3PZ3B

Crystal structure of rabggtase(delta lrr; delta ig) in complex with bms-analogue 14
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
327
structure length
324
Chain Sequence
b'QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structure-Guided Development of Selective RabGGTase Inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 117
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3pz3B00
5JPNB 1QSJA 5FO8B 1JCRB 1FT1B 4M76A 1HZFA 1NL4B 2ZIRB 3DSSB 4LNBB 4ZRPA 5FO7B 5FO9B 1H3AA 1FT2B 3DSVB 3Q75B 2V8KA 4L9PB 4D4BA 1TN8B 3DSWB 2WIIB 3D5RA 3HXFB 4ONTA 2H6GB 1GHQA 2PMVA 1GXMA 3E34B 3EU5B 1TNUB 2B39A 4D4CA 4MU9A 1H35A 4LNVA 4C1SA 3D5SA 4V1SA 3OEDA 1O79A 2NOJA 3Q7AB 2G02A 1H3CA 1D8EB 1S64B 3HXBB 1SQCA 3Q79B 4GTRB 4KKJA 1W6JA 1N4QB 1TNOB 4GTSB 2BEDB 4FXGB 1H36A 1N95B 4YDOB 1NI1B 1N9AB 1X81B 4GTQB 2V8JA 1LD7B 4D94A 5FOBB 4BOJA 3DSTB 1TNBB 3KLSA 3SFYB 4GTOB 1GXNA 2BBCA 2XQWA 4GTVB 1QBQB 1LD8B 2WINB 4ZH1A 4YDEB 2XWJB 2H6IB 3KSQB 2ZISB 4GTMB 2A73B 4FXKB 1DCEB 1S63B 2F0YB 3C72B 2GOXA 1R76A 1D8DB 2V8IA 3CU7A 3HXDB 1TN6B 1O1SB 2G0DA 2BB6A 3E37B 1O1RB 1JCSB 3KQ4A 2XWBB 1TNZB 1N4RB 2IEJB 3HXCB 4ZRQA 1W6KA 1O5MB 2H6FB 1O6QA 3G6JB 1GSZA 1H39A 4MBGB 3PZ2B 3OXUA 1N4PB 3SFXB 1UMPA 1TN7B 4BOKA 1TNYB 4D4DA 1JCQB 1MZCB 4KKIA 4LNGB 1SA5B 4GTPB 2WY8A 1H37A 3Q7FB 4D4AA 1N4SB 1KZOB 3PZ3B 1H3BA 1N94B 3K7XA 3DPYB 4EHMB 2BB5A 1O1TB 1O6HA 3DSUB 3E32B 5JPMB 1LTXB 1FPPB 1O6RA 3EUVB 3SQCA 2R2LB 1KZPB 2SQCA 1SA4B 2H6HB 3DSXB 2I07B 3PZ4B 3E33B 2V3PA 2WY7A 4V1RA 2V3NA 1QQFA 3RJ3A 3DRAB 3PZ1B 3E30B 3KSLB 1GXOA 3Q73B 3HXEB 3Q78B 5AGDA 1C3DA 4GTTB 2PN5A
chains in the Genus database with same CATH superfamily
5ILJA 5JPNB 5M7IA 3W5NA 2JJBA 3DSSB 4F10A 5IKHA 4LNBB 1UG9A 3QRYA 3NFVA 1RW9A 1WU4A 2V8KA 4TXTA 1FAEA 4ONTA 1N21A 3M00A 2PMVA 4GL3A 3QFYA 3SDUA 1TNUB 2B39A 1H35A 2X03A 3W7XA 2NOJA 5M7YA 2DRRA 1H3CA 3ACTA 3M77A 1EGUA 1TNOB 4FXGB 1H36A 1WU6A 1N95B 1H54A 1NI1B 3ANIA 3H2WA 4WVCA 4BOJA 3W7UA 1CB8A 4GTOB 5DHIA 1H13A 1QBQB 4E1YA 2RI8A 2CQSA 1LD8B 1RWCA 2WINB 4ZH1A 4GTMB 2F0YB 3S9VA 4CJ1A 1R76A 2V8IA 3WKGA 2BRVX 3HXDB 5EASA 3KQ4A 1JCSB 1TNZB 1N4RB 3HXCB 2P0VA 1W6KA 1IA7A 4CE7A 1K72A 2FV1A 1OJPA 5IK9A 1N4PB 1UMPA 1TN7B 2DRSA 1TNYB 2FUZA 1JCQB 3M73A 3SDTA 2OKXA 4OK2A 4TF4A 4AYQA 2F6DA 4Z4LA 1N4SB 1KRFA 3P5RA 5IKAA 1F9DA 3WKIA 4FUSA 1H3BA 2FUQA 3K7XA 3W7SA 1N7RA 2BB5A 2B4FA 5JPMB 1FPPB 3A0OA 