDA 1H9LB 1O3NA 2HOBA 4DT7B 4Q63A 2AGGX 2ZWLH 1HJAC 1SGCA 2XNIA 3ATIA 3LC5A 2O9QA 3LGYA 1TX7A 3OY6U 3CENA 1UTLM 1D4PB 1O3JA 1V2ST 1TNHA 2C8XB 2YMSC 6ESTA 3ZZDA 1EASA 1GJCB 2JH5D 3RU4E 5HKKD 3NK8A 2ZQ1A 3NZIA 3W1EA 2RA0A 4BAQB 1MH0A 1N6YA 1WSSH 3MU1A 1Q2WA 4D76A 4ACBA 3BTTE 5IK2D 1SMFE 2GZ8A 3ZVFA 1ELDE 2ZFTA 1RS0A 1QRWA 1GHAG 5A0BA 1G2MA 2PR3A 1TNKA 2AYWA 1GBIA 2QAAA 5IYTA 4ABEA 1TNGA 3SGQE 2NWNA 3SU2A 3V3MA 4Y7BA 1O3AA 2ODPA 4SGBE 1C9TA 3F2HA 3SGAE 1ETSH 4CR9A 2GZ7A 5HM2A 2AGIX 3DT0H 7KMEH 1GHZA 4MLFB 1JXPA 1DY8A 4Z1MD 1YF4A 1A7SA 1GL0E 4X1QU 1GJ4H 1AI8H 4Y6DA 3MU0A 1VITG 2GT7A 2F43B 4D9QA 1OYTH 1ZYOA 2BD7A 2HALA 1L4DA 2FOCA 1YPEH 2H9HA 2Z9LA 1QQ4A 1LCYA 1OHHD 2YNAA 1C1RA 4ABDA 3A7ZA 3BTFE 1S82A 5DKMA 3SV7A 5FCKA 4ACAA 4FXGH 2KFWA 1K1PA 1MKWH 1WUNH 5J4QA 2Z9JA 2ZDMA 4ZHAA 2QXGA 2FOEA 1BBRK 1UVOA 4NZQA 5ESTE 5TCCA 1ZPBA 1FXYA 3UR6A 4HTCH 5C67A 1LQDB 3RXSA 4AFQA 2VH0A 1NRQH 2ZPRA 3QN7A 3RMLH 2ODQA 1BMFD 1Z6EA 3A7YA 4YOGA 4GSOA 3A8DA 4XBCA 2D2DA 3KQ5A 3QO6A 1P2KA 4I7YH 4ZCNA 4FUIA 1SHYA 1DOJA 1O33A 1P2JA 1O5DH 1C1OA 1PYTC 1K1LA 4A6LA 1D3QB 3U8TH 3K65B 2AEIH 4ABBA 1MTWA 1QJ6B 1MAXA 1BTUA 1LKBA 1B5GH 2SFAA 4FUJA 5JB8S 1VGCB 4YLUA 1JRSA 1IOEA 1N6XA 2KX4A 5C20A 3FVFB 1V2TT 4LXBH 4GLYA 3W94A 5HIZA 2NU4E 1ANDA 1O37A 4FU9A 3RXPA 1VCQA 1HAVB 4K1TA 1HAXB 1ZJDA 3VB5A 1MMJN 2XC4A 1T32A 1FY5A 1SLXB 3K6ZA 1HGTH 2HNTF 4KTCA 1V2JT 3U8RH 3ITIA 3A8CA 4AORA 1GJ8B 1BMLA 1T4VH 3PV2A 4ABIA 1CT0E 1VGCC 3BG8A 1ANBA 1MZAA 4Q80A 3L3TA 1W2KH 1FIWA 5E2PA 2A7JA
chains in the Genus database with same CATH topology
4ZXYH 1SR5C 6GCHG 2ZFQH 1DY9A 5AHGH 3A82A 3GICB 1WQSA 5EOKA 2PUQH 1A0JA 1GVZA 1TQ0B 2H5DA 5DGJA 2G4UA 1A0HB 1ZGVA 3ZV8A 3RP2A 4AG1A 4YT7H 3A86A 1BRCE 3D49H 2BDAA 3QZQA 3K9XB 1C1UH 1SOTA 2BY6X 4JCNA 3Q77A 1UK4A 3MO9A 4PROA 1GJ7B 1O30A 1O31A 1W14U 3E8LA 5DP9A 1P57B 1T4UH 1G3DA 1GMHG 3PM3A 