3PZUA

P212121 crystal form of the endo-1,4-beta-glucanase from bacillus subtilis 168
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
297
structure length
297
Chain Sequence
b'PVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Dissecting structure-function-stability relationships of a thermostable GH5-CBM3 cellulase from Bacillus subtilis 168.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 123
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzuA00
3ZJ6A 2F8QA 2GJXB 3VD3A 4HPHA 4OKDA 1W3JA 1CGYA 2OLHA 1DHKA 1UD6A 3GXFA 5DT5A 5JIPA 3WNKA 2J7EA 1CBGA 6TAAA 1BHGA 1WZKA 4JKLA 3S2CA 3QHOA 1WDPA 2RGMA 4ATLA 4Y7EA 2G4FA 4PEEA 3W53A 1E4LA 3MU7A 4OJYA 5EFDA 3VOCA 3WDJA 2XVGA 2AAAA 1X6NA 4JKKA 1GQKA 2QLYA 4GINA 3PZ9A 5ABEA 2VMFA 1QVBA 2VC9A 2BY2A 3MUIA 3TTQA 4GPNA 2WVVA 5I6SA 2O9PA 3A47A 4E4PA 1E73M 3AXXA 1EOKA 3TTOA 4WSJA 4C7FA 1MWOA 3KE0A 4RL3A 3K8LA 4PTXA 5BROA 4H8VA 3AOFA 3B9AA 1VBUA 2D23A 2UY5A 1WDQA 1MXDA 3GZAA 2D3NA 2G3NA 4RE3A 1E6NA 1UA7A 4KGJA 4MTVA 4AD1A 3EBVA 1UR0A 3K4DA 4NSBA 3NDYA 3F5LA 7CGTA 4PUDA 3SUSA 3U7BA 1OT2A 2OSYA 3L2MA 3N13A 1FHDA 1TVPA 4WK9A 2OSWA 2WMIB 4MB1A 4B3KA 2WCSA 2VZOA 2OYLA 3PZQA 3CZLA 2J7FA 2WM0A 1KXHA 5E09A 4XUYA 1E4IA 1GORA 3N17A 4M24A 2ZICA 4CD4A 1JNDA 3OIHA 3WELA 2VQUA 4MDOA 3N11A 5E6YA 4HU8A 2DQXA 4HP5A 3UEQA 2DSUA 4V2XA 4D1IA 1LWHA 5BXSA 4EK7A 3GXIA 3G6MA 3A6OA 2E4TA 2ZX6A 2BVDA 2DT0A 4PSRA 3W26A 5BWFA 4P7QA 4N0RA 1WDRA 3GNPA 4AZCA 1O7AA 1U30A 3WUGA 1P6WA 1CTNA 1XCXA 1DWGM 2E0PA 3DYPA 3SIMA 4YHGA 2WVVB 2D3LA 5A8PA 3A3HA 4MNKA 4GZIA 1PBGA 2Y2WA 1QI2A 2ZUMA 1BVZA 1K9EA 4LYQA 4BA0A 4HU0A 4W87A 1XSKA 1IV8A 3J7HA 5FOOA 1HJUA 5DO8A 1KWKA 2D2OA 1V02E 4GI6A 1E5JA 3GH4A 3WKZA 1B31A 2A3HA 3NJ3A 1ODZA 4ZENA 2BY3A 4IPNB 1E6QM 3GNOA 3DYOA 1W9DM 1QNOA 2W62A 4PSPA 3WD2A 2ZX5A 1MQPA 2Y8KA 5IHSA 4V27A 3TTYA 2WCGA 1KXQA 2J8GA 3KWXA 1PPIA 4JFTA 1JZ7A 1CEOA 2VCCA 4DM2A 2EPKX 2OWXA 1B9ZA 1E0WA 1CGUA 4M80A 1QBAA 4KGLA 1ZBCA 4AD0A 1ZJAA 3KL0A 4B15A 2Y8VA 3L4WA 4AZCB 4XX6A 5A6LA 4J28A 2OYKA 2BV9A 5ABGA 1NOFA 2J7BA 3WY1A 4P8XA 1UR4A 2EQDA 1E56A 3WDIA 2XSBA 2CITA 2DIJA 1ESWA 1UD5A 5A3HA 1XV8A 2D0FA 1SYTA 1JDDA 2VRKA 1LL7A 4P7LA 5A8MA 5DMYA 3DHUA 1PIFA 1UR9A 3M7SA 1VJZA 3GH5A 2E8ZA 5A69A 1FH9A 2BVYA 3DECA 3MV11 1UH3A 3CO4A 1UWQA 4D6DA 5BXRA 3IJ8A 2CESA 2ZIDA 4Z2JA 6A3HA 1NWTA 4ZE4A 3W82A 2XPKA 3MUZ1 3HMCA 1Q6EA 4UOZA 4JFWA 1V3LA 3IANA 1V0LA 4KH2A 4BQ4A 5CGMA 1JZ4A 4LYRA 1HKKA 3WBAA 3N18A 4RE4A 2A3EA 3W6MA 2O9RA 2GK1A 3EMZA 3PZNA 3NCOA 1FOBA 1U33A 3AMCA 3SUVA 3SCTA 1L8NA 5C70A 2X8RA 1WNOA 4GO9A 4AIUA 3AZRA 1E6XM 1AVAA 2GDUA 3AHTA 4PMQA 2OSXA 4X9YA 3T0AA 2IUZA 5M17A 1TMQA 4U2ZA 3WEMA 4W7WA 1ZBVA 1UYQA 3CUFA 1MYRA 3OGSA 2CBVA 3VM7A 3II1A 3W6LA 1EQPA 1GQIA 3L4UA 3AXIA 3VM5A 3SCRA 4TOQA 4ML4A 1JFXA 4W8AA 4WIWA 2J74A 3HU7A 3QHMA 1R86A 4PCSA 3A4XA 1H5VA 4MB3A 4A4AA 1D2KA 3AMKA 1H2JA 5AYBA 3AS3A 3GXDA 1KXVA 4JHZA 4YPJA 2V5DA 4D6GA 2VX6A 2NW0A 3PTKA 3I3DA 3OLEA 1JXJA 2WVUA 2WHJA 2XGIA 4MNMA 4D6EA 2GK1B 2DSWA 3WF2A 4LQ1A 4H8UA 3U5UA 3VDCA 1V6YA 5M3WA 2WMJA 2C0HA 3ARZA 2WMGA 4NZCA 1E40A 4QCEA 2C8NA 1UKOA 3SCPA 1GONA 1JDAA 1C7SA 2DSKA 3WNNA 2G3JA 1UZ1A 1RD6A 4MNLA 1MW3A 4Z2IA 1HNYA 3VD4A 1DWHM 3CPUA 2E9BA 5A95A 4EKJA 2YA2A 4JZ5A 1BYCA 3ARVA 3VIGA 3AIVA 2XUCA 3VNYA 1PX4A 3QGVA 2DSZA 2E8YA 1CECA 2WANA 3W25A 1EQCA 2XFYA 3EMQA 3W29A 5FCZA 1BG9A 2DT1A 3BMWA 1RP8A 4UZSA 3TTSA 4QCFA 4DWSA 1JYXA 4DM1A 6CGTA 2XHYA 1UWUA 2A3CA 2VT0A 2JALA 5D9NA 1A47A 3ZT6A 2D0GA 1H1NA 1H41A 4HPGA 1WZAA 3WDRA 1EHNA 4E8CA 1VENA 3NYDA 1GOIA 1CNVA 1H3GA 1Q6CA 1UD2A 3O2LA 4BQ2A 4PN2A 4CU8A 1CXIA 4W84A 5FD0A 4QLJA 4JFVA 1FFRA 1ISYA 3IJ7A 1PEZA 3N04A 2IXUA 4ACZA 4MAZA 5HDRA 3L4YA 4FF5A 3ARUA 3ZT7A 5I79A 3WH7A 5BYWA 4AD3A 3QHNA 3GDBA 2ZXQA 2BHUA 2HVMA 3K46A 3UG4A 2CBIA 3RM9A 3WNPA 4D6FA 1GHRA 4CU7A 2UY3A 1UWIA 1GQJA 1HL9A 2EBNA 1CLXA 2GJPA 1PIGA 5CGTA 1E4NA 1EHAA 5E6ZA 3B9EA 3O9NA 1W2PA 3JUGA 3RM8A 2ZUSA 1E15A 1MW1A 2J62A 3W4RA 3IAPA 1X1NA 4UFHA 1CXFA 5CG0A 4PMXA 4N42A 4W85A 4DWSB 1GOWA 1HKJA 3AYSA 5ABFB 1E55A 1V08A 3FW6A 3VIFA 3TONA 3WD0A 1I1XA 1HF6A 4R27A 1ISXA 1JZ6A 3WEOA 1ODUA 4OOZA 4AIOA 2W92A 2ZX7A 2XWEA 2JIWA 2VR4A 1KQYA 1JYVA 1ISZA 2XIIA 4GO8A 3VNZA 2XFRA 2BFGA 3ZO9A 4ACZB 4H04A 1DEDA 4P8VA 2YDSA 3WIJA 1BVNP 1WB0A 3CLWA 4GI9A 3AZTA 1WZLA 5A6SA 4GZEA 4WLCA 1V3JA 1E0XA 3AS1A 2VZTA 3OLGA 2QF8A 3AHZA 1L0PA 5GNYA 3IJ9A 5JBFA 3BAIA 3EDKA 4TVUA 3KL5A 1UKSA 1V6XA 1UOKA 1HJQA 2UY4A 4QFUA 2J7DA 4OUEA 2A3BA 3ZJ7A 2Y4SA 3ARPA 1NWRA 4ZE5A 4B3LA 1C8YA 5ECUA 5CXPA 1OIFA 4CCEA 1J0YA 5DFAA 1KQZA 1V6VA 3AHVA 2DDXA 2DIEA 1QI5A 1DTUA 1HJVA 3LPGA 4HTYA 4AC1X 1E3ZA 3FAWA 3VIOA 3CHFA 5I77A 4UNIA 3SUWA 2ZWZA 2XSAA 1V3HA 2YIHA 2XGBA 1R7OA 3VDHA 2WBGA 1JF5A 2VX5A 3RJYA 1LJYA 2HISA 1H11A 1UR8A 3EDEA 1C92A 1I1WA 4YN5A 3MSDA 2YA0A 3UG5A 3UESA 1XH0A 3POCA 3FNDA 3OLDA 5E0FA 1JD9A 2CIPA 4AD2A 3WDHA 5D9PA 1CIUA 3AYRA 1BYDA 1B2YA 5I24A 1BQCA 1XD1A 1QPKA 2ZUNA 4S3KA 2E40A 1TCMA 4H41A 1J0HA 1JYWA 4UFKA 5CPTA 3FN9A 2JIEA 4PMZA 1CLVA 4FLOA 5GPRA 1VIWA 4M56A 1JXKA 1HXJA 