3PZUA

P212121 crystal form of the endo-1,4-beta-glucanase from bacillus subtilis 168
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
297
structure length
297
Chain Sequence
PVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
publication title Dissecting structure-function-stability relationships of a thermostable GH5-CBM3 cellulase from Bacillus subtilis 168.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 123
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzuA00
2CHNA 2CIPA 1UKOA 2XIIA 3VD4A 3GXDA 2WSPA 3BSGA 1HP4A 4OKDA 3WF1A 1OGSA 3U5UA 4BS0A 1W32A 2CBJA 1B3WA 1GOOA 2F61A 4QLJA 4DWSC 1E0XA 4FLQA 2WW5A 4TOQA 4TUFA 2WANA 1BVZA 1CECA 1BQCA 1UWRA 2YL8A 1KB3A 2VNCA 3WFZA 2J7EA 3AHZA 3DYPA 4A3YA 2WB5A 4AZIA 1H1NA 3VGFA 3FXYA 1JI1A 1R86A 1Q6CA 4B15A 1V6VA 2XTKA 4UQAA 4XUYA 1H5VA 1V3LA 3PZUA 4MNMA 2VRJA 4C7DA 3CUHA 4D6DA 1NOFA 3VIMA 3AHYA 3W38A 1MW1A 2WHKA 4Z2LA 3AXXA 4ZXOA 4F66A 2D0GA 1UWQA 3SUWA 1CXLA 2YLLA 3NDYA 3L4TA 3KWXA 4CCEA 4CCDA 1V02E 3FN9A 2QPUA 1QI0A 3K46A 4LYRA 4OOZA 3VINA 4LX4A 1ZBWA 1U2YA 1JF6A 2J77A 2ZUSA 2WZHA 2GUYA 2VX7A 1W91A 1WO2A 1FOBA 3CUIA 3EDJA 3VX0A 1VFFA 2ZE0A 3WF3A 5FCZA 1ZS2A 2ZX6A 1UUQA 3DHUA 3LPPA 3ARQA 6CGTA 3OLIA 1J12A 1TA3B 2W61A 4QCEA 3A47A 1UKQA 3AROA 2WXDM 3MANA 5E70A 1AQ0A 5HXMA 3TTYA 5ABEA 4U5IA 1OD8A 3NSMA 2WHLA 4W5ZA 3VM5A 3ZT5A 1QHOA 1B90A 1ISXA 2D22A 5AYBA 5C70A 1UD5A 1W1VA 1J0YA 3VMPA 5A2CA 4W88A 2VTFA 3GM8A 4AW7A 2G8ZA 4D6JA 1GOWA 1O7AA 4GIAA 2WKGA 4UZSA 5E0CA 1Q6DA 4YHGA 3EBVA 4PMYA 4PMNA 4EAMA 1BGAA 1B3VA 2A3CA 1MFVA 3W24A 3WNLA 2ZWYA 2GFTA 4N0RA 2D2OA 4OZOA 2MANA 2D20A 5D9PA 2G3IA 1NQ6A 4L4OA 3WL1A 2Z1KA 4PUEA 2VZOA 1JDDA 2CKRA 3F5LA 3OIHA 2OWXA 2QLYA 2YA1A 3D3AA 5M17A 5D9MA 3A3HA 3WQ5A 2WMFA 3DYMA 4Z2GA 2PWGA 2YL5A 3RM8A 2J7CA 3VIOA 1HKKA 5ABGA 1LF1A 4AIUA 1UH3A 3VUPA 5I5RA 3VGHA 1D3CA 4U3CA 3L4YA 2WCSA 1EA9C 1ISWA 4AIEA 3NCOA 4TVCA 3ZM8A 2X2YA 4GXPA 3DHPA 3WQWA 2J47A 4AZCB 5D4YA 3WD4A 2VUYA 3K1DA 5LYRA 1ZBKA 2VX4A 3B9EA 1EDQA 5A6JA 3D5HA 4M56A 2JF6A 1J18A 3MV01 3WDIA 3ZR5A 4AMCA 6A3HA 3POCA 3U5YA 2WC4A 3GXMA 3CH9A 4WJXA 3L4VA 2VURA 1BYAA 5A2AA 2NW0A 4F79A 3GDBA 3HU7A 3DC0A 1PIFA 1UWUA 2D1ZA 1OD0A 2J7GA 4TTUA 2ZX7A 1ODZA 3MUY1 5A6BA 4TTGA 1QBBA 3L2LA 4WIWA 2TAAA 2GSJA 1E4NA 4ATWA 3PZNA 1I75A 1BVNP 1LL6A 5I0DA 2VVSA 2XYLA 3BLKA 4AWEA 4D72A 1FP8A 1UR1A 1HXJA 3W6LA 3ZJKA 4RE4A 2QMKA 4LYQA 1LL7A 3W4RA 3BXWA 4PN2A 1XCXA 4PYSA 1KFWA 4IUGA 1GQJA 3WD3A 4D6IA 3BC9A 4UR9A 4NI3A 1H2JA 3CTTA 4IPLA 3PTQA 3ARWA 2WC7A 4H41A 2VR4A 3CZKA 5E0FA 3SCNA 4OUEA 3WUFA 4D6FA 3OLGA 2XSBA 3UG4A 1KBKA 3OLDA 4AD5A 1G5AA 2YJQA 1D7FA 3DECA 1WB0A 3PTKA 3TTOA 4MNJA 1UOKA 5BXSA 5A6AA 1XH1A 3WMBA 1DWIM 2XPKA 2CBUA 3U57A 1EOKA 1HX0A 3CHDA 4D6GA 1H3GA 5D8ZA 5IXEA 4S3KA 3BLPX 3WQ8A 5DT7A 4P7NA 1OWQA 2GJXA 4MAZA 2BVTA 2OSWA 3VGBA 2DIJA 5A8NA 1E73M 1GOKA 1PX3A 1UKTA 1E5JA 3WELA 2BVYA 2ZUWA 1UD6A 1GNXA 1E4MM 2DH3A 1K9TA 4D6CA 2GJPA 3PTMA 5CSUA 2GJRA 3SCVA 3VIHA 3N9KA 3PHAA 4DUWA 3KL0A 3ARTA 3ARRA 3O6AA 1EQPA 4HZ6A 4AZ5A 4FF5A 1E1EA 1VFMA 2VJXA 1HKMA 1ISVA 2EPLX 4UNIA 1MQPA 2CESA 2WLYA 1WDSA 1J11A 5HBFA 2CEQA 4HPGA 4M81A 3W6MA 3VDBA 4W84A 4QDMA 4AISA 4UFLA 4GQQA 3SCOA 1VIWA 3FHAA 3RIKA 1FHLA 3ARVA 5I23A 5BXRA 2Y5EA 1HJSA 3L4UA 3IK2A 3WNPA 3WSUA 3GH5A 5CZKA 4PMRA 1V6WA 4LGXA 4OIFA 3VX1A 4ZE4A 1KGUA 2W66A 1QNPA 5E6YA 1IZKA 3LPFA 3AYRA 4PRWA 3RPMA 4XZBA 1QNQA 4FLSA 2X09A 5BROA 4CUCA 1Q6FA 2WVSA 4ZENA 4CN6A 