3PZTA

Structure of the endo-1,4-beta-glucanase from bacillus subtilis 168 with manganese(ii) ion
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
293
structure length
293
Chain Sequence
NGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Dissecting structure-function-stability relationships of a thermostable GH5-CBM3 cellulase from Bacillus subtilis 168.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 119
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pztA00
5M3WA 4AD1A 2PBGA 2WMFA 5I77A 4BQ3A 4DUXA 5A2BA 1UR8A 3PZGA 3GBDA 2AAAA 1V08A 2G3IA 1JF5A 1SFSA 4AZGA 4AZ5A 2QMKA 2XHYA 2AOSA 2XWEA 2BY3A 4BQ5A 1Q6FA 2WNWA 3ARQA 1EHAA 4N0RA 4W7VA 1XH1A 1MFUA 3WDQA 4KH2A 1BQCA 1LL7A 2ZXQA 1S46A 2JEPA 4JL2A 3WMSA 3IAPA 5CLTA 3VIHA 1CXFA 4J3VA 3GXIA 5A3HA 2DSZA 4OBRA 3VX1A 1WCGA 3LPPA 4KWUA 1CXHA 2VZSA 5LA0A 4RE3A 4JFWA 3QOMA 4UQAA 4IM4A 2IXUA 1B0IA 1BVNP 3CZLA 2FH8A 3PHAA 3T0BA 5BXPA 2XGIA 3N15A 1WZKA 1UD8A 2EQDA 3S6TA 4HMCA 4C7DA 3EBVA 3VKKA 2CBJA 3WNPA 3CHDA 4CGTA 3GH7A 3ZQ9A 3WEMA 1ITCA 2DSKA 3SCRA 3SCQA 1GJWA 2X2YA 1AVAA 1EIBA 3WIJA 2ZUMA 3ARZA 3EMZA 3AHTA 3LPGA 2W67A 2JE8A 2ZE0A 1SR0A 2GSJA 1G0CA 2BY0A 5CLWA 1FP9A 1E55A 2V5CA 4KRTA 3VD4A 2OWWA 3VIIA 4OZOA 1KGWA 1ISXA 2EEXA 4HU8A 1QW8A 1H11A 4H8VA 4D6CA 1JL8A 2XIBA 1NP2A 4PUEA 4X9YA 1UG6A 5A6KA 3NDZA 3AHYA 1QPKA 5JBDA 1QNRA 2O9RA 1W9UA 3DYOA 2OWXA 4UFHA 2J74A 3ZIZA 1J0YA 3F5KA 5I23A 3GZAA 1R7OA 4RL3A 4UQEA 5E0FA 4CN1A 2V3DA 1EDQA 3AISA 3E1F1 4IPNB 3BAKA 3VIJA 1M7XA 3PZUA 2D3NA 2W4XA 1XSIA 1JG9A 4GXPA 1QHPA 1E3ZA 4MTVA 1JZ7A 2VCBA 1EO7A 2WZIA 3WH7A 4LX4A 3CHEA 3BH4A 2WCSA 1V6UA 5AYBA 4QFUA 3VDBA 4AD0A 4B16A 2TAAA 5C71A 3B9DA 5LYRA 1UR4A 3SUWA 1GOQA 3CUFA 2WCAA 1W91A 2XVPA 1NARA 4FLOA 3AYSA 3A4WA 5HOSA 1W3JA 4PCSA 3AIUA 1CPUA 4OUEA 2XSAA 4GKLA 2Y8VA 1QNQA 4HOWA 3AMGA 4BQ2A 4PMVA 3JUGA 2Y5EA 1C93A 3ZT7A 3O6AA 4ACYA 1JI2A 1OB0A 2G3NA 1QW9A 1UR1A 3GTNA 4CU7A 2X05A 2CESA 1J10A 4E8DA 1J0HA 4W87A 2NT1A 3K8KA 3BAWA 3L4VA 1H4PA 3BAYA 1VRXA 5D9NA 1ISWA 4MB5A 5E6YA 2X1IA 4S3KA 1NWSA 4MB1A 2WMGA 3BSGA 1NOFA 1QHOA 4C7FA 2VZTA 2WMIA 5A8QA 1V6YA 4ZEPA 3VM5A 1LL4A 1J9YA 2WHMA 5EMYA 1UD4A 1V0LA 5A6LA 3RILA 3PZNA 4MPKA 1GZJA 5A8OA 1BG9A 4AISA 2WMIB 2D2OA 3L4YA 5HDRA 3WKZA 1HKMA 1W9BM 3WQ4A 3OB8A 1HJXA 3BAIA 1HT6A 1DHKA 4S3JA 1FH8A 1E6QM 3L4XA 3WNMA 5DO8A 3EMCA 5E09A 5ABEA 4K68A 4P7RA 4D6DA 3W29A 3GXDA 2J7GA 7TAAA 5BRQA 2D1ZA 1QHZA 1H0IA 4UTFA 3VIGA 1X6NA 1H0GA 1VAHA 2CNCA 1EOMA 2WXDM 3VIOA 4Q22A 1C7SA 1CZ1A 1ZJBA 2E8ZA 2VX5A 1GQJA 1FA2A 4JHOA 1K9EA 4MAVA 4KMQA 4AIEA 1UWRA 4UQ9A 1XV8A 5HXMA 1A3HA 2IXVA 2D0HA 5CPQA 5DT7A 2WKGA 4XV0A 3NSXA 1NWRA 1SMDA 1WZLA 4CD8A 1W9VA 1MXDA 1CNVA 1BF2A 2J77A 1Y7VA 4B3LA 3RM9A 1OM0A 2XJ7A 4Z2IA 3WUGA 4TTUA 1EO5A 3RPMA 1RP8A 2AMGA 1V6XA 3FAXA 9CGTA 1UD6A 4MJ2A 4AWEA 2WZHA 3NSNA 3APGA 1WB0A 2D22A 3NSMA 3S2CA 1PZ3A 6CGTA 3U57A 1R87A 1JXJA 2G3MA 1U30A 3ARXA 2C8NA 4A4AA 2PC8A 3PZIA 4HA3A 1FHLA 4WJXA 2XYLA 3QR3A 2QF8A 2CBIA 3VD7A 4OJYA 1H3GA 2J78A 4CCDA 4H2CA 3W28A 5JUVA 3VGEA 3WF0A 5F7UA 3UERA 2CHNA 1V3KA 2V3EA 2J25A 1OIFA 7CGTA 4Z2JA 4CCEA 5BWFA 3FHAA 1XC6A 2VR5A 1ZBWA 3B9AA 4AD5A 4JCLA 3WD4A 5GNZA 1VEOA 1MQRA 3POHA 3K8MA 1N82A 3QGVA 4FLQA 4Z2GA 2ZIDA 3WSUA 3CLWA 4CN4A 4CUCA 3IK2A 1PZ2A 1JAEA 1G5AA 3OLIA 4J3XA 2XGBA 2VNCA 1KBBA 4JL1A 1CXKA 4LYRA 3WDIA 1BG4A 4ZXLA 2WVTA 2PWGA 3MS8A 8CGTA 1QBAA 3CGTA 1UUQA 1VBUA 4MAZA 4CN6A 3ZMRA 2JF7A 1UH2A 4UFMA 1ISVA 5FL1A 3L4WA 1E43A 1EH9A 1ECEA 3RM4A 1F4AA 3VM7A 1JI1A 4JFVA 1TUXA 1AQ0A 3WF1A 2YDSA 4A3HA 5BCAA 1HJVA 1M01A 1UQYA 4AZHA 1UR9A 2YOCA 1VFMA 3WD2A 3F5JA 4ZXOA 1YHTA 1GUVA 3MUZ1 3F5LA 4MADA 3U7BA 2J7EA 3D5HA 4XUYA 3OZOA 3K4DA 4Z2LA 3WDPP 1HX0A 3N1AA 4TVCA 1MVYA 2E4TA 4PMUA 5D4YA 4J3WA 1NM9A 3QHMA 1MQPA 4UZUA 1XD0A 1J01A 1CLXA 1KQYA 4GQRA 5C8BB 2PWDA 1SMAA 3VNYA 3MV11 3VGFA 5D9MA 3NYDA 1E15A 3RO8A 4A3YA 4U5IA 2VVSA 1GW1A 5BXRA 2DGAA 3ZJ6A 1O7AA 1LG1A 5A6SA 3EMQA 4MNMA 4PMOA 4PTXA 1ESWA 1UYQA 4P8VA 3CMJA 2V3FA 1NOUA 1PEZA 1RH9A 4U2ZA 1UWIA 1LQ0A 1ZU8A 4CKQA 2UY3A 3I3EA 3WEZA 1TMQA 1K9TA 6A3HA 1GOWA 3KEHA 5CSYA 3IJ7A 1E73M 3U5YA 1NOWA 1JZ8A 3RJYA 2DT2A 3IANA 3RCNA 3BGAA 1GOKA 3BCFA 1IV8A 4JIEA 1GQLA 2WHKA 4GPNA 2YIHA 3CUHA 4ATLA 3T2PA 2CKRA 1UWTA 3PZQA 1G9HA 2WC4A 3VGHA 1QBBA 4LGXA 2WCGA 2EPOA 4LXFA 3SIMA 3A6OA 4UFLA 3TTSA 3WF3A 4QDMA 1K9DA 3K1DA 1OD8A 2UY2A 3TTOA 2V5DA 1W1TA 2W92A 2QPSA 4W5UA 2JF6A 4NF7A 1ISZA 1E70M 5ECUA 2HVMA 2J7BA 1BVZA 2WW5A 3GXMA 5M5DA 1UH4A 1W9DM 4JFTA 2GFTA 1ZBKA 4GO8A 4XZWA 3VU2A 3VNZA 1C8XA 2VMFA 1JZ2A 1E6PA 2GUYA 2E40A 1HKJA 2YL8A 3F4VA 1WO2A 3NUKA 1VFOA 3FAWA 1PX3A 3T08A 1CENA 1EQCA 3PZMA 4JFSA 3TA9A 3THCA 4WKFA 3A4AA 3EDKA 1XH2A 3WH6A 3KL5A 3ARRA 5BXTA 1FH7A 1MQQA 1QNSA 2EXOA 3A3HA 2VL4A 2Z1SA 3RMEA 3VIFA 1XH0A 1BTCA 3VGGA 4H7VA 3VINA 3VDCA 3AICA 1C3FA 2ZUTA 1HP5A 3PN8A 3UR7A 1CGYA 4URIA 3AJ7A 1B1YA 1JYNA 3AYRA 2JFEX 3RIKA 1GPFA 1DWIM 1EQPA 1B3ZA 1OIMA 3W82A 1LL6A 3T0DA 1H49A 3AHZA 3AS2A 1C8QA 2PWFA 1JNEA 1FHDA 1BGAA 3I3DA 4JKMA 2XM1A 4JFUA 4F8XA 2BXZA 1MFVA 2VT0A 4LYQA 2W66A 3IJ9A 