3PYHA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pyhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pyhA02
4GUXA 4K60A 4ISOA 2ASUB 5DP7A 4ZHLU 1P05A 1A3BH 3SN8A 2R0LA 1O2KA 2GMTC 1F0SA 1IQFA 1NRQH 1YYY1 4NIXA 1MCTA 1BZXE 3MNXA 3UNSA 1A5HA 5EXLA 2SGAA 1C5MD 1EKBB 1QA0A 4Y11E 3PO1B 5FBEA 2BDCA 3SV2H 4BAOB 5HGGA 3RC4A 2LNCA 1C2MA 1S82A 2O9QA 4KTCA 1HAIH 1VITF 1K2I1 3SV9A 1CU1A 1CBWC 4DG4A 2XBXA 3FP6E 4WY3A 1C5RA 2BLOA 3AVZA 5A8XA 5JDUB 1ACBE 4GHQA 2BX3A 2F91A 2PKSC 3A89A 2ZPRA 3LH3A 1DLKB 2IN2A 1ARCA 5EW1H 5LGOA 1RXPA 2G81E 1P2QA 4IBLH 4NCYA 1H9IE 1GBEA 1JMOH 4VGCC 3HK3B 3SQHE 1C5LH 1SL3A 1O5CB 4FUJA 4YOJA 1V3XA 4Y8YA 1CSOE 2BD5A 1ESAA 4LK4A 5HM9A 3LGUA 1TGTA 5ETXA 4MQAA 1Z1JA 3SV8A 1C1PA 1NPMA 3E90B 1C9TA 1T4UH 1DSTA 5E0HA 2GV7A 1O2XA 2BDAA 1GBCA 3ZV8A 2P3UB 1B7XB 3K6YA 3ZYEA 1DT2A 2Z7FE 4YOGA 1AVXA 4ZXXH 1NTPA 1NRPH 4X1NU 2PR3A 3LC5A 4Y10E 3T26A 4A5TS 1QB6A 4TPYA 4DJZB 2STBE 3Q3YA 2RDLA 4BTIB 4ISNA 4ABHA 1YPMH 3F9GA 3S9CA 4E05H 3U8OH 2PGBB 2FOAA 1C2DA 3ELAH 2WPLS 1F5KU 3RUOA 2Z9JA 1GBAA 2P59A 1GI2A 4GVUA 2PW8H 2FPZA 4HZHA 5JBAS 1S5SA 1C1SA 4Z6AH 1TNKA 2G5NA 2A4OA 2W3KA 1AKSA 1GBIA 2WINI 2I6QA 3LJJA 6GCHF 2THFB 3GCTF 2OCVB 5GCHF 5JBCS 1GWAA 1P12E 2FMJA 2XW9A 1JRSA 1WCZA 2ZTXA 2OC8A 3JZ1B 2ZFFH 1LPZB 2WPIS 2PKAB 4MTBA 5K0HA 1V2PT 6CHAB 4XSKU 2H5DA 1NC6A 2QF0A 3TLOA 4H4FA 1QBVH 1VITH 2R3UA 1G2LA 1KXBA 5FX6A 1LCYA 3TH4H 1BUIA 1JOUB 1P11E 2VWOA 3A85A 1V2MT 1C4U2 4D9RA 1DOJA 2C8ZB 1MQ6A 1TNLA 1L2EA 3T5FH 1BQYA 1CT2E 5FHTA 9ESTA 3KQCA 2C90B 1L4ZA 4WJG2 1MAYA 4JK5A 4AFUA 2P93A 2Z9KA 1PYTC 3A83A 2P94A 4ZKSU 3ZZ4A 1ANEA 2LPRA 2A5KA 3TJVA 2PSXA 1ELTA 1NO9H 3SNBA 1HJAC 1O3OA 1K1OA 1BHXF 2BY7X 3B9FH 1GBTA 4GCHF 1QA7A 2R0KA 3ZZ8A 1HDTH 5FPTA 4TY6A 4IC5A 3SNCA 1GBDA 1GGDC 3BEFB 2QCYA 5EPYA 3SU1A 3SW2B 4XBDA 4ZMAH 2FS9A 2H9TH 2O8LA 2IJOB 3BG4C 1TX6A 2FYRA 5AFYH 2VIOA 2ZHWH 2VGCC 1C5UA 3Q3XA 5T6DA 2FLBH 1PQAA 3LJOA 4U32A 1NZQH 1H1BA 2ZWLH 4KTSA 5TCCA 2FOHA 1EJNA 1RTFB 5L2ZH 3KGPA 3SU4A 1SLWB 3FZDA 5LPEA 3GDSA 3QK1A 2BDGA 3E16B 5EQRA 2GCHF 4NSYA 1SI5H 2ZIQH 1LHDH 2PSYA 3Q77A 3GOVB 2BM2A 3LOXA 3SHAH 1C1VH 1PQ8A 1LQDB 2FLRH 1T32A 3F1SB 4FU7A 3GCNA 1UVPA 3S0NA 1EPTA 1O3EA 1KXEA 2OTVA 2ZCKP 1BMLA 3PB1E 1ZSJA 3EE0B 2HLCA 2ZFSA 1GJ5H 4FVBA 3DHKH 1TA6A 4K5ZA 4O3TA 3ZZ3A 3B8JA 2GX4A 4ZKRU 1GHBG 1OOKB 2P16A 2BQ6B 3UWJH 3VXEH 1GHWH 2QGRA 4BANB 1HAVB 4TWWA 3VGCC 1TE0A 4RKOB 1O3AA 1YCPH 1FV9A 1XKAC 4K8YA 2ZDMA 1B0FA 2OBQA 1EQ9A 5CHAC 2DUCA 8GCHG 1V2UT 1GDNA 1GBMA 2FYQA 1GMCF 3LGVA 1SLUB 1TBRH 1ANCA 1TPAE 4UEHH 5LH8A 5T3HA 2FODA 2Z9GA 4ISLA 4ABDA 3P92A 3U1JB 2Q1JA 2A4QA 5FAHA 1W0ZU 4IMZA 1WQVH 4NZLA 3HGPA 5JYIA 3BIUH 3TH3H 2H2ZA 1SGYE 3TPIZ 4YZUA 2B9LA 4NA8A 1DWDH 2G8TA 3MU4A 1KXCA 1ZTJA 4YM9A 1BJUA 5F8XA 3SU5A 2CMYA 3SU6A 3SGAE 1GI9B 2J95A 3M3SA 2AH4X 4ZHMU 3P8NA 4CREA 1VITG 1SPJA 1IQJA 2ESTE 3BTDE 1J15A 3EDXB 3RU4D 2PTCE 3GICB 4Q7ZA 4X8SH 2BDHA 2B7DH 3DT0H 1EP5A 1T8MA 1LHEH 2AGEX 1P10A 1T4VH 2TIOA 5DKMA 1WTHD 2GT8A 4KTUA 2NU1E 1KLJH 2C4FH 2F3CE 2ZGXH 3RXTA 1THRH 3SHCH 1ZTLA 1LVMA 1K22H 1NRNH 1PPBH 2A7JA 2QN5T 4B74A 1PQ5A 5FPYA 1XXFA 1TNGA 1DX5M 3UOUA 1FI8A 1KXDA 1TIOA 4F4OC 4UFDH 1DY8A 1DSUA 2RA3A 4BTTB 3P70B 1SVPA 5DG6A 1C5TA 1J8AA 3M5MA 1UK2A 4I7YH 3UNRA 2CHAB 3PV4A 1ZHMA 3I29A 1UCYH 1UTOA 2OINA 1C2KA 3ATKA 4QT8C 1EB2A 1L1NA 1ELGA 2RCEA 1C5WB 2H5CA 1ZOMA 3NPSA 4NIVA 1AUJA 5GIBA 3V3MA 1EOLA 3EA8A 3IITA 1TONA 2ILNA 2ULLA 3DFJA 3KNXA 2WUCA 1SC8U 1GI1A 1PFXC 2ZFQH 4JZEH 4XE4A 1TGSZ 2ZQ2A 1SSXA 2ZG0H 1ELFA 4UFGH 1C4V2 4FUBA 1GHXH 3LGWA 1EX3A 2XC5A 2GV6A 3TK9A 3QTOH 2ZDKA 2G52A 1CA0B 2BDIA 1ELBA 2ZDVH 1JWTA 1C2EA 2BD8A 2FS8A 4ABAA 1QL9A 2UUFB 1CGHA 1TNIA 1O5EH 1OWIA 1X7AC 3A80A 4I32A 2XCFA 3BEUA 4JYTA 4NA9H 2UUKB 3GCTG 5GCHG 3ATLA 6ESTA 1GI5A 4CHAC 1DDJA 1QCPA 1C1UH 3H5CB 1YPHC 1XVOA 1C5QA 1OPHB 1C1NA 1UTKA 2SGDE 2VVCA 1YC0A 3KQBA 1NY22 3RLYH 4GLYA 1SOZA 2ZFTA 1QQ4A 4NA7A 1KXFA 4DIHH 2A45B 2PKSB 3N7OA 2GD4B 3RC5A 2YNAA 4RSPA 1ZPCA 2NU0E 2BVRH 1C5VA 2TBSA 1ESTA 1CHOG 1RIWB 1PPZA 2P8OB 4K1EA 5C5NA 1O3HA 1SGCA 4VGCB 2Q6GA 1UHBB 1ELVA 2FOEA 3D62A 1H9HE 4X2XA 2D26C 1O3NA 5HM2A 2QXIA 5E2PA 1T31A 1VGCC 4THNH 1OWDA 2Z9IA 2VH0A 1CQQA 4WF8A 1RFNA 1C1WH 1V2TT 1DANH 1NROH 2KAIB 2FX4A 5AHGH 2BDYA 1K1IA 1N1LA 3ZVGA 3FANA 4RKJB 4X2YA 4D76A 2HPQH 4SGAE 5A0AE 1O38A 1D3DB 1GJ8B 1CE5A 1AI8H 1O5BB 7ESTE 2VIVA 1HFDA 4JMYA 1D3TB 1HLTH 3LKWA 4B2BA 1O3KA 4NWKA 2P3TB 3LH1A 3UR9A 2QYIA 1ZRBA 1IQIA 1IQEA 5CE1A 4ISHH 1YPJH 3PTBA 1O2UA 3RXAA 1BIOA 2AGGX 2OBOA 2G5VA 4X6OA 2AGIX 5F8TA 3EA7A 5T6FA 3T29A 1E38B 3K2UA 5EPNA 1P09A 1GJBB 1V2JT 4MDSA 2Y5GA 1A0LA 4AORA 4KELA 4TWYA 4OS6A 3P95A 2J2UA 3RMOH 4TYDA 1IQNA 1QTFA 5GJ4B 4AGKA 4CRFA 2BHGA 3LGTA 5FCKA 1WUNH 1XX9A 2ZDNA 3MI4A 3H7TA 2ALPA 4ZUHA 3TNSA 4GPGA 2D2DA 2QY0B 1HB0B 1K1JA 2FZZA 3D23A 1O3PB 1BTUA 1DXPA 3K6ZA 2PUQH 2PKAA 1F2SE 4DIIH 3E91A 4ESTE 4BAHB 1EJMA 1NRSH 1PPHE 2AIQA 5A8ZA 1GI3A 1P9SA 2BY5X 1AZZA 1BRCE 4NWLA 1KY9A 1AWHB 1LHFH 3IWMA 2F9OA 4ZH8A 1Y59T 4FUIA 3RXUA 1YCPK 1NU9A 