1E6ZA 3AYSA 1SMAA 3GTNA 3M46A 3SUVA 3MSDA 1ZL1A 1QI2A 5I79A 4YN5A 3UERA 4KGLA 5FD0A 3WD0A 1V03A 2W92A 1CXHA 4M8UA 1LG2A 3U7VA 3HJEA 1F4HA 4C7FA 1SR0A 3BH4A 4GO9A 1W3HA 2OYMA 2EPMX 2WZIA 2A3BA 4F8XA 1JF5A 3AS1A 1GZJA 4B3KA 1UWTA 1US2A 3EDEA 4P7OA 1QPKA 5KEZA 1DWAM 1JDAA 1EDTA 5LA1A 2WMIA 4UTFA 3AMLA 1C7SA 1GVIA 3VMOA 1ODUA 1KWKA 2IUZA 2PI6A 4E8CA 2Y24A 2BNJA 5GPRA 2OYKA 1W3KA 2QHAA 1EIBA 1NOWA 3THDA 2VI0A 5CJ5A 2VZTA 2DEPA 3PZIA 1UG6A 4ZE5A 3GBDA 3L2MA 4CN4A 2ZXBA 1J0KA 2UY2A 2VT0A 2E8ZA 2WVTA 5M5DA 1B0IA 2YDQA 2PB1A 1UYQA 3MV11 1JI2A 1E4LA 1M01A 3WD1A 3QHMA 1GJWA 2J7BA 3UR8A 1CYGA 4LYPA 4AZHA 4FK9A 5JUVA 1X1NA 3APGA 4PEEA 2WCAA 1R7OA 1JZ7A 1LQ0A 3WQ4A 1LJYA 1Z32X 3F4VA 1J0ZA 5I77A 5A6MA 2WBKA 1HKIA 1HF6A 4D1IA 5BXPA 2VX6A 4P8VA 2VZSA 3AXIA 3VIIA 3PZGA 1R7AA 3POHA 1KXQA 2O9TA 3NIYA 1VEPA 1R85A 1JGIA 1KR1A 4D71A 7TAAA 1W3LA 1XHGA 2VCAA 2W62A 1UWIA 5IHRA 3T08A 1IT0A 4LXFA 4QP0A 1W9DM 1E6RA 1JD7A 1ZB5A 3J7HA 5IFPA 4RL3A 1TMQA 3EYPA 5CGMA 1W3JA 4PMDA 4X0VA 1HL9A 2XFRA 1E56A 5I3DA 4EE9A 1A47A 1MWOA 5E9AA 4HA1A 5TD4A 2WVUA 3W27A 4GO8A 1G0CA 3SCWA 2YA2A 3SCUA 3ZJ8A 3GH4A 2GDUA 2ZX5A 2UWFA 4DUXA 1NP0A 1US3A 5CLWA 3ARYA 2JF7A 3AIVA 4UFKA 1UZ1A 2J7DA 1V0NA 3QR3A 2WMHA 3VIPA 3RILA 3S2CA 2PBOA 2G3MA 4JHZA 2E3ZA 1PX8A 3QHNA 1JZ5A 1U33A 1GHSA 1FHDA 2QPSA 1UR8A 3T0AA 4WKFA 1C8QA 4HMDA 1GW1A 4P8UA 4PUDA 2XVGA 3CHFA 4H8HA 4AZGA 1EDGA 2J25A 3NUKA 2VZVA 1ITCA 2Q8XA 1RP8A 1VJSA 5AY7A 5JBDA 1CDGA 4KH2A 3WNOA 2XGIA 1C93A 4M82A 2G4FA 4BA0A 3BMWA 3N12A 1KWGA 5A8OA 1EHAA 3RJXA 2RGLA 3WQ6A 2GK1A 1UD3A 1ZU8A 4P8XA 1CZ1A 1G1YA 2VX5A 2YKKA 3ZSSA 1FA2A 1WAWA 1VFOA 1WZKA 1NH6A 5I24A 3GH7A 1VFUA 2CBVA 3I3BA 1CGVA 1MW0A 1V0KA 1CGUA 3ZT7A 2D3NA 2ESCA 2X05A 1SMDA 1J10A 2WHJA 3BAIA 1JYNA 2EEXA 4J3TA 1GOQA 3WF0A 2E0PA 5BWFA 5A6LA 1R8LA 4BQ4A 4M24A 3BAXA 4E8DA 1JZ4A 4HPHA 1GUVA 1BHGA 1WDPA 2WSKA 5CLTA 4H8UA 3VDHA 1HT6A 3B9DA 4GQRA 4CU6A 1NWUA 5DO8A 4H7VA 3SCQA 4JFVA 4JCMA 2QV4A 3UCQA 4GINA 4B9ZA 2ZUNA 3UG3A 3VILA 3ZR6A 3EDKA 2WPGA 1V6YA 1HJQA 4PCSA 3T2QA 2VC9A 1QBAA 3ZT6A 2XGBA 2V3GA 2EPKX 3L4XA 3AMCA 4KWUA 2EPNA 4AZ6A 4EANA 4P8WA 4HOWA 1GCYA 3VMNA 3O2LA 2DT3A 2ZXDA 4TVUA 1AMYA 4U31A 3TONA 1Q4NX 1VEMA 4H2CA 2DT2A 3SCRA 3VD5A 3JUGA 3N11A 4CCCA 1C91A 1EQCA 3WH6A 3ZO9A 3VNZA 2NT0A 2A3EA 2ZX9A 2XSAA 4M29A 1QNRA 2GJXB 3K8KA 2PF0A 2OWCA 2CETA 4AY1A 3GXFA 3MMUA 1V6XA 1E3ZA 1VBUA 4C7GA 1LG1A 3K4DA 1E6QM 2C8NA 3I3EA 4D6HA 2XJ7A 3WH8A 5GNZA 4NZCA 4W7VA 3MMDA 1XD1A 3OB8A 3OGSA 1TZ7A 1CLVA 5IDIA 1QNSA 1WDQA 4LQ1A 3FW6A 3VGDA 5DEZA 4U33A 2EXOA 1B1YA 2BY1A 2FHBA 4ATDA 4BQ2A 1CPUA 4CD8A 3EDFA 4GI9A 1JYWA 1GHRA 4ACZB 3AS2A 4F9JA 1XGZA 3IAPA 1HNYA 5C8BB 2DSVA 3PBGA 1W9PA 1XH0A 3O9NA 3WN6A 3PZQA 3FAXA 2BHZA 3W53A 1V0LA 1VBRA 1OM0A 2XVPA 5HPOA 3VOCA 3N18A 2DPEA 1UH4A 3BAWA 5KZ6A 1XV8A 3TA9A 1V02A 3UESA 3N15A 4FLOA 3A6OA 5C71A 2CYGA 1GONA 1MQQA 1PBGA 2D24A 4Q7NA 3WH7A 1NP2A 1WE5A 4AD0A 3N17A 4CVWA 2DSUA 1QW9A 3SURA 3VIGA 1FH9A 4PMUA 3ZQ9A 2BXZA 3F5KA 2BV9A 3WUBA 2E9BA 4GI8A 1V0MA 4PSPA 1LWJA 1UKSA 4WKAA 4NF7A 1W9BM 5GNXA 1W9UA 3T09A 1WKYA 2YA0A 4AD1A 4N42A 4WLCA 2DSKA 2EO7A 1WZAA 4AEEA 4OJYA 5ABFB 1H0GA 3B8SA 1JZ8A 4BF7A 1N82A 1J01A 4NSBA 5HDRA 5AYIA 1NARA 3FY1A 4XV0A 4PTWA 1GQKA 5IFTA 4TX6A 2W63A 4Z2KA 1KGWA 4MTVA 3W28A 5EMYA 2WMIB 4W85A 4XX6A 1OGGA 3WDQA 2BHUA 1OT1A 4JFWA 1XYFA 2WKLA 5JIWA 1JAKA 5A6BD 3CUGA 4MB4A 2ZX8A 4KMQA 1W9VA 1CXIA 3T2PA 4UFMA 4CGTA 1V6UA 1E3XA 1E72M 5E09A 2J62A 