3PZ2B

Crystal structure of rabggtase(delta lrr; delta ig) in complex with bms3 and lipid substrate ggpp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
327
structure length
322
Chain Sequence
b'QKDVTIKSDAPDTLLLEKHADYIASYGSEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structure-Guided Development of Selective RabGGTase Inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 116
structure length 322
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3pz2B00
1O79A 1D8DB 4FXGB 1TN8B 4GTVB 1H3CA 1FT2B 1N4QB 1H3BA 2IEJB 2NOJA 2BBCA 1GXMA 1QBQB 5FO7B 3K7XA 5JPMB 1O1SB 3Q7FB 2BB5A 4FXKB 4D4DA 4ONTA 3HXBB 1NI1B 1TN7B 1O6RA 2I07B 1FT1B 1GHQA 1H35A 3EUVB 4C1SA 3PZ4B 4ZH1A 1W6KA 2H6GB 2H6IB 3KLSA 1SA4B 1H37A 4BOJA 2XWJB 4YDOB 3DRAB 3OXUA 1H3AA 1FPPB 3DSVB 2H6HB 1GSZA 3D5SA 3SFXB 1NL4B 3KSQB 1O1RB 2H6FB 4GTPB 4ZRPA 5FOBB 4M76A 1TNOB 5JPNB 2XWBB 2SQCA 1SQCA 2WY8A 3PZ3B 4V1RA 1N4SB 3D5RA 1KZPB 2V3PA 1LD8B 1TNUB 2WINB 1N94B 4GTMB 3DSWB 3KQ4A 2GOXA 4LNGB 1X81B 2F0YB 3SFYB 1H36A 3E37B 5FO8B 1JCSB 1TNBB 3E32B 4BOKA 1O5MB 4GTQB 3RJ3A 1N9AB 3CU7A 4GTRB 4D4BA 2V3NA 2B39A 1R76A 1TN6B 4D4CA 1N95B 1JCRB 1W6JA 3DPYB 1O6QA 2V8IA 3OEDA 1O6HA 2R2LB 1UMPA 3E34B 4D4AA 2V8JA 3HXEB 3E33B 1LTXB 4GTOB 1GXOA 1HZFA 3Q78B 4GTTB 1D8EB 1QSJA 3PZ2B 2A73B 1MZCB 4D94A 3SQCA 4EHMB 5FO9B 3C72B 2WIIB 2BEDB 2BB6A 2ZISB 4V1SA 1TNYB 3Q75B 3G6JB 4LNVA 2ZIRB 1TNZB 3KSLB 3EU5B 1JCQB 3Q7AB 1N4RB 1QQFA 1LD7B 1SA5B 3DSUB 1C3DA 2PN5A 1DCEB 2WY7A 3Q79B 4MU9A 2G0DA 2PMVA 3HXDB 4MBGB 3HXFB 3PZ1B 2XQWA 2G02A 4LNBB 1S64B 3HXCB 3DSTB 4L9PB 4GTSB 1S63B 4YDEB 3Q73B 3DSXB 1GXNA 1H39A 3E30B 1N4PB 1O1TB 4ZRQA 4KKJA 1KZOB 5AGDA 3DSSB 2V8KA 4KKIA
chains in the Genus database with same CATH superfamily
1X9DA 1D8DB 1TN8B 1FT2B 2NOJA 2D5JA 3WKHA 4KTRA 4AYQA 5JPMB 1O1SB 3Q7FB 2BB5A 3CIHA 3HXBB 1IA6A 2WDAA 4FUSA 1HMWA 3W7SA 1FT1B 1AGMA 3EUVB 4ZH1A 2H6GB 3QG0A 4NEIA 1NC5A 5ILKA 1HMUA 1N1ZA 3OXUA 2QNOA 2ONGA 3SFXB 1FBOA 1NL4B 1O1RB 2H6FB 5ILJA 5IKHA 4F10A 4CE7A 4M76A 1WU6A 3QRYA 5JPNB 2XWBB 1LXKA 4CJ0A 5IL3A 1RQ5A 3M7LA 3S4AA 1H13A 4TF4A 3D5RA 1KZPB 1XWTA 1TNUB 5ILIA 3WKIA 4LNGB 1KSCA 3SFYB 1H36A 5FO8B 1W3YA 1DOGA 3S4DA 1ULVA 5DHIA 2GH4A 3RJ3A 2V3NA 3TF4A 1TN6B 1HXAA 1HN0A 1HCUA 1JCRB 2E24A 3M78A 1J0NA 4FNVA 1UMPA 1FO3A 2JF4A 3ANKA 1IS9A 1V5CA 3WIRA 2E22A 1CEMA 4GAXA 1GXOA 1HZFA 3M75A 2GZ6A 2RI9A 1D8EB 2X03A 3N0FA 3NFVA 2ZISB 4YCRA 