1C82A 3SQCA 2SQCA 2I07B 3PZ4B 5DGRA 2WDAA 2WY7A 1V7VA 2V3NA 5EATA 3ANJA 3WIRA 2JF4A 5AGDA 1C3DA 2PN5A 1HN0A 4GAXA 1KSDA 4OJZA 4AYPA 1HM3A 1N23A 3SAEA 2ZIRB 4ZRPA 5DHKA 1H3AA 2J5CA 1V7XA 1HMWA 2EACA 2VN7A 5GW7A 2RI9A 1TN8B 4WU0A 3HXFB 1GHQA 2ZZRA 3EU5B 5IM1A 3WIWA 1KFGA 4LNVA 1CLCA 1NC5A 3QFZA 1O79A 2VN4A 3M7EA 2G02A 3M75A 1D8EB 1S64B 3NNBA 1W3YA 3E80A 4YDOB 2EABA 4GTQB 2V8JA 1FMIA 3M72A 3SFYB 1J0MA 5ILDA 1NXCA 3K11A 2AHGA 1LF9A 2AHFA 3M71A 1OJNA 3RSYA 1RQ5A 2XWJB 3KSQB 3QXFA 5JMDA 3VSMA 1S63B 3CU7A 1D8DB 2WCOA 1RWGA 4NEIA 1UT9A 1ULVA 2Q1FA 1TN6B 3ACSA 2G0DA 3H7LA 2RGKA 2XWBB 4CJ0A 2IEJB 3QT9A 1N1ZA 1O5MB 1GSZA 3QXQA 4AYOA 4ZH5A 2FUTA 3PZ2B 3OXUA 2E24A 1V5CA 3E73A 2JG0A 1FO2A 3ON6A 4BOKA 2ONHA 3VXDA 3P5PA 2WY8A 3W7TA 3Q7FB 3M76A 4D4AA 1HXGA 1F1SA 3GLYA 1KZOB 4ZG8A 3DPYB 3G4FA 1O1TB 3M78A 4WVAA 1J0NA 3DSUB 1RWFA 3EUVB 3M7CA 4QT9A 3P2CA 3SDQA 3DSXB 3E7JA 2GH4A 3E33B 5IL8A 2V3PA 3H3KA 1FCEA 4RNQA 3RJ3A 1QQFA 3DRAB 1XW2A 3E30B 2DROA 3M7LA 3EQAA 1N24A 1WU5A 1QSJA 1FT1B 4M76A 4LIXA 1NL4B 5FO7B 5FO9B 1FP3A 1FT2B 2QNOA 5CA3A 3DSVB 1KS8A 3Q75B 3VSNA 1HMUA 1LOHA 1N7PA 1WZZA 2H6GB 4MU9A 4MMIA 4XUVA 4AYRA 4C1SA 3D5SA 1X1JA 2EADA 3M7BA 1JS4A 3RENA 3Q7AB 4OZWA 1XWTA 2NVPA 4GTRB 3T33A 5FOBB 3ANKA 3HXBB 1SQCA 3QPFA 4GTSB 1TF4A 4KTRA 3X17A 4Q2BA 1VD5A 2BEDB 1I8QA 2ZBLA 3WKFA 1N9AB 1X81B 3S4AA 3WUXA 4D94A 4F13A 5ILIA 3M74A 3KLSA 2XQWA 2BBCA 4KTPA 4DOEA 5JMFA 5ILZA 2ZISB 3QWTA 2AFAA 2A73B 5DGQA 1DCEB 2D8LA 1AGMA 3W7WA 3N0GA 3RX5A 2BRPA 4Z4JA 1O1SB 3E37B 1O1RB 3EZ8A 1F9OA 3M02A 2H6FB 3RRSA 1O6QA 3G6JB 1L1YA 3SDRA 1H39A 1KREA 2WYNA 5CZLA 4MBGB 3A3VA 1CEMA 1G9GA 4L6XA 3EU8A 1X1IA 3AFJA 1MZCB 1SA5B 2EAEA 4GTPB 3N0FA 1RWAA 3S4DA 5CD2A 1KSCA 1GA2A 1HXCA 1H14A 3PYBA 4DODA 2FV0A 1O6HA 3E32B 1LXMA 1O6RA 3QDEA 4FJQA 1KZPB 1SA4B 2H6HB 2GZ6A 2FBAA 2Z07A 5EAUA 4V1RA 3WIQA 5IK0A 3Q78B 2DRQA 3CIHA 2ONGA 1G87A 3D3IA 1N7NA 5FO8B 1JCRB 1GAIA 5C05A 1HZFA 1F9GA 5IK6A 3LZ9A 1L2AA 4L9PB 4D4BA 3DSWB 5ILKA 3QSPA 2WIIB 1XWQA 3D5RA 1LXKA 5ILYA 3S4CA 3S4BA 1GXMA 3E34B 1HX9A 3PMMA 4D4CA 1KWFA 1DL2A 3GZKA 1QAZA 3OEDA 4V1SA 2E22A 4KKJA 3Q79B 1W6JA 1X9DA 1N4QB 1V7WA 1DOGA 3WC3A 1OJMA 3GT5A 3E6UA 3TF4A 1LD7B 1N7QA 1FBWA 4L0GA 3DSTB 1TNBB 4OK4A 1GXNA 4GTVB 3M01A 2XFGA 2A8ZA 3SDVA 1HXAA 4WVBA 4Q88A 4YDEB 2H6IB 3AFLA 1IS9A 1GAHA 1N22A 4FXKB 3VW5A 1RWHA 1N7OA 3C72B 1AYXA 2GOXA 1HV6A 1G9JA 2YIKA 5KKBA 4DI5A 2BB6A 1G6IA 3RX7A 4MMHA 3QT3A 4ZRQA 1IA6A 1OJOA 3W5MA 4J5TA 3WKHA 4FNVA 3PYAA 4EL8A 1GLMA 3SFXB 5MEHA 4D4DA 4KKIA 4LNGB 3QG0A 1H37A 1X1HA 1FBOA 3G4DA 3PZ3B 1N94B 1HCUA 4OZVA 4EHMB 5GZKA 1H12A 1LTXB 2BRWA 5ILHA 2R2LB 1HM2A 2D5JA 5E2JA 3RX8A 5IL3A 3PZ1B 1N1BA 4JJJA 4YCRA 3KSLB 1GXOA 3Q73B 3HXEB 2CQTA 4GTTB 5GY3A 1LF6A 1KKTA 1V5DA 1N20A 1FO3A