3AXHA 4UQCA 1ZBCA 3K8LA 1UQYA 3WF2A 2Z1SA 4HU0A 1GJUA 3L4ZA 3EDDA 1TFVA 1XYZA 2D0FA 2PWHA 3FNDA 2FDMA 4W5UA 1Y7VA 2ZICA 1IZJA 5A8PA 3IANA 3VD7A 2W5FA 4MADA 1B9ZA 1E71M 3W29A 3LPGA 3IJ7A 1UWSA 2HISA 2W91A 5CGTA 1EGZA 2V5DA 1ECEA 1F4AA 4D6EA 1GOMA 4ZFMA 4XZWA 2AMGA 3U7BA 2AAAA 4WSJA 1NOUA 1HVXA 1PAMA 4PSRA 1K9DA 3SCSA 4UCFA 1G9HA 2DIEA 4X0NA 3GNOA 1XH2A 3VGGA 1UR0A 3WNMA 4W7UA 1U30A 1JYXA 3PZ9A 1PEZA 1BF2A 1K9FA 3ARXA 1VB9A 1LWHA 2WVVA 3WBAA 5EB8A 1UA7A 3TOPA 2PC8A 4CU7A 1CIUA 1OINA 3AIEA 3PN8A 1UQZA 5LA2A 3W0KA 3OGRA 2ZUVA 3WIJA 1UKPA 1UD8A 3FHQA 3LPOA 4HMEA 3MU7A 4J3SA 2DSZA 2E40A 3W82A 1AVAA 2X1IA 3AJ7A 3WEMA 3LMYA 1HIZA 2BFGA 1JZ6A 3AHTA 1PZ3A 2CHOA 3A4XA 1CNVA 5BXTA 1J0IA 1SFSA 2YDRA 2DGAA 1M53A 4DUVA 4TXEA 2OLHA 4AXNA 4H04A 4E2OA 4X9YA 1PIGA 4ZXLA 1KXHA 5HOSA 2XM1A 2E8YA 2FH6A 3PZTA 2E9LA 4PTXA 4A4AA 2V5CA 4MNKA 3MO4A 2JIEA 2FGLA 7CGTA 4WSKA 4JFUA 3CZGA 1KQYA 5FL1A 3NYDA 2VRKA 2BHYA 2GK1B 1H11A 3CBWA 1VAHA 1EOMA 3M6DA 5F7UA 3CMJA 2X8RA 1C92A 1TUXA 4U5KA 5BRQA 2YBTA 2XUCA 1BYDA 2X0HA 1UA3A 2XWDA 4WKHA 1W2VA 1EO7A 1TVNA 4GZJA 3G6LA 1FH7A 3OLEA 4JZ5A 3UEQA 1CBGA 4M1RA 3VU2A 4J3WA 4HZ7A 1E6SM 4HP5A 1TE1A 4JKMA 4ATLA 5EFDA 1YHTA 4JKKA 1JYVA 3ALFA 2EJ1A 4JHOA 4HZ8A 1I1WA 2ZOXA 3AHVA 1J0JA 3ZOAA 1QHZA 5D9OA 2CCRA 2V3DA 2YL6A 3SUSA 2J74A 4W86A 3CZ8A 3SUUA 1L0PA 4DWSA 3M07A 3PZMA 4W87A 2OSXA 1M04A 2B31A 2ZIDA 4MDPA 2XVLA 5I2UA 2X0YA 4B9YA 2XVNA 3AQUA 4JL1A 2C7FA 1E0WA 3IJ9A 1JFHA 3AZRA 4AEFA 1FP9A 1NWSA 4EK7A 2HVMA 1UR9A 5JBFA 3IJ8A 4KGJA 3WH5A 1E4IA 1CLXA 2IXUA 2NSXA 4ML4A 1AQMA 4PMQA 1KCKA 2CXGA 4L4PA 4PCTA 1BAGA 3EMCA 4QFUA 2Y2WA 4LPCA 1JDCA 3CO4A 4UQ9A 4WF7A 3E1F1 2E4TA 2WMJA 1K6AA 2WM0A 2YLAA 2DQXA 5FIPA 4B3LA 5CG0A 4UFIA 4W7WA 5I6SA 4QLLA 3ARZA 4W93A 3THCA 1C90A 3WUGA 3ALGA 4YHEA 3WDJA 2UY4A 1M03A 4PMOA 3MUZ1 3QHOA 2PWDA 1ISZA 2A3HA 3IAQA 3VIFA 3NSXA 4HMCA 1A3HA 1LL4A 3VTRA 1K9EA 1PZ2A 3W25A 2DSWA 4MAVA 3ZSTA 1CGTA 3WY1A 1OCQA 1V3HA 2XVKA 1XSKA 3WNKA 3KE0A 4QLKA 2XFFA 4ZEPA 4Q22A 3VO0A 1XRVA 1OIFA 4U2YA 3AS3A 1BG9A 2VZUA 1XSJA 1R87A 1VJZA 1D2KA 3AMKA 3DYOA 3WBEA 5A1AA 5AC5A 4JFTA 1MXGA 2WBGA 1WZMA 5A2BA 2CPUA 2J8FA 2CNCA 3PZVA 4J3XA 1E15A 3WL0A 2O92A 3WENA 3VNYA 1E5NA 2ZUUA 4UFHA 4BQ5A 4Z2JA 3MSGA 1HL8A 2XG9A 1BYBA 2OYLA 3VKKA 3KEHA 2RGMA 4AD3A 1JNEA 4U3AA 3RMEA 4Z2IA 2CERA 3N1AA 5EFFA 4UQEA 5M03A 2D0HA 4P7RA 3EMQA 4J3UA 3B9AA 1FFQA 4AZ7A 1V3IA 1QHPA 3VM7A 2WMGA 1VF8A 3MUAA 4KRTA 4QCFA 1QI3A 1G94A 4M80A 5IHSA 1B2YA 1RD6A 3OG2A 3MUIA 3WQVA 1WNOA 3VPLA 1VEOA 2V3FA 8A3HA 5FOOA 1S46A 2JEPA 1JZ3A 3BMVA 2F2HA 1MW2A 2JFEX 1NWTA 4DM2A 4TX8A 1VRXA 1P6WA 2XM2A 3ARPA 2WAGA 3CZEA 2FHFA 2XWEA 2XFYA 4GZIA 5CPSA 1JAEA 2VQTA 2Y8VA 3AZSA 1RP9A 3AIQA 1H09A 3QOMA 1OBAA 4MJ4A 7A3HA 2O9OA 5BYWA 2ZXQA 3AI0A 2V38A 3AISA 1DWGM 3WDRA 2G3NA 2ZWZA 3GNPA 4HA3A 4PMZA 1H4PA 1PJ9A 2YBUA 1UD4A 5FKYA 4CD7A 2ZUTA 4AYSA 1C3FA 3BGAA 5E6ZA 1HKJA 1SYTA 3OA5A 3CHCA 1HP5A 1LLOA 2J7HA 1V3JA 3WUEA 3WEOA 1C7TA 1E9LA 1E1FA 1W1TA 1PX4A 1DWJM 1H49A 2J79A 4Z2HA 3A4AA 1E0VA 1ITXA 4HTYA 3M7SA 3PZOA 1GORA 3WFLA 1V3KA 1RPKA 4AZBA 1CTNA 2D23A 3G6MA 4NRRA 1EO5A 2IXVA 1B3ZA 5I78A 4FMVA 2VMFA 2VVNA 3RM9A 4CD6A 1KGXA 3GBEA 4IISA 1X6LA 4JIEA 2PBGA 3AZTA 3WDPP 1QVBA 4UFJA 3AIWA 3WMSA 3AICA 2VCBA 1JNDA 3BSHA 3CGTA 1CGYA 2WVVB 2W4XA 3KL3A 2DDXA 1X6NA 1PPIA 2FGZA 1QNOA 2CBIA 1UD2A 1UR2A 2JE8A 2G3JA 2WK2A 1B31A 2J7FA 4PBGA 4HOXA 1J9YA 1BSIA 1KXTA 2G41A 1TCMA 1GQLA 2XIBA 1CWYA 1W9XA 3AFBA 