3PZVA 3OGRA 4J27A 1E6RA 4HMEA 1GVIA 2XFFA 1KWKA 3KL0A 1CDGA 4RE4A 3WY1A 3ARUA 5CZKA 2WSKA 1G01A 5EFDA 4W8BA 1M03A 1GHSA 3WF4A 1PX8A 2WC7A 5LA1A 4AZIA 4QCEA 1CWYA 2VCAA 5ABHA 3VGBA 2HISA 1ODUA 4UZSA 4D1IA 3GNOA 3SCWA 1CGVA 4L4OA 1CGXA 2BS9A 4DUVA 3DYMA 3M07A 4BQ4A 2WLYA 3WH5A 1QI4A 1ZL1A 1R8LA 2E3ZA 4HU0A 3LPOA 4LPCA 4F9JA 3OA5A 4PTVA 4D72A 3T0AA 3AXHA 3SCOA 1JYVA 1UWSA 1PIFA 1JZ3A 1W9XA 3WL1A 4ZENA 1GNXA 1WZAA 1ZS2A 1ISYA 3DYPA 3SUTA 2ZUWA 2CYGA 2FHBA 2ZWYA 5C70A 4P7OA 1GORA 3RJXA 3UG3A 2VRQA 2FHFA 1W1VA 1E1EA 2W62A 3OGVA 2O9TA 1KCLA 5KEZA 3AMKA 3J7HA 5A1AA 4ZE4A 5I3DA 1VFFA 4QP0A 4M24A 1Q6GA 5BROA 5A94A 1ITXA 1KB3A 1BLIA 3N04A 1J18A 3MUY1 4HPGA 4C7GA 2E9MA 4GZJA 1DWHM 3M7SA 1KXVA 1B2YA 4MNKA 2WPGA 4AD2A 3WUBA 1QI2A 3CZKA 4PMRA 4PMZA 3QHNA 3BLPX 4J3TA 5JIPA 1H09A 4M82A 3WUFA 1ZJAA 2JALA 4M29A 2CCRA 4WF7A 3ALFA 1FFRA 2VX7A 3N11A 4OOZA 2X09A 2Z1KA 5JBFA 2GJRA 1JAKA 7A3HA 2OYMA 1CIUA 4OKDA 1VFUA 2XFYA 1HJQA 3OIHA 4CCCA 4GZIA 3L4UA 4CU8A 3BSHA 5DMYA 5IFPA 2DEPA 4NRSA 3AHVA 2FGLA 1WDRA 1B3YA 4MDOA 3ZOAA 3NJ3A 3BC9A 1BYCA 3SCPA 4QAWA 5I24A 1FH9A 2W63A 1WDQA 1UKSA 2D3LA 3UESA 1B90A 1DWFM 2QHAA 4KGLA 4J7RA 3BXWA 3BCDA 3CUIA 3M46A 3KE0A 3LPFA 1UD2A 4D6EA 2FH6A 3PZTA 1A47A 1B3WA 3M6DA 2CXGA 2W61A 4ATWA 5BRPA 1JXKA 1V0KA 1H2JA 2YLAA 3RDKA 3AIWA 1HJWA 3MU7A 3WDJA 3VD9A 3TONA 1O6IA 4W84A 1B9ZA 3OGSA 1XGZA 3WH9A 3AZTA 4HOZA 5BYWA 4AIOA 2DQXA 1E3XA 3HMCA 5FKYA 3ZT6A 3T2QA 2B31A 1DTUA 2ZXAA 1EXPA 4H04A 2OYKA 1C7TA 2CPUA 4PMXA 1VJSA 3OBAA 3HJEA 3ARVA 2QLYA 3CUGA 4QLLA 3W53A 1W3HA 2OWCA 1LJYA 4WIWA 2CKSA 5JBEA 2DSVA 3QHOA 4R27A 4M1RA 1GONA 2VX6A 2PBOA 1PJ9A 4PN2A 1TCMA 2OLHA 1E6NA 1PIGA 2WANA 5E0CA 4GQQA 2EPKX 2ZX9A 4PCTA 5D8ZA 2J79A 2NSXA 1TVNA 1J11A 3II1A 4M80A 1JDDA 3OLGA 4AW7A 1OT2A 3L2MA 2BVTA 5CJ5A 5I2UA 3HU7A 1QNPA 1E1FA 1E56A 4UNIA 4AZCA 1BPLB 1W32A 1HJSA 3CZJA 4AMCA 3BAXA 5I78A 1TE1A 5A6BD 3WQ8A 4D71A 3VVGA 3UCQA 1J12A 2BHZA 4AYSA 5A69A 2GVYA 2WWDA 4CVWA 3AIRA 5I6SA 5CSUA 4AZCB 2OYLA 1UKTA 2VO5A 4MNJA 3PBGA 1J0IA 3AS1A 1B3XA 2J8GA 2ZUSA 4YHGA 1IZKA 2GJPA 3AXIA 1Q6CA 1ZBVA 2CEQA 1OGGA 2YDQA 3BLKA 1BHGA 1W3LA 2Y8KA 4E2OA 1NQ6A 1MW1A 3OZPA 3ZSTA 5DEZA 2Q8XA 2J7DA 1RP9A 1HVQA 3MO4A 4W85A 2J47A 1JD9A 4JZ5A 3VDHA 4CD5A 5IHRA 2G8ZA 3EYPA 1KXQA 1PPIA 1JD7A 2BVYA 3WENA 3WN6A 4XX6A 1WE5A 1V02E 3HN3A 4JKKA 2EBNA 3PTQA 2A3CA 4AEEA 4ATDA 2YL5A 3AXXA 3AZSA 3QOKA 1RD6A 5D9PA 5CGMA 4FLRA 2WWCA 3ARYA 1VEMA 1E71M 3UG5A 3ARTA 3NDYA 4WSJA 1U2YA 2UY4A 1UWUA 4YN5A 1UHVA 5BXSA 5IFTA 4PMNA 1UZ1A 2YKKA 6TAAA 1D7FA 4U3AA 3GH4A 4W5ZA 5AY7A 4UFIA 3WF2A 4D6JA 2BHUA 2DT1A 1G94A 1XCXA 1OGSA 3AQUA 3L4ZA 4QLJA 1TG7A 1CECA 3WFLA 1P6WA 1US2A 4MB3A 2JIWA 3TTYA 4V28A 1KR0A 4CU6A 2BFGA 1DP0A 1JZ5A 5D9OA 5KZ6A 2IUZA 2A3EA 4TOQA 3ARPA 1E0XA 2YDRA 3KWXA 5EFFA 4UR9A 5FCZA 4FF5A 3WELA 1CGUA 1TFVA 1EHNA 1JFHA 5CGTA 3ECQA 3W27A 2DSWA 4P8XA 3AI0A 4HZ7A 1XYFA 2WMKA 4IISA 5A8MA 2YL9A 2PWHA 1J0JA 3PTKA 4P7QA 4W89A 2D23A 4PMQA 4BF7A 4HA4A 4BA0A 1W2PA 1Q6EA 5FIPA 4DM1A 3ARSA 4CD4A 1JZ4A 3K4AA 3EDDA 2VI0A 4PMYA 3AROA 2A3AA 3CPUA 3VOCA 2WYSA 4TUFA 1HF6A 1V3IA 1C92A 1HKIA 2PI6A 4J3SA 3AIQA 3TP4A 2F61A 3ZJKA 3VMNA 3W25A 1W3KA 3VMPA 3FHQA 2XFRA 3AMLA 2ZX8A 2X0YA 2DT0A 4U2YA 1V03A 4H8UA 1BGGA 2WSPA 4OBSA 1OSEA 2YA1A 2FGZA 2XSBA 4UFJA 4AD3A 3WUEA 3DHUA 2BY2A 2YA0A 1V6WA 4AC1X 3W24A 4WLCA 4F9DA 4JKLA 2ZXDA 1UQZA 2J62A 3MSDA 1E6ZA 3WD1A 3WD3A 4CD6A 1E0VA 1DEDA 1TZ7A 1D2KA 1XSKA 1MW3A 3EDFA 2CETA 5D8WA 4V27A 3O2LA 5I0DA 2Y4SA 3GBEA 3U5UA 2J4GA 3WMBA 2F8QA 2GK1A 4UCFA 2BNJA 5TD4A 2VX4A 4XZBA 1QVBA 1VJZA 1ZBCA 4AZ6A 2J7CA 2GK1B 5EB8A 3ZO9A 1DWAM 1AMYA 1HL8A 1MW2A 2XVNA 1IT0A 2YBTA 3CO4A 1CXLA 3WDHA 2FHCA 3VPLA 3W6MA 1E4IA 4U33A 2XWDA 1RPKA 1UR0A 4J28A 4AXNA 2JEQA 3W37A 1KXTA 1R7AA 1GJUA 1J0KA 1L8NA 5A8PA 3L4TA 3SCUA 4TX6A 5E9AA 4Y7EA 5GNYA 2G41A 3D3AA 2E9BA 2W5FA 5A2AA 4D6HA 1QNOA 2WB5A 5A6BA 2WVUA 1PX4A 3KZSA 3K8LA 2CIPA 2X8RA 4KGJA 2DT3A 4TXEA 3BMVA 1CXEA 1V0MA 4BS0A 3WMCA 4E4PA 4HZ8A 3W38A 4MB4A 1C90A 2D0GA 1DWGM 1E5NA 2NW0A 4W88A 2WC3A 2VZOA 1VENA 2W91A 1UH3A 1V6VA 2Y2WA 1TVPA 3OLEA 1JNDA 3ARWA 1UOKA 1CEOA 1Q6DA 2D24A 4N42A 4V2XA 3UR8A 2D20A 1FFQA 5I5RA 3A47A 1JDAA 3MANA 3DC0A 4WKHA 1HP4A 2G3JA 5CXPA 1QI0A 1GVYA 4KRUA 1E4MM 4AD4A 4J3UA 1HL9A 3EDEA 2ZWZA 2F2HA 3VMOA 3MKKA 1GOIA 3ZR6A 1U33A 4TVUA 3DECA 3SUVA 2J75A 3VDAA 1BYAA 1GQIA 2DIJA 1H41A 4B9YA 2MANA 3IJ8A 1OWQA 3CHCA 2GDVA 2PWEA 1UKQA 1KFWA 5FD0A 1R85A 1WPCA 4DUWA 1NWUA 2CBVA 2XPKA 3K46A 1K6AA 2ZXBA 3ZT5A 3U7VA 5GQBA 4EAMA 1VEPA 1EDGA 4HZ6A 3ZSSA 4DWSC 3PZOA 1E6XM 4CD7A 1XSJA 5HBFA 2V3GA 3N12A 1OD0A 3VIKA 4ML4A 3N13A 1KWGA 4NRRA 2CERA 1VF8A 4GI6A 1LWHA 4X0VA 4PEEA 2NT0A 1BFNA 4X0NA 4TTGA 3N17A 3SUUA 2C0HA 2XTKA 3ZJ8A 3L2LA 3OLDA 1IZJA 3PTMA 4UOQA 1VB9A 1UKOA 5A6JA 1KGUA 5FOOA 3GDBA 1LLOA 4M56A 3T09A 1TR1A 1GQKA 3NIYA 2QV4A 3W26A 1KBKA 5EBAA 1QI3A 3ALGA 4YHEA 3WDRA 3O9NA 1WP6A 1ODZA 4Q7NA 4IPLA 5M17A 1K9FA 3FY1A 1I75A 1NP0A 3CZGA 2WHLA 1JF6A 4MJ4A 1E4NA 2VCCA 2BY1A 3AS0A 4NSBA 3MMUA 4L4PA 1OT1A 2VR4A 1AQHA 4AY1A 4JCMA 2VOTA 2PB1A 