2AHGA 4V1SA 5E2JA 1WU5A 4Z4LA 1TNZB 3SDRA 3M72A 3Q7AB 3M7CA 4ZH5A 1QQFA 3QWTA 4JJJA 3DSUB 2EADA 1C3DA 2WY7A 3NNBA 4MU9A 1HM2A 3HXDB 1GAIA 3WIQA 2DROA 1KKTA 4L9PB 5CZLA 1LF6A 2BRPA 4OK2A 3E30B 4KKJA 3H2WA 5AGDA 1EGUA 4KKIA 4DI5A 4FXGB 1H3CA 2ZBLA 1GA2A 1N7OA 3M01A 4XUVA 1H3BA 1QBQB 3H7LA 5FO7B 3K7XA 5M7YA 3SDTA 4TXTA 5DHKA 4ONTA 1UT9A 1TN7B 3QSPA 3M00A 1GHQA 1H35A 2VN7A 4OJZA 1KWFA 2H6IB 5JMDA 1SA4B 3M7EA 5GY3A 1H37A 2XWJB 4WVCA 3DRAB 1FPPB 1G9JA 2FBAA 4L0GA 1G87A 4GTPB 2FV0A 4AYRA 1FO2A 1K72A 4WVAA 4V1RA 1N4SB 2NVPA 2CQTA 1LD8B 3QT9A 1N94B 2VN4A 3QXFA 1KRFA 2GOXA 1X81B 5IK0A 3M77A 1F1SA 3E73A 1X1IA 1LF9A 2F6DA 2FUQA 1F9OA 1N9AB 1NXCA 3CU7A 1WZZA 1UG9A 1R76A 4D4CA 3SDQA 1KREA 3QFYA 1RWAA 4AYOA 1W6JA 1O6QA 1KFGA 2V8IA 1I8QA 3OEDA 4GL3A 3E34B 4D4AA 1C82A 2V8JA 1LTXB 1FP3A 1X1HA 3P5PA 4GTOB 1FMIA 2Z07A 1QAZA 3Q78B 1QSJA 5KKBA 3RX8A 2FV1A 3S4BA 4DODA 4EHMB 3GZKA 2BB6A 3VSMA 3M7BA 1TNYB 2XFGA 5IK9A 4AYPA 3H3KA 3RENA 5EAUA 1JCQB 3A3VA 4QT9A 1OJMA 1N4RB 1N23A 1LD7B 1SA5B 3VXDA 1F9DA 1DCEB 3WC3A 3GLYA 1RWCA 2PMVA 3PZ1B 4J5TA 2G02A 1S64B 1RWGA 3DSTB 2JJBA 3E80A 1F9GA 1S63B 4OZWA 3QDEA 2AHFA 2Q1FA 1N4PB 1O1TB 2JG0A 4DOEA 5IK6A 3M73A 4GTMB 1O79A 4GTVB 3E7JA 3D3IA 3T33A 4CJ1A 1N24A 1JS4A 3G4FA 1XW2A 4FXKB 4D4DA 3SAEA 1NI1B 1O6RA 2EABA 3WKFA 1HXCA 1VD5A 3KLSA 1L2AA 4BOJA 5IM1A 2YIKA 2RI8A 3M71A 3N0GA 4YDOB 3RSYA 3DSVB 2H6HB 3ACSA 1GSZA 3D5SA 3KSQB 1RW9A 5ILDA 3AFJA 1V7WA 2P0VA 1GAHA 1TNOB 1CLCA 1LOHA 1N21A 1SQCA 3PZ3B 3SDUA 1IA7A 3X17A 3QFZA 5ILYA 5IKAA 1TF4A 3DSWB 3KQ4A 4KTPA 2F0YB 4MMIA 3E37B 2EAEA 1V7XA 3W5NA 1JCSB 3S4CA 3E32B 2OKXA 4BOKA 1O5MB 3PMMA 1J0MA 4WVBA 5CA3A 4GTRB 1N7QA 2B39A 4LIXA 2ZZRA 1N95B 3EQAA 3RRSA 5MEHA 3QPFA 2EACA 1O6HA 2FUZA 2R2LB 3HXEB 3P5RA 2J5CA 3E33B 3EZ8A 3LZ9A 1KSDA 4GTTB 1G6IA 3PZ2B 1MZCB 1XWQA 4D94A 3RX5A 3C72B 1OJPA 2BEDB 2WIIB 3ACTA 4L6XA 3WUXA 1V7VA 1FAEA 4E1YA 3Q75B 4LNVA 4OZVA 3EU5B 3K11A 4Q2BA 2CQSA 1RWHA 3W5MA 1L1YA 1H14A 1X1JA 2G0DA 4EL8A 3HXFB 3VW5A 1H54A 3AFLA 3HXCB 4GTSB 4YDEB 2DRRA 3DSXB 3ANJA 1KZOB 3DSSB 3RX7A 5C05A 1H12A 2BRWA 4WU0A 1N4QB 3E6UA 2IEJB 1AYXA 1RWFA 2BBCA 1GXMA 5DGRA 5EASA 3W7UA 3WKGA 3QT3A 1CB8A 1DL2A 4Q88A 1G9GA 5JMFA 2I07B 1V5DA 3PZ4B 1W6KA 3A0OA 5GZKA 3SDVA 5EATA 1N7RA 3GT5A 1H3AA 3PYBA 4ZG8A 3VSNA 4MMHA 4OK4A 4ZRPA 5FOBB 5DGQA 3QXQA 4FJQA 2SQCA 2WY8A 2ONHA 2FUTA 3S9VA 1HM3A 1N7NA 2V3PA 2WINB 1OJNA 5IL8A 1KS8A 5GW7A 1WU4A 3W7TA 