3AIUA 3BCDA 3GZAA 5A69A 1E70M 1W2PA 4GZEA 4CKQA 4R27A 1CXKA 3RO8A 1JXKA 2J78A 3CUJA 4TVDA 4MB1A 5BRPA 1L8NA 1DP0A 4W8AA 3CUFA 2FHCA 2WNWA 5CXPA 3FAWA 5A8QA 1E6NA 4W8LA 4MNLA 1MW3A 1XSIA 2YDSA 3GXIA 4JL2A 3HMCA 4BZYA 3CHEA 3VD9A 1JXJA 2FH8A 5DT5A 3AS0A 2VQUA 4NRSA 4V2XA 5DMYA 2EPOA 1JD9A 1WPCA 4D1JA 2EBNA 1E6XM 1TA3A 3EMZA 6TAAA 1CGWA 2GVYA 2W67A 3WH9A 3WDHA 2PWEA 2VL4A 1JG9A 3GNRA 4GPNA 3WMCA 2F8QA 2NT1A 4GKLA 3AHXA 2VO5A 4J7RA 1XC6A 3MKKA 3WKZA 3CZJA 2JEQA 4K68A 2QF8A 1DHKA 2OWWA 4CD5A 8CGTA 1GOIA 3T2OA 5D8WA 1IV8A 3RDKA 4AD2A 4RE2A 3WF4A 5DF0A 1BTCA 4AIOA 2ZUMA 2J4GA 3MMWA 2Y8KA 2BY3A 3NJ3A 1BFNA 5A6SA 2J75A 4J28A 3OBAA 4P7QA 2WC3A 1HJWA 2BY0A 3AMDA 4V28A 1QW8A 1UHVA 1OSEA 4DWSB 1MQRA 3VD3A 3RM4A 4CU8A 5GNYA 2O9RA 3SEPA 1KCLA 5JIPA 2BY2A 1CEOA 1EXPA 2UY5A 4WK9A 1ESWA 1MYRA 1DEDA 1RH9A 3K4AA 2YL9A 3W37A 2XHYA 3RJYA 1EHNA 3ZIZA 5EBAA 1B3XA 1GVYA 2D3LA 4DM1A 4PTVA 1QOXA 3S6TA 3ECQA 5JBEA 1O6IA 1I1XA 4ACZA 3F5JA 4JAWA 3CZLA 2PWFA 4J27A 1E40A 4IM4A 3KZSA 4PTMA 4ACYA 1BG4A 1FFRA 1QI5A 1MFUA 4AZCA 3CMGA 1M7XA 4MDOA 4HA4A 3WNNA 2WYSA 1W1YA 5A6KA 1JL8A 1TG7A 4QAWA 1WP6A 4Y7EA 3UR7A 3UG5A 3SUTA 1HVQA 5ABHA 2OSYA 2YIHA 4MB5A 5CSYA 5A95A 3OZOA 2Y4SA 2JIWA 4BQ3A 9CGTA 3QOKA 1C8XA 3A4WA 4J3VA 3SCTA 4PMVA 3W26A 2WZEA 1TR1A 3I3DA 1BGGA 1AQHA 1V08A 2A3AA 1KQZA 4MJ2A 1CXFA 1OGBA 1GQIA 1MXDA 1DWHM 3BAKA 1WDRA 3CLWA 2WMKA 3VVGA 3WEZA 2BS9A 1UH2A 4HOZA 5A8MA 2V3EA 3RCNA 5D9NA 2WLZA 3W81A 5CPQA 1EH9A 4UOZA 2AOSA 3TTQA 1CXEA 5M3WA 1OIMA 1KXVA 5ABFA 4AC1X 1BYCA 4A3HA 4OOUA 5GQBA 1B3YA 1V3MA 1UR4A 3OZPA 1TVPA 4P7LA 2GDVA 4OBSA 4W89A 1GPFA 3CPUA 3GYCA 4F9DA 1E6PA 4BCEA 1W1PA 2WCGA 3AIBA 2WHMA 3WD2A 4H8VA 5A3HA 1C8YA 1H0IA 4CN1A 1NWRA 1XCWA 2CKSA 2DT1A 5HPCA 4W8BA 4UQDA 1Q6EA 3N13A 5LA0A 3ZJ6A 5BCAA 3HN3A 4UOJA 2QMJA 3ZMRA 4XB3A 3SIMA 3QGVA 3BCFA 1XD0A 1KR0A 4CVUA 4OBRA 3BAJA 1HJVA 1DTUA 4E4PA 4PMXA 2WWDA 3L4WA 3TTSA 3ARSA 1KBBA 1JZ2A 3VIJA 3BAYA 2VRQA 1G01A 5CPTA 1JIBA 5ECUA 3N04A 4JCLA 1J0HA 1BLIA 4UZUA 3TP4A 4URIA 3NDZA 1E55A 1ZJAA 3VGEA 4JFSA 3T0BA 1VENA 2ZXAA 2J8GA 4AD4A 4R5EA 1HN1A 3OGVA 4KRUA 5DFAA 2DT0A 2VOTA 1E43A 1MVYA 1YQ2A 1WZLA 1WCGA 2JALA 3MS8A 4RE3A 4U2ZA 4FLRA 4S3JA 3ZJ7A 1JFXA 1B30A 4MB3A 1ZJBA 5HNNA 2VR5A 3II1A 4GI6A 4MPKA 5CQ1A 4UQBA 4JKLA 3CIVA 1H41A 3SCPA 2C0HA 1ISYA 1BPLB 2BVDA 1Q6GA 4B16A 4DWSD 1UZ4A 2UY3A 4IPNB 5A94A 3KL5A 3VDAA 3AMGA 1CGXA 3VIKA 3UETA 1QI4A 1OT2A 3K8MA 2E9MA 1ZBVA 5AC4A 2BXYA 1HJUA 3ARUA 4UOQA 3T0DA 4YPJA 1DWFM 2EQDA 1NM9A 3VDCA 3NSNA 2DH2A 2CITA 4HU8A 2O9PA 3AIRA 2WWCA 3AOFA 2YOCA 1CENA 4EKJA 4V27A 2VCCA 1OB0A 5FL0A 1HJXA 4CD4A 1FH8A
chains in the Genus database with same CATH superfamily
2CIPA 1SW0A 3PBWA 1E9IA 5EMLA 1UR3M 3K1GA 3GXNA 3GK0A 3KP0A 3N2MA 3PWGA 4GUIA 3N2CA 3GU1A 4H9UA 5H2ZA 3R1ZA 4N02A 1B3WA 4QLJA 4J40A 3R12A 2ISSA 4TUFA 4BWLC 1CECA 2VEIA 1KB3A 1OFAA 3AHZA 3DYPA 3EB2A 1KM5A 4WEVX 5AYYA 4UTJA 1CB7B 3G8RA 4B15A 1V6VA 3QYSA 1V3LA 4C7DA 1A3WA 3CUHA 3DN5A 2AQVA 1NOFA 3W38A 3PAJA 2I7GA 1A5CA 2OGYA 5K4ZA 2DV0A 1UWQA 3TEVA 1CXLA 1JDFA 1YE4A 1OFPA 5EPDA 1ZAJA 4TMBA 3E0VA 3VKJA 3GZ3A 3UJRA 2ZZ1A 2E6YA 2J77A 2FPTA 4H9ZA 2GUYA 1W91A 1FOBA 3VOIA 1P0KA 4HHMA 5C5YA 1ZS2A 3DHUA 1A0CA 3LPPA 3ARQA 3KLKA 3AU2A 3IIXA 5J5DA 1PTDA 5LZLA 4UXDA 2NQJA 2W61A 4QCEA 4A21A 3N4FA 1BTMA 1UKQA 2RKXA 2PDKA 4S3CA 4M0XA 5E70A 3USZA 4Z1AA 3STPA 3E5PA 3NSMA 3VM5A 2XDFA 5D03A 3IIZA 1OQFA 2D22A 3STGA 1MUCA 1J0YA 1XGDA 4OV4A 5A2CA 