3AIEA 4P7NA 4UQDA 5GPRA 3G6LA 2ZX5A 4PSPA 2OSYA 3AIBA 2BHYA 3VTRA 2DSUA 3B9EA 2YA2A 4D6FA 4NI3A 2ZX7A 1E5JA 4UFKA 2WHJA 1W2VA 2V38A 1C8YA 1B31A 2EPNA 3SCTA 4FK9A 2VZVA 4DM2A 3VO0A 3AFBA 4W7UA 3MV01 1EDTA 5A6MA 1Q4NX 1UA7A 4QLKA 3GNPA 2EPMX 1OGBA 1BYBA 2FDMA 1UD3A 2CITA 4F66A 4PRWA 1UKPA 2QPUA 4AIUA 1JZ6A 4HPHA 3B8SA 1OINA 2BVDA 3CBWA 1Z32X 4AZ7A 3VIPA 1KXHA 2VQUA 5HNNA 2XM2A 2DPEA 3MSGA 1AQMA 1DWJM 3WNOA 1EA9C 1GCYA 2ZUVA 1LWJA 1EOKA 1V3MA 4IUGA 1FP8A 4DWSD 4MDPA 1CYGA 1I1WA 4GZEA 2YLLA 1PBGA 3WQWA 4WK9A 1GOMA 3CZEA 1KCKA 1V02A 4PTMA 2WMJA 3AMDA 2VRKA 3WNNA 3TOPA 1VIWA 4ZE5A 4XB3A 4D1JA 2WZEA 2WM0A 3WEOA 1BSIA 3VILA 4CVUA 2WLZA 3VD3A 1R86A 4W93A 2WVSA 4P7LA 3WBEA 4YPJA 2VTFA 5M03A 3POCA 1V3LA 4UOZA 3AIVA 5IDIA 1JYXA 1HJUA 1OCQA 3G6MA 3NCOA 5FL0A 4WSKA 3W6LA 3WL0A 3MUAA 4JHZA 3AOFA 1H1NA 4UOJA 2DH3A 1X6LA 2QMJA 5A95A 2WKLA 1LG2A 4PTWA 2A3HA 3CHFA 4ZFMA 5IXEA 1SYTA 4EANA 3VIMA 1WNOA 1L0PA 2PF0A 3SCSA 5LA2A 3TTQA 1CGTA 3MUIA 3UEQA 5A8NA 1G1YA 4JAWA 1HIZA 3WQ5A 2Y24A 1MXGA 2VQTA 1EGZA 3DHPA 1GHRA 2GJXA 2VUYA 4HA1A 4OIFA 2OSXA 2UWFA 4E8CA 4BZYA 5E6ZA 1E40A 2ZICA 2VC9A 4F79A 2J7FA 4HMDA 4TX8A 2BXYA 3CMGA 3MMWA 2GJXB 4U3CA 3N18A 3SUSA 1XYZA 2VJXA 4QCFA 2XVKA 2VRJA 3THDA 5AC5A 3IAQA 5IHSA 2J8FA 2WVVA 1KR1A 4D6GA 1E9LA 5ABGA 2E8YA 4PYSA 3SURA 1NH6A 2BV9A 5A2CA 3AS3A 5E70A 1B30A 2O92A 4UQBA 2WVVB 4PMDA 1MYRA 2VURA 4B9ZA 2ESCA 4WKAA 1H5VA 5JIWA 4W8LA 3WH8A 2RGMA 4EK7A 3UETA 1GOOA 2ZUNA 3VGDA 2OSWA 1MWOA 2WK2A 4FMVA 1NWTA 1XD1A 1PAMA 2RGLA 4AEFA 1J0ZA 2WMHA 4GIAA 2ZX6A 1CLVA 3MMDA 5DT5A 5HPOA 1CBGA 4GO9A 3BAJA 1E6SM 3VX0A 4AZBA 1US3A 2E0PA 5DF0A 3ZM8A 1X1NA 1E72M 4LYPA 2E9LA 4PBGA 2WBGA 3CZ8A 1UR2A 1JIBA 1HN1A 2DDXA 4EE9A 3BMWA 2YJQA 1W1YA 1XRVA 4H41A 5DFAA 2XUCA 2O9PA 5GNXA 2UY5A 3WNLA 1I1XA 4GINA 2YBUA 3WBAA 1CGWA 2XG9A 3FW6A 3GYCA 2O9OA 1VBRA 4M81A 4ACZA 1W1PA 4NZCA 2ZUUA 3RM8A 3SCVA 3T2OA 4W7WA 3EDJA 4HOXA 3GNRA 1UWQA 8A3HA 5HPCA 4ACZB 4OOUA 5CQ1A 4U31A 3WNKA 4TVDA 4U5KA 4P8UA 2ZOXA 1XHGA 2YL6A 2VZUA 4GI9A 2A3BA 5CPTA 2XVGA 3ZR5A 1V3JA 1MW0A 1KQZA 1E4LA 4RE2A 1M53A 1OBAA 2D0FA 1QOXA 1E0WA 1HKKA 2GDUA 1XCWA 4LQ1A 2XIIA 3CTTA 1WDSA 1UZ4A 4GI8A 5I79A 4UQCA 1HVXA 2G4FA 3ZJ7A 1YQ2A 2DH2A 1HNYA 4H8HA 1JGIA 3CUJA 3PZ9A 2CBUA 1FOBA 3W0KA 2C7FA 1V3HA 1LF1A 3SEPA 4Z2KA 1UA3A 1QI5A 1WKYA 1CXIA 1V0NA 1WAWA 3WD0A 2EO7A 3GXFA 1W9PA 1BYDA 4HP5A 5AC4A 4W8AA 1BAGA 4M8UA 4B3KA 5AYIA 3W4RA 2J7HA 4BCEA 3UG4A 3AMCA 3FNDA 3VD5A 1TA3A 3FN9A 5ABFA 1JDCA 1JYWA 1JFXA 2DIEA 4PSRA 4R5EA 4Z2HA 3KL3A 3CIVA 1M04A 1TA3B 1HXJA 5ABFB 5CG0A 3FXYA 3GM8A 2EPLX 4HTYA 3CH9A 2WAGA 3GH5A 4MNLA 1WDPA 2VVNA 3N9KA 1KGXA 3WFZA 2JIEA 3W81A 3WQ6A 4B15A 4D6IA 1D3CA 2X0HA 5CPSA 2XVLA 1WZMA 4DWSA 1C91A 1B3VA 2CHOA 1UD5A 3OG2A 4FLSA 1F4HA 1ZB5A 4P8WA 2EJ1A 4PUDA 5A6AA 3AZRA 3I3BA 3WQVA 3LMYA 4DWSB 1CTNA 3VUPA 4W86A 3AHXA 3SCNA 4EKJA 3A4XA 2WBKA
chains in the Genus database with same CATH superfamily
5I77A 4WY0F 4MKNA 2QUUA 4DUXA 3HIJA 3QR1A 1Q8JA 5JH2A 2QMKA 3GTIA 1ONWA 1CW2A 3MP4A 1OC6A 1YADA 4N7QA 5CZJA 4W7VA 1VRDA 4KS0A 1LL7A 3SSZA 1A5NC 5AZ1A 1KRAC 1EBGA 4ZOBA 2DVXA 3VIHA 3A5VA 5A3HA 2CWNA 3VX1A 3OU8A 4KWUA 1OJXA 4C6FA 1KRMA 1PHWA 5LA0A 2OMAA 1TPWA 4C6JA 4JFWA 3G2GA 1BVNP 3C52A 2XGIA 4O0ZA 1WZKA 5KZEA 1IR2A 4JGDA 1IGWA 2EQDA 2P3EA 3S6TA 3P7YA 3VKKA 3PVFA 2CBJA 4MWAB 4MZ1A 3T1GA 3CHDA 4EP8C 3G1RA 3KVLA 2P1FA 3H12A 3DUGA 4PL2A 3SCRA 1GJWA 3L0GA 3WIJA 4EPKA 4HVXA 4JTEA 3MKVA 3AHTA 2A6LA 3KBVA 3ZZ1A 4ONVA 4IQEA 3LHTA 5AOUA 1E51A 2NSOA 2OWWA 1TPVA 3GHRA 3EA2A 4C6CA 2WNQA 4G5DA 5DMNA 2BX7A 1RPXA 4D6CA 2XIBA 4GKTA 4PUEA 1WAUA 5FJPA 4DXXA 3NDZA 2P0OA 1TTIA 3G1FA 1QNRA 4GJ1A 3BG9A 2IS7A 3DYOA 4UFHA 3VKJA 4QTGA 1R7OA 1T8XA 4RL3A 1W1A1 5E0FA 1TJ0A 2AKZA 3BOFA 3LCFA 1EUAA 1N55A 3VIJA 1WKEA 2D3NA 4XTDA 1AJ0A 1XSIA 3MJMA 1EO7A 4X63A 4LX4A 1M6JA 2EKCA 4X2RA 2WCSA 4N02A 4QFUA 2P3ZA 4B16A 3HPZA 1J5TA 3AJXA 5C71A 3B9DA 4MM1A 5LYRA 3OQ8A 3GC5A 4FNPA 2ZE3A 3CUFA 1JUBA 1Y0EA 1EJVC 1CPUA 4MSSA 4OUEA 2XSAA 4S1FA 1KM1A 2Y8VA 2HNHA 3G1YA 1QNQA 2B7NA 4HOWA 4PMVA 1O60A 1CB7B 1M3UA 2VD9A 1M7PA 3O6AA 1OB0A 1QW9A 3GTNA 3IV8A 5D2YA 5IBXC 4DNHA 4RPPA 4E4FA 1PKNA 4E8DA 1J0HA 5EYWA 1DL3A 3BAWA 4C60A 3ITYA 3SW6A 2GVGA 5EA9A 4L9ZA 5D9NA 1QPNA 2GUUA 3HMJG 4FZIA 1EWDA 5AC8A 1RJQA 3NL5A 5FF3A 4TV5A 3GDKA 1NOFA 4GVGA 3PAJA 1V6YA 3G1VA 3ME3A 1J9YA 1UD4A 1V0LA 5A6LA 3RILA 3KOWA 3GU2A 3PZNA 3QXBA 2KZHA 4MPKA 5A8OA 3IJDA 4PULA 4AISA 3PC0A 4RNIA 1W9BM 3WQ4A 5C5YA 1HJXA 3BAIA 1DHKA 4S3JA 3BLOA 1QXLA 1XLLA 1ELSA 3R0KA 3KOZA 4D6DA 3W29A 3GXDA 3GFXA 2D1ZA 1QHZA 3TCSA 1DJWA 3O6CA 4H6QA 3VIGA 2PZNA 1B5TA 3LQGA 2F38A 3I68A 1EOMA 3OTRA 4Q22A 2OLAA 2Z6IA 3UJFA 5BOOA 4B4HA 2Y88A 2VX5A 1GQJA 5J8LA 4HK6A 5FJTA 2HVNA 1UWRA 4UQ9A 4R7JA 3EX2A 1A3HA 4NNCA 3NSXA 5E93A 2BOFX 4NJIA 3EA1A 1P0DA 8TIMA 1Y7VA 1OM0A 1X98A 3HGOA 1RP8A 1K7FA 1H60A 3FAXA 5DCBA 1KRCC 3GX9A 1W0MA 1JPMA 1IXNA 3NSMA 3N6JA 1MMFA 3S2CA 1YDNA 2G3MA 4A4AA 1W1B1 3CMFA 3L9CA 4N4QA 1IR1A 1DV7A 2QF8A 1QPRA 1KA9F 3WQFA 2C13A 3C0SA 4EXBA 2J78A 1CX9A 1EEPA 3S5OA 2CHNA 1QUMA 