chains in the Genus database with same CATH topology
5M7IA 5JPNB 3W5NA 2JJBA 3DSSB 4LNBB 1UG9A 3QRYA 1WU4A 2V8KA 4TXTA 1FAEA 4ONTA 2PMVA 4GL3A 3QFYA 3SDUA 1TNUB 2B39A 1H35A 3W7XA 2NOJA 5M7YA 2DRRA 1H3CA 3ACTA 3M77A 1TNOB 4FXGB 1H36A 1WU6A 1N95B 1H54A 1NI1B 3ANIA 3H2WA 4WVCA 4BOJA 3W7UA 4GTOB 1H13A 1QBQB 2RI8A 2CQSA 1LD8B 2WINB 4ZH1A 4GTMB 2F0YB 3S9VA 4CJ1A 1R76A 2V8IA 3WKGA 3HXDB 3KQ4A 1JCSB 1TNZB 1N4RB 3HXCB 2P0VA 1W6KA 1IA7A 4CE7A 1K72A 2FV1A 1N4PB 1UMPA 1TN7B 2DRSA 1TNYB 2FUZA 1JCQB 3M73A 3SDTA 2OKXA 4AYQA 4TF4A 2F6DA 4Z4LA 1N4SB 1KRFA 3P5RA 1F9DA 3WKIA 4FUSA 1H3BA 3K7XA 3W7SA 2BB5A 2B4FA 5JPMB 1FPPB 3SQCA 2SQCA 2I07B 3PZ4B 5DGRA 2WY7A 1V7VA 2V3NA 3ANJA 3WIRA 2JF4A 5AGDA 1C3DA 2PN5A 1KSDA 4AYPA 3SAEA 2ZIRB 4ZRPA 1H3AA 1V7XA 2EACA 2VN7A 5GW7A 2RI9A 1TN8B 4WU0A 3HXFB 1GHQA 2ZZRA 3EU5B 3WIWA 1KFGA 4LNVA 1CLCA 1NC5A 3QFZA 1O79A 2VN4A 3M7EA 2G02A 3M75A 1D8EB 1S64B 4YDOB 2EABA 4GTQB 2V8JA 1FMIA 3M72A 3SFYB 1NXCA 3K11A 2AHGA 1LF9A 2AHFA 3M71A 3RSYA 1RQ5A 2XWJB 3KSQB 3QXFA 1S63B 3CU7A 1D8DB 1UT9A 1ULVA 1TN6B 3ACSA 2G0DA 3H7LA 2RGKA 2XWBB 4CJ0A 2IEJB 3QT9A 1O5MB 1GSZA 3QXQA 4AYOA 4ZH5A 3PZ2B 3OXUA 1V5CA 3E73A 3ON6A 2JG0A 1FO2A 4BOKA 3VXDA 3P5PA 2WY8A 3W7TA 3Q7FB 3M76A 4D4AA 3GLYA 1KZOB 4ZG8A 3DPYB 1O1TB 3M78A 4WVAA 3DSUB 3EUVB 3M7CA 4QT9A 3P2CA 3SDQA 3DSXB 2GH4A 3E33B 2V3PA 3H3KA 1FCEA 3RJ3A 1QQFA 3DRAB 1XW2A 3E30B 2DROA 3M7LA 3EQAA 1WU5A 1QSJA 1FT1B 4M76A 4LIXA 1NL4B 5FO7B 5FO9B 1FP3A 1FT2B 2QNOA 5CA3A 3DSVB 1KS8A 3Q75B 1WZZA 2H6GB 4MU9A 4XUVA 4AYRA 4C1SA 3D5SA 2EADA 3M7BA 1JS4A 3RENA 3Q7AB 1XWTA 2NVPA 4GTRB 3T33A 5FOBB 3ANKA 3HXBB 1SQCA 3QPFA 4GTSB 1TF4A 4KTRA 3X17A 4Q2BA 1VD5A 2BEDB 2ZBLA 3WKFA 1N9AB 1X81B 3S4AA 3WUXA 4D94A 3M74A 3KLSA 2XQWA 2BBCA 4KTPA 4DOEA 2ZISB 3QWTA 2AFAA 2A73B 5DGQA 1DCEB 2D8LA 1AGMA 3W7WA 3RX5A 4Z4JA 1O1SB 3E37B 1O1RB 3EZ8A 1F9OA 2H6FB 3RRSA 1O6QA 3G6JB 1L1YA 3SDRA 1H39A 1KREA 2WYNA 5CZLA 4MBGB 3A3VA 1CEMA 1G9GA 4L6XA 3EU8A 3AFJA 1MZCB 1SA5B 2EAEA 4GTPB 3S4DA 5CD2A 1KSCA 1GA2A 1H14A 3PYBA 4DODA 2FV0A 1O6HA 3E32B 1O6RA 3QDEA 1KZPB 