1TNBB 4GTQB 4F13A 5CD2A 2AFAA 3ANIA 4D4BA 1FBWA 2DRQA 1HXGA 3DPYB 1HV6A 3W7WA 1FCEA 5ILHA 2DRSA 1LXMA 3G4DA 2A73B 1N20A 3SQCA 5FO9B 1N7PA 1GLMA 2WCOA 5M7IA 1HX9A 3G6JB 2ZIRB 3WIWA 2RGKA 2D8LA 3KSLB 3W7XA 3M02A 4Z4JA 3M76A 1N22A 3ON6A 1OJOA 2PN5A 2A8ZA 3Q79B 1N1BA 3PYAA 4MBGB 2XQWA 2B4FA 3EU8A 4LNBB 3P2CA 4RNQA 2BRVX 3Q73B 3M74A 1GXNA 1H39A 2WYNA 5ILZA 4ZRQA 4C1SA 2V8KA
chains in the Genus database with same CATH topology
1X9DA 1D8DB 1TN8B 1FT2B 2NOJA 2D5JA 3WKHA 4KTRA 4AYQA 5JPMB 1O1SB 3Q7FB 2BB5A 3CIHA 3HXBB 1IA6A 4FUSA 3W7SA 1FT1B 1AGMA 3EUVB 4ZH1A 2H6GB 3QG0A 1NC5A 3OXUA 2QNOA 3SFXB 1FBOA 1NL4B 1O1RB 2H6FB 4CE7A 4M76A 1WU6A 3QRYA 5JPNB 2XWBB 4CJ0A 1RQ5A 3M7LA 3S4AA 1H13A 4TF4A 3D5RA 1KZPB 1XWTA 1TNUB 3WKIA 4LNGB 1KSCA 3SFYB 1H36A 5FO8B 1DOGA 3S4DA 1ULVA 2GH4A 3RJ3A 2V3NA 3TF4A 1TN6B 1HCUA 1JCRB 3M78A 1UMPA 1FO3A 2JF4A 3ANKA 1IS9A 1V5CA 3WIRA 1CEMA 1GXOA 1HZFA 3M75A 2GZ6A 2RI9A 1D8EB 2ZISB 4YCRA 2AHGA 4V1SA 5E2JA 1WU5A 4Z4LA 1TNZB 3SDRA 3M72A 3Q7AB 3M7CA 4ZH5A 1QQFA 3QWTA 4JJJA 3DSUB 2EADA 1C3DA 2WY7A 4MU9A 3HXDB 1GAIA 3WIQA 2DROA 1KKTA 4L9PB 5CZLA 1LF6A 3E30B 4KKJA 3H2WA 5AGDA 4KKIA 4FXGB 1H3CA 2ZBLA 1GA2A 4XUVA 1H3BA 1QBQB 3H7LA 5FO7B 3K7XA 5M7YA 3SDTA 4TXTA 4ONTA 1UT9A 1TN7B 3QSPA 1GHQA 1H35A 2VN7A 1KWFA 2H6IB 1SA4B 3M7EA 5GY3A 1H37A 2XWJB 4WVCA 3DRAB 1FPPB 1G9JA 2FBAA 4L0GA 1G87A 4GTPB 2FV0A 4AYRA 1FO2A 1K72A 4WVAA 4V1RA 1N4SB 2NVPA 2CQTA 1LD8B 3QT9A 1N94B 2VN4A 3QXFA 1KRFA 2GOXA 1X81B 3M77A 3E73A 1LF9A 2F6DA 1F9OA 1N9AB 1NXCA 3CU7A 1WZZA 1UG9A 1R76A 4D4CA 3SDQA 1KREA 3QFYA 4AYOA 1W6JA 1O6QA 1KFGA 2V8IA 3OEDA 4GL3A 3E34B 4D4AA 2V8JA 1LTXB 1FP3A 3P5PA 4GTOB 1FMIA 2Z07A 3Q78B 1QSJA 5KKBA 3RX8A 2FV1A 3S4BA 4DODA 4EHMB 3GZKA 2BB6A 3M7BA 1TNYB 2XFGA 4AYPA 3H3KA 3RENA 1JCQB 3A3VA 4QT9A 1N4RB 1LD7B 1SA5B 3VXDA 1F9DA 1DCEB 3WC3A 3GLYA 2PMVA 3PZ1B 4J5TA 2G02A 1S64B 3DSTB 2JJBA 1S63B 3QDEA 2AHFA 1N4PB 1O1TB 2JG0A 4DOEA 3M73A 4GTMB 1O79A 4GTVB 3D3IA 3T33A 4CJ1A 1JS4A 1XW2A 4FXKB 4D4DA 3SAEA 1NI1B 1O6RA 2EABA 3WKFA 1VD5A 3KLSA 1L2AA 4BOJA 2YIKA 2RI8A 3M71A 4YDOB 3RSYA 3DSVB 2H6HB 3ACSA 1GSZA 3D5SA 3KSQB 3AFJA 1V7WA 2P0VA 1GAHA 1TNOB 1CLCA 1SQCA 3PZ3B 3SDUA 1IA7A 3X17A 3QFZA 1TF4A 3DSWB 3KQ4A 4KTPA 2F0YB 3E37B 2EAEA 1V7XA 3W5NA 1JCSB 3S4CA 3E32B 2OKXA 4BOKA 1O5MB 3PMMA 4WVBA 5CA3A 4GTRB 2B39A 4LIXA 2ZZRA 1N95B 3EQAA 3RRSA 5MEHA 3QPFA 2EACA 1O6HA 2FUZA 2R2LB 3HXEB 3P5RA 3E33B 3EZ8A 