3PZ3B

Crystal structure of rabggtase(delta lrr; delta ig) in complex with bms-analogue 14
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structure-Guided Development of Selective RabGGTase Inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 117
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3pz3B00
1LD7B 4LNGB 4D4CA 1KZOB 3E32B 3Q73B 2V8JA 4MU9A 4L9PB 3E34B 3Q75B 4YDOB 2I07B 2WY7A 3KSLB 5FO8B 1O79A 2SQCA 1D8EB 1GXMA 4FXGB 2WINB 4BOJA 3KQ4A 1H36A 1H3CA 4BOKA 1S64B 4D94A 4GTPB 2ZISB 4GTMB 1DCEB 1O1TB 1C3DA 3KLSA 1JCRB 1MZCB 1TN8B 4ZRQA 3E30B 3SQCA 3EU5B 4KKIA 4D4BA 3OEDA 1QSJA 2BB6A 3HXFB 3PZ4B 3Q78B 1SQCA 1GXOA 3Q79B 4GTSB 1H35A 1NI1B 2B39A 2G0DA 3PZ3B 3Q7FB 4EHMB 1R76A 1N4SB 3DPYB 2WY8A 3CU7A 1X81B 1H37A 1LD8B 2NOJA 4ZH1A 1H3AA 4M76A 1N4PB 1D8DB 1TN6B 4YDEB 3HXCB 1W6KA 3DSXB 1QBQB 1UMPA 2BB5A 1NL4B 3DSVB 3HXDB 3Q7AB 1TNYB 3DSUB 2R2LB 2BBCA 2XWJB 3E33B 3G6JB 3D5SA 3SFXB 4D4DA 1LTXB 1QQFA 1O6HA 3C72B 2V8KA 1N94B 2WIIB 4V1RA 2XQWA 2BEDB 3D5RA 1N9AB 4LNVA 3DSSB 1SA4B 1FT1B 4MBGB 3SFYB 2ZIRB 4GTRB 4LNBB 3EUVB 2A73B 1HZFA 1O1SB 1TNZB 3RJ3A 2PN5A 1O5MB 1GSZA 2XWBB 2G02A 3KSQB 4GTOB 5FO7B 1TNUB 3OXUA 4ZRPA 1N4RB 3HXBB 1TNOB 1TN7B 2V3NA 2H6IB 2V3PA 1SA5B 4GTVB 1O6QA 1JCSB 3PZ2B 3DSTB 3HXEB 5FO9B 4GTTB 1O6RA 1W6JA 4KKJA 1KZPB 4GTQB 2F0YB 4FXKB 3DRAB 3PZ1B 1FT2B 1H39A 1GXNA 1N4QB 2GOXA 2IEJB 5JPMB 1H3BA 1TNBB 4ONTA 1FPPB 1O1RB 3DSWB 1N95B 5AGDA 4C1SA 5FOBB 5JPNB 1JCQB 2H6GB 2PMVA 2H6FB 3E37B 1GHQA 4V1SA 1S63B 2H6HB 2V8IA 4D4AA 3K7XA
chains in the Genus database with same CATH superfamily
1KZOB 1N7NA 3E32B 4CJ0A 1FO2A 3E34B 2GZ6A 3Q75B 4CJ1A 3M78A 3QRYA 4YDOB 3KSLB 1WU5A 1I8QA 5FO8B 1O79A 3K11A 1D8EB 3TF4A 1N22A 4FXGB 1H3CA 1QAZA 1LXMA 2ZISB 4GTPB 1N7PA 1XW2A 4LIXA 3KLSA 2D8LA 4Z4JA 2E24A 2WCOA 1MZCB 3RRSA 4XUVA 3SQCA 5IL8A 2OKXA 4KKIA 5JMFA 2P0VA 2ZZRA 4WU0A 1KRFA 4KTPA 3Q78B 1HXGA 3AFLA 3M02A 3Q79B 1W3YA 1H35A 1GLMA 2FV0A 3M77A 3WIRA 2B39A 4AYQA 3S4BA 4L0GA 5ILJA 5ILDA 2DROA 5IK0A 5KKBA 1XWTA 1H3AA 3QFYA 5E2JA 4YDEB 1W6KA 2FUTA 4OZWA 3DSXB 2QNOA 1TNYB 3W7UA 4OK4A 2BBCA 3E33B 3G6JB 1QQFA 1O6HA 3C72B 5IKHA 2AFAA 2V8KA 4CE7A 3E7JA 4KTRA 1N9AB 1HM3A 4J5TA 4MMIA 1SA4B 4TXTA 1KREA 4GTRB 1O1SB 5M7YA 3M00A 4JJJA 3S4AA 5FO7B 2G02A 2JF4A 4ZH5A 3A3VA 2BRVX 1TF4A 3M72A 4GTVB 1O6QA 1NXCA 5JMDA 1RWAA 1W6JA 2VN7A 1FT2B 1IA6A 1GXNA 1H13A 5EASA 5GZKA 5JPMB 4AYPA 