2V5JA 2V3EA 3UFYA 1AUSL 4GQBA 4HHLA 2ASHA 1FWRA 4CCEA 3FHAA 3QQ1A 5BWFA 1RK6A 4B5NA 1IEQA 5GNZA 3SM0A 1QO5A 4XZ9A 3QGVA 4A2SA 5BZAA 2PDNA 1V7AA 4CUCA 3QH2A 4O4VA 1JAEA 3R0DA 4YWSA 4J3XA 1T8QA 3ABQA 3ISIX 1Q85A 1KBBA 1S5WA 4LYRA 1XLFA 3M5XA 1BG4A 4ZXLA 2PWGA 1EIXA 4JTSA 3MS8A 3BVJA 3LBOA 3QR0A 3WYZA 3KCLA 4XBJA 4MAZA 1FDYA 3FYYA 3FOKA 4S2CA 3BGGA 3UXLA 3TN4A 7XIMA 3W1TA 3UYCA 3L4WA 1EH9A 2GQAA 1M7OA 3F2CA 3HF3A 3KLLA 4L1XA 1QPQA 2RH9A 2YCIX 5DCEA 3JR2A 3T40A 3IEBA 3MUZ1 3U7BA 3TQPA 1FKWA 4IJBA 1TKKA 1PTAA 1QMLA 3P82A 4TVCA 3KDNA 4GYKA 2E4TA 1NM9A 2I16A 4H4IA 4P2VA 4DNMA 1CLXA 5C8BB 2V2CA 3W88A 4WXZA 3NYDA 5D9MA 1QR7A 4M6PA 2VENA 2YYUA 3QZEA 1GW1A 4K2SA 3RUBL 1LWIA 4IQJA 4O15A 3K5XA 5A6SA 3EMQA 4PTXA 4PMOA 3UZXA 1ESWA 3MDUA 3DXIA 1PEZA 1OHLA 4E5TA 3JU2A 3EB3A 3EWUA 4Q4KA 2QCCA 1ZU8A 3WEZA 3S46A 1S2UA 6A3HA 1DJNA 4F0MA 3NAVA 4H00A 1W54A 5CSYA 3IJ7A 3QPZA 3W71A 1R3SA 3RJYA 3GHUA 4I9MA 3BCFA 1FCQA 4LNYA 6XIMA 2WHKA 1A5UA 1VR6A 4DPQA 3OVGA 3HFTA 4ZQOA 3ABZA 4ATLA 3VZYA 5BRBA 2IW0A 1R5YA 3PZQA 1RXOB 4HIBA 1FWFC 4LGXA 3UCCA 2AMXA 3A6OA 4YMZA 1JDFA 5CJMA 3PWAA 2PTWA 2J6VA 1AL7A 5JQ9A 4QDMA 4JOMA 3VABA 1XLGA 2I14A 3H2OA 4GVIA 2V5DA 3LTPA 3TEVA 4W5UA 3S2MA 2DZWA 2HE8A 1ISZA 2HVMA 3GXMA 3M41A 3GS6A 3N2XA 2QGHA 1MI3A 3QFEA 3RMJA 3LCGA 4Z0JA 5F2LA 3NUKA 1VFOA 3PZMA 5G2HA 3TA9A 4LU0A 4ZZ9A 1YX1A 1ZP3A 4W9TA 4DBWA 3A4AA 1P0BA 5I00A 3PR2A 3E0LA 4N4PA 3WH6A 4ZR8A 4I8YA 2PDHA 3L12A 3KL5A 1QASA 3MCNA 3ARRA 1FH7A 1KD0A 1YPIA 3L67A 3F4WA 2VL4A 1AH3A 2C1IA 1XH0A 4GG9A 1XIFA 1BTCA 3VGGA 3W2NA 3L68A 2QZRA 5TAOA 3FS2A 4ZCWA 1UC4A 2R14A 3AICA 1C3FA 3PN8A 4URIA 1B1YA 3UY8A 2FTPA 4QS6A 2ZRVA 4DF1A 3W76A 1GPFA 7ODCA 1DWIM 1EQPA 1OIMA 2FLIA 3W82A 1LL6A 3WQGA 3N34A 2G3FA 1OFEA 4FA3A 2YXOA 2YXGA 3CAQA 1AH4A 1JNEA 1BGAA 4JKMA 1FUYA 1FDJA 4JFUA 4F8XA 1IWBA 2W66A 3IJ9A 3ABXA 3WLJA 3A9BA 1A4MA 2RUSA 3OGRA 4J27A 3R8GA 4GFIA 3H53A 1GVIA 2XFFA 1J93A 2E67A 1GT8A 3KL0A 5IBXA 3N14A 2QDEA 4B5XA 1M03A 2HPMA 1O4UA 1EL3A 4J1OA 4AZIA 5CZ0A 1CWYA 3PS7A 3ICJA 2DW6A 6REQA 4D1IA 2VEFA 3VOFA 1HW6A 1F3EA 4L4OA 3CM4A 3QSTA 2BS9A 4J9JA 2QCGA 1H1YA 1N8IA 2WLYA 3WH5A 1QI4A 2ZZ1A 1WKFA 1KBJA 2P50A 6REQB 1R8LA 4UCGA 2PDBA 4R9XA 5G1MA 4HU0A 3LPOA 2H9AA 2Y1HA 3OA5A 4HHMA 2CZ5A 3T0AA 2PDUA 1VJIA 3SCOA 3IV3A 3RITA 1QAPA 2O7SA 2H9AB 1JZ3A 1H50A 3DX5A 3FXGA 3RCMA 2NX9A 1WZAA 1OX4A 4K7VA 3V75A 1PV8A 5BOFA 5G5IA 1AH0A 1OABA 3AMKA 1OX4B 4GHRA 5A1AA 4ZE4A 3HQNA 2YFNA 4KBXA 5BROA 5A94A 1KB3A 4HPGA 4C6PA 5E5CA 4C7GA 2Y61A 1KXVA 3P5ZA 2XZ9A 1FWDC 2GWGA 2NV1A 1LORA 2ACUA 4PMZA 2QXWA 4AX6A 3QHNA 2QDDA 2XH4A 4M82A 3WUFA 4N9CA 1VBHA 4DBDA 1ZJAA 2JALA 2W0UA 5H8PA 5TNVA 1KM0A 4OOZA 5C2GA 1EF2A 1DXIA 2X09A 2NVDA 2GJRA 4DO7A 3XISA 1CIUA 2HMCA 4NNBA 3UCDA 5AHFA 1K77A 1VFUA 1HJQA 3LX9A 1V79A 4KWWA 4KRZA 1V51A 3BSHA 5DMYA 1XYMA 2DEPA 2FGLA 1WDRA 3TJIA 1P6BA 1C8VA 4MDOA 4YCPA 4V15A 3TAOA 2Z7KA 4UMAA 3NJ3A 3ZLHA 1BYCA 3TSBA 3B04A 3WQDA 3PBUA 3TWBA 3CV2A 1WDQA 4FPSA 5T9CE 3BL3A 4GY7A 3B97A 3A5FA 3TOYA 1UD2A 2FH6A 3PZTA 3QBUA 3M6DA 4ATWA 3IIVA 2Y7EA 2A3LA 4US5D 3P60A 3MU7A 3Q94A 3TONA 3BZJA 1R30A 4LAKA 5FKYA 4DYEA 1VD6A 4ADSA 3L7RA 4H04A 3P0WA 3CYVA 4JTUA 4PMXA 4WCJA 4IP7A 2BOEX 5LXEA 7TIMA 1HO1A 3LI0A 4JN7A 3SAZA 2Y89A 3N4EA 2CKSA 4KWOA 5T26A 3QHOA 4R27A 4NZFA 4PMJA 5D03A 4BF5A 3MC5A 5FACA 1TCMA 3EX3A 3OODA 1JPIA 1PIGA 5E0CA 4GQQA 1QWGA 1GJPA 1ICPA 2EPKX 4PCTA 1XYBA 1XWYA 1YXDA 2J79A 4IFRA 1PTGA 3W7CA 2I7GA 1RJPA 3OVRA 3EKLA 7REQA 5CJ5A 5HNRA 3KS5A 3IIOA 4M51A 4AZCA 1J5SA 3H21A 5I78A 4PGLA 3WQ8A 4D71A 1C9WA 3Q2DA 7REQB 1DJGA 3UCQA 2A7NA 2WWDA 3UWUA 2A85A 4RK8A 3EOSA 4AZCB 2VO5A 3PPGA 2J8GA 3PANA 2GJPA 3RU8X 3T9PA 3AXIA 3GUGA 1H5YA 1XLEA 3C6CA 3BLKA 3TKFA 4QM1A 3ZSTA 2Q8XA 1HVQA 4LVFA 4W85A 1GG1A 2J47A 4CD5A 4V1XA 5HNTA 2CHRA 4ZO6A 4NJGA 5DBUA 2BVYA 3RO6A 1V02E 2D2GA 3AXKA 2EBNA 3GVWA 4R85A 4ATDA 4C6MA 2IKJA 2Q8ZA 1THFD 4AIBA 3AZSA 4HYVA 1I0DA 2WNNA 3AWOA 5LIYX 3DFTA 2QUMA 4MFDA 3S2NA 3UG5A 4HPJA 3ARTA 2OO0A 5C9WA 2V81A 3N2OA 1ONXA 5F1UA 1XICA 2PP0A 2UY4A 4S3GA 4YN5A 2YKKA 3FKRA 2JGQA 1MRAA 3M64A 4D6JA 2BHUA 2DT1A 1XCXA 2JKEA 1ZENA 4NT0A 1NFPA 3E2VA 5HANA 1EA0A 1US2A 1KC7A 4B5TA 3H70A 3TCEA 1KR0A 3P0XA 3DBPA 2OG9A 2BFGA 3UPMA 1DP0A 4UTUA 5KZ6A 2X30A 3WLTA 1ZRQA 4H6EA 4JNYA 3THAA 1E0XA 1QJWA 4UTMA 2YDRA 3G22A 3LNMA 4DJED 1PZ0A 5K4XA 1CGUA 1EHNA 1JFHA 3ECQA 1XUUA 3W27A 4NZ3A 1JDEA 3GG8A 3AI0A 3LLFA 2A2IA 4J5NA 4CQDA 4OV4A 4IF2A 4U4MA 4EPBC 1Q6OA 1J0JA 2D23A 4HCHA 3A13A 1VLWA 3ARSA 2NWRA 4CD4A 2AQVA 2PLJA 4PMYA 3AROA 4QIUA 2J13A 3TUUA 1MEHA 2VWSA 4WVXA 5HK4A 1HKIA 3AIQA 2GJLA 3TP4A 3ZJKA 3W25A 1W3KA 2XFRA 3AMLA 2JQXA 3CAVA 3KVJA 3IUIA 4OBSA 3I6EA 4AD3A 4CNOA 1V6WA 3W24A 5XIAA 1BSLA 4JKLA 2ZXDA 2J62A 2R82A 3R11A 1JCNA 2E6FA 1DEDA 1XSKA 4K38A 1YTKA 2PCQA 3H4XA 2CETA 1TZ9A 2ZRWA 3AC0A 2Y4SA 1D3GA 4IX0A 3PF3A 1XLAA 2AL1A 3EB2A 2BXVA 3M0HA 1ZBCA 4MPQA 4AZ6A 3CC1A 4M6UA 5DLCA 3GWQA 1HFBA 1DWAM 1EB3A 3TX9A 2XVNA 3QY7A 2YBTA 3QGAC 5CPNA 3G0SA 4KFNA 4QQ3A 3C3NA 3WDHA 3B8UA 4FOUA 1XIDA 4F0RA 3W37A 2ACQA 3M5ZA 3EX1A 