3S1XA 3HG5A 3LCXA 5FJUA 1GOWA 1U5JA 5C2CA 2RFGA 1Q6DA 1QXLA 4EAMA 1B3VA 3UU0A 3RMJA 2HQAA 2D20A 3WL1A 3B06A 3E0FA 3E12A 3A12A 1JDDA 3UR2A 5AVHA 2FJKA 3RRAA 2WMFA 1RVKA 3DDMA 3DYMA 3M5ZA 2XIMA 4O4VA 4XD3A 4Z2GA 2YL5A 3ORWA 3VIOA 1DJXA 4YLWA 4LSBA 1R46A 3LCIA 5TIMA 3VUPA 4U3CA 2WCSA 1EA9C 4JQ1A 4DLFA 3ZM8A 2X2YA 2J9XA 3R25A 4AZCB 4O28A 2VUYA 3K1DA 1ZBKA 2O4QA 3MO7A 3NQ7A 5A6JA 5FAGA 6A3HA 1YYAA 3OU8A 4XZLX 3RK8A 3CUZA 3GXMA 4R85A 3P74A 1BYAA 2VXNA 3P2VA 3C6CA 3HU7A 4Z1BA 3G0XA 2J7GA 1B4EA 2OEJA 5DMNA 2R1NA 4WIWA 3JW7A 4AB4A 1NDVA 4R7WA 1LL6A 1T96A 4MY1A 4NX5A 3H2EA 4RPQA 3AUOA 5KZDA 1DORA 4IMDA 3I6RA 4LYQA 3CTLA 3MP5A 4IGMA 1ZNNA 3OBKA 4C1KA 1DQWA 1GQJA 1AUSL 4UR9A 3CTTA 2X30A 4H41A 1LLZA 1AK5A 2VR4A 3CZKA 3WG6A 2D69A 3SCNA 3OLGA 2C15A 2XSBA 3AU6A 2QCNA 4LC6A 3UG4A 1FWCC 3GDKA 2NZLA 1VJIA 1EGMA 3WMBA 1DWIM 2CBUA 3U57A 1D8CA 2EG7A 3BUVA 1T40A 3HOJA 3CHDA 5IXEA 4JBRA 3M0KA 3QRHA 2GGGA 3CHVA 4B3ZA 4P7NA 2BVTA 3L9CA 2OSWA 2DIJA 1PX3A 2OKTA 2QAPA 2ZUWA 4MLRA 1LZOA 2DH3A 4RNIA 5C9WA 1UROA 4UTLA 3PTMA 5CSUA 2GJRA 1ZP4A 3VIHA 3PHAA 3KL0A 4LS1A 4UBPC 2ZRVA 2CU0A 4Q6JA 2P8CA 3OQEA 3VDBA 4HPGA 4M81A 2Q01A 2R1KA 3DEQA 4QDMA 4K36A 4GQQA 2YZRA 1OK4A 4Q8PA 5D38A 1FHLA 3ARVA 5I23A 5CC3A 1XJBA 1OCBA 2Y5EA 3W6YA 3EX2A 2ZZ2A 2UBPC 4CEXC 1KGUA 1HO4A 1S39A 4UB9A 3TFCA 5E6YA 1IZKA 5EKYA 3RPMA 4PZVA 1FXPA 1QNQA 2DVXA 4FLSA 2X09A 4XD6A 3D47A 3P81A 2J9YA 1T5AA 3R0UA 1VPQA 3F7JA 4CN6A 3EWWA 3DFHA 2Y85A 1S3TC 4M19A 1TJ2A 4QG6A 4EF9A 4HSHA 1WOBA 5AECA 4CQBA 3UERA 2FTPA 3TDFA 3GIYA 3K4WA 2OJPA 2RDUA 1CXHA 3TN4A 4H6KA 5HNTA 1GVEA 1UUMA 1EPVA 1ONXA 3HJEA 1RQEA 4JTLA 2WZIA 4Y8FA 4JD4A 4GY0A 2A3BA 5IOBA 4CQDA 1UWTA 4F2UA 4P7OA 2C13A 5EY5A 1QPKA 5AC6A 1ITQA 5KEZA 4DBUA 1DWAM 1E0TA 1JDAA 1EDTA 1YPXA 3RCYA 1FWNA 2Y7DA 1PWMA 3BJSA 1TIMA 3TYAA 1Z6KA 4E3TA 4RZBA 3CEPA 2WMIA 4UNLA 4F0HA 1K7FA 1GVIA 1GYLA 3VMOA 5KTLA 1PSCA 1KWKA 2IUZA 4NYYA 4PUKA 2OLSA 4I3GA 2PI6A 4E8CA 3O7UA 1R3WA 2BNJA 5GPRA 1KW1A 1NOWA 4JS3A 2VI0A 4KWVA 3PZIA 1IXQA 1F76A 3GBDA 4BI7A 3CT2A 2UY2A 5M5DA 3A21A 1ZALA 3C2VA 2PB1A 1UYQA 3MV11 3I7SA 1M01A 3NDOA 8XIAA 3E3HA 1SZGA 3QHMA 2J7BA 5DN1A 4MKNA 1FDJA 4LYPA 2HPIA 3G1RA 1AA1B 1A5KC 3APGA 1XIEA 2WCAA 1LQ0A 3ES7A 5I77A 5A6MA 1HKIA 1POJA 1HF6A 4V1YA 3BLFA 1DXFA 1WA3A 4Z1YA 1OFRA 2QF7A 2BASA 2DVUA 2ZA3A 1KXQA 3POHA 5HNRA 1R85A 1H7WA 7TAAA 5EMMA 1IT0A 1TV7A 5EMKA 1PZ0A 2X2GA 1W9DM 4IG2A 3O15A 5IFPA 1YDYA 5CGMA 2XFRA 3HGJA 3QW3A 4EE9A 5TD4A 2WVUA 3W27A 3C8NA 1JUKA 1G0CA 3SCUA 4FAMA 4PFMA 4Q4QA 3TYCA 2OCZA 2NQLA 4O57A 1NP0A 3BQ5A 3KS6A 2L5HA 1IWAA 2NXIA 1TQXA 2JF7A 1H51A 3R5EA 5CH9A 4JYEA 4HHLA 3VIPA 2TODA 3B9NA 5FJIA 3QMRA 3S2CA 5MKGB 2PBOA 4Q4SA 4IP4A 4MJMA 1FY6A 3NZPA 1MMFA 3O8AA 2YX0A 4ES4A 3SGGA 5DLCA 1C8QA 5FESA 1GW1A 4P8UA 3NUKA 3KP1A 1RJQA 2FPVA 1FX6A 4KH2A 2H3DA 1C93A 1PKNA 1XBZA 2A0NA 4M6UA 2D2GA 2QJJA 2GK1A 4B5SA 1S5TA 1AZ1A 3LM3A 2OQYA 1NH6A 2RAGA 3GH7A 1VFUA 2NV9A 2D3NA 4POCA 1XG4A 1HFBA 4IGHA 1VKFA 1ZZMA 2KX9A 4XG1A 4IQLA 2EEXA 3I4KA 2QJGA 1SJCA 3S5ZA 1N8FA 4E8DA 1P0NA 1GUVA 4BI5A 2WSKA 4B5TA 3FKRA 4JN6A 3KRUA 3B04A 4B92A 1KCXA 2YCLA 4GQRA 4KWOA 2PD5A 3NPUA 4DJDA 2CC0A 3M4HA 2DORA 3NPWA 3B40A 4IQJA 4RV8A 4JCMA 2QV4A 3PFMA 2WZMA 4NNBA 3RLUA 1QT1A 4RZ5A 3CWHA 3TWBA 2E5CA 4PCSA 4UR7A 1QBAA 2V3GA 3BWWA 4KWUA 4P8WA 3C4UA 4YL2A 3CB3A 3TYEA 1YADA 3W7PA 4UIOA 2YDAA 2CZEA 4EPEC 1Q4NX 1B4KA 5DY3A 2VD9A 3Q37A 3VD5A 3JUGA 4GK8A 5AKQA 1R3RA 3N11A 2YPIA 4CCCA 