3WKFA 3M7LA 4AYOA 5JPNB 1CEMA 3S4DA 1RW9A 2H6GB 3SDVA 1V7XA 1VD5A 1GHQA 2J5CA 2JJBA 4GAXA 4RNQA 5IL3A 3VW5A 4D4AA 4WVBA 3E6UA 2A8ZA 4D4CA 4L9PB 5IK6A 1HV6A 1G6IA 1N20A 3G4FA 3KQ4A 4D94A 1RWFA 1DCEB 2WDAA 1FO3A 2EACA 1V7VA 2AHGA 5DHKA 1JCRB 4ZRQA 1RWCA 3EU5B 4D4BA 3GLYA 1QSJA 1EGUA 5GY3A 3M7EA 3PZ4B 3P5RA 4GTSB 1F1SA 3WKHA 5CD2A 4Z4LA 4EHMB 1LF6A 1R76A 3DPYB 3WKIA 5DHIA 1XWQA 4ZH1A 4M76A 1N4PB 3H2WA 4ZG8A 3HXCB 1UT9A 5DGQA 1UMPA 1LXKA 3ACTA 3HXDB 1IA7A 3DSUB 1J0MA 2XWJB 3SFXB 2FUZA 1N21A 1N94B 3GZKA 1OJPA 4MMHA 4OZVA 1WU6A 2X03A 1FT1B 2FV1A 2ZIRB 3QXFA 3SDTA 2CQTA 2A73B 4FJQA 3QT9A 1GSZA 2XWBB 3RENA 3KSQB 3W5MA 1N4RB 1GA2A 1TNOB 1OJMA 2V3NA 2H6IB 1RQ5A 1WU4A 5EAUA 2Z07A 3PZ2B 3HXEB 5FO9B 4GTTB 2BRPA 1O6RA 3QDEA 5IK9A 3W7XA 1KZPB 2ONHA 3EU8A 1N1BA 1L2AA 3EQAA 3E80A 4GL3A 2B4FA 1N4QB 1X1IA 1H3BA 4E1YA 1FPPB 4OJZA 3T33A 4C1SA 1L1YA 2F6DA 1HXCA 3M71A 5IKAA 3QPFA 4FUSA 3LZ9A 1AYXA 2H6FB 3A0OA 3D3IA 1C82A 1HX9A 1FAEA 1LD7B 2ZBLA 3S4CA 2V8JA 4MU9A 3VSNA 5ILZA 1LOHA 3WIWA 1HN0A 3M76A 3VXDA 2WY7A 1F9GA 2WINB 1HMWA 4BOJA 1H36A 1K72A 1KS8A 1CLCA 4BOKA 1S64B 4GTMB 1O1TB 3P5PA 3M75A 1N7OA 3P2CA 3E30B 3M73A 1HCUA 3S9VA 1NC5A 3PYBA 3H7LA 2EABA 1GXOA 1NI1B 3PZ3B 1G87A 3W7WA 1DOGA 3SDUA 1DL2A 1N4SB 2WY8A 3ANIA 3CU7A 1X81B 3WKGA 1H37A 1LD8B 5IM1A 3SAEA 1D8DB 1TN6B 3AFJA 2FUQA 1FMIA 1QBQB 1X1HA 3DSVB 3ACSA 1X1JA 1V5DA 2VN4A 2R2LB 3CIHA 1LTXB 1N24A 4WVCA 2EAEA 5EATA 3H3KA 3QFZA 2FBAA 3NNBA 1N7RA 3DSSB 4MBGB 3EZ8A 3E73A 4LNBB 1HZFA 2D5JA 4DI5A 3SDQA 1TNZB 3RJ3A 1FP3A 1O5MB 3PYAA 4Q2BA 1G9JA 1GAIA 3OXUA 4ZRPA 1UG9A 2JG0A 2YIKA 3ANKA 2V3PA 5CA3A 1SA5B 2DRRA 1JCSB 3DSTB 3QT3A 2CQSA 2Q1FA 3RSYA 4DOEA 5DGRA 4DODA 3W5NA 3DRAB 4QT9A 1HM2A 5MEHA 2GOXA 1KKTA 4ONTA 3QWTA 1FBWA 1O1RB 5AGDA 1N95B 3NFVA 5FOBB 2EADA 3VSMA 1V5CA 2BRWA 5M7IA 3QG0A 1JS4A 3E37B 2AHFA 3QXQA 3M7CA 1S63B 4NEIA 2V8IA 1F9DA 4LNGB 2XFGA 3Q73B 3RX8A 2I07B 2E22A 3ON6A 2SQCA 1V7WA 1GXMA 1AGMA 3WC3A 2RI9A 3M7BA 1C3DA 4AYRA 1OJOA 1TN8B 2GH4A 1X9DA 3OEDA 3RX7A 3N0FA 1HMUA 2BB6A 3HXFB 4F13A 4WVAA 1SQCA 1FCEA 5ILIA 2NVPA 2G0DA 4L6XA 2RI8A 3Q7FB 1FBOA 1N7QA 2RGKA 1CB8A 2NOJA 3QSPA 3N0GA 1KFGA 1KWFA 2BB5A 1H54A 1NL4B 4TF4A 3Q7AB 1N23A 1LF9A 1N1ZA 3D5SA 4D4DA 4OK2A 5ILYA 2WIIB 4V1RA 2XQWA 2BEDB 3D5RA 3W7SA 4LNVA 4YCRA 5ILKA 1J0NA 5C05A 3SFYB 4F10A 1OJNA 3EUVB 1RWHA 4FNVA 1ULVA 1KSCA 2PN5A 2WYNA 4GTOB 3ANJA 1TNUB 3X17A 1KSDA 1F9OA 3HXBB 1TN7B 3WIQA 4EL8A 1H12A 1WZZA 3G4DA 4KKJA 1HXAA 3W7TA 3SDRA 4GTQB 3GT5A 1IS9A 1GAHA 2F0YB 4FXKB 3PZ1B 1H14A 3WUXA 1H39A 2IEJB 5ILHA 1TNBB 2ONGA 1G9GA 5CZLA 2DRSA 3DSWB 1JCQB 4Q88A 2PMVA 2DRQA 3M74A 1RWGA 3PMMA 3RX5A 3M01A 5GW7A 4V1SA 2H6HB 3K7XA