1KXTA 2UV8G 1R7AA 1L8NA 1J0KA 2ACRA 3LHVA 4JYDA 4NYUA 1YTDA 3SCUA 4Y7EA 3U8GA 4JY8A 3G1DA 3W7RA 3DDMA 2G41A 5HAOA 2OX1A 2V63A 3H4GA 2WB5A 5B7YA 4B92A 1PX4A 4WEVX 3TYZA 5FEWA 1Y5XA 4KF1A 2DT3A 4TXEA 3FJNA 3BMVA 4ZL1A 4E4PA 3W38A 4MB4A 3NL3A 4HN8A 3KOXA 2WC3A 1VENA 2W91A 4NZ1A 1UH3A 1DIKA 3BMXA 3W83A 3WCZA 4F48A 3I6TA 3ARWA 2Y5SA 3RCYA 3MUXA 1OQFA 3M0VA 1M1BA 1H7XA 4V2XA 7PTDA 3UR8A 2D20A 2UZ9A 1QTWA 5I5RA 3V18A 4JTJA 1LTDA 1JDAA 3MANA 4MOZA 3QMTA 5IM51 3CTLA 1J8VA 1QI0A 5T91A 3W1RA 4CQ8A 2F2HA 2DVTA 3VMOA 2EPHA 3DECA 1NIUA 4ZMGA 2OZ8A 3VDAA 3LXBA 1GQIA 4ZO7A 2Z24A 2PGWA 1OWQA 1DHPA 1UKQA 1F9CA 4XISA 4Z1DA 5GQBA 4EAMA 2HS8A 4LUJA 1E6XM 1XSJA 2V82A 4UTJA 4ML4A 3N13A 3UF9A 1KWGA 2C3ZA 2BMBA 3LZ3A 4NRRA 5A5WA 1H62A 4LCSA 4PEEA 4I9AA 3N17A 2Z2AA 3PSWA 4JX5A 3BCJA 3SUUA 1XISA 2XTKA 3ZJ8A 4MWAE 3OLDA 1IZJA 5K7JA 3NG3A 4A6GA 5I03A 1S3HA 3W75A 2VFEA 5C2XA 1EGMA 1NY1A 4XUGA 2C79A 1TR1A 4NVTA 1XDJA 4OV9A 5HA7A 1WP6A 1P1MA 4Q7NA 4A21A 5M17A 1GVSA 3O6DA 2WHLA 3DAQA 1PTDA 1XI3A 1R9ZA 3C8FA 4A8LA 4MLRA 4JCMA 1IEXA 3HM7A 2FZ9A 2Q8LA 2VEMA 1GVQA 5EMLA 3R2GA 3G6LA 4FNRA 4DZAA 2OSYA 4NI8A 1VC4A 2DSUA 1L6SA 5C9XA 4D6FA 1EYEA 2GPTA 2Y62A 4H6KA 3GNNA 3MI3A 1D3HA 4L4MA 3LV6A 4LW7A 2EPNA 3RGTA 4DM2A 3A4JA 3VO0A 2PRHA 3BW2A 3MV01 3VAVA 4AAJA 5A6MA 1V6TA 4ZOEA 3GTHA 1UA7A 3GNPA 4F2TA 4HJFA 3DESA 2KX9A 3M7WA 2EPMX 4HBKA 1AG1O 4JEQA 4AIUA 4HPHA 1OX5A 2JKPA 4H6RA 2E5CA 1OINA 3T05A 3CBWA 3FVDA 1TJRA 2OOFA 5AYZA 2R91A 4IQLA 1RLCL 2DPEA 4NUWA 4LAUA 4LUTA 3LZ5A 4LY4A 2VEGA 4QBXA 1LWJA 1FP8A 1AQFA 4AU0A 3HV8A 4AVFA 4LUTB 3H2FA 2TODA 4FAMA 3LCLA 4JPGA 4WK9A 3UWZA 4IHCA 4E38A 3N6QA 3W2MA 2VRKA 4GQ0A 3TLQA 2G0WA 3DI0A 3EB4A 2WZEA 1XLDA 1JPDX 1YKWA 1BSIA 3BK0A 4HNNA 4K3ZA 3VILA 4C6QA 3W07A 3KTXA 3VD3A 3FDGA 3WBEA 4AB4A 2OOGA 1HJUA 2TMDA 4Y8FA 3GFYA 3SQSA 3WL0A 2DH3A 3HGRA 2WKLA 2A3HA 3B9NA 3PBVA 4ZFMA 5IXEA 4XAGA 4EANA 4I7UA 2P76A 3SCSA 1O5QA 3A24A 1XDMA 1HKWA 5LA2A 1CGTA 1IXPA 3MUIA 4A29A 5A8NA 2GSHA 3UZWA 2W6RA 1G1YA 3C4UA 3O15A 3WQ5A 4FX6M 5LNSA 1TIWA 4IT1A 2ZRUA 1D9EA 2VEIA 1LZOA 1GHRA 4LBRA 4OIFA 1MNZA 1TV3A 4BZYA 3LG3A 5FEZA 3O6YX 4TX8A 2VJXA 2XVKA 3MKCA 1AMKA 4Q8TA 3IAQA 2WVVA 2HBVA 4D6GA 4EVZA 1OYAA 4PYSA 2BV9A 4O1FA 5A2CA 2BGQA 1B30A 3EOEA 4UQBA 2WVVB 2P8BA 4B9ZA 1J96A 2ESCA 1FWWA 2V9DA 1TJ2A 1AW5A 3WH8A 3FYOA 2AGTA 2RGMA 3VGDA 3CT7A 1VCVA 4FMVA 2RGLA 3KW3A 1SPQA 4XAFA 4LCQA 1CLVA 5DT5A 3UP8A 4H9VA 5JMUA 1E6SM 2VGGA 3ZM8A 3E0WA 1CLKA 2E9LA 4PBGA 2QJIA 1P7TA 3LA4A 3FSTA 4HNVA 1JIBA 4XO6A 2ANUA 6ALDA 2DDXA 5FEXA 4L4LA 2HV5A 3BMWA 4Z1BA 5XIMA 3NQBA 4KCUA 2PGRA 5DFAA 1XKYA 3C3UA 1P7TB 4V1YA 4X2PA 3NPWA 1DTNA 3QVQA 4FNTA 4GINA 2CZVA 3GYCA 3W74A 3DIPA 1PWMA 2EF9A 1EC7A 2WV8A 1LUCA 5GVJA 4DY1A 3V1PA 4OOUA 3WNKA 2JK2A 4U31A 3ZXWA 3ZYZA 2J9YA 4TVDA 3NTYA 4P8UA 1ML1A 3BLEA 3IRDA 4TU1A 2YL6A 1LUCB 1VHNA 2VZUA 2B81A 4L5ZA 3B0VC 1MW0A 3R94A 2CLPA 1E4LA 1M53A 1G6CA 4PTNA 4ZGYA 4UB9A 1QOXA 3O06A 4ZODA 2GDUA 4LQ1A 5AECA 4GC3A 2RAGA 5DCDA 2DFAA 2NQLA 3PNZA 3QKZA 4WD0A 4XZLX 3U48A 4DHGA 1XLJA 3FDKA 2G50A 1JGIA 4GC4A 2CBUA 5F4WA 1GKQA 1M65A 3KXQA 3TE9A 3FSUA 4GBDA 1CXIA 1WAWA 3I7SA 3GC2A 4J2MA 4KEZA 1QATA 4GGBA 3DGBA 3HZ3A 5AYIA 4BCEA 1A0EA 2X1RA 1JYWA 4PUJA 1RY8A 1UUOA 4R5EA 4Z2HA 1EJXC 3CIVA 4M19A 2EPLX 3W72A 5BOEA 3MMTA 1AZ1A 1EP2A 2E1DA 2OU4A 3WFZA 3XINA 3HBLA 1O68A 1DIDA 3WQ6A 3HPFA 4B15A 5CPSA 2XVLA 1C91A 1WKDA 1UD5A 1ZB5A 2OT0A 2CC0A 2ON3A 2IKGA 2OO6A 2Z1XA 3OPSA 1SSDA 3WQVA 3W7KA 3EPNA 2OZ3A 4C6IA 3MVIA 1QOPA 3AHXA 4PTDA 1QU4A 2WBKA 3SBFA 3SFWA 3LXCA 2B7OA 1XGDA 3PBWA 4AZGA 3DEQA 3D6NA 4L1GA 4HT3A 1LM1A 2PLKA 2XWEA 4HZMA 3GW3A 4G7FA 3TDFA 2WZMA 4O57A 1EHAA 4N0RA 3MA8A 1BQCA 2JEPA 3WMSA 3IAPA 5CLTA 1ZLPA 2DZUA 4L61A 3GXIA 1TWWA 2G97A 2VZSA 3F7JA 2Z1WA 1SSGA 4DYJA 3QOMA 3ATZA 3F03K 1B0IA 3CZLA 1XGEA 2ALRA 2FH8A 3PHAA 3UR2A 1LBLA 5BXPA 1WBJA 5CG7A 1L6WA 2L5HA 4PC8A 1DIOA 1YYAA 3GH7A 3RF9A 1ITCA 2X2YA 1AVAA 3S5YA 1EIBA 1NF7A 1SGJA 3VZZA 4GVFA 3LPGA 1AJ2A 2JE8A 2BGNE 4LOCA 4ZBCA 3LCWA 1TJ1A 2BY0A 4DLFA 5CLWA 1FP9A 1E55A 3R7MA 1ZCCA 4HCDA 4CQCA 3N73A 3VIIA 3P14A 1ISXA 1LRTA 1P5BA 2HK0A 3NQ2A 4JTFA 4QNEA 4CLMA 1GYLA 4BWLC 1RSCA 1QW8A 1SZNA 3W02A 4BK9A 1IE7C 4EWJA 1NP2A 4Q4OA 4X9YA 2YBVA 3R58A 2GGGA 2IQTA 3F5KA 5I23A 3WBXA 4CN1A 2V3DA 1UPMB 4N2YA 3AISA 4IPNB 3BAKA 3PZUA 3WLQA 4YCOA 1KTBA 4MTVA 3W7LA 2VCBA 2WZIA 3WH7A 4BEQA 4O1CA 2CZDA 5AYYA 2CLIA 3BH4A 3GVQA 4O0KA 4G2DA 2PDJA 5HR7A 2C1HA 3O16A 3OA3A 4A3UA 3B3DA 2A0NA 3PPHA 2TAAA 2CWXA 1IGSA 2QDHA 4XAZA 4POCA 2WCAA 5LGZA 1NARA 1XCFA 1F6PA 3NL6A 1W3JA 2I17A 2QEZA 4PCSA 4QISA 4NXKA 1RY0A 2ZA1A 4BQ2A 3JUGA 2Y5EA 3QZ6A 3STGA 5G2IA 3BUVA 3HV9A 1C93A 3ZT7A 4GISA 4RLIA 4ACYA 2C6QA 2E25A 2CESA 2YB1A 3NA8A 1XLMA 5LNUA 5D09A 1KCZA 2NT1A 5EMKA 4IZGA 1H4PA 4NHVA 3BAYA 3EOUA 4N9BA 3URAA 5FSEC 3TJ4A 4MB5A 5E6YA 1ONEA 1G4SA 1MZHA 2QVNA 4C6LA 4S3KA 1A0DA 3FYPA 2WMGA 4FHAA 1QHOA 3SR7A 2XGZA 2DZXA 2WMIA 1PS9A 1W1IE 5CPOA 3VM5A 1F5ZA 4JX4A 2WMIB 3UZZA 2D2OA 3L4YA 2ALDA 3WKZA 3V5CA 3VNLA 3SECA 3A3WA 4LBUA 1HO4A 1HT6A 3WLNA 3L4XA 3GNXA 4JQ2A 