5EFFA 1E5NA 3M07A 3VDBA 1J0KA 1QNSA 3B9DA 3ZR6A 2X09A 4CN6A 2OYMA 3WF0A 5A6AA 3LPFA 3AS2A 3NIYA 4XV0A 3ZOAA 3VPLA 1HJSA 2WZHA 2XTKA 3ZMRA 1GOMA 3RCNA 1CXLA 2EO7A 3EDDA 1OGGA 2J7CA 3HN3A 2WZEA 3ECQA 3WQ4A 3BLPX 1W9UA 3IK2A 1J11A 4PMDA 3WL1A 3THDA 2V3DA 1UH4A 3TP4A 3QR3A 3QOKA 1E9LA 2E9LA 1E4MM 1ZS2A 4GQRA 3WN6A 4AY1A 4WKFA 4DUWA 1PZ2A 1W3KA 1HX0A 1MFVA 3N1AA 4KRTA 3PZOA 1TFVA 1UWRA 4CD8A 2CKRA 3WNOA 5I2UA 4D72A 3EDJA 1Q6DA 1KBBA 3W37A 2YL9A 4J3WA 2QMKA 1GHSA 1GW1A 2JE8A 1H4PA 5JUVA 1HL8A 2X1IA 1VF8A 1W3LA 1CXEA 4AISA 2OWCA 1CDGA 3T2PA 4AEFA 2J78A 2CYGA 1R8LA 1V03A 4F8XA 3VINA 3VX1A 5CSUA 3KZSA 1LWJA 4Q22A 2CBJA 2NSXA 1V6WA 2WC4A 5A6BD 1R85A 3L4VA 3NUKA 4MAVA 3VD7A 3WD1A 2YDQA 2XVNA 3VDAA 2WMHA 5CSYA 3VMNA 4HOXA 3AROA 2WVSA 1EH9A 4D1JA 1JYNA 1HKMA 5DT7A 1RH9A 5AYIA 3WSUA 1MXGA 1FA2A 4P7OA 1EA9C 4H2CA 3AIQA 1IZKA 1V3KA 4EE9A 1OD8A 4UQCA 2FDMA 1KGWA 3LMYA 2CETA 1M04A 4W5ZA 2VVNA 2W66A 4KMQA 4CUCA 1WO2A 2YKKA 4CN1A 1G0CA 4GZJA 4PMYA 1XD0A 1R87A 1VAHA 1GOOA 3WH8A 4W8BA 1UG6A 3BC9A 3PBGA 3OB8A 4ATDA 2EXOA 3AXHA 3NDZA 4MDPA 4UQ9A 3AIEA 2V5CA 3T09A 1JNEA 4AZIA 2ESCA 3PZUA 2BS9A 5CJ5A 3SUUA 2DPEA 2DT3A 5I0DA 1H0IA 3VD9A 2PWGA 4BS0A 2G3IA 1GVYA 4NF7A 4BZYA 4CD5A 4CU6A 2DT2A 1H0GA 3VU2A 2V3GA 2XG9A 3BMVA 1JD7A 3TOPA 4UQBA 1J0JA 1E1FA 1H09A 3VGDA 3ARQA 3CH9A 5I23A 1US3A 3N9KA 2AMGA 2D22A 5A2AA 3KL3A 3M46A 4BQ5A 4EAMA 4KRUA 2VQTA 4U5KA 5A2BA 3WF1A 3APGA 4DWSC 4HMDA 2VRQA 2WYSA 4AZ6A 4UFLA 3AISA 1OD0A 1ZB5A 1UHVA 2E3ZA 3SUTA 3ALFA 1PJ9A 3GYCA 2V38A 1MW0A 1JGIA 1TA3A 1FH7A 4JFSA 1LQ0A 3BH4A 1GUVA 3SCUA 1QNQA 3CZKA 2X0YA 3CMJA 4QP0A 2WXDM 1B3YA 2BVTA 1WE5A 4E2OA 1QI4A 3AICA 1Q6FA 4W7UA 1XYFA 1K6AA 4JL2A 2CBUA 2QMJA 3OZOA 1CZ1A 3ARRA 5D8WA 3WEZA 2D0HA 1MVYA 1FP9A 1NM9A 4OIFA 3AMGA 2WWCA 4AD5A 1W9VA 3ZSTA 1DWJM 1JZ2A 4TTGA 4CCCA 4OBSA 2VZSA 4AZBA 1K9DA 1J18A 4AD4A 3CUHA 3W81A 4B9YA 1OGBA 4ATWA 1C7TA 4J3UA 4CD6A 3DHPA 1B1YA 2CPUA 3ZM8A 4X0VA 1TE1A 1YHTA 4W8LA 2W5FA 3WL0A 5A6JA 4HZ7A 3F5KA 4Z2LA 1HT6A 3CZ8A 1OINA 1XSIA 4AWEA 1E6SM 2XJ7A 1JIBA 4HMEA 2CKSA 2ZX8A 4M8UA 1NP2A 1KGUA 2NT1A 7A3HA 3VMPA 2WWDA 1E6RA 1HP5A 2O9OA 4YHEA 1XC6A 2VCBA 5JBDA 3VILA 3WDQA 1JL8A 3WQWA 4JL1A 2XM1A 4CKQA 4WF7A 2VUYA 4JHOA 3BAKA 2ZOXA 3W38A 3VD5A 2VZVA 2F2HA 4UTFA 2JEQA 4PTVA 3VKKA 5BCAA 1XCWA 2WC7A 4TX8A 3MSGA 5EMYA 1UQZA 2CEQA 5CLWA 2BHYA 2WW5A 2XVKA 3VGGA 3WENA 1GOQA 3U7VA 1MW2A 1GZJA 3I3EA 5I5RA 4BCEA 2FGZA 3TA9A 4A3YA 3MANA 1MQQA 1DP0A 3RM4A 2YLLA 4LXFA 4W7VA 1GQLA 2FHCA 3BAXA 3PTMA 5A2CA 1UUQA 5D9OA 1OCQA 3ZR5A 1W1TA 1BF2A 1BYAA 4UFIA 3ARTA 5HPOA 2PWDA 1KFWA 3SCNA 4LGXA 3PN8A 2WLZA 3O6AA 4HOWA 1GJUA 3BAYA 3CHCA 3THCA 3OGRA 4GIAA 2BNJA 5EB8A 5CLTA 2ZUTA 3UETA 1ITXA 3WH6A 4J7RA 2XWDA 1XH2A 4PCTA 1O6IA 1D7FA 1XRVA 4UOJA 1ISWA 3VO0A 2VR5A 8A3HA 1G1YA 1NH6A 4UR9A 4W86A 1QW8A 2VURA 1Y7VA 1TVNA 3L4TA 5D9MA 1CWYA 5IDIA 4U31A 1H49A 3GBEA 1J12A 3AIRA 3M6DA 4HA3A 4JCLA 4P8WA 1LLOA 1I75A 2DH3A 2EPLX 1OIMA 2YJQA 3ARSA 2Y5EA 3VVGA 3IAQA 1JI1A 2W4XA 1EDQA 3RIKA 2Z1SA 2BXYA 4QLLA 1GCYA 1W9XA 3VGEA 4CD7A 4URIA 2QPUA 5C71A 1V02A 5GNZA 4PYSA 4JIEA 1KWGA 2D24A 2DEPA 1QI0A 2XVPA 5JIWA 3ZSSA 4OZOA 3F4VA 2J25A 3L2LA 1HJXA 5E9AA 3K1DA 2YL5A 1U2YA 1A3HA 3PZTA 3RMEA 3A4WA 1VB9A 2A3AA 2EEXA 3CUJA 4UFJA 4AZ7A 4A3HA 1FP8A 3K8MA 3SCVA 1JDCA 1WDSA 1KGXA 1HVXA 2JFEX 2V3EA 1GPFA 4DUVA 3OLIA 2PWEA 3VIHA 5F7UA 5IFTA 5BXPA 5FIPA 3I3BA 3OBAA 5A8QA 2VOTA 3AJ7A 3BAJA 2CCRA 1JFHA 1HVQA 3PHAA 3VTRA 1GOKA 1R7AA 4M81A 5IHRA 4Z2HA 3POHA 2WHKA 5I78A 4MB5A 2OWWA 4M29A 2PWFA 7TAAA 2TAAA 2BY0A 3MS8A 4PTWA 3QOMA 3VUPA 3AI0A 1US2A 4UCFA 1WP6A 1UKPA 1E3XA 1BPLB 3RPMA 3MMDA 1EIBA 2FHFA 2ZWYA 4D6IA 1D3CA 1VJSA 1NP0A 3AHXA 3ZIZA 5M03A 5LA1A 3CUGA 1GNXA 3WQVA 1NOUA 1CGVA 2O92A 3ZJKA 2J8FA 4ZXOA 2JEPA 4TVCA 3CTTA 3T0DA 4RE2A 2WVTA 3RO8A 1KB3A 2F61A 4HZ6A 2Z1KA 1JF6A 4HZ8A 2B31A 1E1EA 2ZE0A 4CGTA 1BLIA 1VFUA 1BFNA 1S46A 4P7RA 1N82A 4E8DA 4CVUA 3EDFA 1HIZA 2PI6A 1EO7A 3UR7A 4UOQA 3W27A 3VGHA 1C8XA 2VX7A 2AOSA 3CBWA 2J7HA 5KZ6A 4JAWA 4FLSA 4U3AA 2X05A 2J75A 4MADA 1V0NA 5IXEA 2BHZA 5AC5A 2VO5A 5GQBA 1Q4NX 3AMDA 3FY1A 3FHQA 4AZ5A 1B3VA 4KWUA 1FFQA 2ZUWA 3AQUA 4DUXA 3CIVA 9CGTA 5BRQA 1VFFA 1ECEA 4HA1A 4JFUA 5CZKA 3VX0A 4QLKA 1M53A 1ITCA 3WUEA 3PZGA 4H7VA 4GQQA 3BCDA 5FL0A 1W1VA 2UWFA 1BGGA 1OSEA 2PWHA 3B8SA 3N12A 3MV01 1AQHA 3SCSA 3WUBA 3A4AA 2FGLA 4P8UA 4CN4A 3PZVA 1EDGA 5I3DA 2XVLA 3GXMA 1K9FA 4UFMA 3CUIA 3KEHA 1VEOA 1W2VA 2VVSA 1TUXA 5GNXA 3WF3A 4HA4A 1LL4A 2WHLA 3VGFA 3CHDA 3WMBA 1QBBA 4MB4A 2PB1A 4MJ2A 2PBGA 1CPUA 2CHOA 1DWFM 1UQYA 1XYZA 4UZUA 4TUFA 1KCLA 4J3SA 1MFUA 1PZ3A 2WPGA 3UG3A 1JZ5A 4V28A 2BXZA 4BQ3A 3BSHA 4WKAA 1Z32X 4PBGA 3AMLA 2WSPA 5ABHA 1NWUA 1DWIM 2C7FA 2WK2A 3BGAA 8CGTA 1UWSA 1KCKA 1UD3A 1SR0A 1WKYA 5M5DA 3MUAA 1OGSA 1PX3A 1JG9A 3D5HA 3ZT5A 5HXMA 4PMVA 2GJRA 1JAEA 2VX4A 3WDPP 3RDKA 4HOZA 1WAWA 4IISA 1C91A 5A6BA 3PZIA 1QNPA 1W32A 2WMKA 1KBKA 4J3TA 4FMVA 2UY2A 3GM8A 3U5YA 2EPNA 1HP4A 2YBUA 5JBEA 3UERA 3VIIA 2XYLA 3CMGA 5A6MA 1NARA 2J4GA 3G6LA 2WC3A 5HNNA 2Y24A 2BY1A 2G3MA 1W1PA 1WPCA 4OOUA 1E6PA 1M7XA 