chains in the Genus database with same CATH topology
1KZOB 3E32B 4CJ0A 1FO2A 3E34B 2GZ6A 3Q75B 4CJ1A 3M78A 3QRYA 4YDOB 3KSLB 1WU5A 5FO8B 1O79A 3K11A 1D8EB 3TF4A 4FXGB 1H3CA 4GTPB 2ZISB 1XW2A 4LIXA 3KLSA 2D8LA 4Z4JA 1MZCB 3RRSA 4XUVA 3SQCA 2OKXA 4KKIA 2P0VA 2ZZRA 4WU0A 1KRFA 4KTPA 3Q78B 3Q79B 1H35A 1GLMA 2FV0A 3M77A 3WIRA 2B39A 4AYQA 3S4BA 4L0GA 2DROA 5KKBA 1XWTA 1H3AA 3QFYA 5E2JA 4YDEB 1W6KA 3DSXB 2QNOA 1TNYB 3W7UA 2BBCA 3E33B 3G6JB 1QQFA 1O6HA 3C72B 2AFAA 2V8KA 4CE7A 4KTRA 1N9AB 4J5TA 1SA4B 4TXTA 1KREA 4GTRB 1O1SB 5M7YA 4JJJA 3S4AA 5FO7B 2G02A 2JF4A 4ZH5A 3A3VA 1TF4A 3M72A 4GTVB 1O6QA 1NXCA 1W6JA 2VN7A 1FT2B 1IA6A 1GXNA 1H13A 5GZKA 5JPMB 4AYPA 3WKFA 3M7LA 4AYOA 5JPNB 1CEMA 3S4DA 2H6GB 3SDVA 1V7XA 1VD5A 1GHQA 2JJBA 3VW5A 4D4AA 4WVBA 3E6UA 2A8ZA 4D4CA 4L9PB 1G6IA 3KQ4A 4D94A 1DCEB 1FO3A 2EACA 1V7VA 2AHGA 1JCRB 4ZRQA 3EU5B 4D4BA 3GLYA 1QSJA 5GY3A 3M7EA 3PZ4B 3P5RA 4GTSB 3WKHA 5CD2A 4Z4LA 4EHMB 1LF6A 1R76A 3DPYB 3WKIA 1XWQA 4ZH1A 4M76A 1N4PB 3H2WA 4ZG8A 3HXCB 1UT9A 5DGQA 1UMPA 3ACTA 3HXDB 1IA7A 3DSUB 2XWJB 3SFXB 2FUZA 1N94B 3GZKA 1WU6A 1FT1B 2FV1A 2ZIRB 3QXFA 3SDTA 2CQTA 2A73B 3QT9A 1GSZA 2XWBB 3RENA 3KSQB 3W5MA 1N4RB 1GA2A 1TNOB 2V3NA 2H6IB 1RQ5A 1WU4A 2Z07A 3PZ2B 3HXEB 5FO9B 4GTTB 3QDEA 1O6RA 3W7XA 1KZPB 3EU8A 1L2AA 3EQAA 4GL3A 2B4FA 1N4QB 1H3BA 1FPPB 3T33A 4C1SA 1L1YA 2F6DA 3M71A 3QPFA 4FUSA 1AYXA 2H6FB 3D3IA 1FAEA 1LD7B 2ZBLA 3S4CA 2V8JA 4MU9A 3WIWA 3M76A 3VXDA 2WY7A 2WINB 4BOJA 1KS8A 1H36A 1K72A 1CLCA 4BOKA 1S64B 4GTMB 1O1TB 3P5PA 3M75A 3P2CA 3E30B 3M73A 1HCUA 3S9VA 1NC5A 3PYBA 3H7LA 2EABA 1GXOA 1NI1B 3PZ3B 1G87A 3W7WA 1DOGA 3SDUA 1DL2A 1N4SB 2WY8A 3ANIA 3CU7A 1X81B 3WKGA 1H37A 1LD8B 3SAEA 1D8DB 1TN6B 3AFJA 1FMIA 1QBQB 3DSVB 3ACSA 1V5DA 2VN4A 2R2LB 3CIHA 1LTXB 4WVCA 2EAEA 3H3KA 3QFZA 2FBAA 3DSSB 4MBGB 3EZ8A 3E73A 4LNBB 1HZFA 2D5JA 3SDQA 1TNZB 3RJ3A 1FP3A 1O5MB 3PYAA 4Q2BA 1G9JA 1GAIA 3OXUA 4ZRPA 1UG9A 2JG0A 2YIKA 3ANKA 2V3PA 5CA3A 1SA5B 2DRRA 1JCSB 3DSTB 3QT3A 2CQSA 3RSYA 4DOEA 5DGRA 4DODA 3W5NA 3DRAB 4QT9A 5MEHA 2GOXA 1KKTA 4ONTA 3QWTA 1FBWA 1O1RB 5AGDA 1N95B 5FOBB 2EADA 1V5CA 5M7IA 3QG0A 1JS4A 3E37B 2AHFA 