1KSDA 4GTTB 1G6IA 3PZ2B 1MZCB 1XWQA 4D94A 3RX5A 3C72B 2WIIB 2BEDB 3ACTA 4L6XA 3WUXA 1V7VA 1FAEA 3Q75B 4LNVA 3EU5B 3K11A 4Q2BA 2CQSA 3W5MA 1L1YA 1H14A 2G0DA 4EL8A 3HXFB 3VW5A 1H54A 3HXCB 4GTSB 4YDEB 2DRRA 3ANJA 3DSXB 1KZOB 3DSSB 3RX7A 1H12A 4WU0A 1N4QB 3E6UA 2IEJB 1AYXA 2BBCA 1GXMA 5DGRA 3W7UA 3WKGA 3QT3A 4Q88A 1DL2A 1G9GA 2I07B 1V5DA 3PZ4B 1W6KA 5GZKA 3SDVA 3GT5A 1H3AA 3PYBA 4ZG8A 4ZRPA 5FOBB 5DGQA 3QXQA 2SQCA 2WY8A 3S9VA 2V3PA 2WINB 1KS8A 5GW7A 1WU4A 3W7TA 1TNBB 4GTQB 5CD2A 2AFAA 3ANIA 4D4BA 1FBWA 2DRQA 3DPYB 3W7WA 1FCEA 2DRSA 2A73B 3SQCA 5FO9B 1GLMA 5M7IA 3G6JB 2ZIRB 3WIWA 2RGKA 2D8LA 3KSLB 3W7XA 4Z4JA 3M76A 3ON6A 2PN5A 2A8ZA 3Q79B 3PYAA 4MBGB 2XQWA 2B4FA 3EU8A 4LNBB 3P2CA 3Q73B 3M74A 1GXNA 1H39A 2WYNA 4ZRQA 4C1SA 2V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O79 A;  1D8D B;  4FXG B;  1TN8 B;  4GTV B;  1H3C A;  1FT2 B;  1N4Q B;  1H3B A;  2IEJ B;  2NOJ A;  2BBC A;  1GXM A;  1QBQ B;  5FO7 B;  3K7X A;  5JPM B;  1O1S B;  3Q7F B;  2BB5 A;  4FXK B;  4D4D A;  4ONT A;  3HXB B;  1NI1 B;  1TN7 B;  1O6R A;  2I07 B;  1FT1 B;  1GHQ A;  1H35 A;  3EUV B;  4C1S A;  3PZ4 B;  4ZH1 A;  1W6K A;  2H6G B;  2H6I B;  3KLS A;  1SA4 B;  1H37 A;  4BOJ A;  2XWJ B;  4YDO B;  3DRA B;  3OXU A;  1H3A A;  1FPP B;  3DSV B;  2H6H B;  1GSZ A;  3D5S A;  3SFX B;  1NL4 B;  3KSQ B;  1O1R B;  2H6F B;  4GTP B;  4ZRP A;  5FOB B;  4M76 A;  1TNO B;  5JPN B;  2XWB B;  2SQC A;  1SQC A;  2WY8 A;  3PZ3 B;  4V1R A;  1N4S B;  3D5R A;  1KZP B;  2V3P A;  1LD8 B;  1TNU B;  2WIN B;  1N94 B;  4GTM B;  3DSW B;  3KQ4 A;  2GOX A;  4LNG B;  1X81 B;  2F0Y B;  3SFY B;  1H36 A;  3E37 B;  5FO8 B;  1JCS B;  1TNB B;  3E32 B;  4BOK A;  1O5M B;  4GTQ B;  3RJ3 A;  1N9A B;  3CU7 A;  4GTR B;  4D4B A;  2V3N A;  2B39 A;  1R76 A;  1TN6 B;  4D4C A;  1N95 B;  1JCR B;  1W6J A;  3DPY B;  1O6Q A;  2V8I A;  3OED A;  1O6H A;  2R2L B;  1UMP A;  3E34 B;  4D4A A;  2V8J A;  3HXE B;  3E33 B;  1LTX B;  4GTO B;  1GXO A;  1HZF A;  3Q78 B;  4GTT B;  1D8E B;  1QSJ A;  3PZ2 B;  2A73 B;  1MZC B;  4D94 A;  3SQC A;  4EHM B;  5FO9 B;  3C72 B;  2WII B;  2BED B;  2BB6 A;  2ZIS B;  4V1S A;  1TNY B;  3Q75 B;  3G6J B;  4LNV A;  2ZIR B;  1TNZ B;  3KSL B;  3EU5 B;  1JCQ B;  3Q7A B;  1N4R B;  1QQF A;  1LD7 B;  1SA5 B;  3DSU B;  1C3D A;  2PN5 A;  1DCE B;  2WY7 A;  3Q79 B;  4MU9 A;  2G0D A;  2PMV A;  3HXD B;  4MBG B;  3HXF B;  3PZ1 B;  2XQW A;  2G02 A;  4LNB B;  1S64 B;  3HXC B;  3DST B;  4L9P B;  4GTS B;  1S63 B;  4YDE B;  3Q73 B;  3DSX B;  1GXN A;  1H39 A;  3E30 B;  1N4P B;  1O1T B;  4ZRQ A;  4KKJ A;  1KZO B;  5AGD A;  3DSS B;  2V8K A;  4KKI A; 