3GDLA 1O1ZA 4N6FA 4GNJA 4XSMA 4K68A 4P7RA 2J7GA 4DBSA 7TAAA 2PRMA 3VKBA 2OQHA 1X6NA 1VAHA 5I3GA 4HGXA 1VYRA 4Z42C 1WDWA 1O5RA 5BNKA 1ADOA 3MCOA 2E8ZA 4JTDA 4YVXA 6XIAA 3UZYA 3R79A 4JHOA 1K9EA 4MAVA 4QEEA 4A8NA 1JCJA 5DT7A 4XIMA 2WKGA 1FHVA 4HN4A 1SMDA 1OF6A 4IXHA 1W9VA 4AH7A 3CWNA 4M0XA 3RM9A 2XJ7A 2Z26A 1KM4A 1KTCA 4WXYA 1VBGA 4Q8WA 2O4MA 4K37A 9CGTA 4EXQA 4MJ2A 3WLMA 1KO0A 4AWEA 2WZHA 1O5KA 4GCXA 4UTIA 4Q7BA 4REQA 3OBKA 3DKLA 1F8MA 3OIXA 6CGTA 3KZPA 2Q6ZA 1QK0A 4C6EA 5ABTA 1K8ZA 3MYOA 4REQB 3O1NA 4WJXA 4X3ZA 3UNDA 2CBIA 4OJYA 1X8FA 4C5ZA 3R8HA 3S1UA 2FPYA 3NM1A 3WF0A 1YW1A 5JUVA 3H6OA 3KRUA 3UERA 2V8ZA 1JRCA 3F2DA 1YDOA 3DFNA 3PJUA 2QCEA 5FI8A 2C91A 1XC6A 3DFHA 3K2GA 4AD5A 3R8RA 4JCLA 3WD4A 2OKOA 3P84A 2NQ5A 4FLQA 1UJPA 3IJ6A 3G77A 1GKPA 3HGSA 4CN4A 2OKTA 3E74A 1PZ2A 4G56A 3OLIA 4IP5A 4RNHA 2XGBA 1IF2A 2VNCA 1YIXA 4JL1A 1CXKA 1I4NA 4YTQA 3EPMA 3SIZA 1UZHA 1LBFA 1QBAA 4ZB2A 3LEPA 2OB3A 1VBUA 3ZMRA 1NDYA 4JICA 4UFMA 3DGRA 4XG1A 3V36A 1O12A 1E43A 4XTIA 1FWSA 4PUMA 4ZSUA 1F4AA 3VM7A 1JI1A 1KRBC 1TUXA 4X9SA 1PKLA 1XP3A 2RHGA 4QG8A 5C9ZA 1M01A 2PDYA 4CEXC 4O1AA 1XBXA 1VFMA 2VOMA 5KSWA 1JCMP 2J7EA 3D5HA 3OZOA 1PSCA 1BXBA 4Z2LA 1YNYA 1HX0A 2BDQA 3TQVA 3KWSA 1JJKA 5A8GA 1W5NA 3QHMA 1XW8A 4O8AA 2FIQA 4GQRA 2PWDA 3VNYA 1L6FA 3BICA 1Q45A 3VGFA 2GWNA 4D8ZA 3VE9A 4U5IA 5ECVA 1GTHA 2PDWA 4RZBA 2DGAA 3ZJ6A 4HNUA 1O7AA 4C65A 3FJ4A 4MNMA 1VPYA 4P5UA 1UYQA 4XVDA 3TC6A 4ICCX 1NOUA 4LNCA 4E6MA 1RH9A 2X2GA 2WPBA 1UWIA 3IPWA 1LQ0A 2UY3A 8XIAA 3DFPA 1TPFA 1TMQA 3COTA 5XINA 3CNYA 4ZO9A 4MUPA 1ZY9A 2DU2A 3BGAA 1G7VA 3A64A 5CZTA 4PFMA 1UBPC 1YNPA 3UD6A 1AK5A 2YIHA 4RNFA 4OBTA 4C1NA 3GY1A 3EZ4A 2R9RA 4NP7A 1RA5A 2ISFA 4OHQA 1QDSA 1UWTA 1XYAA 3NEHA 1JR1A 4C1NB 4RXFA 1Q66A 3AUJA 3LSBA 3HQ1A 4LXFA 3SIMA 4WGHA 4UFLA 1F8IA 1NAL1 3CXOA 1K9DA 4Q8MA 4YTUA 4ZA0A 1OD8A 5G2WA 3TTOA 1VPXA 4OU1A 1FBAA 3BDKA 3FJLA 1TE6A 1E70M 2DZAA 1BVZA 2WW5A 3W7DA 4NIRA 2Y70A 1W5PA 4IMGA 1W9DM 2GFTA 2XN2A 1C8XA 3VNZA 2INZA 1T40A 4IG2A 1EJUC 1M5WA 3E49A 2XISA 4BWLA 2YL8A 3QN3A 1ZPTA 1WO2A 4K1GA 2WQDA 3CQKA 3THCA 4DZHA 3RRXA 4IG2B 4HHHA 3LRLA 4WKFA 3WJSA 2QR6A 1SZGA 3S47A 3EDKA 4I9JA 4Y6GA 3KOYA 1CB2A 1MQQA 3D3FA 5LIKX 1Q6QA 2XN0A 3QTPA 2Z1SA 3RMEA 3VIFA 4GH3A 1W8SA 2IQ0A 2POTA 1W8GA 3P2VA 1T99A 4ERGA 4H7VA 3VINA 3HURA 1XJBA 4ORIA 4AVOA 4R7WA 2ZUTA 4DJFD 2Q71A 1ITQA 5FF2A 3RIKA 1B3ZA 4Q4QA 4KT2A 3AHZA 3N2BA 1K70A 3AS2A 1C8QA 2PWFA 4YVVA 2ABBA 4Q32A 4YTTA 2OXNA 3DENA 4I90A 3B0YA 1S2AA 2VT0A 1WYIA 4LYQA 5EMUA 5T8GA 2ZRXA 4HMEA 4AC7C 4YYFA 4QE4A 4CNTA 3VC6A 4BI6A 1CDGA 3ITGA 3V3WA 1GQNA 1DJZA 2WSKA 1G01A 5EFDA 1OFAA 2WC7A 1SJCA 4QCEA 3UR5A 3VGBA 2HISA 1ODUA 4YNGA 1A5OC 2I5IA 3GNOA 4PL1A 4AYGA 4DUVA 4TIMA 4BQ4A 1H63A 4A2RA 3ZWTA 3BURA 5F4XA 4HU4A 4F9JA 4J40A 4N9EA 3L0NA 1ZCOA 3RLGA 3I6RA 5FAGA 3NQFA 4H83A 3MW7A 1UWSA 1PIFA 1WX0A 1W9XA 4L9XA 1HGYA 1ZS2A 4PE8A 4WRHA 2ZWYA 3RJXA 2VRQA 4XZHA 1N2VA 2FHFA 1OF8A 3BQ6A 2W62A 3OGVA 2O9TA 1F76A 4PODA 1KCLA 1W3NA 5AZ0A 2XN1A 2QUTA 5I3DA 1VFFA 3KBNA 3TW9A 1K8YA 1T0OA 4LS1A 3NQAA 1Q6GA 3IUHA 3OHMB 4S2BA 3W9ZA 2E9MA 1B2YA 3B9OA 3D0CA 1V4YA 5D04C 3GTFA 4AD2A 3VA8A 1WUFA 3L66A 1XUZA 1FDZA 4O12A 3BV4A 3ANUA 4J3TA 3BLPX 4LB3A 5SWUA 4M29A 4JTAA 3S1GA 4WF7A 3LCXA 4A8IA 1GOXA 2IPGA 3O0FA 4DI9A 1A50A 1FWBC 5AVHA 4GNKB 1A80A 4CU8A 2GJNA 4Q8VA 1SM9A 1X96A 1RZMA 2XU2A 1SO6A 3JZUA 3ZOAA 5AHMA 3SCPA 4QAWA 5I24A 1FWJC 1UKSA 2D3LA 3V35A 1TMHA 1B90A 1DWFM 4YJ5A 2QHAA 4J7RA 3BXWA 3BCDA 1X6UA 3CUIA 4WDUA 4D6EA 3HJZA 3SRHA 3ZWSA 2CXGA 4RDZA 2W61A 2QT3A 5BRPA 1JXKA 5HMDA 4AWUA 1TPC1 3RDKA 2ZA3A 1F07A 1HJWA 3FLUA 4QGCA 3T42A 2YCJA 1EXBA 3ZS4A 3TW6A 3U9IA 3OGSA 4XD3A 1F3WA 2Z1VA 1XYLA 4NL1A 1E3XA 3HMCA 3ZT6A 2B31A 1VH7A 3E0VA 1EXPA 1W31A 1UMYA 1VJSA 2VFIA 2Z6JA 3OYXA 3KVKA 3ARVA 1TR9A 2ZKMX 5AYXA 4O1BA 2OWCA 4WIWA 1XLCA 4I5RA 1Z41A 3W22A 5JBEA 4GD0A 3RPTA 3CO8A 4RV3A 5AHLA 5AC7A 5H91A 2IQDA 4PN2A 5BMXA 4LUSA 6PTDA 2WANA 3VC5A 4FXJA 2Y7FA 3NGFA 1BF6A 3CB3A 5D8ZA 3WLHA 1ZUAX 2NSXA 1TVNA 4LUSB 2ZTJA 5L6UA 3U4AA 1CI1A 2C0AA 5DY3A 2R94A 1OT2A 4G9PA 2BVTA 1KM6A 4UNLA 3Q65A 2PDFA 1XX1A 4FIRA 4FNQA 1W32A 3CZJA 1FWAC 5A6BD 1L2QA 2YPIA 1ZTVA 4CVWA 5AFDA 3KX6A 3AIRA 1IWPA 5G1YA 5KITA 3MT1A 2Z28A 1S1PA 3UJ2A 3PBGA 2ZYFA 2OTDA 4E2BA 4FALA 1DJYA 2Y7DA 1OGGA 5JVLA 1NVMA 2Y8KA 4E2OA 5K9DA 2J8TA 1MW1A 2B0MA 1RP9A 1YMYA 4JZ5A 3W00A 4HSHA 2YCLA 5PTDA 1W1ZA 1JD7A 2VKZG 4CNUA 3LDVA 3WENA 3WN6A 1WE5A 4UWMA 1JQXA 3QPYA 3R25A 2A3CA 2YCLB 2VELA 2QS8A 3AXXA 2VD8A 3C0JA 4FIQA 1RD6A 1MZRA 4XK2A 5I3IA 1Q5MA 5CGMA 4FLRA 2WWCA 3LCHA 3ARYA 4JTQA 3ANYA 3WZ0E 1E71M 1G4TA 4OT7A 2WO5A 2FYMA 4KEMA 1U2YA 1UWUA 4PMNA 1UZ1A 5F4SA 4QJ5B 3STEA 1D7FA 4LANA 2YYTA 4UBPC 2PPGA 2YW3A 4CNPA 1RCQA 3PJXA 1PYMA 4IIDA 3LK6A 1U5VA 5TBOA 4QLJA 3WFLA 3TN6A 3RNDA 1TREA 2JIWA 4DJFC 1ECQA 1J2BA 4V28A 4B5WA 3S1WA 3LERA 3H7VA 2HXTA 1Q7ZA 4HB7A 2A3EA 4JQ4A 4E3TA 2ISVA 4GBUA 3KWXA 4QEHA 5FCZA 3GFZA 2H8ZA 5RUBA 2OEKA 3WELA 3QZAA 3T81A 4O1DA 4XD6A 2PZ0A 1U83A 3RX4A 1DIEA 4INFA 4NAEA 3CH0A 5A8MA 4W89A 3PTKA 4Y9PA 1MUCA 1Q6EA 