3QXQA 3M7CA 1S63B 2V8IA 1F9DA 4LNGB 2XFGA 3Q73B 3RX8A 2I07B 3ON6A 2SQCA 1V7WA 1GXMA 1AGMA 3WC3A 2RI9A 3M7BA 1C3DA 4AYRA 1TN8B 2GH4A 1X9DA 3OEDA 3RX7A 2BB6A 3HXFB 4WVAA 1SQCA 1FCEA 2NVPA 2G0DA 4L6XA 2RI8A 3Q7FB 1FBOA 2RGKA 2NOJA 3QSPA 1KFGA 1KWFA 2BB5A 1H54A 1NL4B 4TF4A 3Q7AB 1LF9A 3D5SA 4D4DA 2WIIB 4V1RA 2XQWA 2BEDB 3D5RA 3W7SA 4LNVA 4YCRA 3SFYB 3EUVB 1ULVA 1KSCA 2PN5A 2WYNA 4GTOB 3ANJA 1TNUB 3X17A 1KSDA 1F9OA 3HXBB 1TN7B 3WIQA 4EL8A 1H12A 1WZZA 4KKJA 3W7TA 3SDRA 4GTQB 3GT5A 1IS9A 1GAHA 2F0YB 4FXKB 3PZ1B 1H14A 3WUXA 1H39A 2IEJB 1TNBB 1G9GA 5CZLA 2DRSA 3DSWB 1JCQB 4Q88A 2PMVA 2DRQA 3M74A 3PMMA 3RX5A 5GW7A 4V1SA 2H6HB 3K7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LD7 B;  4LNG B;  4D4C A;  1KZO B;  3E32 B;  3Q73 B;  2V8J A;  4MU9 A;  4L9P B;  3E34 B;  3Q75 B;  4YDO B;  2I07 B;  2WY7 A;  3KSL B;  5FO8 B;  1O79 A;  2SQC A;  1D8E B;  1GXM A;  4FXG B;  2WIN B;  4BOJ A;  3KQ4 A;  1H36 A;  1H3C A;  4BOK A;  1S64 B;  4D94 A;  4GTP B;  2ZIS B;  4GTM B;  1DCE B;  1O1T B;  1C3D A;  3KLS A;  1JCR B;  1MZC B;  1TN8 B;  4ZRQ A;  3E30 B;  3SQC A;  3EU5 B;  4KKI A;  4D4B A;  3OED A;  1QSJ A;  2BB6 A;  3HXF B;  3PZ4 B;  3Q78 B;  1SQC A;  1GXO A;  3Q79 B;  4GTS B;  1H35 A;  1NI1 B;  2B39 A;  2G0D A;  3PZ3 B;  3Q7F B;  4EHM B;  1R76 A;  1N4S B;  3DPY B;  2WY8 A;  3CU7 A;  1X81 B;  1H37 A;  1LD8 B;  2NOJ A;  4ZH1 A;  1H3A A;  4M76 A;  1N4P B;  1D8D B;  1TN6 B;  4YDE B;  3HXC B;  1W6K A;  3DSX B;  1QBQ B;  1UMP A;  2BB5 A;  1NL4 B;  3DSV B;  3HXD B;  3Q7A B;  1TNY B;  3DSU B;  2R2L B;  2BBC A;  2XWJ B;  3E33 B;  3G6J B;  3D5S A;  3SFX B;  4D4D A;  1LTX B;  1QQF A;  1O6H A;  3C72 B;  2V8K A;  1N94 B;  2WII B;  4V1R A;  2XQW A;  2BED B;  3D5R A;  1N9A B;  4LNV A;  3DSS B;  1SA4 B;  1FT1 B;  4MBG B;  3SFY B;  2ZIR B;  4GTR B;  4LNB B;  3EUV B;  2A73 B;  1HZF A;  1O1S B;  1TNZ B;  3RJ3 A;  2PN5 A;  1O5M B;  1GSZ A;  2XWB B;  2G02 A;  3KSQ B;  4GTO B;  5FO7 B;  1TNU B;  3OXU A;  4ZRP A;  1N4R B;  3HXB B;  1TNO B;  1TN7 B;  2V3N A;  2H6I B;  2V3P A;  1SA5 B;  4GTV B;  1O6Q A;  1JCS B;  3PZ2 B;  3DST B;  3HXE B;  5FO9 B;  4GTT B;  1O6R A;  1W6J A;  4KKJ A;  1KZP B;  4GTQ B;  2F0Y B;  4FXK B;  3DRA B;  3PZ1 B;  1FT2 B;  1H39 A;  1GXN A;  1N4Q B;  2GOX A;  2IEJ B;  5JPM B;  1H3B A;  1TNB B;  4ONT A;  1FPP B;  1O1R B;  3DSW B;  1N95 B;  5AGD A;  4C1S A;  5FOB B;  5JPN B;  1JCQ B;  2H6G B;  2PMV A;  2H6F B;  3E37 B;  1GHQ A;  4V1S A;  1S63 B;  2H6H B;  2V8I A;  4D4A A;  3K7X A; 