#chains in the Genus database with same CATH topology
 1X9D A;  1D8D B;  1TN8 B;  1FT2 B;  2NOJ A;  2D5J A;  3WKH A;  4KTR A;  4AYQ A;  5JPM B;  1O1S B;  3Q7F B;  2BB5 A;  3CIH A;  3HXB B;  1IA6 A;  2WDA A;  4FUS A;  1HMW A;  3W7S A;  1FT1 B;  1AGM A;  3EUV B;  4ZH1 A;  2H6G B;  3QG0 A;  4NEI A;  1NC5 A;  5ILK A;  1HMU A;  1N1Z A;  3OXU A;  2QNO A;  2ONG A;  3SFX B;  1FBO A;  1NL4 B;  1O1R B;  2H6F B;  5ILJ A;  5IKH A;  4F10 A;  4CE7 A;  4M76 A;  1WU6 A;  3QRY A;  5JPN B;  2XWB B;  1LXK A;  4CJ0 A;  5IL3 A;  1RQ5 A;  3M7L A;  3S4A A;  1H13 A;  4TF4 A;  3D5R A;  1KZP B;  1XWT A;  1TNU B;  5ILI A;  3WKI A;  4LNG B;  1KSC A;  3SFY B;  1H36 A;  5FO8 B;  1W3Y A;  1DOG A;  3S4D A;  1ULV A;  5DHI A;  2GH4 A;  3RJ3 A;  2V3N A;  3TF4 A;  1TN6 B;  1HXA A;  1HN0 A;  1HCU A;  1JCR B;  2E24 A;  3M78 A;  1J0N A;  4FNV A;  1UMP A;  1FO3 A;  2JF4 A;  3ANK A;  1IS9 A;  1V5C A;  3WIR A;  2E22 A;  1CEM A;  4GAX A;  1GXO A;  1HZF A;  3M75 A;  2GZ6 A;  2RI9 A;  1D8E B;  2X03 A;  3N0F A;  3NFV A;  2ZIS B;  4YCR A;  2AHG A;  4V1S A;  5E2J A;  1WU5 A;  4Z4L A;  1TNZ B;  3SDR A;  3M72 A;  3Q7A B;  3M7C A;  4ZH5 A;  1QQF A;  3QWT A;  4JJJ A;  3DSU B;  2EAD A;  1C3D A;  2WY7 A;  3NNB A;  4MU9 A;  1HM2 A;  3HXD B;  1GAI A;  3WIQ A;  2DRO A;  1KKT A;  4L9P B;  5CZL A;  1LF6 A;  2BRP A;  4OK2 A;  3E30 B;  4KKJ A;  3H2W A;  5AGD A;  1EGU A;  4KKI A;  4DI5 A;  4FXG B;  1H3C A;  2ZBL A;  1GA2 A;  1N7O A;  3M01 A;  4XUV A;  1H3B A;  1QBQ B;  3H7L A;  5FO7 B;  3K7X A;  5M7Y A;  3SDT A;  4TXT A;  5DHK A;  4ONT A;  1UT9 A;  1TN7 B;  3QSP A;  3M00 A;  1GHQ A;  1H35 A;  2VN7 A;  4OJZ A;  1KWF A;  2H6I B;  5JMD A;  1SA4 B;  3M7E A;  5GY3 A;  1H37 A;  2XWJ B;  4WVC A;  3DRA B;  1FPP B;  1G9J A;  2FBA A;  4L0G A;  1G87 A;  4GTP B;  2FV0 A;  4AYR A;  1FO2 A;  1K72 A;  4WVA A;  4V1R A;  1N4S B;  2NVP A;  2CQT A;  1LD8 B;  3QT9 A;  1N94 B;  2VN4 A;  3QXF A;  1KRF A;  2GOX A;  1X81 B;  5IK0 A;  3M77 A;  1F1S A;  3E73 A;  1X1I A;  1LF9 A;  2F6D A;  2FUQ A;  1F9O A;  1N9A B;  1NXC A;  3CU7 A;  1WZZ A;  1UG9 A;  1R76 A;  4D4C A;  3SDQ A;  1KRE A;  3QFY A;  1RWA A;  4AYO A;  1W6J A;  1O6Q A;  1KFG A;  2V8I A;  1I8Q A;  3OED A;  4GL3 A;  3E34 B;  