3PZ6A

The crystal structure of glleurs-cp1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
299
structure length
279
Chain Sequence
QEYIGIKLELINYTTLLEEQREAEKLNIKLPRFYSNPKNKAIFDQLWENQVDNAKVYLLAATLRPETMVGQTNCWVLPTGRYGAYYINKDEVIIVSEHAAVNMAHQGLNNNKPFGELDFISEISGSDLLLATVRAPLSPYEQIFVLPLETIKMDKGTGIVTSVPSDAPDDYACYKDILENRNGIAEKYGVDVGLMLEPYSPLPIIEIPDIGTLSAVRLCEESNVDRAKLTQIKEICYTKGFYTGIMKMGPFAGQSVKDCKQSCRDLLVQNNQCIVYSEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peripheral insertion modulates the editing activity of the isolated CP1 domain of leucyl-tRNA synthetase
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Ligase
molecule keywords Leucyl-tRNA synthetase
total genus 76
structure length 279
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 3pz6A00
4ARCA 2BYTA 1QU3A 1H3NA 1ILEA 5AGSA 1WNZA 1OBHA 4AS1A 5AGTA 5AGIA 2BTEA 4AQ7A 1JZQA 1UDZA 5AGRA 2WFGA 3PZ0A 4ARIA 2V0CA 1JZSA 3ZJTA 2AJGA 3PZ5A 1WZ2A 2WFDA 1WK9A 5AGHA 1WK8A 1WNYA 1QU2A 4K48A 4CQNA 2WFEA 3ZJUA 3ZGZA 3O0AA 2AJIA 5AGJA 1FFYA 2V0GA 1UE0A 1IVSA 3PZ6A 1WKBA 1GAXA 1WKAA 3ZJVA 1OBCA 4K47A 2AJHA
chains in the Genus database with same CATH superfamily
4ARCA 2BYTA 1QU3A 1H3NA 1ILEA 5AGSA 1WNZA 1OBHA 4AS1A 5AGTA 5AGIA 2BTEA 4AQ7A 1JZQA 1UDZA 5AGRA 2WFGA 3PZ0A 4ARIA 2V0CA 1JZSA 3ZJTA 2AJGA 3PZ5A 1WZ2A 2WFDA 1WK9A 5AGHA 1WK8A 1WNYA 1QU2A 4K48A 4CQNA 2WFEA 3ZJUA 3ZGZA 3O0AA 2AJIA 5AGJA 1FFYA 2V0GA 1UE0A 1IVSA 3PZ6A 1WKBA 1GAXA 1WKAA 3ZJVA 1OBCA 4K47A 2AJHA
chains in the Genus database with same CATH topology
4ARCA 2BYTA 1QU3A 1H3NA 1ILEA 5AGSA 1WNZA 1OBHA 4AS1A 5AGTA 5AGIA 2BTEA 4AQ7A 1JZQA 1UDZA 5AGRA 2WFGA 3PZ0A 4ARIA 2V0CA 1JZSA 3ZJTA 2AJGA 3PZ5A 1WZ2A 2WFDA 1WK9A 5AGHA 1WK8A 1WNYA 1QU2A 4K48A 4CQNA 2WFEA 3ZJUA 3ZGZA 3O0AA 2AJIA 5AGJA 1FFYA 2V0GA 1UE0A 1IVSA 3PZ6A 1WKBA 1GAXA 1WKAA 3ZJVA 1OBCA 4K47A 2AJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ARC A;  2BYT A;  1QU3 A;  1H3N A;  1ILE A;  5AGS A;  1WNZ A;  1OBH A;  4AS1 A;  5AGT A;  5AGI A;  2BTE A;  4AQ7 A;  1JZQ A;  1UDZ A;  5AGR A;  2WFG A;  3PZ0 A;  4ARI A;  2V0C A;  1JZS A;  3ZJT A;  2AJG A;  3PZ5 A;  1WZ2 A;  2WFD A;  1WK9 A;  5AGH A;  1WK8 A;  1WNY A;  1QU2 A;  4K48 A;  4CQN A;  2WFE A;  3ZJU A;  3ZGZ A;  3O0A A;  2AJI A;  5AGJ A;  1FFY A;  2V0G A;  1UE0 A;  1IVS A;  3PZ6 A;  1WKB A;  1GAX A;  1WKA A;  3ZJV A;  1OBC A;  4K47 A;  2AJH A; 
#chains in the Genus database with same CATH topology
 4ARC A;  2BYT A;  1QU3 A;  1H3N A;  1ILE A;  5AGS A;  1WNZ A;  1OBH A;  4AS1 A;  5AGT A;  5AGI A;  2BTE A;  4AQ7 A;  1JZQ A;  1UDZ A;  5AGR A;  2WFG A;  3PZ0 A;  4ARI A;  2V0C A;  1JZS A;  3ZJT A;  2AJG A;  3PZ5 A;  1WZ2 A;  2WFD A;  1WK9 A;  5AGH A;  1WK8 A;  1WNY A;  1QU2 A;  4K48 A;  4CQN A;  2WFE A;  3ZJU A;  3ZGZ A;  3O0A A;  2AJI A;  5AGJ A;  1FFY A;  2V0G A;  1UE0 A;  1IVS A;  3PZ6 A;  1WKB A;  1GAX A;  1WKA A;  3ZJV A;  1OBC A;  4K47 A;  2AJH A; 
#chains in the Genus database with same CATH homology
 4ARC A;  2BYT A;  1QU3 A;  1H3N A;  1ILE A;  5AGS A;  1WNZ A;  1OBH A;  4AS1 A;  5AGT A;  5AGI A;  2BTE A;  4AQ7 A;  1JZQ A;  1UDZ A;  5AGR A;  2WFG A;  3PZ0 A;  4ARI A;  2V0C A;  1JZS A;  3ZJT A;  2AJG A;  3PZ5 A;  1WZ2 A;  2WFD A;  1WK9 A;  5AGH A;  1WK8 A;  1WNY A;  1QU2 A;  4K48 A;  4CQN A;  2WFE A;  3ZJU A;  3ZGZ A;  3O0A A;  2AJI A;  5AGJ A;  1FFY A;  2V0G A;  1UE0 A;  1IVS A;  3PZ6 A;  1WKB A;  1GAX A;  1WKA A;  3ZJV A;  1OBC A;  4K47 A;  2AJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...