4NZLA 1UCYH 1INCA 1O0DH 1YYY1 2OQ5A 1RFNA 3R0FA 5C5NA 1RTFB 2BX4A 2P3UB 1B0FA 1S0QA 2SNWA 1KXEA 1TNJA 1G2LA 4X1SU 3LJOA 2RA3A 1G9IE 4ZKSU 2PKSC 4BNRA 1ELFA 3RM2H 4Q7YA 2BOHB 2ZGHA 2C8WB 3E0NB 1F2SE 2FESH 2BY5X 2WPIS 1HJ8A 1TGCA 2HRVA 3RXGA 4AYVB 5JPMH 4CHAC 3ZZCA 1SOZA 4MPWA 1G3CA 2Z6BD 1TIOA 3TNTA 2BD2A 1NU7B 1C1VH 1QA0A 5L2YH 1PPBH 2OXSA 4R8TB 1RD3B 2B7DH 1C5MD 1L1GA 2B8OH 2ZZUH 4Z6AH 1DX5M 3DD2H 2R9PA 2UUYA 4O97A 1TGTA 2A45B 1V3XA 1O5CB 3UNSA 1JRTA 4M7GA 1V2MT 1FONA 3QUMP 4WY3A 1F0TA 4X1NU 1TX6A 1C5RA 3SORA 4Q7XA 1TGSZ 3SU5A 3M37A 1S0RA 1FDPA 1MQ5A 1SG8B 4XE4A 2H1UA 2R2MB 1EJAA 1ANEA 1VJ9U 5CE1A 5AF9H 2H9TH 3ATKA 3SU3A 4IMQA 3BEUA 5T3HA 1O2XA 1VCPA 4A1TA 4H4FA 4D7FA 4U30A 1QA7A 1ELCA 3UPEA 1C5SA 1NESE 2FOFA 4ISLA 2JETC 1D3TB 2TPIZ 5GWZA 1ELTA 2QF3A 3E16B 4MNVA 3TH3H 2VWOA 4WXVA 9ESTA 1S85A 1RRKA 1W10U 3HGPA 1EUFA 3B8JA 5LPRA 1CHOG 3BTGE 4D8NA 1LQEA 1TALA 2GMTC 2LNCA 4ZXXH 1SSXA 1P03A 2HNTE 1L2EA 4X6MA 2FLRH 1GJBB 1GJ9B 2R0LA 2A32A 3GYLB 3RXLA 4ISNA 4BTIB 1GJ5H 4B2AA 2ZU4A 2ZU5A 1J8AA 3U1JB 4UFDH 3RLYH 2HPPH 3MH6A 1H9HE 1UTNA 1HAYB 3FZDA 4IC5A 3RUOA 3ZZAA 1QB9A 1EAUA 4AFUA 2VNTA 1HV7A 1C5NH 1JIMA 1P3CA 2GCTC 1BA8B 1GPZA 4O3TA 2R0KA 3MYWA 4VGCB 2QF0A 3SU6A 1MKXH 1A0LA 1L4ZA 1WYKA 1ZSKA 1SLWB 2IJOB 2VB0A 3SGBE 2BVXH 3SU0A 1Y5UT 1ELEE 1AN1E 5JBCS 4Q2KA 3TJUA 3VB6A 3BTKE 4IN2A 4DGJA 1YBWA 1C4U2 2CGAA 3SV6A 3EGKH 1UCYE 3SZNA 1THSH 1XVMA 2P94A 3KNXA 2UWPA 1BCUH 3P70B 1LVBA 1KY9A 2FOGA 2VINA 1C2MA 3UIRA 3Q3YA 2CHAB 3BSQA 5JB9S 3CS7A 1AQ7A 1MKXK 2JETB 1DPOA 3R3GB 1HAPH 4A7IB 4RKJB 1OWEA 3NUMA 3MFJA 4Y79A 1ID5H 2GMTB 4X6PA 1SPJA 1TFXA 2FTMA 2BQWB 5GIBA 3RXDA 1P9SA 3EA8A 2K1QA 4CRFA 4I8KA 3PMHB 1EZXC 1LHFH 1H8IH 2G4TA 2FP7B 2VIQA 5DP6A 2NU0E 5E2OA 1G32B 2ZFSA 3SHCH 3LONA 2QA9E 1E35B 1GBJA 1V2RT 4I32A 3VB7A 1E38B 4YM9A 2VWMA 3HATH 1C1QA 1ELAA 3ZZBA 1O2OA 2M5TA 4ZKNU 4BTUB 3SUDA 