3ARYA 1G94A 1QHPA 3VIKA 2MANA 2ZXBA 1LG2A 1QNRA 3BXWA 1F4AA 4C7GA 2VRJA 4UQEA 3SCOA 5DF0A 3LPPA 3VIMA 2YBTA 5HBFA 2W67A 4L4PA 1W3HA 1V0MA 4GI8A 3WF4A 1BGAA 2VL4A 1CGWA 4L4OA 4Q7NA 4UQAA 3MUY1 2GFTA 1OBAA 4J3XA 3AIUA 1BG4A 3ZQ9A 2ZUUA 1JZ8A 2CHNA 4WSKA 2JF7A 5E0CA 4F66A 3VIJA 3D3AA 2CNCA 4UQDA 1EOMA 3NSMA 3FAXA 1J01A 1MQRA 3GTNA 4HMCA 4NI3A 1SFSA 2WKLA 5DEZA 3WQ5A 5EBAA 4NRSA 3T2QA 2YL8A 2QPSA 4K68A 1B30A 2WB5A 1ZJBA 4CVWA 5CPQA 3K4AA 2V3FA 2D20A 1UKTA 5A8NA 3OGVA 1Q6GA 2CXGA 1CGTA 1NOWA 4PMOA 2VCAA 3SCQA 1UR2A 2ZUVA 4M1RA 1LG1A 1IT0A 4MNJA 2WZIA 4QAWA 1E43A 2GDVA 2IXVA 3MMWA 4PMRA 1EXPA 3UR8A 4LPCA 2PC8A 2W91A 3WNMA 1VEMA 1ISVA 4MPKA 4IPLA 3WBEA 2GSJA 3WQ8A 3WMCA 4D6HA 1BYBA 1UWTA 1B0IA 5FKYA 4W5UA 2JF6A 4QDMA 1OB0A 4CCDA 1B90A 2DGAA 1VFMA 2E9MA 4AEEA 5AY7A 1G5AA 1F4HA 3CZEA 1BTCA 3W24A 4AZGA 5TD4A 1UKQA 3N15A 1TZ7A 2G8ZA 2YL6A 1JI2A 3AS0A 3F5JA 1NWSA 5D4YA 3BSGA 3MMUA 4U5IA 1V0KA 2X0HA 2J77A 1W9BM 5A8OA 2FH8A 3VGBA 4JCMA 1UR1A 4D71A 1E0VA 4LX4A 3WQ6A 1M01A 2WSKA 3NSNA 4ACYA 2VI0A 4S3JA 1BSIA 2O9TA 4JKMA 2FHBA 3CHEA 1W1YA 2ZXAA 1J0IA 3LPOA 2VNCA 5CQ1A 4J3VA 1IZJA 3EMCA 3NSXA 1NQ6A 3WD3A 1HN1A 1TA3B 3DC0A 3VMOA 3AIWA 1B3WA 1UD4A 2DH2A 3BAWA 2WMFA 3WNLA 4X0NA 2J47A 3UCQA 2YDRA 3BLKA 2ZXDA 1WZMA 4TVDA 1KXTA 4AYSA 1TR1A 1B3ZA 3AZSA 4ZEPA 5LA0A 1KR1A 1QW9A 4F9JA 3FHAA 2WBKA 2PBOA 2VTFA 3T08A 1YQ2A 3RJXA 4WJXA 4MJ4A 2Q8XA 2RGLA 4M82A 4U2YA 2EPMX 4GXPA 1FHLA 2WHMA 2CERA 4F79A 1VRXA 3BCFA 1C90A 1QI3A 3L4XA 3RILA 4TXEA 1GJWA 3ARWA 5A94A 1OM0A 4U33A 4C7DA 4DWSD 3SEPA 1XSJA 5BXTA 5ABFA 1PX8A 1UD8A 2EJ1A 3WUFA 2VJXA 1V3IA 1AQMA 1J10A 5LYRA 3T0BA 3GNRA 1EO5A 5HPCA 3OZPA 1BAGA 5D8ZA 4AMCA 4LYPA 1TG7A 1RP9A 1OWQA 4D6CA 1E6ZA 2YLAA 2GVYA 5LA2A 4U3CA 2PF0A 1CENA 3SURA 1W91A 4XZBA 2QHAA 2WAGA 3E1F1 2QV4A 3AHYA 1AMYA 4B16A 4FLQA 1OT1A 3WMSA 3AFBA 3WH9A 1EDTA 1C3FA 1KR0A 3PZMA 5CPSA 1FH8A 3HJEA 5A6KA 4B9ZA 4XB3A 1UA3A 4EANA 5C8BB 1QOXA 3WD4A 3GH7A 2W63A 1CXHA 1UH2A 2DSVA 2XM2A 5HOSA 4GKLA 1E70M 2X2YA 2J7GA 2J79A 1AQ0A 3K8KA 4XZWA 1HJWA 1E72M 3DYMA 1WCGA 3CZGA 3CGTA 3VIPA 3T2OA 4NRRA 3U57A 2WKGA 1SMDA 1XGZA 2NT0A 2XIBA 4H8HA 2GJXA 2D1ZA 4WKHA 3S6TA 1QHOA 5IFPA 3WFLA 1HKIA 1C93A 1SMAA 3ARXA 3MKKA 4F9DA 4PTMA 1ZBWA 1VFOA 1VEPA 1X6LA 4W89A 4FK9A 2YOCA 3OG2A 3SCWA 3CZJA 4AZHA 1ZL1A 4P7NA 2G41A 1J9YA 2WNWA 5KEZA 2XFFA 1CXKA 1ZBKA 3W0KA 5E70A 4PUEA 4W93A 1VBRA 1W9PA 4Z2KA 3OA5A 4TX6A 3AIBA 1LF1A 3MO4A 1PAMA 1RPKA 4PRWA 1G01A 2WLYA 1XHGA 2W61A 3EYPA 4R5EA 1CYGA 5FL1A 4ZFMA 1M03A 3FXYA 3PTQA 2FH6A 4D6JA 2EPOA 5AC4A 4FLRA 1EGZA 4IM4A 1UZ4A 1XH1A 5BRPA 1CGXA 4TTUA 1C8QA 4W88A 1G9HA 4IUGA 1DWAM 1LL6A 1B3XA 4PMUA 2WCAA 1V6UA 4AXNA 1QHZA 4PMNA 3ZJ8A 1JZ3A 2GUYA 2VZUA 2ZX9A 5A1AA 1ZU8A 4J27A 4AW7A 2YA1A 4AIEA 1K9TA 3WFZA 4BF7A 4Z2GA 3GBDA 1GVIA 2WMIA 1V3MA 1E71M 3L4ZA 1J0ZA 1JAKA 3W28A 3ALGA 3WH5A 4OBRA 4ZXLA
chains in the Genus database with same CATH superfamily
1S2TA 4OKDA 1W3JA 1DHKA 1UD6A 3I65A 4PUWA 2YYTA 5JIPA 1UMYA 2AKZA 4FNRA 3H24A 4GVGA 3ES8A 2HDJA 3MVIA 3WDJA 3N2XA 2XVGA 1X6NA 4JKKA 2QLYA 3EWDA 2VC9A 5J5RA 3TTQA 4DNMA 4GPNA 3LD5A 2WVVA 1RY8A 4AB4A 2PP3A 4E4PA 3HZ3A 1H7OA 4FA3A 1EOKA 2DZSA 4C7FA 4LNYA 1GPWA 1VBUA 5HWMA 5H6HA 4MKVA 3K1GA 2AAMA 1E6NA 4FAMA 3AUOA 1UR0A 1SVDA 4NSBA 3GFXA 4NJIA 2DW6A 3N13A 1GVRA 4G6CA 4IL0A 3VOIA 3HQOA 1JPIA 1TVPA 1CT5A 2OSWA 4MB1A 3DFHA 1Z89A 2PDFA 4I3GA 2OYLA 3PZQA 4YCOA 1I2OA 3KTCA 4NL1A 4E3VA 1E4IA 1GORA 3KXQA 3N17A 2C1GA 3A5VA 4M24A 3OIHA 5EGRA 3WELA 3SIZA 3N11A 2OOGA 3P81A 4HU8A 2DQXA 5FAGA 2ZRUA 3B03A 3R10A 3ERPA 4AUBA 5DY3A 3SRKA 4NX0A 2QAFA 2E4TA 3W02A 2ADAA 4QJ3B 2WZMA 4LH8A 1BKHA 1XCXA 2E0PA 4YHGA 5A8PA 3T9PA 4BFAA 3N6QA 1K9EA 2CZFA 4H2HA 3CL7A 3VE9A 2XGZA 4LYQA 4HU4A 4W87A 5DANA 3DIPA 3EXSA 3NQBA 5DO8A 4DF1A 4GI6A 1E5JA 2YFOA 3ELFA 4PB5A 1B31A 3VOFA 2VOMA 3NJ3A 3TW6A 3LCHA 3URBA 4GLEA 1IYXA 1EJUC 4YTSA 3PUOA 1W9DM 2DFAA 2W62A 3KDOA 4PSPA 5C2XA 1UC4A 3BSMA 1UUMA 4HPNA 3H7VA 2QJHA 4L80A 5IHSA 2WCGA 1PPIA 4JFTA 1BXNA 1AH0A 1RZMA 1V51A 4JQ1A 2G0WA 2V2HA 1XJBA 2EG8A 1B9ZA 3LI1A 2Q3OA 2PGEA 3DXIA 3QY8A 4M80A 3GC5A 5D03A 1ZBCA 4GUHA 3RR4A 1A49A 1J8VA 2Z27A 3BCJA 3SBFA 3R7MA 2QCFA 1SO3A 3F1QA 5ABGA 1A4MA 2J7BA 3DAQA 4P8XA 4DLFA 3WBXA 4FXRA 1W0MA 1VLIA 2EQDA 1E56A 3VKDA 5DRIA 2W3ZA 3O6DA 3GAKA 3PK7A 2DIJA 1PYMA 2E5DA 3EPMA 1RV8A 2EHHA 4MFDA 1IEQA 2ZZ1A 2HVOA 2VRKA 4P7LA 1FHVA 1M7PA 1K77A 1VJZA 1XWYA 4H9ZA 5CGQA 4AC7C 2E8ZA 4JN8A 1KRAC 1TX0A 3UR2A 5HQMA 1NWTA 1QATA 2WSYA 4YJ5A 3W82A 2GVJA 3MUZ1 1Q6EA 1XBXA 4RZ6A 4XZ9A 4F2TA 1YE6A 3IANA 3PTDA 2H9AB 1DJXA 1OQFA 4LYRA 1HKKA 2AQOA 3N18A 1WOAA 3T81A 3O8AA 3L0NA 2P3EA 3WJYA 4O17A 1MUCA 4A2SA 1U33A 2VYOA 4PFHA 1A50A 3LQLA 4GXMA 3ATYA 1ICQA 3T1GA 4C6BA 2GDUA 3VYLA 3B97A 3T0AA 5F1VA 2X16A 5BNKA 3KVJA 4J35A 1ZENA 1UYQA 3HG5A 3LM7A 4KWVA 4PBFA 2P8BA 2PS2A 3G77A 4POCA 3W6LA 4ZR8A 7REQA 4NZ4A 1R3SA 3D46A 3VNKA 3IVTA 4WIWA 3ZS4A 3TMQA 3HU7A 2YCLB 1IZCA 3N6HA 2KAUC 4PCSA 3R8HA 1TKKA 5AYBA 3TSDA 4D6GA 2TMDA 3I3DA 2AQVA 1JXJA 2WVUA 3PUDA 3SN1A 2WHJA 4D6EA 3TSMA 2OU4A 2ZZ2A 