1XPYA 4JX6A 3LNPA 1JZ4A 3K4AA 4NAEB 3CPUA 2WYSA 3KTCA 3OYZA 1V3IA 4E3VA 4MUZA 4FOKA 2F61A 4Z1CA 3C2FA 3PUDA 4M7SA 3FHQA 3VMPA 2PGEA 2F6XA 5HQEA 2PE4A 3TMLA 3TA6A 5HUOA 1OY0A 3CL7A 1X39A 1ENUA 5REQA 3D47A 1QFEA 1BGGA 1OSEA 2YA1A 4UFJA 3NQEA 5J04A 3DG6A 4S3FA 4F9DA 3RPDA 2VGIA 4YL2A 5REQB 2E5BA 3DKJA 3XIMA 3KS6A 2IPWA 4LF1A 1D2KA 2D73A 4LSBA 1RV8A 1LYXA 2FMOA 5D8WA 3FA3A 3GBEA 1K8XA 1TTPA 1JCYA 2GK1A 1UPPA 3SI9A 2A1YA 2Z1BA 4EX4A 3B0PA 1ZQ5A 5TD4A 5EGRA 4XZBA 2I9UA 1LRQA 1VJZA 1I8JA 2J7CA 2GK1B 1XIGA 2PTXA 4DUOA 3E5PA 3T8QA 1Q8AA 1R2SA 3CO4A 3QY8A 1CXLA 3ZFHA 4AF0A 4BR1A 3IGXA 3DZ1A 3W6MA 3IIXA 4J28A 3P62A 4LC8A 8RUCA 4AF0B 3USBA 3KCOA 1GJUA 3QW3A 1BWKA 5E9AA 3RAOA 3PUEA 4J2PA 3NOYA 2PGFA 3WK1A 1Q7QA 3VKAA 1P1XA 3ZLFA 2ADAA 2W5FA 1XIEA 1QNOA 3K8LA 4LUIA 4ZTYA 2B7PA 4IX2A 1X1OA 1CXEA 4BS0A 3W1LA 2PDXA 5EY5A 3MB9A 4W88A 1V6VA 2V0TA 3QYQA 2ZZ3A 1JNDA 2PWUA 1UOKA 1CEOA 4XD4A 2RJHA 4YS1A 1YE6A 4MWAA 3A47A 3N9RA 3DC0A 4WKHA 1MUMA 1ICQA 4KRUA 3W7QA 2ZWZA 5LNVA 3ZR6A 1U33A 4TVUA 3NL2A 2Q02A 4D9PA 1BYAA 1H41A 4B9YA 3W7PA 4FR6A 1DYSA 4YVPA 3CHCA 2GDVA 3FIGA 2HK1A 1KFWA 1FWHC 4DUWA 2XPKA 2ABAA 2CBVA 4IICA 3CEUA 3K46A 1K6AA 5CKSA 4WOQA 1OFBA 3BLLA 1CCWB 1VEPA 1TV7A 3TYUA 3ZSSA 4DWSC 3PZOA 4H9MA 2O0TA 1M7JA 3DERA 1E0UA 3W7OA 4GI6A 3MI2A 1RA0A 2Y5JA 2QCLA 4IGHA 2FVKA 4TTGA 1VYPX 3WJWA 1G69A 3TVAA 2QVHA 4O18A 3KHDA 1UKOA 1ADSA 3GDBA 1LLOA 3HPAA 5K9XA 3K30A 1GQKA 5HJYA 3VUSA 1ADDA 1KBKA 3HG4A 4MKVA 5EBAA 1DJHA 1MUWA 1ODZA 1XF0A 3IVUA 4IMCA 1WDDA 1NP0A 4MJ4A 4G1KA 2X0SA 1JUEA 3KRZA 5C6MA 3I7QA 3SSJA 1JQVA 4L4PA 2VR4A 4KWSA 1XLIA 2ZZ2A 2VOTA 3AIEA 2VDHA 1WUEA 1IT7A 1XIJA 2ZX5A 4PH6A 3AIBA 2BHYA 2GOKA 5LHFA 2ZZ5A 3E9AA 2GYIA 4Z1AA 4JYFA 2I1OA 1YBQA 3Q67A 4UFKA 1PUDA 2WHJA 4L56A 3U2EA 6ENLA 3P3BA 4LWWA 2QF7A 4E2VA 4GLEA 5DBTA 1YBQB 4FK9A 1P6CA 3CAKA 1C29A 1BVWA 5B80A 3M5VA 3VKCA 1NFBA 1XYCA 4ZSTA 3IJIA 1OGBA 1BYBA 1A5CA 4F66A 4PRWA 1UKPA 5C9RA 2QPUA 3BOLA 2HVOA 3GLCA 3E0FA 2BVDA 4AZ7A 4DRSA 4NY2A 2VHLA 2PU1A 1QW7A 9XIAA 1IIHA 5EU9A 2W3ZA 2GSEA 4GQGA 3H7UA 3K13A 4JN8A 5DMLA 1AQMA 3MHFA 2QNEA 3WNOA 3S2LA 3BSMA 5LIWX 3LS9A 1TUFA 1EOKA 1V3MA 1X7IA 1S38A 1I1WA 4GZEA 3UW6A 2YLLA 3Q4DA 3CZEA 1KCKA 3CWHA 3O63A 4O4WA 3TOPA 1VIWA 2UBPC 3NDOA 2G5WA 1O95A 4UXDA 3W01A 3M16A 3W7JA 2HE5A 3NQVA 1A5LC 1EKOA 3NZGA 4KEUA 3THUA 3QY6A 5TIMA 1VP5A 4C1KA 4W93A 1SFJA 3W2LA 2WVSA 3OO2A 5DXXA 3PPCA 4YPJA 5M03A 4C1LA 4UOZA 3AIVA 1OCQA 3G6MA 3S42A 5FL0A 1B54A 4WSKA 2DZVA 3W6LA 3MUAA 2XIQA 3WQPA 2POZA 3F1QA 3GZ3A 1EZWA 3UEQA 4ZOAA 4K8EA 1HIZA 1LDCA 2E68A 1MXGA 4L9YA 5DXYA 4NU7A 2OSXA 2UWFA 3QQ0A 1E40A 1TSIA 2ZICA 2XFWA 4AY8A 4F79A 2J7FA 3MMWA 2XIOA 3N18A 1UIPA 4AUBA 3THDA 5AC5A 3LOTA 2J8FA 2Y6ZA 3TXZA 3NZQA 2EKGA 5ABGA 4H2HA 1Z7AA 2O92A 4AWSA 1PCKA 1MYRA 2VURA 3B05A 3WLSA 4WKAA 1KTNA 5JIWA 4WGXA 4YXGA 1BRLA 3QGKC 4XSLA 4JD4A 2FVMA 2WK2A 3OZYA 4B90A 3B8IA 2WMHA 3OZMA 1BRLB 3KP0A 3WX7A 5HPOA 3LV5A 2Y0FA 3S1VA 1WA3A 1OFQA 4AZBA 1NJJA 1UR2A 2PDQA 5FEPA 3GW0A 5DELA 1LQ2A 1RD5A 4X61A 2XUCA 2O9PA 4X22A 2BG5A 3KTSA 4K1WA 3TXVA 3WNLA 2EG8A 3WBAA 1CGWA 1F61A 3FW6A 1VBRA 2DJLA 2RDUA 1W1PA 2PODA 2HQAA 2ZUUA 3RM8A 3SCVA 3T2OA 3CUZA 3EDJA 3C2OA 1RK5A 2PS2A 3QSRA 4IMEA 1LBMA 5G4WA 3AUOA 4ZQPA 5BU6A 3KBWA 4YTRA 2NUYA 4IH3A 4DO5A 3RG6A 3BPWA 1YRRA 1PE1A 4ORMA 4AEOA 4RE2A 4UR7A 4ERIA 1FWCC 1E0WA 1HKKA 3UBPC 3W1AA 5K4ZA 1QWKA 2PDGA 2PLMA 3A23A 4UQCA 2BP1A 2G4FA 4H9ZA 1YQ2A 2W9MA 3KM8A 2CZEA 1F6YA 2JGYA 1V8EA 3OOQA 3TZFA 3EWYA 3W0KA 1HUVA 2QAFA 4R7OA 4H9XA 1IT8A 5L9FA 3SEPA 1V0NA 4U28A 4B4FA 3FV9A 3GXFA 4NZJA 4ES4A 1BYDA 4PUNA 2XH0A 4E2DA 4W8AA 3C61A 1BAGA 1PCWA 4M8UA 1Z69A 2FDSA 4O14A 3VD5A 3M0YA 3VNKA 3SJNA 4DBEA 4A3RA 3QV9A 1M04A 4HTYA 5JU6A 4I7VA 2VVNA 3N9KA 3URQA 3PFMA 1ME9A 3TW7A 3W81A 1D3CA 1MDLA 2X0HA 1WZMA 2TPSA 4DWSA 5HINA 2A6NA 2AQOA 2CHOA 3H55A 1G67A 4P8WA 3GXTA 3M6YA 3MUCA 1PO9A 3G3MA 1Q13A 4DWSB 1CTNA 2C71A 2VYOA 3VXGA 3S9ZA 3KBSA 1HQTA 3SCNA 1UP2A 4S3AA 1IWAA 1XLHA 4QJ4B 1VGAA 2PBGA 2WMFA 3E6EA 5A2BA 3PZGA 1TB3A 3GBDA 2HJPA 1JF5A 4UTWC 5CPMA 2QPXA 2WNWA 3W73A 3ARQA 1XH1A 1MFUA 4KH2A 4JL2A 1S46A 1OZMA 3PM6A 1J6OA 4GA8A 1CXFA 4J3VA 1JCXA 4OBRA 1WCGA 1AL8A 3LPPA 1CXHA 3L5MA 3TK7A 3EWXA 1RR2A 3S9IA 4IM4A 2IXUA 1KKOA 1TPUA 3I65A 1UD8A 4HMCA 1KM3A 3WNPA 2WQPA 4GNVA 1PKMA 3ANVA 1DPMA 3ZQ9A 3WEMA 1SFLA 1R46A 3SCQA 3LU2A 3BG3A 3EMZA 9XIMA 2ZE0A 1SR0A 2GSJA 2VFFA 1G0CA 3AAMA 2V5CA 3VZXA 2YSWA 1WBHA 1ICSA 4OZOA 2HTMA 3M4HA 5C7VA 4IMAA 2ZVRA 3CL6A 2FB3A 1H11A 4K6AA 3CQ0A 2ICSA 4DF0A 4GZ7A 4S39A 4DWDA 5A6KA 4H1ZA 3AHYA 1H1ZA 3TMQA 1PDZA 5JBDA 1AODA 2OWXA 2J74A 1J0YA 3R43A 4RXGA 3GZAA 3ITXA 3GD6A 4UQEA 4HNTA 3WMLA 3RFAA 1EDQA 3PBMA 3E1F1 4B2DD 1M7XA 4RDYA 2I9EA 2W4XA 1AD4A 3WLRA 1QHPA 1R38A 3L21A 1B4EA 1KFLA 4L80A 2ZZ7A 2P88A 1V6UA 5DN1A 5AYBA 4XAYA 3VDBA 4AD0A 1CT5A 1UR4A 1MNSA 1W91A 1D8CA 2XVPA 5CPLA 1TWZA 4FLOA 3AYSA 3A4WA 4M3PA 3GR7A 3AIUA 3ZLGA 4CNNA 2QAPA 4K39A 9RUBA 3QMSA 2P53A 3G1AA 5D30A 5C9UA 4OECA 1JI2A 1XPGA 1UR1A 4IFOA 4WDTA 4ZQRA 1SZFA 2X05A 1XBZA 1J10A 4W87A 1W6TA 1QOQA 