1FY4A 5T6GA 1AZ8A 4JYVH 1KYNA 2ZGHA 1LVOA 1GMCG 2Z3EA 4CR5A 2FDAA 8GCHF 3MU5A 2ZGBH 4ABGA 1FDPA 1QURH 4R0IA 1TFXA 1NU7B 3QDZB 1KDQB 4NZQA 3NUMA 3UTUH 1HJAB 1HRTH 1SHHB 2VIQA 3PMJA 5DP8A 2PLXA 1MTUA 3RXHA 3U98H 1MTWA 1IQGA 1EZQA 2TGPZ 4AN7A 1BBRK 1AB9C 1LPGB 5JB8S 4I8GA 4BXSA 3BTWE 2SGEE 2A2XH 1M9UA 2CF9H 3HK6B 4NFFA 5K7RA 1E34B 3BG4B 5JB9S 2ZU2A 1FXYA 1YP9A 1IAUA 2WV5A 1LHGH 3PLBA 1KIGH 3BTHE 3NCLA 1TABE 4FU9A 5EOKA 2VGCB 4CRDA 3W95A 3EQ0H 3PM3A 1QJ6B 1T8OA 2GCTB 1Y5AT 2WPMS 1MMJN 1P01A 1FPCH 3BF6H 1O3BA 1C9PA 4FXGH 1ELCA 2ODPA 3STJA 4BTUB 2FEQH 4FUHA 3ZYDA 1O31A 3GY7A 2NU3E 3QWCH 1AN1E 2CF8H 1GJ4H 1O2ZA 2EI7A 4CRBA 3UQOA 4Q80A 2ZHEH 1BTPA 3RXQA 1CO7E 2FXRA 3UFAA 3RM2H 1D4PB 2NU2E 4I8KA 4JCNA 1GI4A 3TU7H 1K21H 2ZHQH 3TIUA 3M3VA 3BTKE 1FONA 1GMHF 3SI4H 5GWZA 2VVUA 1ZPBA 1HBTH 2C93B 5JPMH 2FX6A 2BDBA 1GI7B 4JZFH 1GL1A 1NFUA 1ARBA 1TPPA 3BEIB 3P8OA 3ENSB 1U6QA 2Z94A 4PROA 3VGCB 5A2MH 4K8BA 3G01A 3QTVH 1E37B 1PJPA 1INCA 1KTTB 2QXJA 1HAVA 3MU0A 4HGCA 2Y7XA 2VVVA 2V6NA 2VIPA 1FN6A 2Y80A 4JZ1A 1O5AB 1A0JA 1OS8A 4K1TA 4BOHA 1GVLA 1SGPE 1C2IA 3VB6A 2XNIA 1HCGA 1Z1IA 3U69H 4Y6DA 3SJOA 1O2HA 1O0DH 4ABJA 1DPOA 5LPRA 1MZAA 1W8BH 2FIRH 5E2OA 5I46H 2A4GA 1FNIA 4MPXA 2GZ8A 2BYAX 4YLUA 3GY8A 2ZFPH 1QJ7B 1FZZA 1CGJE 1FMGA 2BLWA 1OWJA 1O3MA 4XOJA 1QRZA 4AZ2B 2WYJA 2OLGA 1OP0A 3A8DA 3T27A 1DICA 1XUGA 1O2QA 3BTGE 1MQ5A 1VR1H 3GCHC 1O34A 2D1JA 1SR5C 3RXEA 2QV1A 3M7QA 2P3FH 1ZHRA 5E0GA 4OS7A 1O36A 1K28D 1YPEH 4XBCA 1DY9A 1OP2A 3OTJE 3UUZA 7LPRA 1ZGVA 3BTME 3AW0A 3SUGA 3UIRA 3MH7A 2ZCHP 3SZNA 3OX7U 4DT7B 5IDKA 5A8YA 2XCNA 1BMAA 1S81A 2R3YA 2SGFE 3ZVCA 4B71A 4Q7XA 4U01A 2ZDAH 2Y82A 2TGTA 4DGJA 4TY7A 3AAVA 2SNVA 4H6SB 1EXFA 3A7ZA 3PMHB 3HGNA 1MUEB 4FUCA 1TRYA 1Z8JB 1MCVA 1UVOA 2UWPA 3MH6A 1A0HB 2JETC 2HVXA 1A46H 4BXWA 3M5LA 3O8CA 1F5LA 1CHOF 1QBOA 4B1TA 1XUKA 2A0QB 4LXBH 1J17T 1XUIA 3ATWA 1F5RA 2HNTF 3RMLH 4X8UH 4DW2U 5C1YA 5AF9H 1ESBA 1UO6A 2BVXH 3A7WA 1THSH 3QUMP 3LC3A 1BTXA 1GL0E 4KKDA 1NESE 1DUAA 1SGNE 3RLWH 2O8TA 1EAUA 1VCQA 1H4WA 1HAPH 4MVNA 2Y7ZA 3P6ZB 4X6MA 3SUEA 2IOTA 1MKWK 1C1RA 1D3QB 3KEEA 1AVWA 2OC0A 2Q6FA 1Z8IB 3VB5A 2J38A 4IN1A 2J9NA 2ZTZA 4NSVA 4X2VA 1BDAA 3SU2A 1C1MA 2HRVA 1A2CH 2B5TB 1BRAA 1T8LA 3SORA 3OY6U 3R3GB 3RXDA 3R0FA 1IQLA 4LZ1H 1O5GH 1MBQA 2NWNA 2ANMH 1C5YB 5ABWA 1O35A 2ZPQA 3FZZA 2B8OH 2Z3CA 1ABJH 3RXRA 1HAYB 1W0YH 3A7VA 1TALA 2WUBA 3ATIA 1UVTH 1TB6H 2HALA 1O30A 4CHAB 5L30H 5IYTA 3I78A 3ESTA 4B2CA 5LPFA 5EQQA 1HGTH 1LTOA 3H7OA 2BY9X 4MNYA 4MPUA 5C67A 1DXWA 1Q3XA 2A7CA 2Y81A 1BITA 3EA9A 3SJKA 1Y3YA 3S7KB 3ZVDA 2XWAA 5FCRA 3AW1A 1LKAA 3W94A 2HNTC 5DGJA 1BTYA 1FAXA 4CRCA 4INLA 3GDVA 3UQVA 1GHZA 1Z71A 3QGJA 2OXSA 1BB0B 2ODQA 4DOQA 1BBRE 3LT3A 1ZJDA 5HMAA 1W3CA 3PLKA 1RJXB 2G00A 1HJ8A 1QY6A 1O37A 2ZO3H 1ZYOA 3CS7A 1HXFH 3MO3A 1UHBA 1GHAG 1YBWA 2FOBA 4JK6A 1VGCB 3HPTB 4X0WU 1TRMA 4FVDA 3M36A 1SMFE 2O8UA 3PTNA 1TPSA 2VIWA 1TBQH 1TLDA 1PPCE 2BXUH 4GSOA 1P2NA 1HAGE 1V2QT 2KAIA 1W7GH 1RTKA 3ZV9A 2XBWA 4AG1A 2FI5E 2O8MA 3VB4A 3VB3A 4ZKNU 1O2VA 1DVAH 4TPIZ 1NFYA 2ZECA 1P57B 1Y3XA 1C2LA 1P2IA 5FX5A 1BCUH 6LPRA 3ZZ5A 2F9NA 2VIDA 1ID5H 2R2WU 2TGAA 2OUAA 1ZTKA 3KL6A 1W12U 1WAYB 3A8BA 2TPIZ 3M3TA 2G51A 3E0NB 3B23B 2YOLA 2ALVA 4X2WA 2HPPH 1JIRA 1SG8B 4Z0KA 2O8WA 2BLVA 3P8FA 2CXVA 1YPLH 4MNWA 1S83A 1Z7KA 3UOPA 1O33A 3KHVA 4CRGA 1P3CA 3L6PA 1L4DA 1HPGA 1QRXA 2GZ9A 2R9PA 4KP0A 1WYKA 1SGEE 2BB4A 3L3TA 1WU1A 3A88A 4AFQA 1IQKA 1C2HA 3F9FA 1XVMA 1UVUH 1UTLM 2ZP0H 4ZROA 4ABIA 3BV9B 1ELEE 4LZ4B 1EZSC 1GBBA 1GJCB 1GMHG 4OS2A 4MPVA 2F9PA 1EUFA 1O3IA 4O97A 3MU1A 1IHSH 1YPKH 1ETRH 2J94A 1GPZA 1GCDA 7GCHG 3LGYA 3VFEA 4X8TH 2XYAA 2XTTB 3F9HA 4XFQA 1SGTA 3DD2H 1FIWA 2J92A 3ZVAA 1QB1A 1HIAB 1ELDE 3TJOA 2VWMA 1UK4A 3Q3KA 2VB0A 1V2VT 1LO6A 1W13U 2XC0A 1C2GA 1SGFA 2BMGB 5EQSA 3UR6A 4I8JA 2AYWA 4AB9A 1O39A 1KDQA 1UTNA 4WH8A 1SLVB 4MNXA 5EG4A 1TYNA 2H6MA 1O2JA 4ASHA 4UONA 2W5EA 2TRMA 4CH8B 3SO3A 1AB9B 1XUHA 2GMTB 1LMWB 1E36B 2Q6DA 1HNEE 1BA8B 3M7UA 4UE7H 5EXMA 2F83A 3V0XA 1O3DA 4INHA 5EGMA 4Y8ZA 1ANDA 2ZU3A 1CT4E 5DP6A 1YF4A 4AFZA 1TGNA 1TMTH 3E3TA 3PWBA 3K65B 1O2RA 1NRRH 5J4QA 4HI3A 2C8WB 3BTQE 2J34A 2DE8A 3AASA 3DA9B 3E8LA 1CBWB 3GY3A 4UFEH 3SGBE 1HAOH 1LPKB 2ZGCA 5ESTE 1ZLRA 2G55A 1YKTA 3TK6A 3M7TA 1EB1H 4IS5A 3FAOA 1RRKA 4IMQA 1F0RA 1MD7A 1S6HA 3RXVA 3V12A 3TH2H 1EATA 3M61U 1DITH 2VJ1A 3ODDA 1THPB 2STAE 3GDUA 3A81A 2D8WA 1QIXB 1HAHH 1VZQH 1W10U 3IG6B 5DK1A 1LKBA 1QNJA 1FY5A 4YTAA 3QGNB 1NFWA 1GBLA 4Y71A 4IGDA 1O2LA 1MTVA 1O2IA 1L1GA 1SB1H 1YGCH 1FY8E 1GG6C 5DP9A 3OU0A 1J16A 2QA9E 1FUJA 2BQWB 2FESH 4B73A 3LIWA 4FUDA 2VINA 4Y0ZE 1BRUP 3CENA 3RM0H 2C8YB 1MU6B 3KQDA 1WV7H 3MHWU 1OX1A 1WBGB 2ZI2H 4K3JA 1FY3A 4Y79A 1AO5A 4WH6A 5C20A 1DM4B 5EXNA 3MNSA 1MAXA 1YCPM 1WOFA 3MH5A 2BOHB 4B2AA 2V35A 3K9XB 2C8XB 1BOQA 5GXPA 1QL7A 4E7NA 3QN7A 1ZZZA 4O9VA 8KME2 3FP8E 2ZHFH 2QIQA 4WMEA 1TOCB 4MNVA 1DUEA 2BX4A 3PMAB 1Y3UA 2ZDLA 2BZAA 3SJ9A 1GBFA 5JBBS 1EP6A 1FY1A 1O5FH 3MNCA 4SGBE 1B0EA 2A31A 3RXOA 1ZSKA 3GCHB 1A1RA 1HJ9A 1MU8B 