1BJUA 4JYTA 2OC7A 3F68H 3PO1C 4X8UH 1NRRH 3TU7H 4LZ1H 1O2VA 1P10A 2F9UA 2FOMB 3BTWE 1TMUH 1C5PA 2OBQA 1GI0A 1BOQA 1NY22 3GY4A 3M7QA 2SGQE 5ABWA 2NU3E 5JBTA 2GT8A 1QL9A 2QCYA 1IQLA 2BVRH 3MH4A 3UNQA 4DW2U 3B23B 1YLCA 2BB4A 3A7TA 1NT1A 4CHAB 3MHWU 3KCGH 4YZUA 1OSSA 2UWOA 3ATWA 1IQEA 1O3LA 1LKAA 2AMDA 3E90B 2QV1A 3RXEA 1O2KA 2BLWA 3ZZ5A 1QL7A 1P01A 1CA0B 1MTNC 5HGGA 1C1WH 3ODDA 5EW2H 1LVYA 1QHRB 2UUFB 1FZZA 1LDTT 5A8XA 2QXJA 1LPGB 2LPRA 1DE7H 3M3SA 3MH7A 1BTHH 4ZKOU 3QGJA 5C5OA 2ZNKH 1GDQA 1K22H 4B74A 3SJOA 5BPEA 1FQ3A 4BAKB 2BXTH 1C5YB 5FAHA 1EQ9A 1PPCE 3TGIE 1GMDG 1AGJA 3W95A 3BG4C 1IQJA 4I8GA 2JH6D 2WYGA 3PTNA 3E91A 5EPNA 1D3DB 3PTBA 3TJNA 1GI6A 2JKHA 4FUFA 3M5OA 2A5AA 2FX6A 3RMNH 1GCTC 5EXLA 2BD3A 3ZYEA 2OD3B 5C1XA 4X2WA 1LHDH 5T6DA 2KAIA 3BIVH 1E36B 1YGCH 5FCRA 2R3YA 3PYHA 4KKDA 1UVSH 4KELA 1SI5H 2H6MA 1OP8A 2J9NA 1XKAC 4B2CA 3UWJH 1DANH 3PLPA 5EQQA 3ENSB 3RXUA 2FMJA 3KN2A 3RXHA 1GBKA 3QGNB 3A8BA 1V2NT 1OWKA 1YPKH 4FU7A 3RXVA 3TK6A 1Y3YA 1SGNE 4BTTB 6CHAB 1THRH 2TGPZ 1AIXH 1UTPA 1HYLA 2PTNA 4U01A 4NFEA 1IQMA 3MTYA 1O3GA 2ZQ2A 3UQVA 4CREA 1TNIA 4GHQA 2BX3A 1XMNB 1SGIB 1UHBB 3HK6B 2VGCC 3PB1E 1K1JA 4XFQA 3BEFB 1UO6A 5HYOA 1A3BH 4I8LA 4CRAA 4AYYB 2FDAA 5A8ZA 2V0BA 1MZDA 1TGBA 2VIDA 1GBEA 2W7UA 3HPTB 3E6PH 1GBLA 4KTUA 1MBQA 3GCOA 3A84A 3STJA 1TABE 3TK9A 3MNCA 2GKVE 1AO5A 1UTJA 2OCVB 2PHBA 3SQHE 2VGCB 1W0YH 2AS9A 4KGAA 5GJ4B 2GX4A 3A8AA 3AAVA 3P8GA 4XBBA 1BBRE 1GJ6A 2W7SA 4BOHA 2BDHA 1O2WA 2ZHQH 5AFYH 3A80A 1S6FA 1UHBA 4ZAEA 1BB0B 3O8RA 3RXQA 2ZC9H 2ZGCA 1TPSA 2ZHEH 1AD8H 1O3IA 2V3HH 3GY3A 1BMAA 1O3PB 1QNJA 3A7VA 1T31A 2G00A 2GV6A 1FUJA 1P0SH 2Z3EA 1BDAA 5A09A 3RM0H 1NM6A 1W8BH 2ZU1A 2CF9H 2OP9A 5GCHF 5DP3A 4ISIH 1AMHA 1S5SA 1C2JA 5SGAE 2ZKSA 4GPGA 1GVKB 4JYUH 1PPHE 1PPZA 4YO9A 4IC6A 4K3JA 1SLUB 3U98H 1FMGA 1FJSA 5ESBA 1BRAA 4GHTA 2FPZA 1MTUA 9LPRA 2FI5E 3P95A 3S69A 1BT7A 