3PZ6A

The crystal structure of glleurs-cp1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
299
structure length
279
Chain Sequence
b'QEYIGIKLELINYTTLLEEQREAEKLNIKLPRFYSNPKNKAIFDQLWENQVDNAKVYLLAATLRPETMVGQTNCWVLPTGRYGAYYINKDEVIIVSEHAAVNMAHQGLNNNKPFGELDFISEISGSDLLLATVRAPLSPYEQIFVLPLETIKMDKGTGIVTSVPSDAPDDYACYKDILENRNGIAEKYGVDVGLMLEPYSPLPIIEIPDIGTLSAVRLCEESNVDRAKLTQIKEICYTKGFYTGIMKMGPFAGQSVKDCKQSCRDLLVQNNQCIVYSEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucyl-tRNA synthetase
publication title Peripheral insertion modulates the editing activity of the isolated CP1 domain of leucyl-tRNA synthetase
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Ligase
total genus 76
structure length 279
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 3pz6A00
1H3NA 1WK9A 2BYTA 3PZ0A 1QU3A 1JZSA 3ZJUA 3PZ6A 2AJIA 2WFEA 2V0CA 1WNYA 1WKAA 1QU2A 5AGIA 4AS1A 1WZ2A 1GAXA 4ARIA 1UDZA 5AGRA 1IVSA 2WFDA 5AGSA 3ZGZA 4AQ7A 3PZ5A 1WK8A 2V0GA 1WNZA 2AJHA 4K48A 1OBHA 1OBCA 4CQNA 2AJGA 4ARCA 2WFGA 1UE0A 1WKBA 4K47A 5AGHA 1ILEA 3ZJTA 5AGJA 3O0AA 3ZJVA 1JZQA 5AGTA 2BTEA 1FFYA
chains in the Genus database with same CATH superfamily
1H3NA 1WK9A 2BYTA 3PZ0A 1QU3A 1JZSA 3ZJUA 3PZ6A 2AJIA 2WFEA 2V0CA 1WNYA 1WKAA 1QU2A 5AGIA 4AS1A 1WZ2A 1GAXA 4ARIA 1UDZA 5AGRA 1IVSA 2WFDA 5AGSA 3ZGZA 4AQ7A 3PZ5A 1WK8A 2V0GA 1WNZA 2AJHA 4K48A 1OBHA 1OBCA 4CQNA 2AJGA 4ARCA 2WFGA 1UE0A 1WKBA 4K47A 5AGHA 1ILEA 3ZJTA 5AGJA 3O0AA 3ZJVA 1JZQA 5AGTA 2BTEA 1FFYA
chains in the Genus database with same CATH topology
1H3NA 1WK9A 2BYTA 3PZ0A 1QU3A 1JZSA 3ZJUA 3PZ6A 2AJIA 2WFEA 2V0CA 1WNYA 1WKAA 1QU2A 5AGIA 4AS1A 1WZ2A 1GAXA 4ARIA 1UDZA 5AGRA 1IVSA 2WFDA 5AGSA 3ZGZA 4AQ7A 3PZ5A 1WK8A 2V0GA 1WNZA 2AJHA 4K48A 1OBHA 1OBCA 4CQNA 2AJGA 4ARCA 2WFGA 1UE0A 1WKBA 4K47A 5AGHA 1ILEA 3ZJTA 5AGJA 3O0AA 3ZJVA 1JZQA 5AGTA 2BTEA 1FFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3N A;  1WK9 A;  2BYT A;  3PZ0 A;  1QU3 A;  1JZS A;  3ZJU A;  3PZ6 A;  2AJI A;  2WFE A;  2V0C A;  1WNY A;  1WKA A;  1QU2 A;  5AGI A;  4AS1 A;  1WZ2 A;  1GAX A;  4ARI A;  1UDZ A;  5AGR A;  1IVS A;  2WFD A;  5AGS A;  3ZGZ A;  4AQ7 A;  3PZ5 A;  1WK8 A;  2V0G A;  1WNZ A;  2AJH A;  4K48 A;  1OBH A;  1OBC A;  4CQN A;  2AJG A;  4ARC A;  2WFG A;  1UE0 A;  1WKB A;  4K47 A;  5AGH A;  1ILE A;  3ZJT A;  5AGJ A;  3O0A A;  3ZJV A;  1JZQ A;  5AGT A;  2BTE A;  1FFY A; 
#chains in the Genus database with same CATH topology
 1H3N A;  1WK9 A;  2BYT A;  3PZ0 A;  1QU3 A;  1JZS A;  3ZJU A;  3PZ6 A;  2AJI A;  2WFE A;  2V0C A;  1WNY A;  1WKA A;  1QU2 A;  5AGI A;  4AS1 A;  1WZ2 A;  1GAX A;  4ARI A;  1UDZ A;  5AGR A;  1IVS A;  2WFD A;  5AGS A;  3ZGZ A;  4AQ7 A;  3PZ5 A;  1WK8 A;  2V0G A;  1WNZ A;  2AJH A;  4K48 A;  1OBH A;  1OBC A;  4CQN A;  2AJG A;  4ARC A;  2WFG A;  1UE0 A;  1WKB A;  4K47 A;  5AGH A;  1ILE A;  3ZJT A;  5AGJ A;  3O0A A;  3ZJV A;  1JZQ A;  5AGT A;  2BTE A;  1FFY A; 
#chains in the Genus database with same CATH homology
 1H3N A;  1WK9 A;  2BYT A;  3PZ0 A;  1QU3 A;  1JZS A;  3ZJU A;  3PZ6 A;  2AJI A;  2WFE A;  2V0C A;  1WNY A;  1WKA A;  1QU2 A;  5AGI A;  4AS1 A;  1WZ2 A;  1GAX A;  4ARI A;  1UDZ A;  5AGR A;  1IVS A;  2WFD A;  5AGS A;  3ZGZ A;  4AQ7 A;  3PZ5 A;  1WK8 A;  2V0G A;  1WNZ A;  2AJH A;  4K48 A;  1OBH A;  1OBC A;  4CQN A;  2AJG A;  4ARC A;  2WFG A;  1UE0 A;  1WKB A;  4K47 A;  5AGH A;  1ILE A;  3ZJT A;  5AGJ A;  3O0A A;  3ZJV A;  1JZQ A;  5AGT A;  2BTE A;  1FFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...