3SU3A 4I8HA 3RC6A 2JH5D 1TAWA 4AOQA 1EZUC 2BXTH 2V0BA 4ABEA 4IN2A 1S0RA 1H8IH 1AQ7A 1AGJA 2AFQB 3SU0A 1ZSLA 5EODA 2H1UA 3NK8A 3RXPA 3STIA 4DVAU 1JIMA 1SLXB 1OSSA 1P04A 2A1DB 3SJIA 1GI6A 1OP8A 5HYOA 1C5NH 1MBMA 5EU8A 4A92A 1G3EA 4MG3A 1AE5A 5GDSH 1K1NA 1P2KA 1N6YA 2CGAA 1Q31A 1HYLA 4CR9A 2A5AA 4J1YA 1BTZA 2UWLA 1EAIA 2PV9B 3ZZDA 4HTCH 1TGCA 2CV3A 1Y5BT 3MTYA 2DE9A 4ABFA 1GHAF 1GCTC 1SQAA 3PWCA 3TVJB 5C3NA 1AFQC 2BTCE 3A7YA 1FN8A 1V2KT 5C1UA 3SNDA 4AFSA 2EEKA 1O3FA 2AMPA 1D6WA 4Y8XA 4X1RU 5BRRE 4ABBA 3SNEA 3S9BA 1XUJA 2GGVB 4J2YB 1UJ1A 2SNWA 4OS5A 1JBUH 1NT1A 1GGDB 4AYVB 2YNBA 2BLQA 4M7GA 1K9OE 1MD8A 1ZJKA 1EAWA 1C2FA 3VPKA 2ZU5A 1A61H 1L1JA 2GDEH 1ETSH 5HXFA 4WMFA 1G3CA 4D9QA 3URCA 1XM1A 3SV7A 1CA0C 1P02A 1JRTA 1T8NA 3MNBA 1HV7A 1MTNC 2ZF0H 1BT7A 2QXGA 2ZPSA 1S84A 4BAMB 5F8ZA 1IQMA 2FOMB 3BTFE 1P2OA 1EPTC 1Y5UT 3KCGH 3U8RH 1C5SA 4ZHAA 4FUFA 4DURA 4A6LA 3PLPA 2ZGJA 4BAKB 3F6UH 3S69A 1G3DA 3UNQA 1AY6H 1G2MA 5TCAA 4JZIA 1GDQA 1XKBC 2FTLE 5H4IB 1Z8RA 4YO9A 1OYTH 1CT0E 1GBHA 1UK3A 2AS9A 2Y5HA 4NIYA 3RU4E 1DWEH 4WXVA 1QR3E 2EA3A 1VJAU 1SGIB 1K1PA 3A87A 3KQEA 1G37A 1CA8B 1RIWC 1V2LT 7GCHF 2P8OC 2XRCA 1UCYK 1ETTH 5CHAB 4AB8A 1WQSA 1BHXB 1OWHA 2BVSH 1OWKA 4CH2B 1HUTH 1XXDA 1PQ7A 1BMNH 2BD4A 3SQEE 1AIXH 4INKA 4UDWH 9LPRA 1MKXH 1GI0A 2VH6A 3FFGA 4Y76A 4WWYA 4FUGA 2W3IA 3NXPA 1RGQA 2FOFA 1EASA 2UUYA 1G32B 1SFIA 3QZRA 3F9EA 3SNAA 3WY8A 5E0JA 1RS0A 3RMNH 1OXGA 3ATMA 4I8LA 1NM6A 1DLEA 5L2YH 1LDTT 4UFFH 5C2ZA 2W7SA 4RN6A 2VWNA 1SGDE 1H8DH 3E6PH 1RD3B 3TJUA 1P06A 2BY8X 3A84A 2OC1A 3A8CA 3D65E 3DFLA 3M5OA 4LOYH 1YLDA 1V2WT 4I33A 1YLCA 2BZ6H 4YT7H 1UTJA 1ABIH 2FWWA 1KLTA 1BMMH 1UTQA 4BNRA 3F68H 5BPEA 3T62A 4MPWA 3O8BA 5AFZH 3P8GA 1O2TA 1ZPZA 1G36A 2GT7A 1QFKH 3VXFH 3ZZ9A 3LDXH 1Z6JH 2ZQ1A 1Y3VA 1UVSH 2ZTYA 2ZHDA 4OGXA 1C5ZB 1GHYH 3GY5A 1TPOA 2PUXB 1K1LA 3I77A 1SGQE 2ZFRH 4MLFB 2QF3A 1DFPA 1SQOA 4AGJA 2W26A 2PWXA 1B5GH 3KF2A 3D49H 4NG9H 1A5IA 2BD2A 5E8EH 1K1MA 1N8OC 1V2RT 4A1TA 2XXLA 3QO6A 3GY6A 3ODFA 3P17H 3KIDU 2P95A 4D8NA 2FOCA 2ZZUH 3S9AA 3EYDA 1ORFA 1LVBA 1O3GA 4X1QU 1O2SA 1V6DA 1AUTC 3DUXH 1O2GH 3T2NA 3ZZAA 2B0FA 5L6NH 4F49A 4CBNA 2Y5FA 3MWIU 4D7FA 1O2OA 2GVFA 3PMBB 1HXEH 2Z9LA 3UPEA 4YESB 4GHTA 4X6NA 2GDDA 1VCPA 1PPGE 3MFJA 1HIAA 1S6FA 2WPKS 2VNTA 3M37A 1V2ST 1G9IE 2WPHS 1FQ3A 3CS0A 1PPEE 3BIVH 1P03A 1IHTH 1GMDF 4ISIH 3RXMA 3SI3H 3MU8A 3Q00A 3L33A 1A4WH 1MTSA 1QBNA 1AWFH 1ZR0A 1C1TA 3GY2A 3M5NA 1XMNB 3RXSA 1ZMLA 3U9AH 2Z3DA 2A32A 1L0ZA 5DP3A 3TK5A 1EAXA 4XBBA 1TNHA 4K69A 1V2NT 1GBKA 4FUEA 3TGIE 1W7XH 1V2OT 2OQ5A 3PO1C 4CRAA 2GCTC 5FBIA 2BD7A 4D7GA 2XBVA 2PTNA 1P9UA 1BTWA 1FAKH 1TX7A 1NS3A 2BD3A 1TMBH 2ZCLP 3MOCA 1EOJA 1O2PA 3URDA 4NFEA 3E1XB 3NKKA 3OYPA 5ESBA 8ESTE 2F9BH 2AEIH 1GVKB 1CGIE 2GTBA 1ZRKA 5AVDA 2TGDA 3BN9A 3ZZCA 1GJ6A 5GPIB 1O3JA 1TWXB 2HNTE 1SOTA 2BOKA 2FI4E 1JXPA 2F9VA 5DP5A 2WYGA 3RU4T 2C3SA 1GHVH 4HFPB 1GG6B 4X1SU 3UY9A 3TNTA 1DWBH 1RTLA 1D6RA 3SUFA 1F92A 2CN0H 2GKVE 4E06H 1QB9A 5I25A 1YPGH 1ZMJA 5C1XA 1ZHPA 1AHTH 3ZVFA 1W2KH 2HGTH 3ZZ6A 1KSNA 1GBJA 1AU8A 4JZDH 1ANBA 3RXBA 3GYLB 8LPRA 2PHBA 3ZVEA 4WXIA 3CP7A 4A1XA 3GYMA 3U1IB 3QZQA 1TRNA 3VEQB 3HKIB 3HKJB 1BBRH 4NIWA 2CJIA 1SBWA 2UUJB 3A7TA 1F0UA 2ANWA 4ZXYH 5DPAA 3ZZBA 2BY6X 4H6TA 1AKSB 2EI8A 1BTHH 3SGQE 1P2JA 2QXHA 3MMGA 3O8DA 5FXLA 3FP7E 4K1SA 2G4UA 1IQHA 1C1OA 3EGKH 2HOBA 4OS4A 1QL8A 1O2NA 1BRBE 1VJ9U 3TGJE 1AMHA 3V13A 2EI6A 1UCYE 3JZ2B 2FOGA 3RMMH 1C2JA 1QRWA 3Q76A 2NU4E 2FI3E 1NFXA 4DCDA 5J4SA 1EJAA 2A5IA 3PYHA 2ZEBA 3O8RA 1C5XB 2BD9A 4FU8A 2SGPE 6CHAC 5JBTA 2OQUA 4AG2A 4IC6A 3OY5U 1HAXB 3TGKE 1EZXC 3M35A 1P3EA 1GJ7B 1C5OH 3E0PB 1O3LA 1W11U 2ODYB 1E0FD 1CHGA 1A3EH 1C4Y2 5A0BA 4JYUH 3A8AA 1Z8GA 1H9LB 3NWUA 1GJ9B 3UWIA 5F6MA 2M5TA 3LONA 1QQUA 4Y7AA 1GCTB 3V7TA 1AE8H 1AFQB 4Y7BA 4YOIA 2RG3A 4R8TB 3C27B 3QX5H 5FPSA 1MKXK 3LU9B 1Z6EA 1O3CA 4Q2KA 1NN6A 3RXCA 2H9EH 2J4IA 2V3HH 2AMQA 1SGFG 2ZA5A 1CVWH 1KXAA 3SBKA 4ZAEA 2XBYA 3KN2A 1O2WA 3ZVBA 5DO4H 1OYQA 3PROA 1SGRE 3SJ8A 2W7UA 2PGQB 1WSSH 3A82A 2WPJS 1N6XA 4A7IB 1KTSB 1P8VC 1J9CH 1O32A 2FTMA 2QAAA 3EAJA 1FJSA 3RDZA 2JH6D 3BTEE 4O3UA 1GVZA 2K1QA 2ZU4A 1OWEA 4X1PU 4H42U 1C5PA 1Y8TA 4NGAH 3RXGA 1AFEH 2VU8E 1YPHE 3C1KA 1MTNB 3FVFB 1E35B 1PPFE 5F03A 3GCOA 1GJDB 2SFAA 1UTPA 1P2MA 2VWLA 3MO9A 1UTMA 6GCHG 1QGFA 5CMXH 2OD3B 3U8TH 1EPTB 3ITIA 2G4TA 3SOSA 3BTTE 5PTPA 1TOMH 2ZC9H 1TX8A 2ANKH 2A2QH 1C1QA 2AERH 1IOEA 1VCWA 1GJAB 2QC2A 4OS1A 4B75A 5DP4A 1PYTD 5A0CA 4GAWA 1FLEE 2ANYA 2PFEA 3VB7A 2BQ7B 1SFQB 1QHRB 1G3BA 2IPHA 1AVGH 1QJ1B 1SQTA 2OC7A 1D9IA 4UD9H 1KLIH 2HWLB 3RXLA 5B6OA 1YM0A 3TITA 3S7HB 3T25A 5G4BA 2AIPA 2R2MB 1F0TA 4XDEA 1DS2E 2SGQE 1GI8B 1SHYA 1AD8H 1LVYA 1DE7H 2ZKSA 3ZZ7A 1F7ZA 2JH0D 1GMDG 2F9UA 1TA2A 2GP9B 2Z6BD 1MKWH 1A7SA 2XC4A 2EC9H 3MYWA 4I31A 4YLQH 4GCHG 1O2MA 3TJNA 3AAUA 1WTGH 1TNJA 1MZDA 2RA0A 1OKXA 3BG8A 1XUFA 2H9HA 4U30A 1S0QA 3LGIA 4BAQB 2GZ7A 3QLPH 3NZIA 2FP7B 1GDUA 3A7XA 4Q7YA 4WMDA 4IW4E 1T7CA 3OSYA 2UWOA 4X8VH 1FIZA 4YT6H 3RP2A 1LHCH 1UMAH 3A86A 4O03A 4Y0YE 2WV4A 1TQ0B 2OP9A 1MH0A 1S85A 3MH4A 2V3OH 2GCHG 2ZNKH 5EW2H 1Q2WA 3GISB 1W14U 4ZKOU 5DJ7A 1G30B 4AX9H 1LQEA 5SGAE 3SV6A 3GY4A 1ZMNA 2JETB 3UREA 1O2YA 1FPHH 2A4RA 3HATH 3RXFA 3LPRA 2AMDA 1N8OB 1J14A 2Y6TA 1DWCH 3MO6A 4CBOA 4OGYA 2ZU1A 4E7RG 1P0SH 1TGBA 1TMUH 4U2WA 4X6PA 1A5GH 1GHBF 2FO9A 2FM2A 2I6SA 7KMEH 1D3PB 2CHAC 5TJXA 3RXIA 1Y3WA 1TQ7B 4B76A 4AYYB 4WVPE 4K2YA 3RXJA 2JKHA 4A1VA 1TBZH 2XWBI 4KGAA 5A09A 3T28A 3BSQA 3RXKA 1ELAA 5C5OA 1BJVA 2A7HA 4DY7B 1HAZB 3SUDA 1O5DH 1ZGIA