3VDCA 1XISA 1SFLA 5M3WA 4A21A 1A0CA 4I7VA 1PYFA 1S5WA 4JTQA 3ARZA 1GQNA 4JD4A 1G4SA 2OLAA 3N3MA 1I2QA 2Z2AA 3SN4A 2C8NA 1UKOA 2OGYA 3SCPA 3BGGA 3BPWA 4XZLX 1JDAA 3H4XA 3WYZA 4AX7A 3UW6A 1UZ1A 3EX4A 4EIVA 2AMXA 2V63A 4Z2IA 4JZ5A 1JCNA 1RLDA 1OEPA 4LBRA 3MVTA 2DZWA 1XICA 2E8YA 1CECA 3ANYA 6TIMA 3MWCA 1ECQA 2GSEA 3DG6A 3W29A 3FDKA 2DT1A 3I10A 4DWSA 1JYXA 4DM1A 2INZA 3CMFA 6CGTA 4ERGA 2VT0A 1VBHA 4XO6A 2JALA 5C7VA 3O6CA 2D0GA 1VFLA 2V5JA 4HPGA 1WZAA 1S3TC 1EHNA 1PTAA 3WDRA 1JQVA 1CNVA 2BG5A 1MI3A 1XIIA 3E49A 1AH4A 4HSOA 5FD0A 4QLJA 3P67A 4A35A 3N04A 2IXUA 3TYDA 3G0XA 1N8IA 3L4YA 3WH7A 3SJ3A 3M6YA 3PFRA 4QQUA 3L67A 3GDBA 3WLOA 2HVMA 3MDWA 3K46A 4GVFA 1YNQA 3UG4A 3BK0A 3RM9A 3WNPA 4D6FA 2YB4A 3UJSA 5CPNA 2UY3A 3UR5A 1HL9A 5H1WA 2GJPA 1PIGA 1XLLA 1W5MA 1W2PA 1E15A 1MW1A 2Y89A 2EAWA 2Z6JA 2X40A 4O10A 4C6JA 4GNVA 4DO5A 1AH3A 3B4UA 3NQ8A 3RLUA 3QPEA 3AYSA 5I09A 2F38A 1FRBA 4RNFA 3JVAA 3Q94A 5HNRA 2ACRA 3GVWA 4XAYA 1HF6A 1UIPA 2IQDA 4B90A 1ODUA 2XWEA 2Q09A 2HNEA 3U6WA 1ISZA 3TN3A 4H04A 1XIJA 2O7QA 2PZNA 4P8VA 4ZB2A 1BVNP 4UTIA 3RX2A 1R3WA 3O16A 4IIHA 5REQA 1U5VA 2VZTA 2JKPA 3OLGA 4JNMA 2W9MA 4IMAA 1P0KA 3BAIA 3EDKA 4NJHA 1F8MA 1TR9A 4ERAA 4Q8MA 1QPRA 2QJGA 4QSHA 5BOEA 3PBUA 3RN6A 1YTKA 1C8YA 3GG1A 1SW7A 5FJUA 3GNNA 3LGGA 1OIFA 1J0YA 3WMLA 4QTGA 1KQZA 3UF9A 1LRTA 3C0SA 2DIEA 3JR2A 5EA9A 1HJVA 4AC1X 3GY1A 1POKA 3FAWA 3HG4A 3VIOA 3VKAA 3ZLHA 3CHFA 4UNIA 4X3ZA 3SUWA 2PDXA 2QW5A 5HINA 1V3HA 4QITA 1QT1A 1R7OA 4DPQA 1HGYA 2VX5A 1LJYA 4LUTA 3PWGA 1KM3A 2PSNA 4W9TA 4MMWA 1VCFA 4GY0A 3UG5A 1XH0A 3POCA 1UZDA 3N9SA 1U1JA 1VBJA 4ZCWA 5G4EA 1JEZA 3ID7A 1CB2A 1BYDA 1B3OA 3GU1A 3MCOA 4FX8A 1XD1A 2RJHA 2ZUNA 3G1XA 1TCMA 1J0HA 4OGZA 3UD6A 1P5BA 1JYWA 3DBPA 3KBJA 1HL2A 2WSRA 3DBNA 4RUBA 4FLOA 5IOBA 3CV7A 4ZO8A 3SJNA 4Y90A 4N9BA 1ME7A 3ZR6A 2X09A 4CN6A 3WF0A 1FWBC 3OEXA 3EOUA 2WZHA 2EO7A 3EDDA 5TNVA 4GQGA 1S5VA 5AHMA 4G1KA 2WZEA 4C6EA 4DI9A 3IK2A 1J11A 1AK5A 1KTBA 4CEUC 4C65A 1IT8A 1F61A 1K8XA 2E9LA 3IGHX 1E4MM 4GQRA 5DBUA 1PCKA 3G0UA 3ITOA 5TAOA 4H00A 2AQWA 4F0HA 3C0QA 4L5ZA 1TQXA 2JBMA 1MFVA 4XD3A 4HYVA 3KOZA 1ZLPA 2E5BA 3N1AA 4UUIA 2B7PA 2ZTKA 1NDZA 1GTHA 1O5XA 4JY8A 2JKEA 4H9VA 1KBBA 4LF2A 4O1DA 2DZPA 4ORMA 4KCVA 3STGA 3R58A 4QJ4B 4HNVA 2PWUA 3RK8A 2HCVA 3TH6A 4H3DA 4AEFA 1FWNA 3VINA 1W17A 5DMMA 3MWAA 1G69A 1IR1A 1NDWA 4IIEA 2Z2UA 1LWJA 3EWUA 4Q22A 4QSFA 2NSXA 1R85A 4JN6A 4MLRA 4IFRA 1REQB 5CZ0A 3VD7A 3WD1A 2IPGA 2YDQA 1KKOA 4LSBA 4RV8A 1RR2A 3VMNA 4HOXA 2WVSA 1EH9A 5HWNA 4JN7A 1JYNA 3UYIA 4IH3A 1EA9C 1SW3A 1EPXA 1K7EA 4UQCA 3S5OA 5LSMA 1SFJA 3CUZA 2PDLA 3LMYA 1M04A 2A4AA 4W5ZA 2BZNA 2OQLA 4RW5A 5M2FX 4KMQA 5KZEA 1T5AA 2YKKA 4C6IA 3W2UA 3LRMA 3KBNA 1S5MA 2NV2A 4LF1A 4MJMA 4W8BA 5KSWA 3N4FA 4EP8C 3S46A 4ATDA 3TA6A 3NDZA 2OJPA 1JNEA 4AZIA 2BS9A 1OK4A 1TTQA 1X39A 2EG6A 4EF9A 4QEEA 2OB3A 4ZZ9A 4AY8A 2R8WA 3TU9A 3VD9A 1K02A 4ZQRA 4R9XA 1VFSA 2DT2A 1H0GA 2Y1HA 4HBKA 3HQPA 4ZODA 4N02A 3H21A 1JD7A 1OX6A 1J0JA 1AQFA 4XZIA 1E1FA 1JDFA 2XN2A 4C5YA 1H09A 3VGDA 4KERA 4ILSA 1US3A 5I23A 3N9KA 3PWIA 4NNBA 4X9SA 5A2AA 1ZRQA 4GMEA 4KRUA 4Z1CA 3U4FA 1WKEA 2FTWA 4MZ1A 5AKQA 4Q8WA 3BW4A 1XPGA 1FKXA 5AZ1A 1W5NA 3ALFA 2V38A 2I1OA 1VPXA 2BGQA 1JGIA 1I45A 1FH7A 4MFEA 3KOWA 1XC4A 1AW1A 4R7OA 1QNQA 4JYDA 3NO5A 3WX7A 3BZJA 1WE5A 1A5BA 4UTHA 3AICA 4INFA 1WBHA 5CJNA 1XYFA 4HJFA 2QMJA 4XK2A 3SB0A 2PLKA 1D8CA 3WEZA 4H6KA 2PTDA 4OIFA 1GKQA 1W3TA 2Z7KA 3RG6A 2XU2A 3W7NA 2XISA 3EX3A 3ZSTA 3TV8A 4LAZA 1X6UA 4HHLA 1J18A 4AD4A 1LT8A 4F40A 1OGBA 3OYXA 4ATWA 2SFPA 3ANUA 4S3EA 3P93A 3M0LA 3WLSA 1QOPA 2W5FA 4XIMA 5A6JA 1JJKA 1K6WA 1OINA 4XBKA 3SQSA 4HMEA 1KLYA 3C86A 4M8UA 4YU1A 1R5YA 7A3HA 4ZO7A 3LENA 4XVDA 3H2EA 5EMLA 2WWDA 1VBGA 4FXSA 4GYJA 4BKNA 4NVTA 5CSRA 1GJPA 1QMLA 1VYSX 5T9BG 3VILA 2OT0A 1PV8A 5D05A 3RLHA 1SJAA 1B5TA 2ZOXA 1YEYA 1XYCA 3QY6A 4OU1A 4XAZA 2JEQA 1VJIA 3RHGA 1XCWA 3R11A 1JCXA 3QZ6A 5EMYA 2BP1A 3NR0A 1FDZA 2Z0IA 3VOHA 2CEQA 5CLWA 4QDPA 4RNJA 4NXKA 1SO4A 3TQVA 4RX0A 3H2NA 1GZJA 4B2DA 5I5RA 4KFOA 4B2DD 3QW3A 4DF2A 3MMTA 2FPTA 2OX4A 1MQQA 3GG7A 4O8RA 2FFCA 2C19A 1RQHA 3NOYA 1Q6QA 1OCQA 1BF2A 2QJJA 4EF8A 3ARTA 5HPOA 4O1EA 4LGXA 3IJ6A 5JVLA 2WLZA 1UASA 4M6VA 4GRSA 4GIAA 1KV8A 3UETA 2PDKA 4RK8A 2ZADA 1Y5WA 4PCTA 1JUKA 4E2BA 2QCMA 4QX4A 4E2VA 4AHPA 1XRVA 3W7EA 1ISWA 2VR5A 1G1YA 1AJ2A 1J6OA 4PRRA 5DMLA 1QW8A 2VURA 4AHQA 2AL2B 4GYKA 1CWYA 3CQKA 1FWDC 2DVTA 3KCOA 5FF0A 3DEQA 2ABAA 3AIRA 2PP0A 4IFKA 1I75A 2DH3A 2FDSA 3NZQA 3RCMA 4B92A 1S1PA 5HJYA 4Y6GA 4Q4PA 5F2GA 2V5LA 1OFQA 4KFNA 2P8CA 4I5UA 5FEXA 1V02A 5HQLA 4L7ZA 1EF2A 1IEIA 2D24A 1H51A 4O57A 3ZWTA 5TBOA 3F7JA 2E5CA 2J25A 1QPNA 1JDEA 1AFSA 3UVIA 3P84A 3A4WA 1Q66A 4OQVA 3CUJA 1EA0A 4AZ7A 1FP8A 1KFBA 1UCWA 3BZGA 2JFEX 1YMYA 5BXPA 5FIPA 3D0CA 3OBAA 4Z17A 3NZ1A 5C9RA 5C5YA 3CYVA 4A8RA 1R7AA 2XH0A 5IHRA 4PA8A 1Z3NA 3M0YA 3POHA 2WOQA 3GYEA 3R89A 2G3FA 3I4EA 3PULA 5FESA 3E0WA 2QEZA 1A5LC 1LLZA 4HK5A 3QOMA 4Z1YA 2JGQA 2VENA 1TJPA 5I3KA 1UKPA 3GFZA 1E3XA 4ZA0A 2H8ZA 4WCJA 3EWCA 1VJSA 4WRHA 2AL1A 5J5DA 2CZVA 3PVFA 4JGDA 3V36A 1W1B1 