#chains in the Genus database with same CATH topology
 1KZO B;  1N7N A;  3E32 B;  4CJ0 A;  1FO2 A;  3E34 B;  2GZ6 A;  3Q75 B;  4CJ1 A;  3M78 A;  3QRY A;  4YDO B;  3KSL B;  1WU5 A;  1I8Q A;  5FO8 B;  1O79 A;  3K11 A;  1D8E B;  3TF4 A;  1N22 A;  4FXG B;  1H3C A;  1QAZ A;  1LXM A;  2ZIS B;  4GTP B;  1N7P A;  1XW2 A;  4LIX A;  3KLS A;  2D8L A;  4Z4J A;  2E24 A;  2WCO A;  1MZC B;  3RRS A;  4XUV A;  3SQC A;  5IL8 A;  2OKX A;  4KKI A;  5JMF A;  2P0V A;  2ZZR A;  4WU0 A;  1KRF A;  4KTP A;  3Q78 B;  1HXG A;  3AFL A;  3M02 A;  3Q79 B;  1W3Y A;  1H35 A;  1GLM A;  2FV0 A;  3M77 A;  3WIR A;  2B39 A;  4AYQ A;  3S4B A;  4L0G A;  5ILJ A;  5ILD A;  2DRO A;  5IK0 A;  5KKB A;  1XWT A;  1H3A A;  3QFY A;  5E2J A;  4YDE B;  1W6K A;  2FUT A;  4OZW A;  3DSX B;  2QNO A;  1TNY B;  3W7U A;  4OK4 A;  2BBC A;  3E33 B;  3G6J B;  1QQF A;  1O6H A;  3C72 B;  5IKH A;  2AFA A;  2V8K A;  4CE7 A;  3E7J A;  4KTR A;  1N9A B;  1HM3 A;  4J5T A;  4MMI A;  1SA4 B;  4TXT A;  1KRE A;  4GTR B;  1O1S B;  5M7Y A;  3M00 A;  4JJJ A;  3S4A A;  5FO7 B;  2G02 A;  2JF4 A;  4ZH5 A;  3A3V A;  2BRV X;  1TF4 A;  3M72 A;  4GTV B;  1O6Q A;  1NXC A;  5JMD A;  1RWA A;  1W6J A;  2VN7 A;  1FT2 B;  1IA6 A;  1GXN A;  1H13 A;  5EAS A;  5GZK A;  5JPM B;  4AYP A;  3WKF A;  3M7L A;  4AYO A;  5JPN B;  1CEM A;  3S4D A;  1RW9 A;  2H6G B;  3SDV A;  1V7X A;  1VD5 A;  1GHQ A;  2J5C A;  2JJB A;  4GAX A;  4RNQ A;  5IL3 A;  3VW5 A;  4D4A A;  4WVB A;  3E6U A;  2A8Z A;  4D4C A;  4L9P B;  5IK6 A;  1HV6 A;  1G6I A;  1N20 A;  3G4F A;  3KQ4 A;  4D94 A;  1RWF A;  1DCE B;  2WDA A;  1FO3 A;  2EAC A;  1V7V A;  2AHG A;  5DHK A;  1JCR B;  4ZRQ A;  1RWC A;  3EU5 B;  4D4B A;  3GLY A;  1QSJ A;  1EGU A;  5GY3 A;  3M7E A;  3PZ4 B;  3P5R A;  4GTS B;  1F1S A;  3WKH A;  5CD2 A;  4Z4L A;  4EHM B;  1LF6 A;  1R76 A;  3DPY B;  3WKI A;  5DHI A;  1XWQ A;  4ZH1 A;  4M76 A;  1N4P B;  3H2W A;  4ZG8 A;  3HXC B;  1UT9 A;  5DGQ A;  1UMP A;  1LXK A;  3ACT A;  3HXD B;  1IA7 A;  3DSU B;  1J0M A;  2XWJ B;  3SFX B;  2FUZ A;  1N21 A;  1N94 B;  3GZK A;  1OJP A;  4MMH A;  4OZV A;  1WU6 A;  2X03 A;  1FT1 B;  2FV1 A;  2ZIR B;  3QXF A;  3SDT A;  2CQT A;  2A73 B;  4FJQ A;  3QT9 A;  1GSZ A;  2XWB B;  3REN A;  3KSQ B;  3W5M A;  1N4R B;  1GA2 A;  1TNO B;  1OJM A;  2V3N A;  2H6I