chains in the Genus database with same CATH superfamily
4GUXA 4K60A 2IJD1 4ISOA 2ASUB 5DP7A 5C0UA 4ZHLU 2WPDD 1P05A 2XNDD 1A3BH 3SN8A 2R0LA 1O2KA 2GMTC 1F0SA 1IQFA 1NRQH 3F2GA 1YYY1 4NIXA 1MCTA 1BZXE 3MNXA 3UNSA 1A5HA 5EXLA 2SGAA 1C5MD 1EKBB 1QA0A 4Y11E 3PO1B 5FBEA 2BDCA 3SV2H 4BAOB 5HGGA 3RC4A 2LNCA 1C2MA 1S82A 2O9QA 4KTCA 1HAIH 1VITF 1K2I1 5B6LA 3SV9A 1CU1A 1CBWC 4DG4A 2XBXA 1E79D 3FP6E 4WY3A 1C5RA 2BLOA 3AVZA 5A8XA 5JDUB 1ACBE 4GHQA 2BX3A 2F91A 2PKSC 3A89A 3OFND 1WDIA 2ZPRA 3LH3A 1DLKB 2IN2A 1ARCA 5EW1H 5LGOA 1RXPA 2G81E 1P2QA 4IBLH 4NCYA 1H9IE 1GBEA 1JMOH 4VGCC 3HK3B 3SQHE 1C5LH 1SL3A 1O5CB 4FUJA 4YOJA 1V3XA 4Y8YA 1CSOE 2BD5A 1ESAA 4LK4A 5HM9A 3LGUA 1TGTA 5ETXA 4MQAA 1Z1JA 3SV8A 1C1PA 1NPMA 3E90B 1C9TA 1T4UH 1DSTA 5E0HA 2GV7A 1O2XA 2BDAA 1GBCA 3ZV8A 2P3UB 1B7XB 3K6YA 3ZYEA 1DT2A 2Z7FE 4YOGA 5C94A 1UW7A 1AVXA 4ZXXH 1NTPA 1NRPH 4X1NU 2PR3A 3LC5A 4Y10E 3T26A 4A5TS 1QB6A 4TPYA 4DJZB 2STBE 3Q3YA 2RDLA 4BTIB 4ISNA 4ABHA 2M2AA 1YPMH 3F9GA 3S9CA 4E05H 3U8OH 2PGBB 2FOAA 1C2DA 3ELAH 2WPLS 1F5KU 3RUOA 2Z9JA 1GBAA 2P59A 3F2FA 1GI2A 4GVUA 2PW8H 2FPZA 4HZHA 5JBAS 1S5SA 1C1SA 4Z6AH 1TNKA 2G5NA 3N7DA 5T1VA 5DSFA 2A4OA 2W3KA 1AKSA 1GBIA 2WINI 2I6QA 3LJJA 6GCHF 2THFB 3GCTF 2OCVB 5GCHF 5JBCS 1GWAA 1P12E 2FMJA 2XW9A 1JRSA 1WCZA 2ZTXA 3FKSD 2OC8A 3JZ1B 2ZFFH 1LPZB 2WPIS 2PKAB 4MTBA 5K0HA 1V2PT 6CHAB 4XSKU 2H5DA 1NC6A 2QF0A 3TLOA 4H4FA 1QBVH 1VITH 2R3UA 1G2LA 1KXBA 5FX6A 1LCYA 3TH4H 1BUIA 1JOUB 1P11E 2VWOA 3A85A 1V2MT 1C4U2 4D9RA 1DOJA 2C8ZB 1MQ6A 1TNLA 1L2EA 3T5FH 1BQYA 1CT2E 5FHTA 4ZCNA 9ESTA 3KQCA 2C90B 1L4ZA 4WJG2 1MAYA 4JK5A 4AFUA 2P93A 2Z9KA 1PYTC 3A83A 2P94A 4ZKSU 3ZZ4A 1ANEA 2J5UA 2LPRA 2A5KA 3TJVA 2PSXA 4FOUC 1ELTA 1NO9H 3SNBA 1HJAC 1O3OA 1K1OA 1BHXF 2BY7X 3B9FH 1GBTA 4GCHF 1QA7A 2R0KA 3ZZ8A 1HDTH 3FN8A 5FPTA 4TY6A 4IC5A 3SNCA 1GBDA 1GGDC 3BEFB 2QCYA 5EPYA 3SU1A 3SW2B 4XBDA 4ZMAH 2FS9A 2H9TH 2O8LA 2IJOB 3BG4C 1TX6A 2FYRA 5AFYH 2VIOA 2ZHWH 1H8HD 2VGCC 1C5UA 3Q3XA 5T6DA 2FLBH 1PQAA 3LJOA 4U32A 1NZQH 1H1BA 2ZWLH 4KTSA 5TCCA 2FOHA 1COWD 1EJNA 1RTFB 5L2ZH 3KGPA 3SU4A 1SLWB 3FZDA 5LPEA 3GDSA 3QK1A 2BDGA 2CK3D 3E16B 5EQRA 2GCHF 4NSYA 1SI5H 2ZIQH 1LHDH 2PSYA 3Q77A 3GOVB 2BM2A 2KCOA 3LOXA 3SHAH 1C1VH 1PQ8A 1LQDB 2FLRH 1T32A 3F1SB 4FU7A 3GCNA 1UVPA 3S0NA 1EPTA 1O3EA 1KXEA 2OTVA 2ZCKP 1BMLA 3PB1E 1ZSJA 3EE0B 2HLCA 2ZFSA 1GJ5H 4FVBA 3DHKH 1TA6A 4K5ZA 4O3TA 3ZZ3A 3B8JA 2GX4A 4Q4LA 4ZKRU 1GHBG 1OOKB 2P16A 2BQ6B 3UWJH 3VXEH 1GHWH 2QGRA 4BANB 1HAVB 4TWWA 3VGCC 1TE0A 4RKOB 1O3AA 1YCPH 1FV9A 3F3BA 1XKAC 4K8YA 2ZDMA 1B0FA 2OBQA 1EQ9A 5CHAC 2DUCA 8GCHG 1V2UT 1GDNA 1GBMA 2FYQA 1GMCF 3LGVA 1SLUB 1TBRH 1ANCA 1TPAE 4UEHH 5LH8A 5T3HA 2FODA 2Z9GA 4ISLA 4ABDA 3P92A 3U1JB 2Q1JA 2A4QA 5FAHA 1W0ZU 4IMZA 1WQVH 4NZLA 3HGPA 5JYIA 3BIUH 3TH3H 2H2ZA 1SGYE 3TPIZ 4YZUA 2B9LA 4NA8A 1DWDH 2G8TA 3MU4A 1KXCA 1ZTJA 3F0PA 1BJUA 4YM9A 5F8XA 3SU5A 2CMYA 3SU6A 3SGAE 1GI9B 2J95A 2RDEA 3M3SA 3UB0A 2AH4X 4ZHMU 3P8NA 4CREA 1VITG 1SPJA 1IQJA 2ESTE 3BTDE 4YXWD 1J15A 3EDXB 3RU4D 2PTCE 3GICB 4Q7ZA 4X8SH 2BDHA 2B7DH 3DT0H 1EP5A 1T8MA 5CDFE 1LHEH 2AGEX 1P10A 4TSFD 1T4VH 2TIOA 5DKMA 1WTHD 2GT8A 4KTUA 2NU1E 1KLJH 2C4FH 2F3CE 2ZGXH 3RXTA 1THRH 3SHCH 1ZTLA 1LVMA 1K22H 1NRNH 1PPBH 2A7JA 2QN5T 4B74A 1PQ5A 5FPYA 1XXFA 1TNGA 1DX5M 3UOUA 1FI8A 1KXDA 1TIOA 5HIYA 4F4OC 4UFDH 1DY8A 1DSUA 2RA3A 4BTTB 3P70B 1SVPA 5DG6A 1C5TA 1J8AA 3M5MA 1UK2A 4I7YH 3UNRA 2CHAB 3PV4A 1ZHMA 3I29A 1UCYH 1UTOA 2OINA 1C2KA 3ATKA 4QT8C 1EB2A 4F48B 1L1NA 1ELGA 2RCEA 1C5WB 2H5CA 1ZOMA 3NPSA 4NIVA 1AUJA 5GIBA 3V3MA 1EOLA 3EA8A 3IITA 1TONA 2ILNA 2ULLA 3PV5A 3DFJA 3KNXA 2WUCA 1SC8U 1GI1A 1PFXC 2ZFQH 2HVYB 4JZEH 4XE4A 1TGSZ 2WSSD 2ZQ2A 1SSXA 2ZG0H 1ELFA 4UFGH 1C4V2 4FUBA 1GHXH 3LGWA 1EX3A 2XC5A 2GV6A 3TK9A 3QTOH 2ZDKA 2G52A 2KR7A 3SZEA 1CA0B 2BDIA 1ELBA 2JDID 2ZDVH 1JWTA 1C2EA 2BD8A 2FS8A 4ABAA 1QL9A 2UUFB 5GNDA 1CGHA 1TNIA 1O5EH 1OWIA 1X7AC 3A80A 4I32A 2XCFA 3BEUA 4JYTA 4NA9H 2UUKB 3GCTG 5GCHG 3ATLA 6ESTA 1GI5A 4CHAC 1DDJA 5EJ1A 1QCPA 1C1UH 3H5CB 1YPHC 1XVOA 1C5QA 1OPHB 1C1NA 1UTKA 2SGDE 2VVCA 1YC0A 3KQBA 1NY22 3RLYH 4GLYA 1SOZA 2ZFTA 1QQ4A 4NA7A 1KXFA 4DIHH 2A45B 2PKSB 3N7OA 2GD4B 3RC5A 2YNAA 4RSPA 1ZPCA 2NU0E 2BVRH 1C5VA 2TBSA 1ESTA 1CHOG 1RIWB 1PPZA 2P8OB 4K1EA 5C5NA 1O3HA 1SGCA 4VGCB 2Q6GA 1UHBB 1ELVA 2FOEA 3D62A 1H9HE 4X2XA 2D26C 1O3NA 5HM2A 2QXIA 5E2PA 1T31A 1VGCC 2J97A 4THNH 1OWDA 2Z9IA 2VH0A 4DT4A 1CQQA 4WF8A 1RFNA 1C1WH 1V2TT 1DANH 1NROH 2KAIB 2FX4A 5AHGH 2BDYA 1K1IA 1N1LA 3ZVGA 3FANA 4RKJB 4X2YA 4D76A 2HPQH 4SGAE 