3ZJKA 4ZXOA 3T0DA 3W7MA 1TV7A 1M1BA 3EKLA 1YBQA 4K1WA 1WA3A 3O6YX 1ONEA 4AEOA 3B8UA 1H1ZA 3CAWA 4ZB5A 4KQNA 2CZEA 4C1KA 5REQB 2ZE0A 2JGYA 4P7RA 4CVUA 3EDFA 1HIZA 1EP2A 2PI6A 1EO7A 3UR7A 2BLEA 1C8XA 2UBPC 1E9YB 1WXJA 2J7HA 3TVAA 1FWHC 4JAWA 1FQ0A 2X05A 4ZO6A 1V0NA 2IS7A 3OYZA 3CEPA 3V3WA 1HQTA 1GYMA 1DYSA 5GQBA 1VH7A 3FY1A 1B3VA 3KZPA 4KWUA 1FFQA 4M6UA 9CGTA 3NXLA 2XN0A 1KFEA 3LQGA 2BVWA 3VX0A 2NV9A 5G2HA 1M53A 2Z28A 1ITCA 2X1SA 3R5EA 1MMFA 4H7VA 3BCDA 4IGSA 2ZVRA 4UNLA 3IIOA 1R9XA 3WUBA 3IARA 1OY0A 3MCNA 1DE5A 3S2JA 3GXMA 4UFMA 4LFYA 1GTEA 1W2VA 1EJTC 1TUXA 4IP7A 3KBMA 5AC8A 2WHLA 3CHDA 4S39A 1QBBA 4MJ2A 1DWFM 4C6NA 1UQYA 1XYZA 4UZUA 3DU0A 3QPYA 5FI8A 1MFUA 4XBSA 3S42A 1WKDA 3BSHA 3GHSA 3QFEA 4B5UA 4HN8A 3RU6A 1OCBA 1XKJA 2QS8A 4J2PA 3EB4A 1UWSA 1WKYA 4EPEC 3MP5A 2I7GA 1OG0A 4LS2A 4MWAA 3I68A 1NDVA 4GYPC 4E4UA 3E2QA 2GJRA 1EZWA 3Q4DA 1P43A 2VX4A 3WDPP 3R8GA 4O19A 4R34A 3FYPA 3ISIX 1LTDA 2I9EA 1W32A 5D38A 3VCRA 2WMKA 3FVMA 4FMVA 4MLJA 2I57A 4R85A 2VGFA 4L9YA 5CSSA 3TJLA 3WLIA 4J5NA 1ZTVA 2HK1A 1SZGA 5HNNA 2Y24A 1JPHA 3GXNA 4KWSA 2QT3A 3ABQA 4OOUA 1KRMA 1OFAA 1E6PA 2F6UA 3TC6A 2I17A 4GXWA 2MANA 1SGJA 1LG2A 2C6QA 2WPBA 3B0XA 3SCOA 5DF0A 3LPPA 1AA1B 4PH6A 3HFTA 5HBFA 4JX5A 1OC7A 4L4PA 2UZ9A 1V0MA 4CNOA 2VL4A 2OLSA 1YNYA 4GOAA 4L4OA 4X2PA 4K1GA 1TJ2A 3LMZA 3OVPA 1GVEA 8RUCA 1XR2A 4YTQA 5HMDA 3WZ0E 1T6MA 1JZ8A 4K6AA 4F66A 2QULA 4Z0JA 4AXKA 5LNSA 1J01A 1XX1A 1R3TA 1Q7MA 2E6FA 3OU8A 3GTNA 4IHCA 4NI3A 1W5QA 1OF8A 4NRSA 3T2QA 4Y9AA 3ICJA 2WB5A 2OOFA 1ZJBA 4S2CA 2D20A 1V77A 1UKTA 4JQ2A 1Q6GA 1ZJHA 4BF9A 2INEA 2CWNA 1TB3A 4MNJA 4QAWA 1AJZA 4KPLA 1FWTA 2CW6A 4C6LA 3SAZA 2G96A 1PTDA 2PC8A 5E0KA 4MPKA 1GVSA 3H7RA 3WBEA 3L23A 2ONEA 3W23A 1UBPC 3WMCA 3CJPA 4MHBA 1X98A 3MB9A 1B0IA 3A64A 4CQAA 1MO0A 1XYLA 2DGAA 1VFMA 4AY7A 3BLIA 3NZGA 3CZEA 2XINA 2NV1A 3EX2A 1OVDA 1BD0A 5CZJA 4AZGA 5TD4A 1UKQA 2XDFA 3N15A 2G8ZA 4DBEA 3F5JA 3L5MA 5D4YA 2R1MA 3BSGA 4TV5A 5HWJA 3MZ2A 1TYGA 2X0HA 5A8OA 4JCMA 3FKRA 4MY8A 4C1NA 5DCEA 4WJEA 4IT1A 4LX4A 3WQ6A 4P2VA 1M01A 2OT1A 3NSNA 3B3DA 4ACYA 5C6MA 1MSSA 3WCZA 4C6QA 1FWWA 4JKMA 1Q65A 3UXLA 4JQ3A 4MYXA 1W1YA 2ZRZA 3R6IA 5B80A 1P0NA 5CQ1A 4J3VA 3C2YA 3M0IA 2INFA 3ABOA 2PU0A 1B3WA 2HWGA 4ZXLA 3UCQA 1ELSA 4ZOCA 3PM6A 4IOTA 1KXTA 1H62A 1SZRA 4US5A 1TRIA 5SWUA 5EBUA 2BASA 3PG9A 4US5D 4F9JA 2G4JA 5K7JA 2OTDA 3IGXA 3QV9A 1Y0EA 3DHFA 2E67A 4D8ZA 2Q8XA 4NZFA 1UP3A 2GGEA 4KBXA 2PP1A 3W1MA 4CQBA 4ZQOA 2F2KA 4KIEA 3WQCA 3KTXA 1JCMP 4TXEA 1KRBC 3ARWA 1VD6A 3O0FA 1GWJA 3PJWA 3AWOA 5HA7A 5ABFA 5LNVA 1L6FA 3GVVA 4HIBA 1YPXA 3PNUA 1T8XA 3Q2DA 3T0BA 4PRTA 1EO5A 3LTSA 5HNTA 1TV2A 5AHEA 1CCWB 4L56A 5A6TC 3EWWA 3BURA 5D8ZA 4AMCA 1SZFA 4Y8EA 1TG7A 4IIDA 1ONXA 2Q01A 4AWSA 4DJDA 4Z1BA 5G1MA 4D6CA 4DJDD 1I2RA 2YLAA 4ENLA 4F4RA 2BGNE 3WO8A 4KCWA 3NPXA 4GQBA 4M6PA 4WY0B 2WJZA 4DBUA 1W31A 3WH9A 1EDTA 4KT2A 4FNSA 2BB0A 1C3FA 3GC4A 3PZMA 1DXFA 3HJEA 3M0JA 4B9ZA 4I5XA 5MKGB 5C8BB 3WD4A 1V6TA 3UZ5A 3KP0A 2W63A 1GVOA 4WVXA 5E1QA 1RLCL 5HOSA 3N25A 5D33A 4U10A 4JPGA 1HJWA 3CZGA 3CGTA 2RH9A 1Q6RA 4TMBA 3A4JA 1QNVA 3W7JA 3A3WA 3E2VA 4O11A 4WKHA 9RUBA 1QHOA 1HKIA 1YNPA 3PP7A 2GOKA 5K3VA 4H4IA 4FK9A 2YOCA 3OG2A 1ZL1A 2G41A 1CXKA 3BV4A 5HJXA 5E70A 2E28A 4F2BA 4TX6A 5K2ZA 1LF1A 3MO4A 4PRWA 1RPKA 3N2MA 1G01A 4X63A 4D6JA 5AC4A 3ZLGA 2V81A 4XTDA 4UNKA 4NJKA 3ITCA 4IM4A 1XH1A 2DVUA 2GVGA 3IEBA 3WLTA 3LCFA 1C8QA 2IQ0A 1SUXA 4W88A 5AZ0A 4D9PA 5FEWA 4O16A 1VIZA 4GYFA 1GEQA 4E3TA 4O1AA 4FO4A 1MRQA 5A1AA 4J27A 4I9MA 4Z0SA 3T07A 3PJUA 3WFZA 4BF7A 1ICPA 2I14A 1PL9A 1XXXA 1TIMA 1O5QA 1JAKA 4Q4KA 5A8GA 4HPHA 1FWSA 3FYYA 3GXFA 5DT5A 5JH2A 3E2SA 4LWWA 2J7EA 4H6EA 1BHGA 4HVXA 4FZIA 2TPSA 1L2QA 3QHOA 1WDPA 2RGMA 3LHYA 3LXBA 1E4LA 3MU7A 2FGBA 3VOCA 1J6PA 1TPDA 4ZTXA 1NY1A 4DHGA 2VMFA 5I6SA 3A47A 5CC3A 2NXGA 3B9OA 2J9ZA 3AXXA 5LXXA 2QDGA 4WSJA 1L6SA 1MWOA 3KE0A 3K8LA 1TPUA 3TQPA 3IS4A 2UY5A 5DN1A 1MXDA 2D3NA 4MTVA 2GUBA 4HPJA 7CGTA 2Z1WA 4ADSA 3U7BA 1XLMA 1Y5XA 3G18A 1XLIA 4L6HA 2YCKX 3UWUA 2QXWA 2WMIB 1TJRA 2WCSA 4UMCA 2VZOA 1QTWA 1YBQB 1XLAA 1EWDA 3NM1A 1TPVA 4LYKA 1KXHA 1LUCB 4XUYA 2HRWA 4WEVX 2ZICA 3LY0A 2VQUA 5E6YA 4NHVA 3HJZA 3UEQA 4I7WA 3PB2A 4JIHA 3FCPA 2DT0A 2C16A 2A6LA 3W26A 4O14A 5BRBA 1WDRA 3GNPA 4AZCA 1XI3A 1W1IE 5FAJA 3S83A 3DYPA 3SIMA 2PTYA 4YL2A 2D3LA 3A3HA 4QR6A 1L9WA 4GZIA 1PBGA 3CWHA 3GKAA 1GVQA 4C6KA 2HK0A 4HU0A 5FOOA 1HJUA 3GS6A 3HGJA 4E5TA 3GUGA 3LA4A 1Q8JA 4Y9NA 4FOKA 1IT7A 4RDVA 1Q4WA 2OXNA 2P1FA 1UIOA 2ZZ4A 3U2EA 5LNRA 2A7RA 2BSLA 1YW1A 3DYOA 3MHFA 1MDRA 4I5RA 1A3XA 5IRPA 3WD2A 1A5KC 1L6GA 2FB3A 4HD5A 3LGEA 3RUBL 3H4WA 4J3ZA 4JTEA 1HUVA 2VCCA 4G2DA 2ZC1A 1OABA 2VHLA 3GTFA 1MEIA 5L6UA 1TJ0A 1N55A 2QR6A 4JY9A 2G37A 4O13A 2Y8VA 3L4WA 1ZAHA 1I9CB 4XX6A 1TTJA 2OYKA 3CHVA 3NGJA 4BEUA 5JMUA 3WDIA 2XSBA 4IG2A 4NKCA 2C15A 3S8HA 4GI4A 1XLJA 4DY1A 1ESWA 1UD5A 1XV8A 2D0FA 2A79A 4NZ3A 1TIWA 3RX3A 1XFBA 5A8MA 1IXNA 1PIFA 1UR9A 5A69A 2BVYA 3DECA 1WV2A 2VR2A 4UTTC 3MV11 3CO4A 4D6DA 3IJ8A 1VRDA 2GJLA 1GZ1A 2NUYA 4MF4A 4JFWA 1U5HA 1V0LA 4BQ4A 5CGMA 3AC0A 1TUFA 4DXKA 