4D4A A;  1C82 A;  2V8J A;  1LTX B;  1FP3 A;  1X1H A;  3P5P A;  4GTO B;  1FMI A;  2Z07 A;  1QAZ A;  3Q78 B;  1QSJ A;  5KKB A;  3RX8 A;  2FV1 A;  3S4B A;  4DOD A;  4EHM B;  3GZK A;  2BB6 A;  3VSM A;  3M7B A;  1TNY B;  2XFG A;  5IK9 A;  4AYP A;  3H3K A;  3REN A;  5EAU A;  1JCQ B;  3A3V A;  4QT9 A;  1OJM A;  1N4R B;  1N23 A;  1LD7 B;  1SA5 B;  3VXD A;  1F9D A;  1DCE B;  3WC3 A;  3GLY A;  1RWC A;  2PMV A;  3PZ1 B;  4J5T A;  2G02 A;  1S64 B;  1RWG A;  3DST B;  2JJB A;  3E80 A;  1F9G A;  1S63 B;  4OZW A;  3QDE A;  2AHF A;  2Q1F A;  1N4P B;  1O1T B;  2JG0 A;  4DOE A;  5IK6 A;  3M73 A;  4GTM B;  1O79 A;  4GTV B;  3E7J A;  3D3I A;  3T33 A;  4CJ1 A;  1N24 A;  1JS4 A;  3G4F A;  1XW2 A;  4FXK B;  4D4D A;  3SAE A;  1NI1 B;  1O6R A;  2EAB A;  3WKF A;  1HXC A;  1VD5 A;  3KLS A;  1L2A A;  4BOJ A;  5IM1 A;  2YIK A;  2RI8 A;  3M71 A;  3N0G A;  4YDO B;  3RSY A;  3DSV B;  2H6H B;  3ACS A;  1GSZ A;  3D5S A;  3KSQ B;  1RW9 A;  5ILD A;  3AFJ A;  1V7W A;  2P0V A;  1GAH A;  1TNO B;  1CLC A;  1LOH A;  1N21 A;  1SQC A;  3PZ3 B;  3SDU A;  1IA7 A;  3X17 A;  3QFZ A;  5ILY A;  5IKA A;  1TF4 A;  3DSW B;  3KQ4 A;  4KTP A;  2F0Y B;  4MMI A;  3E37 B;  2EAE A;  1V7X A;  3W5N A;  1JCS B;  3S4C A;  3E32 B;  2OKX A;  4BOK A;  1O5M B;  3PMM A;  1J0M A;  4WVB A;  5CA3 A;  4GTR B;  1N7Q A;  2B39 A;  4LIX A;  2ZZR A;  1N95 B;  3EQA A;  3RRS A;  5MEH A;  3QPF A;  2EAC A;  1O6H A;  2FUZ A;  2R2L B;  3HXE B;  3P5R A;  2J5C A;  3E33 B;  3EZ8 A;  3LZ9 A;  1KSD A;  4GTT B;  1G6I A;  3PZ2 B;  1MZC B;  1XWQ A;  4D94 A;  3RX5 A;  3C72 B;  1OJP A;  2BED B;  2WII B;  3ACT A;  4L6X A;  3WUX A;  1V7V A;  1FAE A;  4E1Y A;  3Q75 B;  4LNV A;  4OZV A;  3EU5 B;  3K11 A;  4Q2B A;  2CQS A;  1RWH A;  3W5M A;  1L1Y A;  1H14 A;  1X1J A;  2G0D A;  4EL8 A;  3HXF B;  3VW5 A;  1H54 A;  3AFL A;  3HXC B;  4GTS B;  4YDE B;  2DRR A;  3DSX B;  3ANJ A;  1KZO B;  3DSS B;  3RX7 A;  5C05 A;  1H12 A;  2BRW A;  4WU0 A;  1N4Q B;  3E6U A;  2IEJ B;  1AYX A;  1RWF A;  2BBC A;  1GXM A;  5DGR A;  5EAS A;  3W7U A;  3WKG A;  3QT3 A;  1CB8 A;  1DL2 A;  4Q88 A;  1G9G A;  5JMF A;  2I07 B;  1V5D A;  3PZ4 B;  1W6K A;  3A0O A;  5GZK A;  3SDV A;  5EAT A;  1N7R A;  3GT5 A;  1H3A A;  3PYB A;  4ZG8 A;  3VSN A;  4MMH A;  4OK4 A;  4ZRP A;  5FOB B;  5DGQ A;  3QXQ A;  4FJQ A;  2SQC A;  2WY8 A;  2ONH A;  2FUT A;  3S9V A;  1HM3 A;  1N7N A;  2V3P A;  2WIN B;  1OJN A;  5IL8 A;  