5A0AE 1O38A 1D3DB 1GJ8B 1CE5A 1AI8H 1O5BB 7ESTE 2VIVA 1HFDA 4JMYA 1D3TB 1HLTH 3LKWA 4B2BA 1O3KA 4NWKA 2P3TB 3LH1A 3UR9A 2QYIA 1ZRBA 1IQIA 1IQEA 5CE1A 4ISHH 1YPJH 3PTBA 1O2UA 3RXAA 1BIOA 2AGGX 2OBOA 2G5VA 4X6OA 2AGIX 5F8TA 3EA7A 2WZQA 5T6FA 3T29A 1E38B 3K2UA 5EPNA 1P09A 1GJBB 1V2JT 4MDSA 2Y5GA 1A0LA 4AORA 4KELA 4TWYA 4OS6A 3P95A 2J2UA 3RMOH 4TYDA 1IQNA 1QTFA 5GJ4B 4AGKA 4CRFA 2BHGA 3LGTA 5FCKA 1WUNH 1XX9A 2ZDNA 4P00A 3MI4A 3H7TA 2ALPA 4ZUHA 3TNSA 4GPGA 2D2DA 2QY0B 1HB0B 1K1JA 2FZZA 3D23A 1O3PB 1BTUA 1DXPA 3K6ZA 1KMHB 2PUQH 2PKAA 1F2SE 4DIIH 3E91A 4ESTE 4BAHB 1EJMA 1NRSH 1PPHE 2AIQA 5A8ZA 1GI3A 1P9SA 2BY5X 1AZZA 1BRCE 4NWLA 1KY9A 1AWHB 1LHFH 3IWMA 2F9OA 4ZH8A 1Y59T 4FUIA 3RXUA 1YCPK 1NU9A 1FY4A 5T6GA 1AZ8A 4JYVH 1KYNA 2ZGHA 1LVOA 1GMCG 2Z3EA 4CR5A 2FDAA 8GCHF 3MU5A 2ZGBH 4ABGA 1FDPA 1QURH 4R0IA 1TFXA 1NU7B 3QDZB 1KDQB 3AK5A 4NZQA 3NUMA 3UTUH 1HJAB 1HRTH 1SHHB 2VIQA 3PMJA 5DP8A 2PLXA 1MTUA 3RXHA 1FX0B 3U98H 1MTWA 1IQGA 1EZQA 2TGPZ 4AN7A 1BBRK 1AB9C 1LPGB 2L6OA 5JB8S 4I8GA 4BXSA 3BTWE 2SGEE 2A2XH 1M9UA 2CF9H 3HK6B 4NFFA 5K7RA 1E34B 3BG4B 5JB9S 2ZU2A 1FXYA 1YP9A 1IAUA 2WV5A 1LHGH 3PLBA 1KIGH 3BTHE 3NCLA 1TABE 4FU9A 5EOKA 2VGCB 4CRDA 3W95A 3EQ0H 3PM3A 1QJ6B 1T8OA 2GCTB 1Y5AT 2WPMS 4XD7D 1MMJN 1P01A 1FPCH 3BF6H 1O3BA 1C9PA 4FXGH 1ELCA 2ODPA 3STJA 4BTUB 2FEQH 4FUHA 3ZYDA 1O31A 3GY7A 2NU3E 3QWCH 1AN1E 2CF8H 1GJ4H 1O2ZA 2EI7A 4CRBA 3UQOA 4Q80A 2ZHEH 4ACBA 1BTPA 3RXQA 1CO7E 2YMSB 2FXRA 3UFAA 3RM2H 1D4PB 2NU2E 4I8KA 4JCNA 1GI4A 3TU7H 1K21H 2ZHQH 3TIUA 3M3VA 2QF5A 3BTKE 1FONA 1GMHF 3SI4H 5GWZA 2VVUA 1ZPBA 1HBTH 2C93B 5JPMH 2FX6A 2BDBA 1GI7B 4JZFH 5EJZA 1GL1A 2K8IA 4Q63A 1NFUA 1ARBA 1TPPA 3BEIB 3P8OA 3ENSB 1U6QA 2Z94A 4PROA 3VGCB 5A2MH 4K8BA 3G01A 3QTVH 1E37B 1PJPA 1INCA 1KTTB 2QXJA 1HAVA 3MU0A 4HGCA 2Y7XA 2VVVA 2V6NA 2VIPA 1FN6A 2Y80A 4JZ1A 1O5AB 1A0JA 1OS8A 4K1TA 4BOHA 1GVLA 1SGPE 1C2IA 3VB6A 2XNIA 1HCGA 1Z1IA 3U69H 4Y6DA 3SJOA 1O2HA 1O0DH 4ABJA 1DPOA 5LPRA 1MZAA 1W8BH 2FIRH 5E2OA 5I46H 2A4GA 1FNIA 4MPXA 2GZ8A 2BYAX 4YLUA 3GY8A 2ZFPH 1QJ7B 1FZZA 1CGJE 1FMGA 2BLWA 1OWJA 1O3MA 3N7EA 4XOJA 1QRZA 4AZ2B 2WYJA 2OLGA 1OP0A 3A8DA 3T27A 1DICA 1XUGA 1O2QA 3BTGE 1MQ5A 1VR1H 3GCHC 1O34A 2D1JA 1SR5C 3RXEA 2QV1A 3M7QA 2P3FH 1ZHRA 5E0GA 4OS7A 1O36A 1K28D 1YPEH 4XBCA 1NBMD 1DY9A 1OP2A 3OTJE 3UUZA 7LPRA 1ZGVA 3BTME 3AW0A 3SUGA 3UIRA 3MH7A 2ZCHP 3SZNA 3OX7U 4DT7B 5IDKA 5A8YA 2XCNA 1BMAA 1S81A 2R3YA 2SGFE 3ZVCA 4B71A 4Q7XA 3UAIC 4U01A 2ZDAH 2V3MA 2Y82A 2TGTA 4DGJA 4TY7A 3AAVA 2SNVA 4H6SB 1EXFA 3A7ZA 3PMHB 3HGNA 1MUEB 4FUCA 1TRYA 1Z8JB 1MCVA 1UVOA 2UWPA 3MH6A 1A0HB 2JETC 2HVXA 1A46H 4BXWA 3M5LA 3O8CA 1F5LA 1CHOF 1QBOA 4B1TA 1XUKA 2A0QB 4LXBH 1J17T 1XUIA 3ATWA 1F5RA 2HNTF 3RMLH 4X8UH 4DW2U 5C1YA 4M9FA 5AF9H 1ESBA 1UO6A 2BVXH 3A7WA 1THSH 3QUMP 3LC3A 1BTXA 1GL0E 4KKDA 1NESE 1DUAA 1SGNE 5IK2D 3RLWH 2O8TA 5HKKD 1EAUA 1VCQA 2KCAA 1H4WA 1HAPH 4MVNA 2Y7ZA 3P6ZB 4X6MA 3SUEA 2IOTA 1MKWK 1MABB 1C1RA 1D3QB 3KEEA 1AVWA 2OC0A 2Q6FA 1Z8IB 3U28C 3VB5A 2J38A 4IN1A 2J9NA 2ZTZA 4NSVA 4X2VA 1BDAA 3SU2A 1C1MA 2HRVA 1A2CH 2B5TB 1BRAA 1T8LA 3SORA 3OY6U 3R3GB 3RXDA 1BMFD 3R0FA 1IQLA 4LZ1H 1O5GH 1MBQA 2NWNA 2ANMH 1C5YB 5ABWA 1O35A 2ZPQA 3FZZA 2B8OH 2Z3CA 1ABJH 3RXRA 1HAYB 1W0YH 3A7VA 1TALA 2WUBA 3ATIA 1UVTH 1TB6H 3F0OA 2HALA 1O30A 4CHAB 5L30H 2PP6A 5IYTA 3I78A 3ESTA 4B2CA 5LPFA 5EQQA 1HGTH 1LTOA 3H7OA 2BY9X 4MNYA 4MPUA 5C67A 1DXWA 1Q3XA 2V7QD 2A7CA 2Y81A 1BITA 3EA9A 1YWUA 3SJKA 1Y3YA 3S7KB 3ZVDA 2XWAA 5FCRA 3AW1A 1LKAA 3W94A 2HNTC 5DGJA 1BTYA 1FAXA 4CRCA 4INLA 3GDVA 3UQVA 1GHZA 1Z71A 3QGJA 2OXSA 1BB0B 2ODQA 4DOQA 1BBRE 3LT3A 1ZJDA 5HMAA 1W3CA 3PLKA 1RJXB 2G00A 1HJ8A 1QY6A 1O37A 2ZO3H 1ZYOA 3CS7A 1HXFH 3MO3A 1UHBA 1GHAG 1YBWA 2FOBA 4JK6A 1VGCB 3HPTB 4X0WU 1TRMA 3DSOA 4FVDA 3M36A 1SMFE 2O8UA 3PTNA 1TPSA 2VIWA 1TBQH 1TLDA 1PPCE 2BXUH 4GSOA 1P2NA 5C0TA 1HAGE 1V2QT 2KAIA 1W7GH 1RTKA 3KQ5A 3ZV9A 2XBWA 4AG1A 2FI5E 2O8MA 3VB4A 3VB3A 1S6LA 4ZKNU 1O2VA 1DVAH 4TPIZ 1NFYA 2ZECA 1P57B 1Y3XA 1C2LA 1P2IA 5FX5A 1BCUH 6LPRA 3ZZ5A 2F9NA 2VIDA 1ID5H 2R2WU 2TGAA 2OUAA 1ZTKA 3KL6A 1W12U 1WAYB 3A8BA 2TPIZ 3M3TA 1W0KD 2G51A 3E0NB 3B23B 2YOLA 2ALVA 2WHXA 4X2WA 2HPPH 1JIRA 1SG8B 4Z0KA 2O8WA 2BLVA 3P8FA 2CXVA 1YPLH 4MNWA 1S83A 1Z7KA 3UOPA 1O33A 3KHVA 4CRGA 1P3CA 3L6PA 1L4DA 1HPGA 1QRXA 2GZ9A 2R9PA 4KP0A 1WYKA 1SGEE 2BB4A 3L3TA 4ASUD 1WU1A 3A88A 4AFQA 1IQKA 1C2HA 3F9FA 1XVMA 1UVUH 1UTLM 2ZP0H 4ZROA 4ABIA 3BV9B 1ELEE 4LZ4B 1EZSC 1GBBA 1GJCB 1GMHG 4OS2A 4MPVA 2F9PA 1EUFA 1O3IA 4O97A 3MU1A 1IHSH 1YPKH 1ETRH 2J94A 1GPZA 1GCDA 7GCHG 3LGYA 3VFEA 4X8TH 2XYAA 2XTTB 3F9HA 4XFQA 1SGTA 3DD2H 1W0JD 1FIWA 2J92A 3ZVAA 1QB1A 1HIAB 1ELDE 3TJOA 2VWMA 1UK4A 3Q3KA 2VB0A 3GS9A 1V2VT 1LO6A 5F53A 1W13U 2XC0A 1C2GA 1SGFA 2BMGB 5EQSA 3UR6A 4I8JA 2AYWA 3PRDA 4AB9A 1O39A 4Z1MD 1KDQA 1UTNA 4WH8A 1SLVB 4MNXA 5EG4A 2W6JD 2LP6A 1TYNA 2H6MA 1O2JA 4ASHA 4UONA 2W5EA 2TRMA 4CH8B 3SO3A 1AB9B 1XUHA 2GMTB 1LMWB 1E36B 2Q6DA 1HNEE 1BA8B 3M7UA 4UE7H 2HLDD 5EXMA 2F83A 3V0XA 1O3DA 4P02A 4INHA 5EGMA 