1SA4B 2H6HB 2GZ6A 2FBAA 2Z07A 4V1RA 3WIQA 3Q78B 2DRQA 3CIHA 1G87A 3D3IA 5FO8B 1JCRB 1GAIA 1HZFA 1L2AA 4L9PB 4D4BA 3DSWB 3QSPA 2WIIB 1XWQA 3D5RA 3S4CA 3S4BA 1GXMA 3E34B 3PMMA 4D4CA 1KWFA 1DL2A 3GZKA 3OEDA 4V1SA 4KKJA 3Q79B 1W6JA 1X9DA 1N4QB 1V7WA 1DOGA 3WC3A 3GT5A 3E6UA 3TF4A 1LD7B 1FBWA 4L0GA 3DSTB 1TNBB 1GXNA 4GTVB 2XFGA 2A8ZA 3SDVA 4WVBA 4Q88A 4YDEB 2H6IB 1IS9A 1GAHA 4FXKB 3VW5A 3C72B 1AYXA 2GOXA 2YIKA 1G9JA 5KKBA 2BB6A 1G6IA 3RX7A 3QT3A 4ZRQA 1IA6A 3W5MA 4J5TA 3WKHA 3PYAA 4EL8A 1GLMA 3SFXB 5MEHA 4D4DA 4KKIA 4LNGB 3QG0A 1H37A 1FBOA 3PZ3B 1N94B 1HCUA 4EHMB 5GZKA 1H12A 1LTXB 2R2LB 2D5JA 5E2JA 3RX8A 3PZ1B 4JJJA 4YCRA 3KSLB 1GXOA 3Q73B 3HXEB 2CQTA 4GTTB 5GY3A 1LF6A 1KKTA 1V5DA 1FO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPN B;  1QSJ A;  5FO8 B;  1JCR B;  1FT1 B;  4M76 A;  1HZF A;  1NL4 B;  2ZIR B;  3DSS B;  4LNB B;  4ZRP A;  5FO7 B;  5FO9 B;  1H3A A;  1FT2 B;  3DSV B;  3Q75 B;  2V8K A;  4L9P B;  4D4B A;  1TN8 B;  3DSW B;  2WII B;  3D5R A;  3HXF B;  4ONT A;  2H6G B;  1GHQ A;  2PMV A;  1GXM A;  3E34 B;  3EU5 B;  1TNU B;  2B39 A;  4D4C A;  4MU9 A;  1H35 A;  4LNV A;  4C1S A;  3D5S A;  4V1S A;  3OED A;  1O79 A;  2NOJ A;  3Q7A B;  2G02 A;  1H3C A;  1D8E B;  1S64 B;  3HXB B;  1SQC A;  3Q79 B;  4GTR B;  4KKJ A;  1W6J A;  1N4Q B;  1TNO B;  4GTS B;  2BED B;  4FXG B;  1H36 A;  1N95 B;  4YDO B;  1NI1 B;  1N9A B;  1X81 B;  4GTQ B;  2V8J A;  1LD7 B;  4D94 A;  5FOB B;  4BOJ A;  3DST B;  1TNB B;  3KLS A;  3SFY B;  4GTO B;  1GXN A;  2BBC A;  2XQW A;  4GTV B;  1QBQ B;  1LD8 B;  2WIN B;  4ZH1 A;  4YDE B;  2XWJ B;  2H6I B;  3KSQ B;  2ZIS B;  4GTM B;  2A73 B;  4FXK B;  1DCE B;  1S63 B;  2F0Y B;  3C72 B;  2GOX A;  1R76 A;  1D8D B;  2V8I A;  3CU7 A;  3HXD B;  1TN6 B;  1O1S B;  2G0D A;  2BB6 A;  3E37 B;  1O1R B;  1JCS B;  3KQ4 A;  2XWB B;  1TNZ B;  1N4R B;  2IEJ B;  3HXC B;  4ZRQ A;  1W6K A;  1O5M B;  2H6F B;  1O6Q A;  3G6J B;  1GSZ A;  1H39 A;  4MBG B;  3PZ2 B;  3OXU A;  1N4P B;  3SFX B;  1UMP A;  1TN7 B;  4BOK A;  1TNY B;  4D4D A;  1JCQ B;  1MZC B;  4KKI A;  4LNG B;  1SA5 B;  4GTP B;  2WY8 A;  1H37 A;  3Q7F B;  4D4A A;  1N4S B;  1KZO B;  3PZ3 B;  1H3B A;  1N94 B;  3K7X A;  3DPY B;  4EHM B;  2BB5 A;  1O1T B;  1O6H A;  3DSU B;  3E32 B;  5JPM B;  1LTX B;  1FPP B;  1O6R A;  3EUV B;  3SQC A;  2R2L B;  1KZP B;  2SQC A;  1SA4 B;  2H6H B;  3DSX B;  2I07 B;  3PZ4 B;  3E33 B;  2V3P A;  2WY7 A;  4V1R A;  2V3N A;  1QQF A;  3RJ3 A;  3DRA B;  3PZ1 B;  3E30 B;  3KSL B;  1GXO A;  3Q73 B;  3HXE B;  3Q78 B;  5AGD A;  1C3D A;  4GTT B;  2PN5 A; 
