The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
211
|
structure length |
211
|
Chain Sequence |
EGALIRFYVEIEEPEKFLNCVPEELKETLLKEKRIYIDVFTTRPDTVFGATFVVLAPEHPLVPVLACIGERLGNACYSDVENFVEKMKKMSTRERTMEEDKEGVFLGVYATNPANGEKIPVWSANYVLYEYGTGAIMCVPAHDQRDWEFAKKYDLPIKVVVKPEGAWDFEKGAYEGKGTLVNSDGFDGLDSETAKRKITEWLQDRGLGEKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Peripheral insertion modulates the editing activity of the isolated CP1 domain of leucyl-tRNA synthetase
pubmed doi rcsb |
| molecule keywords |
Leucyl-tRNA synthetase subunit alpha
|
| molecule tags |
Ligase
|
| source organism |
Aquifex aeolicus
|
| total genus |
63
|
| structure length |
211
|
| sequence length |
211
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
6.1.1.4: Leucine--tRNA ligase. |
| pdb deposition date | 2010-12-13 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Isoleucyl-tRNA Synthetase; domain 2 | Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain |
#chains in the Genus database with same CATH superfamily 3O0A A; 5AGI A; 2WFE A; 2AJI A; 2V0C A; 1OBH A; 1OBC A; 2BYT A; 1WK9 A; 1WNZ A; 1UDZ A; 1WKA A; 3ZJV A; 2AJH A; 1WK8 A; 5AGR A; 3PZ6 A; 4AS1 A; 1H3N A; 1WZ2 A; 5AGJ A; 1FFY A; 4CQN A; 5AGS A; 1JZS A; 2AJG A; 2WFG A; 1UE0 A; 3PZ5 A; 1QU3 A; 3PZ0 A; 1GAX A; 3ZJU A; 3ZGZ A; 1ILE A; 1QU2 A; 2V0G A; 1WNY A; 4K48 A; 1JZQ A; 5AGT A; 1WKB A; 2WFD A; 4K47 A; 4ARI A; 2BTE A; 1IVS A; 5AGH A; 4AQ7 A; 4ARC A; 3ZJT A; #chains in the Genus database with same CATH topology 3O0A A; 5AGI A; 2WFE A; 2AJI A; 2V0C A; 1OBH A; 1OBC A; 2BYT A; 1WK9 A; 1WNZ A; 1UDZ A; 1WKA A; 3ZJV A; 2AJH A; 1WK8 A; 5AGR A; 3PZ6 A; 4AS1 A; 1H3N A; 1WZ2 A; 5AGJ A; 1FFY A; 4CQN A; 5AGS A; 1JZS A; 2AJG A; 2WFG A; 1UE0 A; 3PZ5 A; 1QU3 A; 3PZ0 A; 1GAX A; 3ZJU A; 3ZGZ A; 1ILE A; 1QU2 A; 2V0G A; 1WNY A; 4K48 A; 1JZQ A; 5AGT A; 1WKB A; 2WFD A; 4K47 A; 4ARI A; 2BTE A; 1IVS A; 5AGH A; 4AQ7 A; 4ARC A; 3ZJT A; #chains in the Genus database with same CATH homology 3O0A A; 5AGI A; 2WFE A; 2AJI A; 2V0C A; 1OBH A; 1OBC A; 2BYT A; 1WK9 A; 1WNZ A; 1UDZ A; 1WKA A; 3ZJV A; 2AJH A; 1WK8 A; 5AGR A; 3PZ6 A; 4AS1 A; 1H3N A; 1WZ2 A; 5AGJ A; 1FFY A; 4CQN A; 5AGS A; 1JZS A; 2AJG A; 2WFG A; 1UE0 A; 3PZ5 A; 1QU3 A; 3PZ0 A; 1GAX A; 3ZJU A; 3ZGZ A; 1ILE A; 1QU2 A; 2V0G A; 1WNY A; 4K48 A; 1JZQ A; 5AGT A; 1WKB A; 2WFD A; 4K47 A; 4ARI A; 2BTE A; 1IVS A; 5AGH A; 4AQ7 A; 4ARC A; 3ZJT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