4Y8ZA 1ANDA 2ZU3A 1CT4E 5DP6A 1YF4A 4AFZA 1TGNA 1TMTH 3E3TA 3PWBA 3K65B 1O2RA 1NRRH 4OM9A 5J4QA 4HI3A 2C8WB 3BTQE 2J34A 2DE8A 3AASA 3DA9B 3E8LA 1CBWB 3GY3A 4UFEH 3SGBE 1HAOH 1LPKB 2ZGCA 5ESTE 1ZLRA 2G55A 1YKTA 3TK6A 3PV2A 3M7TA 1EB1H 4IS5A 5HIZA 3FAOA 1RRKA 4IMQA 1F0RA 1MD7A 1S6HA 2K0QA 3RXVA 3TH2H 1EATA 3V12A 3M61U 1DITH 2VJ1A 3ODDA 3H09A 1THPB 2STAE 2QF4A 3GDUA 3A81A 2D8WA 1QIXB 1HAHH 1VZQH 1W10U 3IG6B 5DK1A 1LKBA 1QNJA 3FO8D 1FY5A 4YTAA 3QGNB 1NFWA 1GBLA 4Y71A 4IGDA 1O2LA 1MTVA 1O2IA 1L1GA 1SB1H 1YGCH 1FY8E 1GG6C 5DP9A 3OU0A 3SYJA 1J16A 2QA9E 1FUJA 2RFKC 2BQWB 2FESH 4B73A 5CHBA 3LIWA 4FUDA 2VINA 4Y0ZE 1BRUP 3CENA 3RM0H 2C8YB 1MU6B 3KQDA 1WV7H 3MHWU 1OX1A 1WBGB 2ZI2H 4K3JA 1FY3A 4Y79A 3N99A 1AO5A 4WH6A 5C20A 1DM4B 5EXNA 3MNSA 1MAXA 1YCPM 1WOFA 3MH5A 2BOHB 4B2AA 2V35A 1E1QD 3K9XB 2C8XB 1BOQA 5KGOA 5GXPA 1QL7A 4RI0A 4E7NA 3QN7A 1ZZZA 4O9VA 8KME2 3FP8E 2ZHFH 2QIQA 4WMEA 1TOCB 4MNVA 1DUEA 2BX4A 3PMAB 1Y3UA 2ZDLA 2BZAA 3SJ9A 5FL7D 1GBFA 5JBBS 1EP6A 1FY1A 1O5FH 3MNCA 4SGBE 1B0EA 2A31A 3RXOA 1ZSKA 3GCHB 1A1RA 1HJ9A 5C17A 1MU8B 3SU3A 4I8HA 3RC6A 2JH5D 1TAWA 4AOQA 1EZUC 2BXTH 2J98B 2V0BA 4ABEA 4IN2A 1S0RA 1H8IH 1AQ7A 1AGJA 2AFQB 3SU0A 1ZSLA 5EODA 2H1UA 3NK8A 3RXPA 3STIA 4DVAU 1JIMA 1SLXB 1OSSA 1P04A 2A1DB 3SJIA 1GI6A 1OP8A 5HYOA 1C5NH 1MBMA 2EY4C 5EU8A 4A92A 1G3EA 4MG3A 1AE5A 4FETA 5GDSH 3MQKC 1K1NA 1P2KA 1N6YA 2CGAA 1Q31A 1HYLA 4CR9A 2A5AA 4J1YA 1BTZA 2UWLA 1EAIA 2PV9B 3ZZDA 4HTCH 1TGCA 2CV3A 1Y5BT 3MTYA 5KEDA 2DE9A 4AC9A 4ABFA 1GHAF 1GCTC 1SQAA 3PWCA 5EIYA 3TVJB 5C3NA 1AFQC 3DCLA 2BTCE 3A7YA 4B6EA 1FN8A 1V2KT 5C1UA 3SNDA 4AFSA 2EEKA 1O3FA 2AMPA 1D6WA 4Y8XA 4X1RU 5BRRE 4ABBA 1EFRD 3SNEA 3S9BA 1XUJA 2GGVB 4J2YB 1UJ1A 2SNWA 4OS5A 1JBUH 1NT1A 1GGDB 4AYVB 2YNBA 2BLQA 4M7GA 2F4LA 1K9OE 1MD8A 1ZJKA 2JJ1D 2JJ2D 1EAWA 1C2FA 3VPKA 2ZU5A 1A61H 1L1JA 1OHHD 2GDEH 1ETSH 5HXFA 4WMFA 1G3CA 3OEED 4D9QA 3CNRA 3URCA 1XM1A 3SV7A 1CA0C 1P02A 1JRTA 1T8NA 3MNBA 1HV7A 1MTNC 2LELA 2ZF0H 1BT7A 2QXGA 2ZPSA 3WWFA 1S84A 4BAMB 4ACAA 5F8ZA 1IQMA 2FOMB 3BTFE 1P2OA 1EPTC 1Y5UT 3KCGH 3U8RH 2L74A 1C5SA 4ZHAA 4FUFA 2KCYA 4DURA 4A6LA 3PLPA 2ZGJA 4BAKB 3F6UH 3S69A 1G3DA 3UNQA 1AY6H 1G2MA 5TCAA 4JZIA 1GDQA 1XKBC 2FTLE 5H4IB 1Z8RA 4YO9A 1OYTH 1CT0E 1GBHA 1UK3A 2AS9A 2Y5HA 4NIYA 3RU4E 1DWEH 1YY3A 1QR3E 2EA3A 4WXVA 1VJAU 1SGIB 1K1PA 1YLNA 3A87A 3KQEA 1G37A 2IPQX 1CA8B 1RIWC 1V2LT 7GCHF 2P8OC 2XRCA 1UCYK 3F2HA 1ETTH 5CHAB 4AB8A 1WQSA 1BHXB 1OWHA 2BVSH 1OWKA 4CH2B 1HUTH 1XXDA 1PQ7A 1BMNH 2BD4A 3SQEE 1AIXH 4INKA 4UDWH 9LPRA 1MKXH 1GI0A 2VH6A 2KX4A 3FFGA 4Y76A 4WWYA 4FUGA 1K0HA 2W3IA 3NXPA 1RGQA 2FOFA 1EASA 2UUYA 1G32B 1SFIA 3QZRA 3F9EA 3SNAA 3VG8A 3WY8A 5E0JA 1RS0A 3RMNH 2W6ID 1OXGA 3ATMA 4I8LA 1NM6A 1DLEA 5L2YH 1LDTT 4UFFH 5C2ZA 4TT3D 2W7SA 4RN6A 2VWNA 1SGDE 4XRNA 1H8DH 3E6PH 1RD3B 3TJUA 1P06A 2BY8X 3A84A 2OC1A 3A8CA 3D65E 3DFLA 3M5OA 4LOYH 1YLDA 3WW7A 1V2WT 4I33A 1YLCA 2BZ6H 4YT7H 1UTJA 1ABIH 2FWWA 1KLTA 1BMMH 1UTQA 4BNRA 3F68H 5BPEA 3T62A 4MPWA 3O8BA 5AFZH 3P8GA 1O2TA 1ZPZA 1G36A 2GT7A 1QFKH 3VXFH 3ZZ9A 1QZ8A 3LDXH 1Z6JH 2ZQ1A 1Y3VA 1UVSH 2ZTYA 2ZHDA 4OGXA 1C5ZB 1GHYH 3GY5A 1TPOA 2PUXB 1K1LA 3I77A 1SGQE 2ZFRH 4MLFB 2QF3A 1DFPA 1SQOA 4AGJA 2W26A 2PWXA 1B5GH 3KF2A 3D49H 1SKYE 4NG9H 1A5IA 2BD2A 3KYFA 5E8EH 1K1MA 2EQNA 1N8OC 1V2RT 4A1TA 2WV9A 2QE7D 2XXLA 3QO6A 3GY6A 3ODFA 3P17H 3KIDU 2P95A 4D8NA 2FOCA 2ZZUH 3S9AA 3EYDA 1ORFA 1LVBA 4B6FA 1O3GA 4X1QU 1O2SA 1V6DA 1AUTC 2KZ4A 3DUXH 1O2GH 3T2NA 3ZZAA 2B0FA 2OK5A 5L6NH 4F49A 4CBNA 2Y5FA 3ZIAD 3MWIU 4D7FA 1O2OA 1SQRA 2VBCA 2GVFA 3PMBB 1HXEH 2Z9LA 3UPEA 4YESB 4GHTA 4X6NA 2GDDA 1VCPA 1PPGE 3MFJA 1HIAA 1S6FA 2WPKS 2VNTA 3M37A 1V2ST 1G9IE 2WPHS 1FQ3A 3CS0A 1PPEE 3BIVH 3FOAA 1P03A 1IHTH 1GMDF 4ISIH 3RXMA 3SI3H 5KECA 3MU8A 3Q00A 3L33A 1A4WH 1MTSA 1QBNA 1AWFH 1ZR0A 1C1TA 3GY2A 3M5NA 1XMNB 3RXSA 1ZMLA 3U9AH 2Z3DA 2A32A 1L0ZA 5DP3A 3TK5A 1EAXA 4XBBA 1TNHA 4K69A 1V2NT 1GBKA 4FUEA 3TGIE 1W7XH 3PRBA 1V2OT 2OQ5A 3PO1C 4CRAA 2GCTC 5FBIA 2BD7A 4D7GA 2XBVA 2PTNA 1P9UA 1BTWA 3KYGA 1FAKH 1TX7A 1NS3A 2BD3A 1TMBH 2ZCLP 3MOCA 1EOJA 1O2PA 3URDA 4NFEA 3E1XB 3NKKA 3OYPA 5ESBA 8ESTE 2F9BH 2AEIH 1GVKB 1CGIE 2GTBA 2XOKD 1ZRKA 5AVDA 2TGDA 3BN9A 3ZZCA 1GJ6A 5GPIB 1O3JA 1TWXB 2HNTE 1SOTA 2YMSC 2BOKA 2FI4E 1JXPA 2F9VA 5DP5A 2WYGA 3RU4T 2C3SA 1GHVH 4HFPB 4HG6A 1GG6B 4X1SU 3WWBA 3UY9A 3TNTA 1DWBH 1RTLA 1D6RA 3SUFA 1F92A 2CN0H 2GKVE 4E06H 3W1EA 1QB9A 5I25A 1YPGH 1ZMJA 5C1XA 1ZHPA 1AHTH 3ZVFA 1W2KH 2HGTH 3ZZ6A 1KSNA 1GBJA 1AU8A 4JZDH 1ANBA 4I86A 3RXBA 3GYLB 8LPRA 2PHBA 3ZVEA 4WXIA 3CP7A 4A1XA 3GYMA 3U1IB 3QZQA 1TRNA 3VEQB 3HKIB 3HKJB 1BBRH 4NIWA 2CJIA 1SBWA 2UUJB 3A7TA 1F0UA 2ANWA 4ZXYH 5DPAA 3ZZBA 2BY6X 4H6TA 3EE7A 1AKSB 2EI8A 1BTHH 3SGQE 1P2JA 2QXHA 3MMGA 3O8DA 5FXLA 3FP7E 4K1SA 2G4UA 1IQHA 1C1OA 3EGKH 2HOBA 4OS4A 3DSGA 5EJLA 1QL8A 1O2NA 1BRBE 1VJ9U 3TGJE 1AMHA 3V13A 2EI6A 1UCYE 3JZ2B 2FOGA 3RMMH 2J98A 1C2JA 1QRWA 3Q76A 2NU4E 2FI3E 1NFXA 4DCDA 5J4SA 1EJAA 2A5IA 3NRLA 3PYHA 2ZEBA 2F43B 2KFWA 3O8RA 1C5XB 2BD9A 4FU8A 2SGPE 