1MDLA 3FJNA 3WLLA 3ZO9A 3VNZA 2A3EA 1RV8A 2ZX9A 4DBSA 2GJXB 3PJXA 2WJEA 3WQCA 2CZVA 1GK8A 4GI4A 1XC4A 3SN4A 3THQA 4MUPA 3HGSA 4MOZA 2QDGA 4D6HA 2XJ7A 5GNZA 3R89A 4NZCA 4GVGA 3LQLA 3HTWA 2QCEA 3VGDA 2W6RA 3JR2A 1A0EA 4M3PA 5I07A 2BY1A 1M7JA 3KW3A 2FHBA 1QW7A 4BF5A 2VEMA 3VI2A 3AS2A 3PBYA 5M1TA 3E0LA 1SFTA 4DAFA 1A4MA 1K8YA 2BHZA 5HJYA 4CNTA 4Z42C 3WLIA 3TIMA 1OM0A 2P1FA 5HPOA 1H7RA 1R2RA 3VOCA 5D2TA 4AC7C 1HGWA 2DPEA 3BAWA 2YBVA 1XV8A 1V02A 4H3DA 4BEQA 4FLOA 3H12A 3ZLFA 2BWGA 2CYGA 1GONA 3ZS4A 1J93A 1FKWA 4Q7NA 1NIUA 1WE5A 3VNJA 1EYWA 4AD0A 1G7VA 2YYUA 5HMFA 4CVWA 2DSUA 4ZFCA 4HPNA 1W1ZA 2ZDRA 2HS6A 2BXZA 3G1VA 2E68A 1KNWA 1UKSA 1P1XA 4NF7A 1UWAA 1W9UA 1WKYA 2YA0A 3COTA 1AJZA 4ML9A 2DSKA 3AUJA 1A5UA 5ABFB 3B8SA 3T42A 2VFHA 4ENLA 8TIMA 1XXXA 2X42A 4XV0A 4PTWA 5IFTA 3R4IA 1P48A 4TX6A 1ZQ5A 2PGEA 3VCNA 3NTYA 1SQ7A 4HNLA 4W85A 1AZ2A 2RDWA 1OT1A 4NZ3A 4TX9A 3V7PA 1XYFA 5DY2A 5A6BD 4FPSA 4MB4A 4D9PA 1T41A 3B4YA 3T2PA 2ZRZA 1E3XA 3UXDA 6XIAA 6ENLA 4XWUA 1EFZA 4K6AA 4GY1A 3K8LA 1HGYA 1GVOA 5AHLA 3QH2A 2B81A 4JQ2A 3EDDA 1TFVA 2PWHA 2FDMA 4RPPA 3V1PA 4TQTA 2X41A 3W29A 1NTHA 1AG1O 1JPHA 4HBKA 3T44A 3RO6A 2BB0A 4ROPA 1EB3A 2V5DA 3NWRA 3W86A 3LQGA 1KTNA 4WJEA 1DTNA 1M41A 5XINA 4EPBC 5BW6A 2HPMA 4MZYA 2QKFA 1OHLA 4WSJA 4XTIA 1K9DA 3IGHX 3IJQA 3PM6A 3GDRA 1N7KA 2DIEA 1OFDA 1TZZA 2E7FA 3M0HA 1A50A 2JKPA 4YCOA 2Q02A 3K5XA 3BGGA 3HV8A 1IHIA 3EOOA 3APTA 1LWHA 2WVVA 3R8RA 3TQKA 3V16A 2YW4A 3TOPA 4IHCA 2PC8A 4HNVA 3N9SA 3LBMA 4NVTA 3BW3A 2Y7GA 2QUTA 1BEUA 3QTPA 3WIJA 3CH0A 1W54A 4HMEA 3WLMA 2QCDB 3OZYA 4JTDA 3HA1A 2EAWA 4LOCA 4Y9AA 4KWWA 3T81A 4JTEA 3AHTA 3RX4A 1CNVA 3R0KA 1J0IA 3LXBA 4I5XA 1QJWA 2OMAA 3PPCA 3DFNA 2TYSA 4AXNA 4Q8MA 3UYIA 1PIGA 2G97A 2DVTA 4ZXLA 4LAZA 4K7VA 4MZ8A 2E8YA 4MNKA 4YTUA 2FGLA 2NX3A 3INPA 4DY1A 2WJFA 3CBWA 1TV2A 3W1LA 3S0CA 1PUDA 2PWVA 4RW3A 1C92A 1OZMA 1U5VA 4TR9A 1BYDA 1DJZA 4C91A 2XWDA 1H7XA 3QGKC 2AKMA 4GZJA 4IZGA 3R43A 3G6LA 3EWXA 2TSYA 3QF0A 4NZ4A 1GWJA 4XVEA 3VNKA 1CBGA 1OG6A 2HXUA 1LDCA 2FGBA 3VU2A 4HP5A 3G3MA 4ATLA 1GKPA 4BY3A 1YHTA 2GVGA 2VEKA 2EJ1A 4ECLA 1C8VA 4IJBA 3AHVA 4C6FA 3EOUA 3LRMA 4FEZA 4H00A 2PTDA 1NF0A 1YXYA 3DBPA 1QHZA 4XKYA 4OHQA 2V3DA 4F2BA 1SUXA 4HIBA 3SUUA 3RRXA 3M07A 5LNSA 3SW6A 3PZMA 4BWLA 2E5DA 3DCPA 3DHFA 5I09A 2J24A 4ICCX 3D0CA 1I4NA 3S5YA 4OU1A 3FA5A 4XIMA 4LF2A 1F07A 4GCAA 4IT1A 4HA0A 1Z7AA 3TN6A 1QO5A 3SO7A 3S6DA 4HGXA 4EK7A 1NWSA 2HVMA 2HZGA 1E4IA 4HU4A 1CLXA 3ANUA 4PMQA 1KCKA 3R79A 3QC0A 2W79A 3TNOA 4JTGA 1REQB 2AL2A 2E4TA 3E1F1 3HPFA 2YLAA 5TBOA 5FIPA 3SFWA 5CG0A 1B54A 4CEUC 2F9RA 4REQA 2PS2A 2JQXA 1ICPA 1IXOA 2QW5A 1GVQA 1Q85A 4KEMA 2PWDA 4LH8A 1ISZA 3FLUA 3CWNA 5FF3A 1K9EA 1UC5A 2CW6A 2IPGA 3L66A 3SRKA 3L23A 4IXHA 2V2DA 3QV8A 1H5YA 2OQHA 3ZSTA 4EP8C 1OCQA 4PBEA 1ELSA 2A7NA 1RBOB 4F0RA 4Q22A 3TYBA 3VO0A 3UYCA 3G1SA 1LRQA 4L6OA 4S3AA 4ZB2A 4DJEC 1EF2A 1VS1A 1D2KA 3AMKA 5A1AA 3JU2A 1MNZA 1RCQA 1YW1A 2CPUA 1JULA 5GJMA 3PZVA 7TIMA 3PPFA 5G1TA 4I5UA 3TUUA 2WPBA 3W2KA 4DO7A 3MHFA 3WLRA 4DUOA 4BQ5A 2ABBA 4IXXA 3MSGA 4FOUA 1HL8A 2XG9A 3CMFA 1ONWA 3LZ5A 1JEZA 4U3AA 3UY8A 3TCEA 3UCCA 3N1AA 5M03A 2OEMA 2D0HA 1V3IA 2WMGA 4G7EA 1ZTVA 3MUAA 1WBHA 1IGSA 1G94A 4BK9A 3MZNA 3OG2A 4XBKA 3QKZA 4YTTA 5CG7A 1NY1A 2INFA 1J6OA 5D2YA 4LNYA 1ECQA 3MYOA 1T8QA 2F38A 1M1BA 4L4LA 4ZQNA 3BL3A 3C52A 2HS8A 4A8NA 1KKRA 2JFEX 3OA3A 4TX8A 4ZB0A 5LGZA 1P6WA 1NAL1 2WAGA 1DQXA 3CZEA 3LV5A 1TSIA 2XWEA 1WUEA 1MUMA 4H6RA 1RP9A 