B;  1RQ5 A;  1WU4 A;  5EAU A;  2Z07 A;  3PZ2 B;  3HXE B;  5FO9 B;  4GTT B;  2BRP A;  1O6R A;  3QDE A;  5IK9 A;  3W7X A;  1KZP B;  2ONH A;  3EU8 A;  1N1B A;  1L2A A;  3EQA A;  3E80 A;  4GL3 A;  2B4F A;  1N4Q B;  1X1I A;  1H3B A;  4E1Y A;  1FPP B;  4OJZ A;  3T33 A;  4C1S A;  1L1Y A;  2F6D A;  1HXC A;  3M71 A;  5IKA A;  3QPF A;  4FUS A;  3LZ9 A;  1AYX A;  2H6F B;  3A0O A;  3D3I A;  1C82 A;  1HX9 A;  1FAE A;  1LD7 B;  2ZBL A;  3S4C A;  2V8J A;  4MU9 A;  3VSN A;  5ILZ A;  1LOH A;  3WIW A;  1HN0 A;  3M76 A;  3VXD A;  2WY7 A;  1F9G A;  2WIN B;  1HMW A;  4BOJ A;  1H36 A;  1K72 A;  1KS8 A;  1CLC A;  4BOK A;  1S64 B;  4GTM B;  1O1T B;  3P5P A;  3M75 A;  1N7O A;  3P2C A;  3E30 B;  3M73 A;  1HCU A;  3S9V A;  1NC5 A;  3PYB A;  3H7L A;  2EAB A;  1GXO A;  1NI1 B;  3PZ3 B;  1G87 A;  3W7W A;  1DOG A;  3SDU A;  1DL2 A;  1N4S B;  2WY8 A;  3ANI A;  3CU7 A;  1X81 B;  3WKG A;  1H37 A;  1LD8 B;  5IM1 A;  3SAE A;  1D8D B;  1TN6 B;  3AFJ A;  2FUQ A;  1FMI A;  1QBQ B;  1X1H A;  3DSV B;  3ACS A;  1X1J A;  1V5D A;  2VN4 A;  2R2L B;  3CIH A;  1LTX B;  1N24 A;  4WVC A;  2EAE A;  5EAT A;  3H3K A;  3QFZ A;  2FBA A;  3NNB A;  1N7R A;  3DSS B;  4MBG B;  3EZ8 A;  3E73 A;  4LNB B;  1HZF A;  2D5J A;  4DI5 A;  3SDQ A;  1TNZ B;  3RJ3 A;  1FP3 A;  1O5M B;  3PYA A;  4Q2B A;  1G9J A;  1GAI A;  3OXU A;  4ZRP A;  1UG9 A;  2JG0 A;  2YIK A;  3ANK A;  2V3P A;  5CA3 A;  1SA5 B;  2DRR A;  1JCS B;  3DST B;  3QT3 A;  2CQS A;  2Q1F A;  3RSY A;  4DOE A;  5DGR A;  4DOD A;  3W5N A;  3DRA B;  4QT9 A;  1HM2 A;  5MEH A;  2GOX A;  1KKT A;  4ONT A;  3QWT A;  1FBW A;  1O1R B;  5AGD A;  1N95 B;  3NFV A;  5FOB B;  2EAD A;  3VSM A;  1V5C A;  2BRW A;  5M7I A;  3QG0 A;  1JS4 A;  3E37 B;  2AHF A;  3QXQ A;  3M7C A;  1S63 B;  4NEI A;  2V8I A;  1F9D A;  4LNG B;  2XFG A;  3Q73 B;  3RX8 A;  2I07 B;  2E22 A;  3ON6 A;  2SQC A;  1V7W A;  1GXM A;  1AGM A;  3WC3 A;  2RI9 A;  3M7B A;  1C3D A;  4AYR A;  1OJO A;  1TN8 B;  2GH4 A;  1X9D A;  3OED A;  3RX7 A;  3N0F A;  1HMU A;  2BB6 A;  3HXF B;  4F13 A;  4WVA A;  1SQC A;  1FCE A;  5ILI A;  2NVP A;  2G0D A;  4L6X A;  2RI8 A;  3Q7F B;  1FBO A;  1N7Q A;  2RGK A;  1CB8 A;  2NOJ A;  3QSP A;  3N0G A;  1KFG A;  1KWF A;  2BB5 A;  1H54 A;  1NL4 B;  4TF4 A;  3Q7A B;  1N23 A;  1LF9 A;  1N1Z A;  3D5S A;  4D4D A;  4OK2 A;  5ILY A;  2WII B;  4V1R A;  2XQW A;  2BED B;  3D5R A;  3W7S A;  4LNV A;  4YCR