6CHAC 1WXRA 5JBTA 2KCPA 2OQUA 4IC6A 4AG2A 3OY5U 1HAXB 3TGKE 1EZXC 3M35A 1P3EA 1GJ7B 1C5OH 3E0PB 1O3LA 1W11U 2ODYB 1E0FD 1CHGA 1A3EH 1C4Y2 5A0BA 4JYUH 3A8AA 1Z8GA 1H9LB 3NWUA 1GJ9B 3UWIA 5F6MA 2M5TA 1H8ED 3LONA 1QQUA 4Y7AA 1GCTB 3V7TA 1AE8H 1AFQB 4Y7BA 4YOIA 2RG3A 4R8TB 3C27B 3QX5H 5FPSA 1MKXK 3LU9B 1Z6EA 1O3CA 4Q2KA 1NN6A 3RXCA 2H9EH 2J4IA 2V3HH 5DN6D 2AMQA 1SGFG 2ZA5A 3DSPA 1CVWH 1KXAA 3SBKA 4ZAEA 2XBYA 3KN2A 1O2WA 3ZVBA 5DO4H 1OYQA 3OE7D 3PROA 1SGRE 3SJ8A 2W7UA 2PGQB 1WSSH 3A82A 2WPJS 1N6XA 4A7IB 1KTSB 1P8VC 1J9CH 1O32A 2FTMA 2QAAA 3EAJA 1FJSA 3RDZA 2JH6D 3BTEE 4O3UA 1GVZA 2K1QA 2ZU4A 1OWEA 4X1PU 4H42U 1C5PA 1Y8TA 4NGAH 3RXGA 1AFEH 2VU8E 1YPHE 3C1KA 1MTNB 3FVFB 1E35B 1PPFE 5F03A 3GCOA 1GJDB 2SFAA 1UTPA 1P2MA 2VWLA 3MO9A 1UTMA 6GCHG 1QGFA 5CMXH 2OD3B 3U8TH 1EPTB 3ITIA 2G4TA 3SOSA 3BTTE 5PTPA 1TOMH 2ZC9H 1TX8A 2ANKH 2AHME 2A2QH 1C1QA 2AERH 1IOEA 1VCWA 3OAAD 1GJAB 2QC2A 4RT1A 4OS1A 4B75A 5DP4A 1NBME 1PYTD 5A0CA 4GAWA 1FLEE 2ANYA 2PFEA 3VB7A 2BQ7B 1SFQB 1QHRB 1G3BA 2IPHA 1AVGH 1QJ1B 1SQTA 2OC7A 1D9IA 4UD9H 1KLIH 2HWLB 3RXLA 5B6OA 1YM0A 3TITA 3S7HB 3T25A 5G4BA 2AIPA 2R2MB 1F0TA 4XDEA 1DS2E 2SGQE 1GI8B 1SHYA 1AD8H 1LVYA 1DE7H 2ZKSA 3ZZ7A 1F7ZA 2JH0D 1GMDG 2F9UA 1TA2A 2GP9B 2Z6BD 1MKWH 1A7SA 2XC4A 2EC9H 3MYWA 4I31A 4YLQH 4GCHG 1O2MA 3TJNA 3AAUA 1WTGH 1TNJA 1MZDA 2RA0A 4RT0A 1OKXA 3BG8A 1XUFA 2H9HA 4U30A 1S0QA 3LGIA 4BAQB 2GZ7A 3QLPH 3NZIA 2FP7B 1GDUA 3A7XA 4Q7YA 4WMDA 4IW4E 1T7CA 3OSYA 2UWOA 2YMSD 1FIZA 4X8VH 4YT6H 3RP2A 2JIZD 1LHCH 1UMAH 3A86A 4O03A 4Y0YE 2WV4A 1TQ0B 2OP9A 2KM0A 1MH0A 1S85A 3MH4A 2V3OH 2GCHG 2ZNKH 5EW2H 1Q2WA 3GISB 3OEHD 1W14U 4ZKOU 5DJ7A 1G30B 4AX9H 3OTPA 1LQEA 5SGAE 3SV6A 3GY4A 1ZMNA 2JETB 3UREA 1O2YA 1FPHH 2A4RA 3HATH 1E1RD 3RXFA 3LPRA 2AMDA 1N8OB 1J14A 2Y6TA 1DWCH 3MO6A 4CBOA 4OGYA 1VKYA 2ZU1A 4E7RG 2GJGA 1P0SH 1TGBA 1TMUH 4F55A 4U2WA 4X6PA 1A5GH 1GHBF 2FO9A 2FM2A 2I6SA 7KMEH 1D3PB 2CHAC 5TJXA 3RXIA 1Y3WA 1TQ7B 4B76A 4AYYB 4WVPE 4K2YA 3RXJA 2JKHA 4A1VA 1TBZH 2XWBI 4KGAA 5A09A 3T28A 3BSQA 3RXKA 1ELAA 5C5OA 1BJVA 2A7HA 4DY7B 1HAZB 3SUDA 1O5DH 1ZGIA
chains in the Genus database with same CATH topology
4GUXA 4K60A 4ISOA 2ASUB 5DP7A 4ZHLU 1P05A 1A3BH 3SN8A 2R0LA 1O2KA 2GMTC 1F0SA 1IQFA 1NRQH 1YYY1 4NIXA 1MCTA 1BZXE 3MNXA 3UNSA 1A5HA 5EXLA 2SGAA 1C5MD 1EKBB 1QA0A 4Y11E 3PO1B 5FBEA 2BDCA 3SV2H 4BAOB 5HGGA 3RC4A 2LNCA 1C2MA 1S82A 2O9QA 4KTCA 1HAIH 1VITF 1K2I1 3SV9A 1CU1A 1CBWC 4DG4A 2XBXA 3FP6E 4WY3A 1C5RA 2BLOA 3AVZA 5A8XA 5JDUB 1ACBE 4GHQA 2BX3A 2F91A 2PKSC 3A89A 2ZPRA 3LH3A 1DLKB 2IN2A 1ARCA 5EW1H 5LGOA 1RXPA 2G81E 1P2QA 4IBLH 4NCYA 1H9IE 1GBEA 1JMOH 4VGCC 3HK3B 3SQHE 1C5LH 1SL3A 1O5CB 4FUJA 4YOJA 1V3XA 4Y8YA 1CSOE 2BD5A 1ESAA 4LK4A 5HM9A 3LGUA 1TGTA 5ETXA 4MQAA 1Z1JA 3SV8A 1C1PA 1NPMA 3E90B 1C9TA 1T4UH 1DSTA 5E0HA 2GV7A 1O2XA 2BDAA 1GBCA 3ZV8A 2P3UB 1B7XB 3K6YA 3ZYEA 1DT2A 2Z7FE 4YOGA 1AVXA 4ZXXH 1NTPA 1NRPH 4X1NU 2PR3A 3LC5A 4Y10E 3T26A 4A5TS 1QB6A 4TPYA 4DJZB 2STBE 3Q3YA 2RDLA 4BTIB 4ISNA 4ABHA 1YPMH 3F9GA 3S9CA 4E05H 3U8OH 2PGBB 2FOAA 1C2DA 3ELAH 2WPLS 1F5KU 3RUOA 2Z9JA 1GBAA 2P59A 1GI2A 4GVUA 2PW8H 2FPZA 4HZHA 5JBAS 1S5SA 1C1SA 4Z6AH 1TNKA 2G5NA 2A4OA 2W3KA 1AKSA 1GBIA 2WINI 2I6QA 3LJJA 6GCHF 2THFB 3GCTF 2OCVB 5GCHF 5JBCS 1GWAA 1P12E 2FMJA 2XW9A 1JRSA 1WCZA 2ZTXA 2OC8A 3JZ1B 2ZFFH 1LPZB 2WPIS 2PKAB 4MTBA 5K0HA 1V2PT 6CHAB 4XSKU 2H5DA 1NC6A 2QF0A 3TLOA 4H4FA 1QBVH 1VITH 2R3UA 1G2LA 1KXBA 5FX6A 1LCYA 3TH4H 1BUIA 1JOUB 1P11E 2VWOA 3A85A 1V2MT 1C4U2 4D9RA 1DOJA 2C8ZB 1MQ6A 1TNLA 1L2EA 3T5FH 1BQYA 1CT2E 5FHTA 9ESTA 3KQCA 2C90B 1L4ZA 4WJG2 1MAYA 4JK5A 4AFUA 2P93A 2Z9KA 1PYTC 3A83A 2P94A 4ZKSU 3ZZ4A 1ANEA 2LPRA 2A5KA 3TJVA 2PSXA 1ELTA 1NO9H 3SNBA 1HJAC 1O3OA 1K1OA 1BHXF 2BY7X 3B9FH 1GBTA 4GCHF 1QA7A 2R0KA 3ZZ8A 1HDTH 5FPTA 4TY6A 4IC5A 3SNCA 1GBDA 1GGDC 3BEFB 2QCYA 5EPYA 3SU1A 3SW2B 4XBDA 4ZMAH 2FS9A 2H9TH 2O8LA 2IJOB 3BG4C 1TX6A 2FYRA 5AFYH 2VIOA 2ZHWH 2VGCC 1C5UA 3Q3XA 5T6DA 2FLBH 1PQAA 3LJOA 4U32A 1NZQH 1H1BA 2ZWLH 4KTSA 5TCCA 2FOHA 1EJNA 1RTFB 5L2ZH 3KGPA 3SU4A 1SLWB 3FZDA 5LPEA 3GDSA 3QK1A 2BDGA 3E16B 5EQRA 2GCHF 4NSYA 1SI5H 2ZIQH 1LHDH 2PSYA 3Q77A 3GOVB 2BM2A 3LOXA 3SHAH 1C1VH 1PQ8A 1LQDB 2FLRH 1T32A 3F1SB 4FU7A 3GCNA 1UVPA 3S0NA 1EPTA 1O3EA 1KXEA 2OTVA 2ZCKP 1BMLA 3PB1E 1ZSJA 3EE0B 2HLCA 2ZFSA 1GJ5H 4FVBA 3DHKH 1TA6A 4K5ZA 4O3TA 3ZZ3A 3B8JA 2GX4A 4ZKRU 1GHBG 1OOKB 2P16A 2BQ6B 3UWJH 3VXEH 1GHWH 2QGRA 4BANB 1HAVB 4TWWA 3VGCC 1TE0A 4RKOB 1O3AA 1YCPH 1FV9A 1XKAC 4K8YA 2ZDMA 1B0FA 2OBQA 1EQ9A 5CHAC 2DUCA 8GCHG 1V2UT 1GDNA 1GBMA 2FYQA 1GMCF 3LGVA 1SLUB 1TBRH 1ANCA 1TPAE 4UEHH 5LH8A 5T3HA 2FODA 2Z9GA 4ISLA 4ABDA 3P92A 3U1JB 2Q1JA 2A4QA 5FAHA 1W0ZU 4IMZA 1WQVH 4NZLA 3HGPA 5JYIA 3BIUH 3TH3H 2H2ZA 1SGYE 3TPIZ 4YZUA 2B9LA 4NA8A 1DWDH 2G8TA 3MU4A 1KXCA 1ZTJA 4YM9A 1BJUA 5F8XA 3SU5A 2CMYA 3SU6A 3SGAE 1GI9B 2J95A 3M3SA 2AH4X 4ZHMU 3P8NA 4CREA 1VITG 1SPJA 1IQJA 2ESTE 3BTDE 1J15A 3EDXB 3RU4D 2PTCE 3GICB 4Q7ZA 4X8SH 2BDHA 2B7DH 3DT0H 1EP5A 1T8MA 1LHEH 2AGEX 1P10A 1T4VH 2TIOA 5DKMA 