1KS8 A;  5GW7 A;  1WU4 A;  3W7T A;  1TNB B;  4GTQ B;  4F13 A;  5CD2 A;  2AFA A;  3ANI A;  4D4B A;  1FBW A;  2DRQ A;  1HXG A;  3DPY B;  1HV6 A;  3W7W A;  1FCE A;  5ILH A;  2DRS A;  1LXM A;  3G4D A;  2A73 B;  1N20 A;  3SQC A;  5FO9 B;  1N7P A;  1GLM A;  2WCO A;  5M7I A;  1HX9 A;  3G6J B;  2ZIR B;  3WIW A;  2RGK A;  2D8L A;  3KSL B;  3W7X A;  3M02 A;  4Z4J A;  3M76 A;  1N22 A;  3ON6 A;  1OJO A;  2PN5 A;  2A8Z A;  3Q79 B;  1N1B A;  3PYA A;  4MBG B;  2XQW A;  2B4F A;  3EU8 A;  4LNB B;  3P2C A;  4RNQ A;  2BRV X;  3Q73 B;  3M74 A;  1GXN A;  1H39 A;  2WYN A;  5ILZ A;  4ZRQ A;  4C1S A;  2V8K A; 
#chains in the Genus database with same CATH homology
 1X9D A;  1D8D B;  1TN8 B;  1FT2 B;  2NOJ A;  2D5J A;  3WKH A;  4KTR A;  4AYQ A;  5JPM B;  1O1S B;  3Q7F B;  2BB5 A;  3CIH A;  3HXB B;  1IA6 A;  4FUS A;  3W7S A;  1FT1 B;  1AGM A;  3EUV B;  4ZH1 A;  2H6G B;  3QG0 A;  1NC5 A;  3OXU A;  2QNO A;  3SFX B;  1FBO A;  1NL4 B;  1O1R B;  2H6F B;  4CE7 A;  4M76 A;  1WU6 A;  3QRY A;  5JPN B;  2XWB B;  4CJ0 A;  1RQ5 A;  3M7L A;  3S4A A;  1H13 A;  4TF4 A;  3D5R A;  1KZP B;  1XWT A;  1TNU B;  3WKI A;  4LNG B;  1KSC A;  3SFY B;  1H36 A;  5FO8 B;  1DOG A;  3S4D A;  1ULV A;  2GH4 A;  3RJ3 A;  2V3N A;  3TF4 A;  1TN6 B;  1HCU A;  1JCR B;  3M78 A;  1UMP A;  1FO3 A;  2JF4 A;  3ANK A;  1IS9 A;  1V5C A;  3WIR A;  1CEM A;  1GXO A;  1HZF A;  3M75 A;  2GZ6 A;  2RI9 A;  1D8E B;  2ZIS B;  4YCR A;  2AHG A;  4V1S A;  5E2J A;  1WU5 A;  4Z4L A;  1TNZ B;  3SDR A;  3M72 A;  3Q7A B;  3M7C A;  4ZH5 A;  1QQF A;  3QWT A;  4JJJ A;  3DSU B;  2EAD A;  1C3D A;  2WY7 A;  4MU9 A;  3HXD B;  1GAI A;  3WIQ A;  2DRO A;  1KKT A;  4L9P B;  5CZL A;  1LF6 A;  3E30 B;  4KKJ A;  3H2W A;  5AGD A;  4KKI A;  4FXG B;  1H3C A;  2ZBL A;  1GA2 A;  4XUV A;  1H3B A;  1QBQ B;  3H7L A;  5FO7 B;  3K7X A;  5M7Y A;  3SDT A;  4TXT A;  4ONT A;  1UT9 A;  1TN7 B;  3QSP A;  1GHQ A;  1H35 A;  2VN7 A;  1KWF A;  2H6I B;  1SA4 B;  3M7E A;  5GY3 A;  1H37 A;  2XWJ B;  4WVC A;  3DRA B;  1FPP B;  1G9J A;  2FBA A;  4L0G A;  1G87 A;  4GTP B;  2FV0 A;  4AYR A;  1FO2 A;  1K72 A;  4WVA A;  4V1R A;  1N4S B;  2NVP A;  2CQT A;  1LD8 B;  3QT9 A;  1N94 B;  2VN4 A;  3QXF A;  1KRF A;  2GOX A;  1X81 B;  3M77 A;  3E73 A;  1LF9 A;  2F6D A;  1F9O A;  1N9A B;  1NXC A;  3CU7 A;  1WZZ A;  1UG9 A;  1R76 A;  4D4C A;  3SDQ A;  1KRE A;  3QFY A;  4AYO A;  1W6J A;  1O6Q A;  1KFG A;  2V8I A;  