1NRPH 3UY9A 1IQIA 1WTHD 4Y76A 2GCTB 1LMWB 2Q6FA 1UJ1A 2FOBA 8LPRA 1C5WB 1KIGH 4RKOB 4HI3A 2Z3DA 3F6UH 4ZROA 4LK4A 1SQAA 2WINI 1T8LA 4X2VA 3SI4H 3M7TA 2FODA 3MH5A 1BQYA 3VXFH 1V2VT 1KTSB 1RIWC 3MU5A 2CF8H 3SV8A 2ZGJA 1LTOA 3UOPA 3RXTA 1CSOE 3SN8A 4ABAA 2EA3A 1TPAE 2J95A 2BOKA 1ESTA 2PGQB 2THFB 2ALPA 3S9CA 3ZVDA 5CHAB 3KQEA 3SQEE 1FN6A 1TBZH 1WQVH 1SGFA 3FANA 1L0ZA 1YPHC 1OX1A 2HVXA 1AZZA 4D7GA 3PMBB 1HUTH 2GDDA 1BTPA 1NPMA 4Y8YA 2V3OH 2OLGA 1JMOH 1EX3A 1FN8A 1QBVH 3DHKH 1ZTJA 2Y82A 1GHVH 3ZVAA 4CH2B 1IQFA 4O3UA 4XBDA 4JZDH 1L1JA 1TBRH 4ISHH 1AU8A 3VFEA 2PKSB 5FPSA 2XWAA 3TJVA 5EPYA 3QDZB 1MTSA 1DSTA 2ANWA 4UE7H 3EAJA 1C5XB 3RU4T 1GHYH 1IQKA 2W3KA 3M5MA 4GVUA 1Y59T 3T25A 1GI1A 1TOCB 3O8BA 5F8TA 4FU8A 3RXAA 3P17H 1PQ8A 2ANYA 3GCTF 1YM0A 3ESTA 4X6OA 1O3FA 4AFSA 4FVDA 2YOLA 1HAZB 5LPEA 2F9BH 2ZF0H 4NWLA 2VJ1A 2PTCE 4DCDA 1KXAA 5A8YA 1XKBC 3S7HB 1TA6A 2QXIA 3RXRA 1CU1A 1DDJA 1CT4E 1Q3XA 3BEIB 1S81A 4O03A 2STAE 3UWIA 2Z9GA 2AIQA 5T6GA 1O3BA 4K1SA 2ZDNA 1ARCA 3PMAB 3M5NA 2C3SA 1AFEH 4X2YA 1IHSH 2XXLA 1O3CA 1O2PA 2ZU3A 1OKXA 1WOFA 2G81E 1GG6C 3OU0A 1PQ5A 1V2KT 2BD5A 2W5EA 1O2NA 5B6OA 1AUTC 1TQ7B 1TRMA 4BAHB 1B7XB 2EI7A 2P59A 4IMZA 4CBOA 2A5KA 4KP0A 1EATA 2XBWA 3RC6A 1HJ9A 3U9AH 2HNTC 3O8DA 2Y7XA 2SGFE 1P2QA 2PKAB 3HGNA 1P05A 4BXSA 4OGYA 3TH2H 4ASHA 1SGPE 4Y7AA 5BRRE 1W0ZU 1FY8E 2W3IA 1VITH 1Y5AT 2ANMH 2Z3CA 3KQBA 7GCHG 1U6QA 1ZHMA 1QFKH 3ZV9A 1TE0A 3GCTG 2Q1JA 2ZHWH 2F91A 3EDXB 1O2LA 1T8OA 3IWMA 3EYDA 1O3EA 5E0JA 4NIWA 3MO6A 1KXCA 5DG6A 1GBDA 1E37B 1O2TA 4BANB 3KHVA 4UEHH 2BHGA 2RDLA 1YPJH 1C2LA 3RLWH 1O39A 1CA8B 1W11U 3LGUA 1EPTA 3PO1B 3E1XB 3I78A 1SGEE 2P8OC 5F6MA 1AUJA 1C5OH 3LC3A 3RXFA 1DVAH 1GHBF 1K1IA 2FOAA 4X6NA 2PSYA 1A5GH 3LU9B 1Q31A 1KXBA 2FTLE 1C2HA 5FBEA 3I77A 3GDUA 1Z1JA 3LOXA 3AASA 1FY3A 2A5IA 3MMGA 1XUJA 3VGCC 1MD7A 3GY5A 3U69H 2BXUH 1TRNA 1UVUH 2D8WA 3B9FH 2FI4E 