A;  5ILK A;  1J0N A;  5C05 A;  3SFY B;  4F10 A;  1OJN A;  3EUV B;  1RWH A;  4FNV A;  1ULV A;  1KSC A;  2PN5 A;  2WYN A;  4GTO B;  3ANJ A;  1TNU B;  3X17 A;  1KSD A;  1F9O A;  3HXB B;  1TN7 B;  3WIQ A;  4EL8 A;  1H12 A;  1WZZ A;  3G4D A;  4KKJ A;  1HXA A;  3W7T A;  3SDR A;  4GTQ B;  3GT5 A;  1IS9 A;  1GAH A;  2F0Y B;  4FXK B;  3PZ1 B;  1H14 A;  3WUX A;  1H39 A;  2IEJ B;  5ILH A;  1TNB B;  2ONG A;  1G9G A;  5CZL A;  2DRS A;  3DSW B;  1JCQ B;  4Q88 A;  2PMV A;  2DRQ A;  3M74 A;  1RWG A;  3PMM A;  3RX5 A;  3M01 A;  5GW7 A;  4V1S A;  2H6H B;  3K7X A; 
#chains in the Genus database with same CATH homology
 1KZO B;  3E32 B;  4CJ0 A;  1FO2 A;  3E34 B;  2GZ6 A;  3Q75 B;  4CJ1 A;  3M78 A;  3QRY A;  4YDO B;  3KSL B;  1WU5 A;  5FO8 B;  1O79 A;  3K11 A;  1D8E B;  3TF4 A;  4FXG B;  1H3C A;  4GTP B;  2ZIS B;  1XW2 A;  4LIX A;  3KLS A;  2D8L A;  4Z4J A;  1MZC B;  3RRS A;  4XUV A;  3SQC A;  2OKX A;  4KKI A;  2P0V A;  2ZZR A;  4WU0 A;  1KRF A;  4KTP A;  3Q78 B;  3Q79 B;  1H35 A;  1GLM A;  2FV0 A;  3M77 A;  3WIR A;  2B39 A;  4AYQ A;  3S4B A;  4L0G A;  2DRO A;  5KKB A;  1XWT A;  1H3A A;  3QFY A;  5E2J A;  4YDE B;  1W6K A;  3DSX B;  2QNO A;  1TNY B;  3W7U A;  2BBC A;  3E33 B;  3G6J B;  1QQF A;  1O6H A;  3C72 B;  2AFA A;  2V8K A;  4CE7 A;  4KTR A;  1N9A B;  4J5T A;  1SA4 B;  4TXT A;  1KRE A;  4GTR B;  1O1S B;  5M7Y A;  4JJJ A;  3S4A A;  5FO7 B;  2G02 A;  2JF4 A;  4ZH5 A;  3A3V A;  1TF4 A;  3M72 A;  4GTV B;  1O6Q A;  1NXC A;  1W6J A;  2VN7 A;  1FT2 B;  1IA6 A;  1GXN A;  1H13 A;  5GZK A;  5JPM B;  4AYP A;  3WKF A;  3M7L A;  4AYO A;  5JPN B;  1CEM A;  3S4D A;  2H6G B;  3SDV A;  1V7X A;  1VD5 A;  1GHQ A;  2JJB A;  3VW5 A;  4D4A A;  4WVB A;  3E6U A;  2A8Z A;  4D4C A;  4L9P B;  1G6I A;  3KQ4 A;  4D94 A;  1DCE B;  1FO3 A;  2EAC A;  1V7V A;  2AHG A;  1JCR B;  4ZRQ A;  3EU5 B;  4D4B A;  3GLY A;  1QSJ A;  5GY3 A;  3M7E A;  3PZ4 B;  3P5R A;  4GTS B;  3WKH A;  5CD2 A;  4Z4L A;  4EHM B;  1LF6 A;  1R76 A;  3DPY B;  3WKI A;  1XWQ A;  4ZH1 A;  4M76 A;  1N4P B;  3H2W A;  4ZG8 A;  3HXC B;  1UT9 A;  5DGQ A;  1UMP A;  3ACT A;  3HXD B;  1IA7 A;  3DSU B;  2XWJ B;  3SFX B;  2FUZ A;  1N94 B;  3GZK A;  1WU6 A;  1FT1 B;  2FV1 A;  2ZIR B;  3QXF A;  3SDT A;  2CQT A;  2A73 B;  3QT9 A;  1GSZ A;  2XWB B;  3REN A;  3KSQ B;  3W5M A;  1N4R B;  1GA2 A;  1TNO B;  2V3N A;  2H6I B;  1RQ5 A;  1WU4 A;  2Z07 A;  3PZ2 