#chains in the Genus database with same CATH topology
 5ILJ A;  5JPN B;  5M7I A;  3W5N A;  2JJB A;  3DSS B;  4F10 A;  5IKH A;  4LNB B;  1UG9 A;  3QRY A;  3NFV A;  1RW9 A;  1WU4 A;  2V8K A;  4TXT A;  1FAE A;  4ONT A;  1N21 A;  3M00 A;  2PMV A;  4GL3 A;  3QFY A;  3SDU A;  1TNU B;  2B39 A;  1H35 A;  2X03 A;  3W7X A;  2NOJ A;  5M7Y A;  2DRR A;  1H3C A;  3ACT A;  3M77 A;  1EGU A;  1TNO B;  4FXG B;  1H36 A;  1WU6 A;  1N95 B;  1H54 A;  1NI1 B;  3ANI A;  3H2W A;  4WVC A;  4BOJ A;  3W7U A;  1CB8 A;  4GTO B;  5DHI A;  1H13 A;  1QBQ B;  4E1Y A;  2RI8 A;  2CQS A;  1LD8 B;  1RWC A;  2WIN B;  4ZH1 A;  4GTM B;  2F0Y B;  3S9V A;  4CJ1 A;  1R76 A;  2V8I A;  3WKG A;  2BRV X;  3HXD B;  5EAS A;  3KQ4 A;  1JCS B;  1TNZ B;  1N4R B;  3HXC B;  2P0V A;  1W6K A;  1IA7 A;  4CE7 A;  1K72 A;  2FV1 A;  1OJP A;  5IK9 A;  1N4P B;  1UMP A;  1TN7 B;  2DRS A;  1TNY B;  2FUZ A;  1JCQ B;  3M73 A;  3SDT A;  2OKX A;  4OK2 A;  4TF4 A;  4AYQ A;  2F6D A;  4Z4L A;  1N4S B;  1KRF A;  3P5R A;  5IKA A;  1F9D A;  3WKI A;  4FUS A;  1H3B A;  2FUQ A;  3K7X A;  3W7S A;  1N7R A;  2BB5 A;  2B4F A;  5JPM B;  1FPP B;  3A0O A;  1C82 A;  3SQC A;  2SQC A;  2I07 B;  3PZ4 B;  5DGR A;  2WDA A;  2WY7 A;  1V7V A;  2V3N A;  5EAT A;  3ANJ A;  3WIR A;  2JF4 A;  5AGD A;  1C3D A;  2PN5 A;  1HN0 A;  4GAX A;  1KSD A;  4OJZ A;  4AYP A;  1HM3 A;  1N23 A;  3SAE A;  2ZIR B;  4ZRP A;  5DHK A;  1H3A A;  2J5C A;  1V7X A;  1HMW A;  2EAC A;  2VN7 A;  5GW7 A;  2RI9 A;  1TN8 B;  4WU0 A;  3HXF B;  1GHQ A;  2ZZR A;  3EU5 B;  5IM1 A;  3WIW A;  1KFG A;  4LNV A;  1CLC A;  1NC5 A;  3QFZ A;  1O79 A;  2VN4 A;  3M7E A;  2G02 A;  3M75 A;  1D8E B;  1S64 B;  3NNB A;  1W3Y A;  3E80 A;  4YDO B;  2EAB A;  4GTQ B;  2V8J A;  1FMI A;  3M72 A;  3SFY B;  1J0M A;  5ILD A;  1NXC A;  3K11 A;  2AHG A;  1LF9 A;  2AHF A;  3M71 A;  1OJN A;  3RSY A;  1RQ5 A;  2XWJ B;  3KSQ B;  3QXF A;  5JMD A;  3VSM A;  1S63 B;  3CU7 A;  1D8D B;  2WCO A;  1RWG A;  4NEI A;  1UT9 A;  1ULV A;  2Q1F A;  1TN6 B;  3ACS A;  2G0D A;  3H7L A;  2RGK A;  2XWB B;  4CJ0 A;  2IEJ B;  3QT9 A;  1N1Z A;  1O5M B;  1GSZ A;  3QXQ A;  4AYO A;  4ZH5 A;  2FUT A;  3PZ2 B;  3OXU A;  2E24 A;  1V5C A;  3E73 A;  2JG0 A;  1FO2 A;  3ON6 A;  4BOK A;  2ONH A;  3VXD A;  3P5P