5HMSA 4DEFA 4DXVA 5FJIA 1TWSA 3L4VA 4E8GA 1ISWA 2X1UA 4OGZA 1K6WA 2X1IA 4NJHA 1S5TA 3BSGA 4RW5A 4C7FA 3BWWA 4A3QA 1TPEA 1TV4A 2WHMA 5EMYA 3GB6A 3GDMA 1GZJA 3FCPA 5HDRA 3CS2A 4FEZA 3H8AA 4JR5A 5A6TC 3V4BA 1FRBA 2YB4A 5CC3A 3WNMA 5DO8A 3QLLA 5J5RA 1F3TA 5C0QA 4H01A 3EMCA 1XIIA 5ABEA 1EC8A 3CJPA 3L65A 1OFPA 4UTFA 2XZ7A 1X8CA 1H0GA 4AMAA 3SRFA 3RX2A 3EX6A 3VIOA 1C7SA 3C2VA 4NASA 2PUZA 2QV5A 2C16A 3TC7A 1FA2A 2X1SA 3V0TA 4KMQA 4IGSA 3V7PA 3DFOA 4BFAA 1XV8A 4QNWA 3QLDA 5HXMA 4B5SA 2IXVA 2D0HA 2FZMA 4XV0A 1UR3M 4Y9AA 1SO5A 1WZLA 4PFHA 4JXCA 2PDMA 3AU2A 1CNVA 2DV0A 5KZDA 1BF2A 2R1LA 2FFCA 4TTUA 1EO5A 4GABA 3RPMA 2BASA 2C19A 3C0QA 1V6XA 2Z29A 3H2NA 5DRIA 2DUZA 1YDYA 3NSNA 2VR2A 1BKSA 1WB0A 2D22A 1FY6A 2AQWA 4DO4A 4F3HA 3DFYA 3TYAA 3U57A 1R87A 3P61A 1JXJA 3ARXA 1U30A 2C8NA 2JKAA 4DX3A 3QMRA 1TTJA 3EWWA 3M0MA 1FHLA 3W86A 4HKPA 3FVMA 3BW3A 2BLEA 4NQ1A 3VD7A 2C18A 1GVRA 1GYNA 2QIIA 4CCDA 4H2CA 3W28A 2OEJA 1UBSA 3FKKA 3S2JA 1V3KA 4F0SA 5D05A 2VP8A 2R24A 3CQHA 7CGTA 4Z2JA 2QCHA 1ZBWA 4DN1A 3B9AA 1SU5A 1XBYA 3S6OA 5GJNA 1A53A 1VEOA 1MQRA 3POHA 3K8MA 1N82A 4MMWA 4Z2GA 2OPJA 3NXFA 4WUIA 3CHVA 3IK2A 3AU6A 1G5AA 2Z0IA 4NJKA 4HK7A 5AHNA 1JRBA 6TIMA 4MY1A 3WDIA 2Y8UA 1ME8A 1S2VA 2WVTA 2OODA 1VFSA 3IRSA 5M1TA 8CGTA 4RW3A 3CGTA 5JXQA 4O52A 3NURA 1UUQA 2JF7A 1O66A 3GR8A 1UH2A 3M0XA 4RKAA 3B8DA 4Y96A 5HNUA 1ISVA 3R5EA 2QUNA 3RM4A 3DHFA 4JFVA 3VOIA 2YDSA 3RLVA 4Q33A 3C5QA 1UQYA 4AZHA 1Y5WA 2YOCA 1Q3NA 3P74A 4DIAA 3F5JA 4ZXOA 4FF7A 3F5LA 4L65A 1LT7A 7ENLA 4L64A 5D2VA 3WDPP 1J6PA 1MO0A 3N1AA 3PG8A 1MQPA 1FKXA 5D38A 2GGEA 1J01A 1KQYA 4ZB0A 1SMAA 3W85A 4MY8A 2Z7GA 4Y2WA 2ZADA 2C1GA 2VVSA 3MJYA 3URBA 4LJ3A 4GUIA 2VGBA 3TSDA 3CMJA 2VGFA 2ONEA 4WJ8A 2HCVA 5I06A 5LGXA 2OGYA 4UTWA 1RLDA 3I3EA 1K9TA 3PAOA 4DPPA 1GOWA 1UCWA 3KEHA 1SO3A 1SJBA 3U5YA 1NOWA 2X16A 2DT2A 3IANA 4LVGA 4JIEA 4IGNA 1GQLA 1EZ2A 4GPNA 3UT0A 4C91A 1TWIA 3ITVA 4DZIA 3RU6A 3CYJA 3N9SA 1F2JA 2Z25A 1UB3A 2CKRA 2HEJA 3BG5A 1NDZA 1QBBA 2CFFA 4I6VA 5LHEA 1ZJHA 3W84A 3T0TA 3WF3A 3K1DA 3AXMA 2UY2A 4M7TA 4QSFA 1W1TA 2W92A 5DY2A 2YZ5A 2QPSA 2FTWA 2JF6A 5I02A 3TNOA 3AO0A 1E9ZB 2WJDA 1TPDA 2WJEA 5ECUA 4MJMA 5M5DA 5M2FX 1UH4A 4LYKA 4JFTA 2GL5A 4H9TA 1ZBKA 4GO8A 4XZWA 1XFCA 2VMFA 3NPVA 5I07A 1RBLA 2E40A 2FZ8A 5CH9A 3F4VA 4S3EA 1YXCA 3T08A 1EQCA 4JFSA 5CBBA 1I60A 2AGKA 2YZRA 3EXRA 1PHQA 1GKRA 4LCRA 1XH2A 1GVEA 4DXKA 3CK5A 2E7FA 2HPIA 1NEYA 5U4NA 1UMLA 2EXOA 5DQPA 1OFDA 1Q7MA 1HL2A 4HMNA 1GGOA 3K4WA 3Q45A 2X42A 4O0QA 3UVIA 1B3OA 1DOSA 4RCXA 3VDCA 3O3RA 1HP5A 3UR7A 1CGYA 3LHYA 1JYNA 3AYRA 2JFEX 3NQDA 3F4CA 3CEPA 1WXJA 3EEGA 4YYCA 1FHDA 2GVJA 3I3DA 3LHWA 2WNZA 3QFWA 2XM1A 2Z00A 4YLWA 4HYWA 5KINA 3U3HA 4QE5A 2OCZA 3PZVA 2QYGA 4RV8A 1E6RA 3LYEA 2Q09A 1UZDA 3LRMA 2CLEA 4Q4SA 1L6YA 4RE4A 3WY1A 2HXUA 3ARUA 4GACA 5CZKA 1HG3A 4W8BA 2V68A 2RDTA 4G1NA 3ZVIA 3UXIA 1VYSX 5LA1A 2J66A 2NXHA 1VZWA 1WXYA 1E9IA 3S5NA 5ABHA 4E0CA 3WK2A 1MDRA 3MP3A 4JIPA 3WLKX 2VFHA 5FF4A 4K7YA 1CGVA 4B91A 2RFGA 1RBAA 3WJYA 3HFYA 1DQUA 4GOAA 4ROQA 4FI4A 4LPCA 3UU0A 3EA3A 3R4IA 2BOGX 3RLHA 1S2WA 2REQA 3VOJA 1XLKA 1XQKA 1JYVA 3LB0A 1ZGDA 3QV6A 3LMZA 4ZENA 4B3ZA 3SUTA 2REQB 2ZUWA 2CYGA 4IIFA 4WX2A 5C70A 1GORA 1Z42A 2F9RA 5E0KA 1E1EA 3PPFA 1TRIA 2PD9A 3ONCA 3RLUA 2BZNA 4M24A 4IJCA 3HG3A 4C6KA 3VNDA 2QGYA 3MUY1 1KBLA 1JPHA 1RAKA 4GZJA 3PNUA 3WLOA 3M7SA 1H7WA 5FJOA 3IS4A 3SDOA 2WPGA 2PEVA 2O55A 2OZ0A 4MYAA 3NO1A 3CZKA 4BI5A 1US0A 2FKPA 5DMMA 2CCRA 5FJUA 3ALFA 3NO3A 3MO7A 3N11A 4I3GA 3VKDA 1F7BA 2Z1KA 1JAKA 7A3HA 4ZB5A 4TX9A 3OIHA 4O28A 2TRSA 4GZIA 1OYBA 3L4UA 1Q4WA 3M0LA 1RJRA 2WJFA 3R13A 3HQPA 3L23A 1H7OA 1K7XA 5IFPA 1LOSA 4NRSA 3AHVA 2P0IA 3E12A 3VK5A 4O8RA 2DP3A 3WQEA 3SGZA 2IPFA 3O8AA 2ZA2A 4GCAA 1FH9A 2W63A 3H22A 5BMWA 3UESA 3B40A 4BJHA 1EJTC 3CAWA 3KE0A 4CQ9A 1E1CA 1A47A 1B3WA 3UA4A 3GAYA 4I9TA 4WZHA 1H2JA 2YLAA 3GVVA 1E1CB 4FXRA 3WDJA 4FX8A 3NGJA 1B9ZA 2Y85A 3AZTA 5BYWA 3LGEA 4AIOA 3T2QA 4J3ZA 3V0UA 1XXXA 3T78A 4MJZA 3OBAA 3K1GA 5GJPA 3HJEA 2VEKA 5H6HA 1DQXA 4QLLA 1LROA 1Z9AA 4L1WA 4JQ1A 4Q6XA 2DSVA 4IFKA 1GONA 5F2IA 2VX6A 2PBOA 1PJ9A 1OYCA 3MY9A 1E6NA 4FXFA 1QK2A 4IFKB 1TJPA 2EG7A 1Y5VA 4O11A 2ZX9A 2GVLA 3IARA 1J11A 1XL9A 4RZ4A 1MSSA 1F73A 1Z6KA 4AW7A 4DJEC 4GYJA 3L2MA 2VM8A 5D2TA 5I2UA 4JDYA 1SW0A 1QNPA 1E56A 4NNAA 4UNIA 4RDVA 1HJSA 3E02A 3MVTA 4AMCA 2F6KA 3WLLA 1TE1A 1XIMA 5JH1A 2PRLA 4GWEA 3BJFA 1J12A 2BHZA 3T55A 4AYSA 2NQZA 5I6SA 1KFKA 2OYLA 1KLZA 3TH6A 4DAIA 5H1WA 4MNJA 2DZSA 1PZ1A 1TTQA 1AW1A 1B3XA 2NVCA 4UTKA 1Q6CA 1ZBVA 1M9HA 2YDQA 1EWEA 4OUIA 1BHGA 4Y9NA 1XLBA 1A3WA 1NQ6A 4QJ1A 4ZTXA 4Y9OA 1FWGC 1Q65A 4ALDA 5DEZA 2J7DA 4IMFA 1S5VA 3UWYA 3MO4A 2YFOA 3BV7A 3GYEA 3N2CA 1R2TA 3VDHA 1OCJA 1I2RA 5EPDA 2G8ZA 3TLLA 2ISDA 4CEUC 1KXQA 1P0NA 4K8HA 4O10A 4TMCA 4XX6A 4GK8A 5AHEA 3HN3A 3RHGA 3HA1A 4UMCA 3PTQA 4Z1YA 4AEEA 3SRDA 2YL5A 1U1HA 3QOKA 4LV4A 2FFIA 4M5PA 3NR0A 4LAMA 2FPVA 2BWGA 3RK8A 3WLIA 1BWLA 1YDVA 3TAKA 3NDYA 3EKZA 4WSJA 5ENLA 4JTRA 4JEJA 4IIEA 1ZP4A 4A22A 6TAAA 4CQBA 4U3AA 4W5ZA 1G7UA 4UFIA 3WF2A 3E2RA 2WSQA 4B2DA 2NX1A 5HWJA 3GXNA