5MF5A 4RE4A 3P5YA 7PTDA 1XW8A 1SQ7A 2O9RA 4FR6A 2GK1A 1DPMA 3DFSA 1RUSA 4A29A 3CU2A 4E4FA 3W1AA 4ZSTA 3VKJA 3TEVA 1FOBA 4O15A 3HQ1A 3AMCA 1GG0A 2QIIA 2VKZG 1WNOA 4DELA 5CZTA 1WAUA 1Z42A 2Y8UA 4FNTA 5C9ZA 3AHTA 3U2OA 2OSXA 4DO7A 5M17A 1TMQA 3WEMA 3NPWA 1IEWA 3LK6A 3CNYA 1F76A 1MYRA 2CBVA 3VM7A 4XKYB 3L4UA 4H9YA 4N9CA 2DJXA 1RXOB 4ML4A 3QBUA 4IP4A 2PEVA 2GQAA 4LOCA 2J74A 1BF6A 3NQCA 3OW1A 1GYLA 3FA5A 3G22A 4PE8A 1Y8BA 3N2BA 4KEUA 4PTDA 3GXDA 3W3OA 1AL8A 3PTKA 3VOGA 1YE4A 2NX1A 3PPHA 3OLEA 4H9XA 4OBTA 2XGIA 4KWOA 5C7HA 4H8UA 1JPMA 3U5UA 5AHFA 2WMJA 2C0HA 4QNWA 4J1OA 3TFXA 2I9UA 1TWDA 3MUXA 3KLLA 2FKPA 3SADA 3GG0A 4I9TA 2BOFX 3R2GA 3LI0A 1Y65A 3XISA 3MI3A 3BW3A 1HNYA 1DWHM 3CPUA 3UWVA 2E9BA 4JNZA 1J2BA 2YA2A 1BYCA 1MRAA 2TYSA 3C56A 3ARVA 2NQJA 4XIAA 2XUCA 3LDVA 4ORIA 2HBXA 4ZQMA 1Q7QA 3VNYA 3QGVA 2CLLA 2DSZA 4US6A 3W25A 3PNZA 2XFYA 1BSLA 5D37A 3QQWA 1M68A 3QN3A 4LAUA 4AH7A 3BMWA 1RP8A 4DZAA 3HA1A 2JK2A 2XHYA 3PPGA 1UWUA 1A47A 1H1NA 1H41A 4LY8A 1R9ZA 5FJJA 1VENA 2R1LA 3B8DA 5G4WA 4RNIA 1UD2A 2IKIA 3O2LA 4PN2A 3UQNA 1YLVA 5E93A 4W84A 1LQAA 3F2BA 1E0TA 1ISYA 4KEVA 2DV0A 5HDRA 1SR9A 3ARUA 4HQVA 3M64A 2ZXQA 3A23A 4S1FA 2ISFA 4HNNA 4B5NA 2B81A 3S5YA 2CBIA 4S3AA 1SZEA 3NQVA 2OELA 1ZAJA 3GIPA 4B5XA 3JZEA 4AMAA 1GQJA 5CGTA 3S9YA 1E4NA 5AVNA 5E6ZA 5FF4A 2ZUSA 1TTIA 4YVPA 3F03K 1O60A 1LLWA 4L9ZA 1CXFA 5CH9A 3CPGA 3S3GA 4PMXA 4OFCA 4AU0A 3VZZA 3E38A 4PULA 4GGBA 5ABFB 2Y7EA 3BW2A 4GE8A 3SY8A 3LHZA 4X22A 4LEQA 4AIOA 2ZX7A 2GUUA 2JIWA 2VEGA 5DXYA 1JYVA 4KETA 2XIIA 3VNZA 2XFRA 3ZO9A 4ACZB 1WYIA 4JTTA 4G7EA 1GKRA 1RPXA 1KV5A 4IFOA 3VNDA 5HMSA 1FVPA 2P76A 1L0PA 3MKCA 5GNYA 3IJ9A 3E5BA 4TVUA 3KL5A 1UKSA 5EMMA 1PDYA 1QXLA 4QFUA 4DLMA 1FX6A 2J7DA 4OUEA 2A3BA 3AU2A 4GK8A 2Y4SA 3OQEA 4ZE5A 4AVFA 3G24A 3S2LA 2X1TA 1S3HA 5AVHA 2H8XA 4DBSA 5ECUA 2ZDRA 4CCEA 3K13A 3URNA 3BJTA 4JIQA 1FKWA 3U2ZA 1I0BA 4HB7A 3VNMA 3GWQA 2PDYA 3SM0A 2XSAA 2YIHA 2GZXA 5C9WA 4X61A 1JF5A 4JTGA 3IUDA 3RJYA 1G4PA 1K7FA 3EDEA 4YN5A 3R1ZA 3OLDA 1JD9A 3VA8A 4Y9OA 2UV8G 3WDHA 3L68A 3FJ4A 5AC7A 3ABRA 5BU9A 3B8VA 1BQCA 2PDGA 3SSZA 4H41A 4QJ5B 2VC6A 4XD6A 2R9RA 1JCTA 1NELA 3HG2A 3S5NA 3SI9A 1RBOB 3V0TA 1FCQA 2Q3RA 1EC7A 2ATMA 1FWAC 1RQEA 1W1A1 4IPIA 2E6YA 4M56A 1HXJA 3FYOA 5EFFA 1E5NA 2B7QA 3MY9A 1J0KA 2DVXA 4ADUA 3B9DA 1OC5A 4RCXA 5XIMA 2ACSA 2OYMA 5A6AA 4A8NA 1VR6A 3NIYA 4XV0A 4O54A 1HJSA 3VPLA 4O52A 4R88A 3TXZA 2XTKA 3M4HA 3RCNA 4P61A 4HMNA 2E09A 1OGGA 3HN3A 3W1NA 4WGXA 4Q8UA 3B40A 4IZGA 4LUSB 1TO3A 3W74A 4Q4SA 5EU9A 1P4CA 1JR1A 4UMAA 3BO9A 2MUCA 2V3DA 1HKVA 1UH4A 3QR3A 3QOKA 1E9LA 1ZS2A 4MIMA 1GEHA 4AY1A 5K9CA 2WQPA 4DUWA 3C3UA 5F4WA 2E6AA 3HPSA 2YCEA 1HX0A 3S6OA 4PUJA 5CC5A 3SZ8A 4KRTA 3PZOA 4WUIA 1O5KA 1VYRA 5FEPA 1UWRA 5D32A 3M0MA 4CD8A 1RK6A 1DIEA 4J3WA 5BU6A 3GXPA 3YPIA 3NQFA 2QV5A 2JE8A 1O4UA 4LC6A 5JUVA 1HL8A 4IWWA 2X1IA 1VF8A 1CXEA 4O53A 3FX4A 3RLGA 2OWCA 2CHRA 1CDGA 3INPA 3T2PA 1OHLA 3RYSA 4M3PA 2QVHA 4F8XA 3QC3A 3ANVA 3VX1A 5CSUA 3VUSA 7TIMA 3KZSA 2BODX 3A21A 4MZYA 2OZ8A 2WC4A 1XFCA 5A6BD 1ADOA 4MAVA 1LWIA 3GLCA 3AAMA 5DCDA 2XVNA 3AROA 2RDXA 3LGDA 3KHDA 5C54A 5AYIA 1MXGA 4AWUA 3BQ5A 2CZDA 1IZKA 1SU5A 1V3KA 3AUJA 4DZHA 3K30A 5HANA 4R53A 1KGWA 2ALDA 1WQ5A 2OPJA 3NQAA 3HV9A 1G0CA 4PMYA 1KLZA 1U5JA 4OHQA 1LROA 4LU0A 1VAHA 2HNHA 3CQJA 3PAJA 1UG6A 3OB8A 1MDLA 2XH7A 5IBXA 1Z44A 4UQ9A 1UROA 2ESCA 4J4KA 3NDOA 2IW0A 1J4EA 4HU3A 4N4PA 2DT3A 5I0DA 2XZ9A 1H0IA 3EWBX 5CG7A 2NXHA 1Q85A 4BZYA 4CD5A 1KM2A 4YVVA 5XINA 4UMBA 3ES7A 3NPVA 4Q4OA 4A05A 5BZAA 1F6YA 4Y9MA 5AN7A 1G4TA 4K38A 1W8SA 3ARQA 3CH9A 3NQ7A 2OFJA 1VC4A 3M46A 2QCDA 3UPBA 5L9FA 2HVNA 4U5KA 3C2RA 3W1UA 4AQLA 4DWSC 4HMDA 1RJRA 3AISA 1ZB5A 2ZRYA 5I3GA 2E3ZA 2CLIA 5D2WA 4ERIA 1SO5A 1MW0A 4Q8TA 3B0VC 3UZYA 3O05A 1GUVA 5JU6A 3CZKA 3FDGA 3CMJA 4QP0A 5LIYX 3B0UX 2OX1A 4BY3A 4DJEA 2QVNA 3UCDA 5FJRA 4LUJA 4W7UA 3TFCA 1IWBA 3QSRA 3MUCA 3GVGA 3OZOA 3CT2A 2C1HA 1PHWA 3RU8X 2D0HA 1MVYA 3I6EA 1QWKA 1FP9A 3AMGA 3TKFA 4LV4A 5AFDA 3FLUA 5JXQA 3ZYZA 1X8FA 4A3QA 5HR6A 2QGHA 3O1NA 1JZ2A 2VZSA 2QCHA 3LLDA 4CQ9A 1K9DA 4IPJA 2D2JA 4J3UA 5KMYA 3DHPA 2CPUA 3ZM8A 4MOZA 4DBWA 3LBMA 1YHTA 4AHOA 2FVKA 4Q7BA 3CZ8A 1E6SM 4WOZA 2XJ7A 2CKSA 2ZRVA 3FJLA 2QQ6A 1KM0A 2O7SA 3VMPA 4BR1A 4QDWA 2GVEA 2IKHA 3DENA 4H6RA 3TROA 1GT8A 2O9OA 1H60A 1XC6A 2X2GA 4BWLA 3COTA 1H7WA 3MI6A 3R0DA 4JL1A 2XM1A 3H2AA 4MG4A 4CKQA 1DQWA 2VUYA 3L5LA 2CLMA 3UG8A 4FNQA 3TMLA 3VD5A 3V35A 3M0XA 2F2HA 4UTFA 4PTVA 1PVNA 1ZPTA 3VKKA 3SECA 1KM6A 2WC7A 4Q6JA 2G97A 3GR7A 3MSGA 3QKEA 3F4CA 2FJKA 3O07A 3VCNA 1JCYA 3WENA 3NZPA 4EACA 1MW2A 3W7OA 3HGSA 1TELA 1KFCA 3PUGA 3LV6A 3MANA 4I90A 3S4TA 5AB3A 2PDWA 4W7VA 3OVRA 3SRFA 2FHCA 3BAXA 5A2CA 4IPPA 1XBVA 4UTUA 1ADDA 1H63A 3IV3A 4LC8A 4XISA 3SCNA 4U28A 3O6AA 1RCOB 4B91A 5EB8A 3EZ4A 3W1TA 4JX6A 1Z7AA 4IQEA 3T4CA 3GDRA 1WX0A 1D7FA 1W5PA 4IP5A 5G4HC 3VK5A 3MQTA 2ISSA 3VO0A 4UR9A 4W86A 1JUEA 1VP5A 1XM3A 3FGCB 1KC7A 3L4TA 5K4ZA 5IDIA 4U31A 3REQB 1H49A 3TSBA 2EPLX 2YJQA 3ARSA 2Y5EA 2POTA 1QASA 5LKYA 1JI1A 3E96A 1EDQA 3NA8A 3RIKA 1NU5A 2BXYA 1GCYA 4CD7A 