3OED A;  4GL3 A;  3E34 B;  4D4A A;  2V8J A;  1LTX B;  1FP3 A;  3P5P A;  4GTO B;  1FMI A;  2Z07 A;  3Q78 B;  1QSJ A;  5KKB A;  3RX8 A;  2FV1 A;  3S4B A;  4DOD A;  4EHM B;  3GZK A;  2BB6 A;  3M7B A;  1TNY B;  2XFG A;  4AYP A;  3H3K A;  3REN A;  1JCQ B;  3A3V A;  4QT9 A;  1N4R B;  1LD7 B;  1SA5 B;  3VXD A;  1F9D A;  1DCE B;  3WC3 A;  3GLY A;  2PMV A;  3PZ1 B;  4J5T A;  2G02 A;  1S64 B;  3DST B;  2JJB A;  1S63 B;  3QDE A;  2AHF A;  1N4P B;  1O1T B;  2JG0 A;  4DOE A;  3M73 A;  4GTM B;  1O79 A;  4GTV B;  3D3I A;  3T33 A;  4CJ1 A;  1JS4 A;  1XW2 A;  4FXK B;  4D4D A;  3SAE A;  1NI1 B;  1O6R A;  2EAB A;  3WKF A;  1VD5 A;  3KLS A;  1L2A A;  4BOJ A;  2YIK A;  2RI8 A;  3M71 A;  4YDO B;  3RSY A;  3DSV B;  2H6H B;  3ACS A;  1GSZ A;  3D5S A;  3KSQ B;  3AFJ A;  1V7W A;  2P0V A;  1GAH A;  1TNO B;  1CLC A;  1SQC A;  3PZ3 B;  3SDU A;  1IA7 A;  3X17 A;  3QFZ A;  1TF4 A;  3DSW B;  3KQ4 A;  4KTP A;  2F0Y B;  3E37 B;  2EAE A;  1V7X A;  3W5N A;  1JCS B;  3S4C A;  3E32 B;  2OKX A;  4BOK A;  1O5M B;  3PMM A;  4WVB A;  5CA3 A;  4GTR B;  2B39 A;  4LIX A;  2ZZR A;  1N95 B;  3EQA A;  3RRS A;  5MEH A;  3QPF A;  2EAC A;  1O6H A;  2FUZ A;  2R2L B;  3HXE B;  3P5R A;  3E33 B;  3EZ8 A;  1KSD A;  4GTT B;  1G6I A;  3PZ2 B;  1MZC B;  1XWQ A;  4D94 A;  3RX5 A;  3C72 B;  2WII B;  2BED B;  3ACT A;  4L6X A;  3WUX A;  1V7V A;  1FAE A;  3Q75 B;  4LNV A;  3EU5 B;  3K11 A;  4Q2B A;  2CQS A;  3W5M A;  1L1Y A;  1H14 A;  2G0D A;  4EL8 A;  3HXF B;  3VW5 A;  1H54 A;  3HXC B;  4GTS B;  4YDE B;  2DRR A;  3ANJ A;  3DSX B;  1KZO B;  3DSS B;  3RX7 A;  1H12 A;  4WU0 A;  1N4Q B;  3E6U A;  2IEJ B;  1AYX A;  2BBC A;  1GXM A;  5DGR A;  3W7U A;  3WKG A;  3QT3 A;  4Q88 A;  1DL2 A;  1G9G A;  2I07 B;  1V5D A;  3PZ4 B;  1W6K A;  5GZK A;  3SDV A;  3GT5 A;  1H3A A;  3PYB A;  4ZG8 A;  4ZRP A;  5FOB B;  5DGQ A;  3QXQ A;  2SQC A;  2WY8 A;  3S9V A;  2V3P A;  2WIN B;  1KS8 A;  5GW7 A;  1WU4 A;  3W7T A;  1TNB B;  4GTQ B;  5CD2 A;  2AFA A;  3ANI A;  4D4B A;  1FBW A;  2DRQ A;  3DPY B;  3W7W A;  1FCE A;  2DRS A;  2A73 B;  3SQC A;  5FO9 B;  1GLM A;  5M7I A;  3G6J B;  2ZIR B;  3WIW A;  2RGK A;  2D8L A;  3KSL B;  3W7X A;  4Z4J A;  3M76 A;  3ON6 A;  2PN5 A;  2A8Z A;  3Q79 B;  3PYA A;  4MBG B;  2XQW A;  2B4F A;  3EU8 A;  4LNB B;  3P2C A;  3Q73 B;  3M74 A;  1GXN A;  1H39 A;  2WYN A;  4ZRQ A;  4C1S A;  2V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...