5EXNA 4WH8A 1H9IE 3E0PB 4ZUHA 4RN6A 1GG6B 1RIWB 3EA7A 1RXPA 5EQSA 1UCYK 1ZSJA 1HPGA 2BTCE 1J15A 3M7UA 3QK1A 4MG3A 1THPB 2PSXA 1XUKA 1DWDH 1YPGH 1J14A 1A5HA 1D9IA 4IGDA 4X0WU 3VB4A 1EOLA 5GDSH 1GCDA 3NKKA 4MNWA 1DLEA 1ELVA 1EOJA 1AKSB 2ZFRH 1ZSLA 1AY6H 3D62A 3IITA 1ZMLA 2RCEA 3F9HA 4K5ZA 3ZZ7A 1ZTLA 2ZDAH 4F4OC 1MAYA 3MU8A 3M5LA 4NIXA 4THNH 1TMTH 2XBVA 3TGKE 4TPYA 3ZYDA 4UFFH 4YT6H 3T29A 3ZVGA 1IAUA 8GCHF 5CHAC 3DFLA 2WPMS 3F9EA 7LPRA 1LO6A 5JBBS 3VXEH 4CH8B 1UMAH 1O3OA 2GCHG 4CBNA 4K60A 1YCPH 1ABJH 1O36A 2A4GA 3RDZA 1T8NA 2VVVA 3S9BA 1BIOA 3ATLA 5GCHG 1AVXA 4OS7A 1MQ6A 5EU8A 3BV9B 1O5FH 2H2ZA 2P3TB 3FFGA 2OC1A 1O2RA 1N8OB 1XX9A 1RJXB 1QB6A 2B0FA 4TY6A 1BJVA 1TMBH 2C93B 1SVPA 1ZGIA 1Z8IB 1Z8JB 3ZZ3A 2A2XH 3LJJA 1GMCF 1O3MA 4ESTE 5H4IB 2AMPA 2IPHA 1NZQH 3NPSA 1GI9B 1V2OT 3UFAA 2XTTB 4I8HA 2OUAA 3O8CA 1ZR0A 4ABHA 4A92A 2BZ6H 4UFGH 4BXWA 2WPKS 2P3FH 1WU1A 2ILNA 2BY7X 1EKBB 2WUBA 1RTLA 2C4FH 1KLTA 3KGPA 2V35A 4DIHH 2WV5A 3TITA 1O34A 3AW1A 1NO9H 3TGJE 1JBUH 7ESTE 2BDCA 1TX8A 5C3NA 1VITF 3KIDU 3NCLA 2NU1E 3FZZA 3VB3A 2A7HA 1XUGA 1NFWA 3GY7A 1O35A 1MU8B 5FPTA 3TJOA 2ALVA 1G37A 2GCHF 1EJNA 2J94A 1DWBH 5EQRA 2H9EH 1BHXB 2TBSA 3BTME 1SFIA 3F1SB 3FP6E 2WYJA 4NIVA 2G55A 2ZO3H 1ZPZA 4Y11E 1RGQA 5TJXA 4K8BA 3MU4A 1TGNA 2G8TA 2PLXA 1GL1A 1EP6A 1P12E 4OS1A 3TNSA 3V0XA 3N7OA 3DFJA 2OQUA 3ATMA 3PMJA 3SNBA 1BMNH 4TWWA 1X7AC 1JOUB 4YLQH 2P93A 2NU2E 4U32A 4X2XA 1MU6B 1TWXB 1Z6JH 2ZA5A 1BRBE 4INHA 1AB9C 1MBMA 1UK2A 5DPAA 1P11E 1OPHB 1VZQH 1DITH 1GJDB 1QR3E 3SNEA 3V12A 2QGRA 4XDEA 1ARBA 5EW1H 2AH4X 6GCHF 2BQ6B 1Z8RA 4YTAA 3T62A 2P16A 3BTQE 3MOCA 1C2IA 1P06A 1O5EH 1EZUC 1BTZA 4NCYA 2ZCKP 3T27A 2C90B 2SNVA 1BRUP 2WV4A 1NROH 1AB9B 1HCGA 3GCNA 1P8VC 3SNCA 3LGVA 4UFEH 1ETTH 4X1PU 1OS8A 1DXPA 2F9VA 4TPIZ 3V7TA 3P8FA 1AE8H 3A85A 2GGVB 4WH6A 3BIUH 5C2ZA 3SUGA 2BVSH 4TY7A 1TB6H 1Y3WA 1F0SA 1CVWH 1CT2E