3AIQA 1GVSA 5I3HA 4MJ4A 1WDDA 3GFYA 2HE8A 3B0UX 1PTGA 2H8XA 2V38A 4DF2A 2EKGA 3CLMA 3DFTA 3N73A 4PMZA 4KFNA 4HA3A 2YBUA 4Y96A 4I7VA 3BGAA 3SY1A 5AC7A 3DUGA 1PS9A 4GYJA 4XO6A 3N2XA 3EXTA 1E1FA 3GIPA 1LOQA 1AH4A 1KO0A 1DWJM 3UVIA 4K8GA 4X61A 5SWUA 1W5PA 3GC5A 3M7SA 1GORA 3WFLA 1Q4WA 2ZA1A 2IXVA 3G1FA 4QISA 2IKHA 3UCDA 5I78A 3GHRA 1SW7A 2BTMA 3E0WA 2VMFA 3RM9A 4GIYA 1XICA 3BK0A 2EHHA 3MDUA 3NOYA 3VZXA 4A22A 3CGTA 4MMWA 3HB9A 3AWNA 5I06A 5XIMA 1GG0A 1I0DA 3GFZA 1EJ7L 2FGZA 4IGSA 1QNOA 2CBIA 1UR2A 2JE8A 2VEGA 2VDHA 2WK2A 3UY7A 1B31A 1UPMB 4B91A 2OELA 1TPB1 4US5D 3LM7A 2V82A 2X1TA 3RPTA 3M0IA 3GZAA 3NZQA 5A69A 3MCNA 3GG7A 4IF2A 1YNPA 3RO8A 3FDGA 3CUJA 1DJWA 5BRPA 5CPOA 4L9ZA 5HQMA 3CUFA 2FHCA 2WNWA 5CXPA 4HKPA 4KCVA 4K37A 2DZWA 2QJMA 1JCJA 1KRBC 3CHEA 1OCNA 2P0OA 3U48A 1JXJA 1XLGA 2OX1A 3AS0A 3R8GA 4GH1A 5G1MA 1JD9A 1WPCA 3LOTA 3P6LA 1E6XM 1TA3A 2VENA 2F84A 1W1IE 2VL4A 1O5XA 3P61A 1DVJA 3AHXA 4J7RA 1FBAA 2VO5A 1XC6A 4GISA 3CZJA 4PEKA 1OX5A 1GOIA 4XAYA 1FRBA 5B7ZA 1OX4A 4LUYA 1Y5VA 1KM0A 4J28A 3FEMA 1LLWA 3OBAA 4KESA 4P7QA 5G4WA 2C1IA 4V28A 1KM4A 1UHVA 1MQRA 1E9ZB 4CU8A 5GNYA 4XIAA 1KCLA 5K4XA 4G5DA 2BY2A 3FKKA 4WK9A 3P82A 4QNEA 3OOQA 2PDXA 1MYRA 2YL9A 4LVDA 3EWZA 4IG2B 3W37A 1KC7A 1XIIA 5BOOA 4DM1A 5HK4A 3TN3A 3ECQA 3NL3A 5JBEA 3BMXA 3BVJA 3V0UA 4MJZA 4PCNA 4J27A 1E40A 1B9BA 3SECA 4PTMA 4YYCA 1WKDA 1QI5A 1MFUA 4G9PA 4DZHA 2VFEA 2A7PA 2PPGA 4QAWA 3IACA 4A2RA 4RK8A 1L6WA 4MB5A 3NG3A 5A95A 3N6QA 3GTXA 2YCEA 2JIWA 4NUWA 2NQ9A 4J2PA 4WJ8A 3QOKA 3I3DA 1AQHA 3V5OA 1KFLA 3BE7A 1LOLA 3P67A 1G4TA 1GQIA 1MXDA 3BAKA 2WMKA 3WEZA 2BS9A 4JN7A 1UH2A 3JS3A 2OZTA 2PU0A 3H6OA 4UTKA 1XL9A 5FI8A 3GTHA 1P0EA 1YTKA 5D9NA 2WLZA 5CPQA 2WQPA 4MG4A 5M3WA 5LIWX 1PDZA 2PLCA 1PKMA 4AC1X 4QDWA 2ZC1A 5GQBA 4QG8A 4DZIA 8RUCA 1UR4A 3OZPA 4Q8NA 4P7LA 3L65A 2OT0A 1GPFA 3CPUA 3TJLA 4R53A 4DXXA 2V2HA 4UQDA 2PTWA 1XIJA 3RPDA 3TCSA 1AD1A 4S3GA 4WDUA 5CGQA 1Q6EA 1DXEA 2GQAA 4ZOCA 5LA0A 4O50A 3U4FA 3ZJ6A 3P62A 2V68A 3LYEA 3PP7A 1MNSA 1VCGA 4N6EA 3T4CA 3EWUA 1EL3A 4JNZA 3DOPA 2BBFA 2ATSA 4LTSA 3QQ0A 3VIJA 3V0SA 1UASA 3W2MA 5CC7A 5LIKX 3VKCA 1G01A 1SO5A 5CPTA 4PUMA 4JCLA 3MBFA 3N3MA 1AL8A 2PP0A 1FTXA 3RG6A 4AVNA 3VGEA 3U2EA 4ZMGA 1OFEA 2QCLA 2JK2A 2J8GA 5FJTA 1MZHA 3LB0A 1HN1A 2PDJA 2ZTKA 4H9VA 2DT0A 5BU9A 1IEIA 1E43A 3PPGA 3Q2DA 1MVYA 2PD9A 1IT7A 3UWVA 2VELA 1WZLA 4QEHA 2JALA 2YFOA 4FLRA 4IIBA 1B30A 4S3BA 3C2OA 5C55A 3WZ0E 4MPKA 3II1A 5D02A 4Q4RA 4F0SA 4DJED 3L0KA 1QTWA 5H91A 3N9RA 3R0DA 1K77A 5LHEA 3GTIA 1PL9A 3TXZA 3WBXA 2Z27A 5HR7A 2R1PA 1Q6GA 2A79A 4B16A 2HK1A 2UY3A 5A94A 3KL5A 3RUBL 3VIKA 4JTTA 5T9BG 1OT2A 3K8MA 1R3TA 4LANA 5F4XA 2PTYA 2QCFA 5FACA 5DX7A 1QPQA 2E9MA 3QPZA 2H8ZA 2EF9A 1V5XA 4R9XA 3T0DA 4YPJA 3ME3A 2V5JA 2ZBTA 2I9EA 3B0PA 1TRIA 2ZZ7A 1GVFA 2DH2A 2CITA 3HGOA 4WDTA 5CZJA 1GW9A 2WWCA 2YOCA 4EKJA 1HJXA 3DGRA 4H4IA 3THUA 4H9XA 4A3UA 1UKOA 2R14A 2XIIA 1KM1A 3HM7A 4ADUA 3VD4A 1IEQA 5ENLA 3N4EA 3GXDA 3W01A 5JQ9A 1H7PA 4ADTA 1JQVA 3U5UA 1FUYA 3W73A 1DHPA 2CBJA 2F61A 1QOPA 4DWSC 4Z1DA 1E0XA 4FLQA 2WW5A 3SSZA 1BQCA 1E1CA 5LNWA 2WB5A 1TRDA 3WJYA 1EZ2A 1Q6CA 3OJGA 1R2TA 1JRBA 2XTKA 2ZFAA 4XUYA 1W5MA 2V5LA 2VRJA 2H3BA 2D2HA 1PE1A 4D6DA 2X1UA 3DG6A 1MW1A 2WHKA 1J79A 4Z2LA 3AXXA 4HN8A 1Q63A 4OECA 3NZGA 2FZBA 3OODA 4CCDA 4RXGA 3FN9A 3TSBA 2QDDA 2QPUA 1XM3A 3K46A 2XISA 3QN3A 4LYRA 4L6HA 2V0TA 2FKPA 4OOZA 1QWKA 2FMNA 3DAQA 4NXKA 1ZBWA 3TZFA 4YCPA 2PLMA 1VFFA 2ZE0A 5FCZA 