1WTHD 2GT8A 4KTUA 2NU1E 1KLJH 2C4FH 2F3CE 2ZGXH 3RXTA 1THRH 3SHCH 1ZTLA 1LVMA 1K22H 1NRNH 1PPBH 2A7JA 2QN5T 4B74A 1PQ5A 5FPYA 1XXFA 1TNGA 1DX5M 3UOUA 1FI8A 1KXDA 1TIOA 4F4OC 4UFDH 1DY8A 1DSUA 2RA3A 4BTTB 3P70B 1SVPA 5DG6A 1C5TA 1J8AA 3M5MA 1UK2A 4I7YH 3UNRA 2CHAB 3PV4A 1ZHMA 3I29A 1UCYH 1UTOA 2OINA 1C2KA 3ATKA 4QT8C 1EB2A 1L1NA 1ELGA 2RCEA 1C5WB 2H5CA 1ZOMA 3NPSA 4NIVA 1AUJA 5GIBA 3V3MA 1EOLA 3EA8A 3IITA 1TONA 2ILNA 2ULLA 3DFJA 3KNXA 2WUCA 1SC8U 1GI1A 1PFXC 2ZFQH 4JZEH 4XE4A 1TGSZ 2ZQ2A 1SSXA 2ZG0H 1ELFA 4UFGH 1C4V2 4FUBA 1GHXH 3LGWA 1EX3A 2XC5A 2GV6A 3TK9A 3QTOH 2ZDKA 2G52A 1CA0B 2BDIA 1ELBA 2ZDVH 1JWTA 1C2EA 2BD8A 2FS8A 4ABAA 1QL9A 2UUFB 1CGHA 1TNIA 1O5EH 1OWIA 1X7AC 3A80A 4I32A 2XCFA 3BEUA 4JYTA 4NA9H 2UUKB 3GCTG 5GCHG 3ATLA 6ESTA 1GI5A 4CHAC 1DDJA 1QCPA 1C1UH 3H5CB 1YPHC 1XVOA 1C5QA 1OPHB 1C1NA 1UTKA 2SGDE 2VVCA 1YC0A 3KQBA 1NY22 3RLYH 4GLYA 1SOZA 2ZFTA 1QQ4A 4NA7A 1KXFA 4DIHH 2A45B 2PKSB 3N7OA 2GD4B 3RC5A 2YNAA 4RSPA 1ZPCA 2NU0E 2BVRH 1C5VA 2TBSA 1ESTA 1CHOG 1RIWB 1PPZA 2P8OB 4K1EA 5C5NA 1O3HA 1SGCA 4VGCB 2Q6GA 1UHBB 1ELVA 2FOEA 3D62A 1H9HE 4X2XA 2D26C 1O3NA 5HM2A 2QXIA 5E2PA 1T31A 1VGCC 4THNH 1OWDA 2Z9IA 2VH0A 1CQQA 4WF8A 1RFNA 1C1WH 1V2TT 1DANH 1NROH 2KAIB 2FX4A 5AHGH 2BDYA 1K1IA 1N1LA 3ZVGA 3FANA 4RKJB 4X2YA 4D76A 2HPQH 4SGAE 5A0AE 1O38A 1D3DB 1GJ8B 1CE5A 1AI8H 1O5BB 7ESTE 2VIVA 1HFDA 4JMYA 1D3TB 1HLTH 3LKWA 4B2BA 1O3KA 4NWKA 2P3TB 3LH1A 3UR9A 2QYIA 1ZRBA 1IQIA 1IQEA 5CE1A 4ISHH 1YPJH 3PTBA 1O2UA 3RXAA 1BIOA 2AGGX 2OBOA 2G5VA 4X6OA 2AGIX 5F8TA 3EA7A 5T6FA 3T29A 1E38B 3K2UA 5EPNA 1P09A 1GJBB 1V2JT 4MDSA 2Y5GA 1A0LA 4AORA 4KELA 4TWYA 4OS6A 3P95A 2J2UA 3RMOH 4TYDA 1IQNA 1QTFA 5GJ4B 4AGKA 4CRFA 2BHGA 3LGTA 5FCKA 1WUNH 1XX9A 2ZDNA 3MI4A 3H7TA 2ALPA 4ZUHA 3TNSA 4GPGA 2D2DA 2QY0B 1HB0B 1K1JA 2FZZA 3D23A 1O3PB 1BTUA 1DXPA 3K6ZA 2PUQH 2PKAA 1F2SE 4DIIH 3E91A 4ESTE 4BAHB 1EJMA 1NRSH 1PPHE 2AIQA 5A8ZA 1GI3A 1P9SA 2BY5X 1AZZA 1BRCE 4NWLA 1KY9A 1AWHB 1LHFH 3IWMA 2F9OA 4ZH8A 1Y59T 4FUIA 3RXUA 1YCPK 1NU9A 1FY4A 5T6GA 1AZ8A 4JYVH 1KYNA 2ZGHA 1LVOA 1GMCG 2Z3EA 4CR5A 2FDAA 8GCHF 3MU5A 2ZGBH 4ABGA 1FDPA 1QURH 4R0IA 1TFXA 1NU7B 3QDZB 1KDQB 4NZQA 3NUMA 3UTUH 1HJAB 1HRTH 1SHHB 2VIQA 3PMJA 5DP8A 2PLXA 1MTUA 3RXHA 3U98H 1MTWA 1IQGA 1EZQA 2TGPZ 4AN7A 1BBRK 1AB9C 1LPGB 5JB8S 4I8GA 4BXSA 3BTWE 2SGEE 2A2XH 1M9UA 2CF9H 3HK6B 4NFFA 5K7RA 1E34B 3BG4B 5JB9S 2ZU2A 1FXYA 1YP9A 1IAUA 2WV5A 1LHGH 3PLBA 1KIGH 3BTHE 3NCLA 1TABE 4FU9A 5EOKA 2VGCB 4CRDA 3W95A 3EQ0H 3PM3A 1QJ6B 1T8OA 2GCTB 1Y5AT 2WPMS 1MMJN 1P01A 1FPCH 3BF6H 1O3BA 1C9PA 4FXGH 1ELCA 2ODPA 3STJA 4BTUB 2FEQH 4FUHA 3ZYDA 1O31A 3GY7A 2NU3E 3QWCH 1AN1E 2CF8H 1GJ4H 1O2ZA 2EI7A 4CRBA 3UQOA 4Q80A 2ZHEH 1BTPA 3RXQA 1CO7E 2FXRA 3UFAA 3RM2H 1D4PB 2NU2E 4I8KA 4JCNA 1GI4A 3TU7H 1K21H 2ZHQH 3TIUA 3M3VA 3BTKE 1FONA 1GMHF 3SI4H 5GWZA 2VVUA 1ZPBA 1HBTH 2C93B 5JPMH 2FX6A 2BDBA 1GI7B 4JZFH 1GL1A 1NFUA 1ARBA 1TPPA 3BEIB 3P8OA 3ENSB 1U6QA 2Z94A 4PROA 3VGCB 5A2MH 4K8BA 3G01A 3QTVH 1E37B 1PJPA 1INCA 1KTTB 2QXJA 1HAVA 3MU0A 4HGCA 2Y7XA 2VVVA 2V6NA 2VIPA 1FN6A 2Y80A 4JZ1A 1O5AB 1A0JA 1OS8A 4K1TA 4BOHA 1GVLA 1SGPE 1C2IA 3VB6A 2XNIA 1HCGA 1Z1IA 3U69H 4Y6DA 3SJOA 1O2HA 1O0DH 4ABJA 1DPOA 5LPRA 1MZAA 1W8BH 2FIRH 5E2OA 5I46H 2A4GA 1FNIA 4MPXA 2GZ8A 2BYAX 4YLUA 3GY8A 2ZFPH 1QJ7B 1FZZA 1CGJE 1FMGA 2BLWA 1OWJA 1O3MA 4XOJA 1QRZA 4AZ2B 2WYJA 2OLGA 1OP0A 3A8DA 3T27A 1DICA 1XUGA 1O2QA 3BTGE 1MQ5A 1VR1H 3GCHC 1O34A 2D1JA 1SR5C 3RXEA 2QV1A 3M7QA 2P3FH 1ZHRA 5E0GA 4OS7A 1O36A 1K28D 1YPEH 4XBCA 1DY9A 1OP2A 3OTJE 3UUZA 7LPRA 1ZGVA 3BTME 3AW0A 3SUGA 3UIRA 3MH7A 2ZCHP 3SZNA 3OX7U 4DT7B 5IDKA 5A8YA 2XCNA 1BMAA 1S81A 2R3YA 2SGFE 3ZVCA 4B71A 4Q7XA 4U01A 2ZDAH 2Y82A 2TGTA 4DGJA 4TY7A 3AAVA 2SNVA 4H6SB 1EXFA 3A7ZA 3PMHB 3HGNA 1MUEB 4FUCA 1TRYA 1Z8JB 1MCVA 1UVOA 2UWPA 3MH6A 1A0HB 2JETC 2HVXA 1A46H 4BXWA 3M5LA 3O8CA 1F5LA 1CHOF 1QBOA 4B1TA 1XUKA 2A0QB 4LXBH 1J17T 1XUIA 3ATWA 1F5RA 2HNTF 3RMLH 4X8UH 4DW2U 5C1YA 5AF9H 1ESBA 1UO6A 2BVXH 3A7WA 1THSH 3QUMP 3LC3A 1BTXA 1GL0E 4KKDA 1NESE 1DUAA 1SGNE 3RLWH 2O8TA 1EAUA 1VCQA 1H4WA 1HAPH 4MVNA 2Y7ZA 3P6ZB 4X6MA 3SUEA 2IOTA 1MKWK 1C1RA 1D3QB 3KEEA 1AVWA 2OC0A 2Q6FA 1Z8IB 3VB5A 2J38A 4IN1A 2J9NA 2ZTZA 4NSVA 4X2VA 1BDAA 3SU2A 1C1MA 2HRVA 1A2CH 2B5TB 1BRAA 1T8LA 3SORA 3OY6U 3R3GB 3RXDA 3R0FA 1IQLA 4LZ1H 1O5GH 1MBQA 2NWNA 2ANMH 1C5YB 5ABWA 1O35A 2ZPQA 3FZZA 2B8OH 2Z3CA 1ABJH 3RXRA 1HAYB 1W0YH 3A7VA 1TALA 2WUBA 3ATIA 1UVTH 1TB6H 2HALA 1O30A 4CHAB 5L30H 5IYTA 3I78A 3ESTA 4B2CA 5LPFA 5EQQA 1HGTH 1LTOA 3H7OA 2BY9X 4MNYA 4MPUA 5C67A 1DXWA 1Q3XA 2A7CA 2Y81A 1BITA 3EA9A 3SJKA 1Y3YA 3S7KB 3ZVDA 2XWAA 5FCRA 3AW1A 1LKAA 3W94A 2HNTC 5DGJA 1BTYA 1FAXA 4CRCA 4INLA 3GDVA 3UQVA 1GHZA 1Z71A 3QGJA 2OXSA 1BB0B 2ODQA 4DOQA 1BBRE 3LT3A 1ZJDA 5HMAA 1W3CA 3PLKA 1RJXB 2G00A 1HJ8A 1QY6A 1O37A 2ZO3H 1ZYOA 3CS7A 1HXFH 3MO3A 1UHBA 1GHAG 1YBWA 2FOBA 4JK6A 1VGCB 3HPTB 4X0WU 1TRMA 4FVDA 3M36A 1SMFE 2O8UA 3PTNA 1TPSA 2VIWA 1TBQH 1TLDA 1PPCE 2BXUH 4GSOA 1P2NA 1HAGE 1V2QT 2KAIA 1W7GH 1RTKA 3ZV9A