3PZ6A

The crystal structure of glleurs-cp1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
299
structure length
279
Chain Sequence
QEYIGIKLELINYTTLLEEQREAEKLNIKLPRFYSNPKNKAIFDQLWENQVDNAKVYLLAATLRPETMVGQTNCWVLPTGRYGAYYINKDEVIIVSEHAAVNMAHQGLNNNKPFGELDFISEISGSDLLLATVRAPLSPYEQIFVLPLETIKMDKGTGIVTSVPSDAPDDYACYKDILENRNGIAEKYGVDVGLMLEPYSPLPIIEIPDIGTLSAVRLCEESNVDRAKLTQIKEICYTKGFYTGIMKMGPFAGQSVKDCKQSCRDLLVQNNQCIVYSEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peripheral insertion modulates the editing activity of the isolated CP1 domain of leucyl-tRNA synthetase
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Ligase
molecule keywords Leucyl-tRNA synthetase
total genus 76
structure length 279
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 3pz6A00
4CQNA 3ZJVA 3ZJUA 2BTEA 1OBHA 5AGTA 5AGSA 4K47A 1WNZA 2V0CA 4K48A 1ILEA 3O0AA 3ZJTA 2AJIA 1JZQA 1WKAA 5AGHA 1WKBA 1WNYA 4ARIA 2WFEA 5AGRA 3PZ6A 5AGJA 1IVSA 5AGIA 2AJGA 2V0GA 1JZSA 2WFDA 4AS1A 1OBCA 4ARCA 1UDZA 3PZ5A 1H3NA 1QU2A 2BYTA 1UE0A 1WZ2A 1WK9A 2WFGA 1FFYA 2AJHA 3PZ0A 1WK8A 1GAXA 1QU3A 4AQ7A 3ZGZA
chains in the Genus database with same CATH superfamily
4CQNA 3ZJVA 3ZJUA 2BTEA 1OBHA 5AGTA 5AGSA 4K47A 1WNZA 2V0CA 4K48A 1ILEA 3O0AA 3ZJTA 2AJIA 1JZQA 1WKAA 5AGHA 1WKBA 1WNYA 4ARIA 2WFEA 5AGRA 3PZ6A 5AGJA 1IVSA 5AGIA 2AJGA 2V0GA 1JZSA 2WFDA 4AS1A 1OBCA 4ARCA 1UDZA 3PZ5A 1H3NA 1QU2A 2BYTA 1UE0A 1WZ2A 1WK9A 2WFGA 1FFYA 2AJHA 3PZ0A 1WK8A 1GAXA 1QU3A 4AQ7A 3ZGZA
chains in the Genus database with same CATH topology
4CQNA 3ZJVA 3ZJUA 2BTEA 1OBHA 5AGTA 5AGSA 4K47A 1WNZA 2V0CA 4K48A 1ILEA 3O0AA 3ZJTA 2AJIA 1JZQA 1WKAA 5AGHA 1WKBA 1WNYA 4ARIA 2WFEA 5AGRA 3PZ6A 5AGJA 1IVSA 5AGIA 2AJGA 2V0GA 1JZSA 2WFDA 4AS1A 1OBCA 4ARCA 1UDZA 3PZ5A 1H3NA 1QU2A 2BYTA 1UE0A 1WZ2A 1WK9A 2WFGA 1FFYA 2AJHA 3PZ0A 1WK8A 1GAXA 1QU3A 4AQ7A 3ZGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CQN A;  3ZJV A;  3ZJU A;  2BTE A;  1OBH A;  5AGT A;  5AGS A;  4K47 A;  1WNZ A;  2V0C A;  4K48 A;  1ILE A;  3O0A A;  3ZJT A;  2AJI A;  1JZQ A;  1WKA A;  5AGH A;  1WKB A;  1WNY A;  4ARI A;  2WFE A;  5AGR A;  3PZ6 A;  5AGJ A;  1IVS A;  5AGI A;  2AJG A;  2V0G A;  1JZS A;  2WFD A;  4AS1 A;  1OBC A;  4ARC A;  1UDZ A;  3PZ5 A;  1H3N A;  1QU2 A;  2BYT A;  1UE0 A;  1WZ2 A;  1WK9 A;  2WFG A;  1FFY A;  2AJH A;  3PZ0 A;  1WK8 A;  1GAX A;  1QU3 A;  4AQ7 A;  3ZGZ A; 
#chains in the Genus database with same CATH topology
 4CQN A;  3ZJV A;  3ZJU A;  2BTE A;  1OBH A;  5AGT A;  5AGS A;  4K47 A;  1WNZ A;  2V0C A;  4K48 A;  1ILE A;  3O0A A;  3ZJT A;  2AJI A;  1JZQ A;  1WKA A;  5AGH A;  1WKB A;  1WNY A;  4ARI A;  2WFE A;  5AGR A;  3PZ6 A;  5AGJ A;  1IVS A;  5AGI A;  2AJG A;  2V0G A;  1JZS A;  2WFD A;  4AS1 A;  1OBC A;  4ARC A;  1UDZ A;  3PZ5 A;  1H3N A;  1QU2 A;  2BYT A;  1UE0 A;  1WZ2 A;  1WK9 A;  2WFG A;  1FFY A;  2AJH A;  3PZ0 A;  1WK8 A;  1GAX A;  1QU3 A;  4AQ7 A;  3ZGZ A; 
#chains in the Genus database with same CATH homology
 4CQN A;  3ZJV A;  3ZJU A;  2BTE A;  1OBH A;  5AGT A;  5AGS A;  4K47 A;  1WNZ A;  2V0C A;  4K48 A;  1ILE A;  3O0A A;  3ZJT A;  2AJI A;  1JZQ A;  1WKA A;  5AGH A;  1WKB A;  1WNY A;  4ARI A;  2WFE A;  5AGR A;  3PZ6 A;  5AGJ A;  1IVS A;  5AGI A;  2AJG A;  2V0G A;  1JZS A;  2WFD A;  4AS1 A;  1OBC A;  4ARC A;  1UDZ A;  3PZ5 A;  1H3N A;  1QU2 A;  2BYT A;  1UE0 A;  1WZ2 A;  1WK9 A;  2WFG A;  1FFY A;  2AJH A;  3PZ0 A;  1WK8 A;  1GAX A;  1QU3 A;  4AQ7 A;  3ZGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...