A;  2WY8 A;  3W7T A;  3Q7F B;  3M76 A;  4D4A A;  1HXG A;  1F1S A;  3GLY A;  1KZO B;  4ZG8 A;  3DPY B;  3G4F A;  1O1T B;  3M78 A;  4WVA A;  1J0N A;  3DSU B;  1RWF A;  3EUV B;  3M7C A;  4QT9 A;  3P2C A;  3SDQ A;  3DSX B;  3E7J A;  2GH4 A;  3E33 B;  5IL8 A;  2V3P A;  3H3K A;  1FCE A;  4RNQ A;  3RJ3 A;  1QQF A;  3DRA B;  1XW2 A;  3E30 B;  2DRO A;  3M7L A;  3EQA A;  1N24 A;  1WU5 A;  1QSJ A;  1FT1 B;  4M76 A;  4LIX A;  1NL4 B;  5FO7 B;  5FO9 B;  1FP3 A;  1FT2 B;  2QNO A;  5CA3 A;  3DSV B;  1KS8 A;  3Q75 B;  3VSN A;  1HMU A;  1LOH A;  1N7P A;  1WZZ A;  2H6G B;  4MU9 A;  4MMI A;  4XUV A;  4AYR A;  4C1S A;  3D5S A;  1X1J A;  2EAD A;  3M7B A;  1JS4 A;  3REN A;  3Q7A B;  4OZW A;  1XWT A;  2NVP A;  4GTR B;  3T33 A;  5FOB B;  3ANK A;  3HXB B;  1SQC A;  3QPF A;  4GTS B;  1TF4 A;  4KTR A;  3X17 A;  4Q2B A;  1VD5 A;  2BED B;  1I8Q A;  2ZBL A;  3WKF A;  1N9A B;  1X81 B;  3S4A A;  3WUX A;  4D94 A;  4F13 A;  5ILI A;  3M74 A;  3KLS A;  2XQW A;  2BBC A;  4KTP A;  4DOE A;  5JMF A;  5ILZ A;  2ZIS B;  3QWT A;  2AFA A;  2A73 B;  5DGQ A;  1DCE B;  2D8L A;  1AGM A;  3W7W A;  3N0G A;  3RX5 A;  2BRP A;  4Z4J A;  1O1S B;  3E37 B;  1O1R B;  3EZ8 A;  1F9O A;  3M02 A;  2H6F B;  3RRS A;  1O6Q A;  3G6J B;  1L1Y A;  3SDR A;  1H39 A;  1KRE A;  2WYN A;  5CZL A;  4MBG B;  3A3V A;  1CEM A;  1G9G A;  4L6X A;  3EU8 A;  1X1I A;  3AFJ A;  1MZC B;  1SA5 B;  2EAE A;  4GTP B;  3N0F A;  1RWA A;  3S4D A;  5CD2 A;  1KSC A;  1GA2 A;  1HXC A;  1H14 A;  3PYB A;  4DOD A;  2FV0 A;  1O6H A;  3E32 B;  1LXM A;  1O6R A;  3QDE A;  4FJQ A;  1KZP B;  1SA4 B;  2H6H B;  2GZ6 A;  2FBA A;  2Z07 A;  5EAU A;  4V1R A;  3WIQ A;  5IK0 A;  3Q78 B;  2DRQ A;  3CIH A;  2ONG A;  1G87 A;  3D3I A;  1N7N A;  5FO8 B;  1JCR B;  1GAI A;  5C05 A;  1HZF A;  1F9G A;  5IK6 A;  3LZ9 A;  1L2A A;  4L9P B;  4D4B A;  3DSW B;  5ILK A;  3QSP A;  2WII B;  1XWQ A;  3D5R A;  1LXK A;  5ILY A;  3S4C A;  3S4B A;  1GXM A;  3E34 B;  1HX9 A;  3PMM A;  4D4C A;  1KWF A;  1DL2 A;  3GZK A;  1QAZ A;  3OED A;  4V1S A;  2E22 A;  4KKJ A;  3Q79 B;  1W6J A;  1X9D A;  1N4Q B;  1V7W A;  1DOG A;  3WC3 A;  1OJM A;  3GT5 A;  3E6U A;  3TF4 A;  1LD7 B;  1N7Q A;  1FBW A;  4L0G A;  3DST B;  1TNB B;  4OK4 A;  1GXN A;  4GTV B;  3M01 A;  2XFG A;  2A8Z A;  3SDV A;  1HXA A;  4WVB A;  4Q88 A;  4YDE B;  2H6I B;  3AFL A;  1IS9 A;  1GAH A;  1N22 A;  4FXK B;  3VW5 A;  1RWH A;  1N7O A;  3C72 B;  