B;  3HXE B;  5FO9 B;  4GTT B;  3QDE A;  1O6R A;  3W7X A;  1KZP B;  3EU8 A;  1L2A A;  3EQA A;  4GL3 A;  2B4F A;  1N4Q B;  1H3B A;  1FPP B;  3T33 A;  4C1S A;  1L1Y A;  2F6D A;  3M71 A;  3QPF A;  4FUS A;  1AYX A;  2H6F B;  3D3I A;  1FAE A;  1LD7 B;  2ZBL A;  3S4C A;  2V8J A;  4MU9 A;  3WIW A;  3M76 A;  3VXD A;  2WY7 A;  2WIN B;  4BOJ A;  1KS8 A;  1H36 A;  1K72 A;  1CLC A;  4BOK A;  1S64 B;  4GTM B;  1O1T B;  3P5P A;  3M75 A;  3P2C A;  3E30 B;  3M73 A;  1HCU A;  3S9V A;  1NC5 A;  3PYB A;  3H7L A;  2EAB A;  1GXO A;  1NI1 B;  3PZ3 B;  1G87 A;  3W7W A;  1DOG A;  3SDU A;  1DL2 A;  1N4S B;  2WY8 A;  3ANI A;  3CU7 A;  1X81 B;  3WKG A;  1H37 A;  1LD8 B;  3SAE A;  1D8D B;  1TN6 B;  3AFJ A;  1FMI A;  1QBQ B;  3DSV B;  3ACS A;  1V5D A;  2VN4 A;  2R2L B;  3CIH A;  1LTX B;  4WVC A;  2EAE A;  3H3K A;  3QFZ A;  2FBA A;  3DSS B;  4MBG B;  3EZ8 A;  3E73 A;  4LNB B;  1HZF A;  2D5J A;  3SDQ A;  1TNZ B;  3RJ3 A;  1FP3 A;  1O5M B;  3PYA A;  4Q2B A;  1G9J A;  1GAI A;  3OXU A;  4ZRP A;  1UG9 A;  2JG0 A;  2YIK A;  3ANK A;  2V3P A;  5CA3 A;  1SA5 B;  2DRR A;  1JCS B;  3DST B;  3QT3 A;  2CQS A;  3RSY A;  4DOE A;  5DGR A;  4DOD A;  3W5N A;  3DRA B;  4QT9 A;  5MEH A;  2GOX A;  1KKT A;  4ONT A;  3QWT A;  1FBW A;  1O1R B;  5AGD A;  1N95 B;  5FOB B;  2EAD A;  1V5C A;  5M7I A;  3QG0 A;  1JS4 A;  3E37 B;  2AHF A;  3QXQ A;  3M7C A;  1S63 B;  2V8I A;  1F9D A;  4LNG B;  2XFG A;  3Q73 B;  3RX8 A;  2I07 B;  3ON6 A;  2SQC A;  1V7W A;  1GXM A;  1AGM A;  3WC3 A;  2RI9 A;  3M7B A;  1C3D A;  4AYR A;  1TN8 B;  2GH4 A;  1X9D A;  3OED A;  3RX7 A;  2BB6 A;  3HXF B;  4WVA A;  1SQC A;  1FCE A;  2NVP A;  2G0D A;  4L6X A;  2RI8 A;  3Q7F B;  1FBO A;  2RGK A;  2NOJ A;  3QSP A;  1KFG A;  1KWF A;  2BB5 A;  1H54 A;  1NL4 B;  4TF4 A;  3Q7A B;  1LF9 A;  3D5S A;  4D4D A;  2WII B;  4V1R A;  2XQW A;  2BED B;  3D5R A;  3W7S A;  4LNV A;  4YCR A;  3SFY B;  3EUV B;  1ULV A;  1KSC A;  2PN5 A;  2WYN A;  4GTO B;  3ANJ A;  1TNU B;  3X17 A;  1KSD A;  1F9O A;  3HXB B;  1TN7 B;  3WIQ A;  4EL8 A;  1H12 A;  1WZZ A;  4KKJ A;  3W7T A;  3SDR A;  4GTQ B;  3GT5 A;  1IS9 A;  1GAH A;  2F0Y B;  4FXK B;  3PZ1 B;  1H14 A;  3WUX A;  1H39 A;  2IEJ B;  1TNB B;  1G9G A;  5CZL A;  2DRS A;  3DSW B;  1JCQ B;  4Q88 A;  2PMV A;  2DRQ A;  3M74 A;  3PMM A;  3RX5 A;  5GW7 A;  4V1S A;  2H6H B;  3K7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...