5C71A 1DBTA 2D2HA 2QPUA 2A0NA 4IGMA 5GNZA 1QI0A 4ML9A 1AD1A 5JIWA 4OZOA 3F4VA 3L2LA 2NQ5A 4GNJA 2YL5A 3NEVA 4RDWA 2F6KA 3DX5A 2YB1A 4JTLA 3IJLA 3PPCA 3N9RA 2A3AA 3LU2A 2OEJA 3H70A 2V0TA 4UTWC 3SCVA 4KFPA 2IQTA 1K7XA 5IFTA 1DVJA 3H2CA 3TLLA 3I3BA 1PKYA 2VM8A 5A8QA 3AJ7A 1WXYA 1ZGDA 1JFHA 3PHAA 1A5NC 4PB4A 1QDSA 1GOKA 2ZZ7A 4M81A 3G1SA 3DESA 4Z2HA 3LHUA 2P5NA 2H6RA 2BOEX 1V7AA 3EB2A 2PWFA 3T44A 3QR0A 4FR1A 5DBTA 4ROQA 1JRBA 3NWRA 1H7XA 3TYUA 4UCFA 3EA3A 1KD0A 2OZ0A 2RUSA 1PDZA 1BKSA 3KS6A 2FHFA 2ZWYA 4D6IA 3Q58A 4JNYA 4U4MA 3Q37A 3CUGA 1IIHA 3HFYA 3WQVA 4LAKA 3EKZA 1KBIA 1CGVA 4O18A 3TN4A 4ZOEA 4QS6A 3S0CA 4REQB 3L0KA 3NQ2A 3RO8A 3SSJA 3O7UA 1KB3A 2F61A 4G7EB 4UXDA 4Q8PA 2NX3A 2A2IA 1E1EA 3TQKA 1BLIA 1G67A 3V5CA 4YTUA 5FJIA 5H8UA 4UOQA 4IJBA 3VGHA 3TWAA 2VX7A 2AOSA 3V1PA 1YTDA 4QNEA 2WQDA 3GQYA 1XRTA 4U3AA 2Y5SA 1QRQA 3OVGA 5EL1A 1A4LA 3E3HA 8XIMA 2VO5A 3FHQA 4J40A 1ADSA 4DUXA 3CIVA 1XG3A 3C0JA 4MZ8A 4JFUA 4OTKA 3DKJA 4H83A 4QLKA 4QGCA 4LAOA 1F6PA 3PZGA 4GQQA 3OZMA 2B7OA 1OSEA 4JTIA 5AHNA 3QM3A 3B8SA 3N12A 3MV01 4Q4MA 4EXQA 3A4AA 3PZVA 4QE4A 1A3WA 1K9FA 2QUTA 3FXGA 1OFEA 1PHQA 1R2RA 2VVSA 4HN4A 4M6QA 4PL1A 3WF3A 4MB4A 1O66A 3W7IA 4QEHA 4TUFA 3LCGA 1KCLA 1O95A 4J3SA 2GWNA 5ABTA 4GH3A 3KCLA 2WPGA 1TV4A 1TPFA 3UG3A 4V28A 2BXZA 3M9YA 4BQ3A 4GA8A 1VZWA 4S3GA 2GGHA 3PR2A 2GOUA 3SDOA 2YXGA 1Q7ZA 2GJNA 4PBGA 3B06A 1PKMA 5ABHA 1NWUA 1DWIM 2WK2A 3BGAA 3L21A 1BRLB 6REQA 1D3HA 2POZA 3FA4A 4GZ7A 1KCKA 4LAMA 5M5DA 3RPTA 3M5YA 1OGSA 4LS1A 1JG9A 3E74A 4FF7A 5HXMA 1EFZA 4PMVA 4YTTA 3RDKA 1PKNA 1EJVC 1C91A 3O0KA 3UA3A 3PZIA 1QNPA 4AF0A 2GQ9A 4J3TA 1M9HA 2UY2A 1F3XA 3GM8A 4YLWA 4JOMA 4C6PA 3QV7A 2YBUA 3UERA 3VIIA 4F0LA 3CMGA 2GVLA 4GX9A 5A6MA 3IUHA 3WLQA 3T05A 3CIWA 3V7PA 3G6LA 4WHBA 4EPBC 1DQUA 2WC3A 4MGGA 3UXKA 2G3MA 3N19B 1EBGA 1ZCCA 4L4LA 3P8IA 1AUSL 3PJXA 3EOSA 2PD5A 3EPOA 3G5EA 4EVZA 3IIZA 4Q3MA 1G94A 4YCPA 3VIKA 2ZXBA 3GKFA 4UQEA 2G95A 3VI2A 5LGXA 4DB7A 3GB6A 2W67A 5D30A 3BANA 1M6JA 4Y8FA 4GI8A 3WF4A 3K2GA 4C6CA 3RPDA 1F73A 1O68A 3BWWA 3QMRA 5IM51 4J3XA 3AIUA 3ZQ9A 2CHNA 2PDCA 2BWGA 1O1HA 2NWRA 3D3AA 3PWAA 5C0QA 3HMJG 2DZVA 3CH0A 4JTJA 1RY0A 4HMCA 3UY7A 2QPXA 1TE6A 1LRNA 2QUMA 3FVDA 3UPWA 1B30A 4PZVA 3W1RA 2QUNA 5CPQA 1EWEA 1UP0A 4OE7A 2OQYA 1TV8A 3CB8A 2NWSA 2CXGA 2VFHA 4PMOA 2V2DA 1UR2A 2PLCA 5J04A 4TU1A 1M5WA 2WJFA 4RR4A 2QCCA 1YX1A 3RR1A 3W2NA 4K7YA 3QRHA 4OV4A 3W1LA 3KUMA 3UR8A 1VEMA 1ISVA 4GX8A 4IPLA 1EBHA 1OX4B 2GSJA 1W1ZA 3UZXA 1EUAA 1UWTA 3NEHA 3WLHA 3ABXA 1E1CB 3U0HA 5I3JA 5FKYA 3VXGA 1NQKA 1VLWA 1MNZA 4HHMA 3ITVA 4X2RA 3HG3A 5AY7A 3TXVA 3HOJA 1F4HA 3W2LA 1W37A 1HW6A 3XINA 2A21A 3W24A 2P3ZA 3WLKX 4M0XA 5U4NA 1F3WA 3AS0A 3F4DA 3F2DA 4V1XA 4BF5A 1N2VA 3BICA 2DJLA 2XZ7A 3EKGA 3VGBA 1XKYA 1PCWA 4B5WA 1EGVA 3BV7A 2VI0A 4GVHA 1SSGA 4HYWA 2X7WA 2Q8LA 4O28A 3FK4A 3CHEA 3QMSA 3KCJA 4Q6XA 3T4WA 1RK5A 4C91A 3I7QA 3PS7A 2FB2A 2NQ9A 3NSXA 2REQA 2B0MA 3TYCA 1PIIA 3DC0A 1UD4A 4CNTA 3BAWA 2WMFA 4X0NA 2J47A 3APYA 4NAEB 1WZMA 1FUYA 4TVDA 4AYSA 1WKFA 1B3ZA 3VZYA 4ZEPA 3W22A 1YXYA 3FHAA 2HSAA 2J9XA 4NZ5A 2W6RA 2VTFA 2KZHA 4X60A 5K9XA 3RJXA 4LCRA 1PZ1A 1P7TA 3IWPA 3MKVA 2FFIA 3N14A 4GXPA 1QJWA 1UPPA 2WHMA 1TRDA 2V82A 1TWWA 3N2OA 2PGRA 1XG4A 1N8WA 2Y7GA 1VRXA 5CPOA 3BCFA 3R0KA 3L4XA 3KM8A 3RILA 1ZQ5A 1GJWA 5A5WA 1OM0A 4DWSD 5BXTA 4WR3A 3KFTA 1UD8A 2PDQA 4PUUA 4O1BA 3P82A 1V3IA 1J10A 3LHVA 5LYRA 4XZNX 1YDNA 1K8CA 5B7YA 3DCPA 5HPCA 3W7HA 1BAGA 1BVWA 3CWNA 3RF9A 2DUXA 1E6ZA 4NG3A 1OCJA 4FNPA 3HB9A 1XYBA 2VGIA 2PTXA 3LHTA 1AMYA 1OT1A 3TX9A 1T99A 3HTWA 1R3YA 3HURA 3AFBA 2B7NA 4CNUA 1KR0A 3LB0A 4IQJA 3E5PA 3RXZA 4JBRA 3DI0A 2J7GA 4IQDA 2Z7GA 4K36A 1AQ0A 3GFYA 3DYMA 1Q3NA 2PDIA 5I7GA 3O06A 1DJNA 4NRRA 2VEMA 3D47A 3U57A 2WKGA 3JW7A 3PSVA 3UY8A 1EC9A 2D1ZA 3GZ3A 3S6TA 2J6XA 1C93A 3ARXA 5I3FA 1ZBWA 5D02A 1X6LA 1VEPA 4W89A 2VELA 1YYAA 2XIMA 4C6MA 1VCVA 3PF3A 1IF2A 2XFFA 1ZBKA 3W0KA 5D2YA 4PUEA 1W9PA 1EJRC 3L65A 2Q6ZA 3KBSA 3IRSA 3URAA 2VD9A 1LOQA 1PAMA 3IJDA 1XHGA 5FL1A 4ZFMA 3W76A 1M03A 3PTQA 4MUPA 4M19A 8XIAA 1FCUA 5CC6A 4GD0A 3MHGA 4LEFA 2X7VA 4GWEA 3O63A 1K4GA 4N6EA 1AG1O 1F5ZA 3FFSA 1LL6A 1B3XA 5C2GA 2Z1XA 1V6UA 3QGAC 3GNDA 1XQKA 1R2SA 3EEZA 2ASHA 3ZJ8A 1JZ3A 3A24A 2VZUA 2ZX9A 3LHWA 3RX4A 2XFWA 4AIEA 4HHHA 4Z2GA 3M44A 1LOLA 2PE4A 3LRKA 1TPEA 1NAL1 4MWAC 5FF2A 3WH5A 3ZJ6A 2GJXB 1CGYA 2OLHA 1SO6A 2YCIX 4BI5A 3EOOA 5C9XA 3WNKA 1CBGA 3K5XA 5FSEC 4HNCA 3S2CA 4V1YA 4K3ZA 4PEEA 3R25A 3ZWSA 1FXPA 1T96A 2ZYFA 3TLQA 2AAAA 1KM4A 1GQKA 5ABEA 4GINA 2CLFA 2BY2A 3MUIA 2BXVA 5FF7A 2P10A 3HPAA 2FZDA 1E73M 2VP8A 2V8ZA 1EJSC 4OV9A 5DCBA 4DZ5A 4RL3A 1FCVA 1G7VA 3AOFA 3EPNA 3TAKA 3B9AA 1WDQA 2G3NA 5LHEA 3C6CA 4RE3A 3MZNA 1PXGA 1VPQA 1UA7A 4KGJA 3EBVA 2TODA 4IIFA 4H7CA 3NDYA 3F5LA 4PUDA 3SUSA 4UTWA 1DKWA 4ZB0A 5T8GA 3L2MA 3KVMA 1FHDA 4WK9A 2V68A 3CK5A 3KVLA 4ROPA 1XUUA 2ON3A 4FALA 2QZRA 3ITLA 1P1MA 2WM0A 4IMGA 1NTHA 5E09A 2R1KA 2PAJA 4CD4A 4E38A 3TR2A 4MDOA 2DU2A 3FSUA 4D1IA 1LWHA 3GXIA 2OR2A 2ZX6A 4MJZA 4PSRA 3LERA 4N0RA 1TWZA 3TR9A 2Y70A 3ITTA 1P6WA 1CTNA 1IXPA 1DWGM 