1AYX A;  2GOX A;  1HV6 A;  1G9J A;  2YIK A;  5KKB A;  4DI5 A;  2BB6 A;  1G6I A;  3RX7 A;  4MMH A;  3QT3 A;  4ZRQ A;  1IA6 A;  1OJO A;  3W5M A;  4J5T A;  3WKH A;  4FNV A;  3PYA A;  4EL8 A;  1GLM A;  3SFX B;  5MEH A;  4D4D A;  4KKI A;  4LNG B;  3QG0 A;  1H37 A;  1X1H A;  1FBO A;  3G4D A;  3PZ3 B;  1N94 B;  1HCU A;  4OZV A;  4EHM B;  5GZK A;  1H12 A;  1LTX B;  2BRW A;  5ILH A;  2R2L B;  1HM2 A;  2D5J A;  5E2J A;  3RX8 A;  5IL3 A;  3PZ1 B;  1N1B A;  4JJJ A;  4YCR A;  3KSL B;  1GXO A;  3Q73 B;  3HXE B;  2CQT A;  4GTT B;  5GY3 A;  1LF6 A;  1KKT A;  1V5D A;  1N20 A;  1FO3 A; 
#chains in the Genus database with same CATH homology
 5M7I A;  5JPN B;  3W5N A;  2JJB A;  3DSS B;  4LNB B;  1UG9 A;  3QRY A;  1WU4 A;  2V8K A;  4TXT A;  1FAE A;  4ONT A;  2PMV A;  4GL3 A;  3QFY A;  3SDU A;  1TNU B;  2B39 A;  1H35 A;  3W7X A;  2NOJ A;  5M7Y A;  2DRR A;  1H3C A;  3ACT A;  3M77 A;  1TNO B;  4FXG B;  1H36 A;  1WU6 A;  1N95 B;  1H54 A;  1NI1 B;  3ANI A;  3H2W A;  4WVC A;  4BOJ A;  3W7U A;  4GTO B;  1H13 A;  1QBQ B;  2RI8 A;  2CQS A;  1LD8 B;  2WIN B;  4ZH1 A;  4GTM B;  2F0Y B;  3S9V A;  4CJ1 A;  1R76 A;  2V8I A;  3WKG A;  3HXD B;  3KQ4 A;  1JCS B;  1TNZ B;  1N4R B;  3HXC B;  2P0V A;  1W6K A;  1IA7 A;  4CE7 A;  1K72 A;  2FV1 A;  1N4P B;  1UMP A;  1TN7 B;  2DRS A;  1TNY B;  2FUZ A;  1JCQ B;  3M73 A;  3SDT A;  2OKX A;  4AYQ A;  4TF4 A;  2F6D A;  4Z4L A;  1N4S B;  1KRF A;  3P5R A;  1F9D A;  3WKI A;  4FUS A;  1H3B A;  3K7X A;  3W7S A;  2BB5 A;  2B4F A;  5JPM B;  1FPP B;  3SQC A;  2SQC A;  2I07 B;  3PZ4 B;  5DGR A;  2WY7 A;  1V7V A;  2V3N A;  3ANJ A;  3WIR A;  2JF4 A;  5AGD A;  1C3D A;  2PN5 A;  1KSD A;  4AYP A;  3SAE A;  2ZIR B;  4ZRP A;  1H3A A;  1V7X A;  2EAC A;  2VN7 A;  5GW7 A;  2RI9 A;  1TN8 B;  4WU0 A;  3HXF B;  1GHQ A;  2ZZR A;  3EU5 B;  3WIW A;  1KFG A;  4LNV A;  1CLC A;  1NC5 A;  3QFZ A;  1O79 A;  2VN4 A;  3M7E A;  2G02 A;  3M75 A;  1D8E B;  1S64 B;  4YDO B;  2EAB A;  4GTQ B;  2V8J A;  1FMI A;  3M72 A;  3SFY B;  1NXC A;  3K11 A;  2AHG A;  1LF9 A;  2AHF A;  3M71 A;  3RSY A;  1RQ5 A;  2XWJ B;  3KSQ B;  3QXF A;  1S63 B;  3CU7 A;  1D8D B;  1UT9 A;  1ULV A;  1TN6 B;  3ACS A;  2G0D A;  3H7L A;  2RGK A;  2XWB B;  4CJ0 A;  2IEJ B;  3QT9 A;  1O5M B;  1GSZ A;  3QXQ A;  4AYO A;  4ZH5 A;  3PZ2 B;  3OXU A;  1V5C A;  3E73 A;  3ON6 A;  2JG0 A;  1FO2 A;  4BOK A;  3VXD A;  3P5P A;  2WY8 A;  3W7T A;  3Q7F B;  3M76 A;  4D4A A;  3GLY A;  1KZO B;  4ZG8 A;  3DPY B;  1O1T B;  3M78 A;  4WVA A;  3DSU B;  3EUV B;  3M7C A;  4QT9 A;  3P2C A;  3SDQ A;  3DSX B;  2GH4 A;  3E33 B;  2V3P A;  3H3K A;  1FCE A;  3RJ3 A;  1QQF A;  3DRA B;  1XW2 A;  3E30 B;  2DRO A;  3M7L A;  3EQA A;  1WU5 A;  1QSJ A;  1FT1 B;  4M76 A;  4LIX A;  1NL4 B;  5FO7 B;  5FO9 B;  1FP3 A;  1FT2 B;  2QNO A;  5CA3 A;  3DSV B;  1KS8 A;  3Q75 B;  1WZZ A;  2H6G B;  4MU9 A;  4XUV A;  4AYR A;  4C1S A;  3D5S A;  2EAD A;  3M7B A;  1JS4 A;  3REN A;  3Q7A B;  1XWT A;  2NVP A;  4GTR B;  3T33 A;  5FOB B;  3ANK A;  3HXB B;  1SQC A;  3QPF A;  4GTS B;  1TF4 A;  4KTR A;  3X17 A;  4Q2B A;  1VD5 A;  2BED B;  2ZBL A;  3WKF A;  1N9A B;  1X81 B;  3S4A A;  3WUX A;  4D94 A;  3M74 A;  3KLS A;  2XQW A;  2BBC A;  4KTP A;  4DOE A;  2ZIS B;  3QWT A;  2AFA A;  2A73 B;  5DGQ A;  1DCE B;  2D8L A;  1AGM A;  3W7W A;  3RX5 A;  4Z4J A;  1O1S B;  3E37 B;  1O1R B;  3EZ8 A;  1F9O A;  2H6F B;  3RRS A;  1O6Q A;  3G6J B;  1L1Y A;  3SDR A;  1H39 A;  1KRE A;  2WYN A;  5CZL A;  4MBG B;  3A3V A;  1CEM A;  1G9G A;  4L6X A;  3EU8 A;  3AFJ A;  1MZC B;  1SA5 B;  2EAE A;  4GTP B;  3S4D A;  5CD2 A;  1KSC A;  1GA2 A;  1H14 A;  3PYB A;  4DOD A;  2FV0 A;  1O6H A;  3E32 B;  1O6R A;  3QDE A;  1KZP B;  1SA4 B;  2H6H B;  2GZ6 A;  2FBA A;  2Z07 A;  4V1R A;  3WIQ A;  3Q78 B;  2DRQ A;  3CIH A;  1G87 A;  3D3I A;  5FO8 B;  1JCR B;  1GAI A;  1HZF A;  1L2A A;  4L9P B;  4D4B A;  3DSW B;  3QSP A;  2WII B;  1XWQ A;  3D5R A;  3S4C A;  3S4B A;  1GXM A;  3E34 B;  3PMM A;  4D4C A;  1KWF A;  1DL2 A;  3GZK A;  3OED A;  4V1S A;  4KKJ A;  3Q79 B;  1W6J A;  1X9D A;  1N4Q B;  1V7W A;  1DOG A;  3WC3 A;  3GT5 A;  3E6U A;  3TF4 A;  1LD7 B;  1FBW A;  4L0G A;  3DST B;  1TNB B;  1GXN A;  4GTV B;  2XFG A;  2A8Z A;  3SDV A;  4WVB A;  4Q88 A;  4YDE B;  2H6I B;  1IS9 A;  1GAH A;  4FXK B;  3VW5 A;  3C72 B;  1AYX A;  2GOX A;  2YIK A;  1G9J A;  5KKB A;  2BB6 A;  1G6I A;  3RX7 A;  3QT3 A;  4ZRQ A;  1IA6 A;  3W5M A;  4J5T A;  3WKH A;  3PYA A;  4EL8 A;  1GLM A;  3SFX B;  5MEH A;  4D4D A;  4KKI A;  4LNG B;  3QG0 A;  1H37 A;  1FBO A;  3PZ3 B;  1N94 B;  1HCU A;  4EHM B;  5GZK A;  1H12 A;  1LTX B;  2R2L B;  2D5J A;  5E2J A;  3RX8 A;  3PZ1 B;  4JJJ A;  4YCR A;  3KSL B;  1GXO A;  3Q73 B;  3HXE B;  2CQT A;  4GTT B;  5GY3 A;  1LF6 A;  1KKT A;  1V5D A;  1FO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...