2WVVB 3H53A 4NQ1A 2PLMA 4YS1A 2Y2WA 1YXCA 3I7RA 1F3EA 2R82A 5G1YA 4Z08A 4ZL1A 5HUPA 1EP3A 2DY3A 2D2OA 4LALA 1V02E 1XGEA 1F74A 1UW9A 4A8LA 3OBKA 5G5IA 2CZ5A 2A3HA 1XIDA 3QC0A 1EPVA 2HEJA 5EY5A 4ZENA 3SR7A 1E51A 1LDCA 3XIMA 1QNOA 4CQDA 1Q2SA 4HNTA 2YZRA 2H9AA 2ZX5A 1MQPA 4LB3A 4V27A 3UT0A 2Z2BA 2Z29A 2KX9A 1CEOA 1XLKA 1KTCA 2OWXA 4XWUA 1A5MC 4KS0A 1THFD 4HNOA 4KGLA 3W2KA 4AD0A 5LXEA 4B15A 3AWNA 2YXOA 2XN1A 5A6LA 3V0UA 4J28A 2BV9A 1ZZMA 5AC6A 2QCGA 3HIJA 1SJDA 1UR4A 1GZGA 4ZQPA 3LNMA 1UPMB 2CITA 2DW7A 1VHNA 2GGIA 1P0DA 1SYTA 5DMYA 3DHUA 1FH9A 4DJFA 4JTUA 4LCSA 3T6CA 1UWQA 1P1XA 2CESA 2YCLA 2ZIDA 4Z2JA 3PG8A 2RJGA 1ZSXA 4UOZA 3P61A 4GIYA 4KH2A 3WBAA 1BXCA 1U83A 4DI8A 2HQAA 2A3EA 3KRZA 1DJYA 4LVDA 4OUIA 5BOOA 5KETA 3S9ZA 2CU0A 2FVMA 2Q02A 3SCTA 4I8YA 1L8NA 4GCAA 5C70A 4ZSUA 4HSNA 4N4QA 2R91A 3TNBA 4GO9A 1W8GA 3AZRA 1LT7A 5F2IA 5JH1A 1VHCA 4ZVJA 2PDPA 4X9YA 4WXZA 2IUZA 4U2ZA 4W7WA 1IEVA 2QF7A 1B4KA 3TYBA 3JS3A 3OGSA 3W7QA 1H7PA 1UJQA 3GHRA 1GOXA 2E6DA 1ZUAX 2RFGA 3AXIA 1TMLA 3GG8A 5C9UA 2YZ5A 3KVKA 3SCRA 5TF0A 1TSIA 4TOQA 3N3TA 3WQOA 4JEQA 4FHAA 4W8AA 3LM3A 4DJDC 3W88A 5CPLA 4MB3A 1CLKA 1H2JA 4JHZA 2QCNA 3DG7A 3A22A 2V5DA 3OBEA 3NTYA 3QEZA 2NW0A 3T55A 5EKYA 1ICSA 1P0BA 4EXBA 2C79A 3WF2A 3MCMA 4LQ1A 2ZKMX 3WLRA 3E0IA 4UTLA 3Q45A 5HAOA 2C13A 5DRCA 2WMGA 4NZCA 1RCQA 3QLDA 1ME9A 3V4BA 1C7SA 4MWAE 1OJXA 4H19A 4KEMA 2NQZA 2G3JA 3ENLA 1FWFC 3W7LA 4MNLA 1MW3A 3VD4A 5A95A 4EKJA 1Q63A 4HT3A 3WBWA 7REQB 2PDNA 4PUMA 2FMNA 1MNSA 1PX4A 6PTDA 3E0VA 3QTGA 2DORA 1EQCA 2Y62A 3E0LA 3FOKA 2OVLA 5FCZA 2YXXA 5HJLA 2QDHA 4DAIA 4UZSA 3TTSA 4QCFA 3GU9A 3G1VA 2QKFA 3HQNA 4JIRA 5D9NA 3ZT6A 3GE7A 1CW2A 1QCWA 4E8CA 4FIQA 3NYDA 1GOIA 1EZ2A 1H3GA 3A5FA 4BQ2A 3QR1A 4E8GA 4C90A 4K7VA 1ZY9A 2B4GA 5LHFA 2PRHA 4CU8A 3P14A 4JFVA 4LTSA 3W07A 1PEZA 1PWLA 1IGWA 4NXSA 1GVFA 4M1BA 3D3FA 4FF5A 3ZT7A 2WJEA 2OQHA 5BYWA 4R3UA 4S2BA 3QHNA 3LSBA 4ZO9A 3WLPA 3GVQA 4YVXA 1GHRA 1TVLA 4BK9A 4H1ZA 2YW3A 1OF6A 2EBNA 3AXKA 3T8LA 3B9EA 3RITA 2R6OA 1U1UA 4HKPA 4S38A 1XRFA 3BTNA 4OVXA 2FLIA 4GJJA 5M1TA 1X1NA 4UFHA 5CG0A 3P0XA 3P6LA 4I6KA 4NNCA 1DHPA 4N42A 4W85A 4DWSB 1HKJA 3CL6A 1B57A 1E55A 1GK8A 3GAYA 1I1XA 1JZ6A 4O8AA 3WEOA 3HGRA 3DFNA 2ISDA 2W92A 3H26A 3OPSA 1KQYA 4RXGA 3MDUA 4KCUA 1TJ1A 4GO8A 2BFGA 1DEDA 1QK2A 1S5TA 2YDSA 1PSCA 3CLWA 3JU2A 2Y88A 1WZLA 3S1XA 4GZEA 4WLCA 3E02A 3TTEA 4QG6A 1P6BA 3AS1A 2D73A 1DJGA 4DQWA 5JBFA 1V6XA 4GIRA 3USBA 1UOKA 4IGHA 3ZJ7A 3BLFA 3PPFA 3CB3A 4B3LA 4XSLA 3LCLA 2ZE3A 3UBPC 5CXPA 2NX9A 3S1GA 2J66A 4Z1AA 2DDXA 1X38A 2ZRWA 3EGJA 1QI5A 1DTUA 5I3HA 3LPGA 4HTYA 1E3ZA 3KAOA 5EYWA 5I77A 1RBLA 3TWBA 2XGBA 3VDHA 2WBGA 5LGZA 5C2CA 1QAPA 4NYYA 4GABA 4PUKA 2HISA 1C92A 5D09A 3SGGA 3UESA 3CASA 1XLDA 3FNDA 3LZ3A 2CIPA 1T41A 1ZFJA 3G1DA 4QBXA 3IACA 4NI8A 4LT9A 5DELA 1CIUA 3AYRA 5EPDA 4JTDA 1B2YA 4UTKA 1QPKA 2E40A 1BEUA 3NQGA 4UFKA 1W54A 4OWGA 3FN9A 3CM4A 4E0CA 2JIEA 4PMZA 1CLVA 1E9ZB 5GPRA 1VIWA 1JXKA 3C2VA 3M07A 3P62A 3VDBA 1QNSA 3LPFA 3AS2A 3VABA 3V18A 3ZMRA 1K03A 1GOMA 1O5RA 2IPFA 2A6NA 1XL9A 2J7CA 3CAVA 4O4WA 4TO8A 1REQA 1DTNA 3ECQA 4KKXA 3EOEA 3WQ4A 3BLPX 2C71A 3B05A 3LS9A 4LUTB 2A7NA 4NYUA 4QM1A 1XDJA 4GGHA 3TP4A 1PZ0A 1F6KA 4F0MA 3H4GA 1VFTA 5CKSA 1W3KA 2Y6ZA 4H7ZA 4NU7A 2XH4A 3GD6A 2Y5JA 5ECVA 3BLOA 1TFVA 4LRSA 1XLFA 7ENLA 4XZHA 2PRMA 2CKRA 3L0GA 5I2UA 4N2YA 3V5OA 4D72A 3EDJA 2BTMA 5DY2A 1LYXA 3W37A 4ASTA 2YL9A 2QMKA 3VKCA 1GHSA 1GW1A 1VPYA 1H4PA 3HM7A 3WJWA 2IKJA 4DPPA 3PFMA 4AISA 1XYAA 3GDKA 4MWAD 4HCLA 2FZBA 1R8LA 1V03A 2VC7A 4AVNA 2CBJA 4DYKA 3G1YA 4PL2A 1EIXA 4XSMA 3L4VA 3SGZA 3TJIA 1L6YA 5FJTA 4GJIA 3VDAA 5I03A 2WMHA 3KS5A 4D1JA 2X42A 1HKMA 3N4AA 1OZQA 2Y61A 3WLJA 4ZMGA 1FA2A 4P7OA 3BMXA 1V8EA 3IGSA 3R79A 3F4WA 5D2VA 3C0LA 4ICNA 2CETA 2VVNA 4HZMA 2W66A 3AXMA 4CUCA 2RKXA 1WO2A 4CN1A 1W56A 4GZJA 4DF0A 1XD0A 3PUEA 4G9PA 5G1TA 3VC5A 1GOOA 1MZHA 4PCNA 3NPUA 3N6JA 1EX5A 3GK0A 4MDPA 2V5CA 5LIKX 3T09A 5AECA 5CJ5A 1I60A 2EG7A 4GACA 4HSHA 3F2CA 2DPEA 3APTA 1BWVA 5T9CE 1HFBA 6ALDA 3VCCA 1GVYA 4F0KA 2GL5A 3VU2A 2ABBA 5LZLA 3BMVA 3TOPA 1J2WA 1I0DA 4IIBA 3S1VA 1S39A 2D69A 3DFQA 2VC5A 1XIMA 1R0MA 2AMGA 2D22A 2OG9A 4BQ5A 3UWWA 2VQTA 3P80A 4FS9A 5A2BA 3C61A 4G8TA 1XF0A 3QKZA 3WF1A 3APGA 1KM1A 3QYQA 3EWZA 4PGLA 1YDYA 4AZ6A 4UFLA 4MPQA 1UHVA 3GYCA 4KW2A 3S2MA 2BMBA 4BHYA 4JFSA 1LQ0A 3BH4A 4YIWA 4QG9A 4RXFA 2X0YA 3GHUA 3UJFA 1B3YA 4E2OA 3WLMA 1YDOA 4DX3A 1Q6FA 2OEKA 4Q33A 1JVNA 3WLLA 2IKGA 4IMDA 4IX2A 5GJPA 4PMJA 3B9NA 3NL3A 2ZA2A 1CZ1A 3ARRA 5D8WA 2X1UA 3W70A 4JTFA 5RUBA 5FSDC 9XIMA 4QJ1A 4RDZA 2WWCA 4UR7A 4ES4A 2GSHA 4TTGA 4CCCA 4OBSA 4B9YA 4EAYA 1EEXA 4GNKB 1C7TA 2PA6A 4CD6A 4QS5A 4PCPA 1B1YA 4X0VA 1TE1A 4W8LA 3WL0A 1UR3M 4BEQA 2A1YA 3F5KA 4Z2LA 1HT6A 1QR7A 4AWEA 3GTHA 4S3BA 1JIBA 4GIEA 1NP2A 2QJIA 1EJ7L 3TOYA 4J9JA 2VDGA 1VYPX 3IK4A 1E6RA 4LANA 3PB0A 3NO1A 1CI1A 1JL8A 4JDYA 4WF7A 4GKTA 4JHOA 3BAKA 2I5GA 4CQCA 2VZVA 2AL2A 4I6VA 2FJUB 4KF1A 2WNNA 2X41A 3V0SA 4R7JA 3W7DA 4IL2A 3A12A 1H1YA 3RNDA 1UQZA 2BHYA 2XVKA 1Y5VA 4L65A 2FPVA 1T7LA 3AJXA 3VGGA 4B5VA 4FSAA 4IIGA