1UUQA 3IIOA 1J12A 4GVHA 2E67A 1G4SA 1AQ0A 1GYMA 5DCEA 3TKFA 3CV6A 2Y7EA 2NQHA 3BICA 3NQGA 1HQTA 3BLEA 3CJPA 1Q7QA 4JX4A 2QJHA 3VMPA 4YNGA 2V81A 4W88A 3GM8A 2G8ZA 1AW5A 4GIAA 1MXSA 4FR1A 5AHNA 4RW5A 1Z42A 4QSHA 4FNSA 5H8PA 2A3CA 4GG9A 3HMJG 3RHGA 4KCTA 2D2OA 5CSSA 5D9PA 3EOEA 4PUEA 2CKRA 3OIHA 3CXOA 5KITA 5D2XA 4IIGA 3WQ5A 1RD5A 4LCSA 3WQEA 3RM8A 2J7CA 4LBRA 1HKKA 2G3FA 4WX2A 5ABGA 1KM6A 3SSJA 2WOQA 3W7MA 2E6DA 4JTUA 1SFJA 3L4YA 2A1YA 3WQGA 4TVCA 3DHPA 5AZ0A 3WQWA 5EBUA 5D4YA 3WD4A 5LYRA 4DO6A 5BZAA 3B9EA 4B4HA 5C2GA 2JGYA 4IPJA 3O0FA 3W2NA 4AMCA 4UC5A 2BVWA 1XRTA 4F4RA 3POCA 3U5YA 4JICA 2XFWA 4WJXA 3OEXA 3L4VA 1FWDC 1I2RA 1DJIA 3G1HA 5A2AA 2DFAA 3GDBA 3DC0A 3LMZA 1UWUA 1OD0A 4NL1A 4TTUA 3DG7A 4TTGA 3OG3A 4N9CA 3IVSA 3L2LA 3JZEA 1E4NA 4ATWA 3PZNA 1I75A 5I0DA 2E5BA 3O0KA 2XYLA 2PDNA 1GZ1A 3ABSA 2V8ZA 2P88A 4D72A 3Q58A 4HQVA 3ZJKA 1FCBA 5I03A 3MI2A 1VQTA 3W4RA 2NV2A 2DZPA 3AC0A 3WD3A 1R3YA 1UW9A 1H2JA 3LXCA 3GVQA 5I7GA 2WC7A 1XYAA 5E0FA 3UZYA 5CBIA 1XBYA 3WUFA 1YPIA 5BRBA 2C19A 1VD6A 1D7FA 3DECA 1S2WA 1WB0A 3H70A 1X7FA 3H55A 1UOKA 5REQA 4JNYA 5BXSA 4MVAA 1UZDA 4LUSB 4E8GA 4IMEA 1S5NA 1EOKA 3ANVA 4D6GA 2OOFA 3EXSA 2OODA 5LNRA 2PC4A 4Y9PA 2PTXA 3SADA 2ZE3A 3BLPX 3WQ8A 5DT7A 5K3VA 1A4LA 4MAZA 1P0BA 3TQPA 1E5JA 3M0MA 1GNXA 3MHGA 1AD4A 4D6CA 1XLAA 5GJNA 1NVMA 1LWIA 3CS2A 3SCVA 3C2RA 4OV9A 3N9KA 1I2OA 4DUWA 4XAPA 2QYGA 4AZ5A 1E1EA 4GOAA 1VFMA 4LUTA 3VYLA 1ISVA 4UNIA 1I0BA 2CESA 2WLYA 1C29A 3CAWA 2GLKA 4LY8A 4WQ6A 2FZ9A 4AISA 3C3UA 1VR6A 3T6CA 3CU2A 3FHAA 5LHFA 4GVIA 5BXRA 3ZVHA 1VZWA 3WSUA 3GH5A 3PY2A 4PMRA 3EOLA 1MEHA 4NAEA 2G96A 3W1PA 1B57A 2W66A 1ZAIA 3Q65A 4PRWA 4YMZA 2HBXA 3DU0A 5BROA 3S1WA 1Q6FA 3O07A 4AVFA 4A2SA 1E6ZA 2Z24A 4QG9A 3MSDA 5CJMA 4O15A 1XQLA 3MY9A 5CPNA 2HMCA 2WNNA 4KGLA 2E77A 4QSFA 1TPFA 4TO8A 5FD0A 1UP0A 1TTJA 3WD0A 2W92A 4A8RA 3QY7A 1X1ZA 1M9HA 4JOMA 2ZCGA 5AC8A 2Z28A 4C7FA 1SR0A 4XUGA 1O95A 4Y9MA 1DE6A 4GO9A 5JH1A 5EMUA 1JF5A 2C6QA 4KERA 3EDEA 1US2A 4Q8OA 4O12A 3C0LA 3BZGA 1ENUA 1DL3A 5LA1A 3PUGA 5I3FA 4CNPA 3V36A 8XIMA 4ZVJA 2Y24A 2CLKA 3LRKA 1Y65A 2OYKA 4XQ6A 1F3WA 1W3KA 2QHAA 2Y5SA 1XLEA 2VZTA 1UG6A 4S38A 5BNKA 1VBHA 1ZCCA 1ONEA 1J0KA 2VT0A 1KFJA 3ITOA 2WVTA 2I5GA 3TNBA 2YDQA 1ADOA 1CYGA 3EWCA 3UR8A 4FK9A 1JQXA 1R7OA 1J0ZA 5T91A 1YBQA 3IJLA 4DJEA 3W23A 4XZIA 1RY8A 2G5WA 3VIIA 2JBMA 1R7AA 1A3XA 1EJTC 3KOWA 1JGIA 3NEHA 3P84A 4D71A 2ZC8A 4YTRA 3NFUA 1W3LA 1TV5A 2W62A 2ALRA 1UWIA 3B0VC 1E6RA 1JD7A 3F4NA 4Q8UA 3LGEA 3CV1A 1Q7MA 5D32A 3PR2A 4ONVA 4PMDA 3FJLA 5I3DA 4S3EA 4WY0B 1YXCA 1A47A 1KM2A 3KBMA 3KTCA 3SCWA 2Z2UA 3S1VA 2GDUA 3GLCA 2UWFA 4DUXA 5CLWA 5IDZA 3ARYA 3WK0A 2CZDA 2J7DA 4AVOA 3HPSA 3EWYA 3GKAA 3ZFHA 3V1HA 2YCIX 1EUNA 2E3ZA 1PX8A 3QHNA 4PCPA 3C5QA 1GHSA 4GUGA 4ZSUA 4FNUA 2PODA 1UR8A 4G7FA 3EB4A 3L0NA 2XVGA 3QM3A 4K1WA 5H8MA 3U0HA 5HULA 1VJSA 5AY7A 3M0JA 4MWAA 2ALDA 4BA0A 1KWGA 1MRQA 5A8OA 1EHAA 4GJ1A 1TREA 3A9IA 1A5LC 3NXLA 4P8XA 4DZAA 4CQ9A 1W6TA 2A21A 5BU6A 3ZSSA 2ZADA 2VWSA 1C9WA 1WZKA 4O1EA 5K9XA 3QQWA 1H7OA 3M5YA 4JQAA 1A5MC 3I3BA 2ZRUA 3O16A 4S2CA 3UD6A 3NURA 3QY6A 3BAIA 1JYNA 1RJPA 4UWMA 4WOZA 2E0PA 5FF2A 4M24A 3EKLA 5BOEA 3BAXA 1B3OA 3N2OA 4HPHA 3UPBA 3W2LA 2AMXA 4WXYA 3GW0A 5GJPA 3PUEA 3LLDA 3M0LA 4I90A 1HT6A 3UF9A 4OBTA 3W1AA 5HAOA 3SRHA 3SCQA 2IKJA 4E2VA 4GINA 2WPGA 5C2XA 2P0IA 1V6YA 4EPKA 1HJQA 3S9IA 4H1ZA 4Q32A 1ITUA 3ZT6A 3GQYA 3Q94A 1VPYA 3NPXA 3L4XA 2GPTA 4LC8A 2EPNA 1GCYA 1UIOA 3TLQA 2PDMA 4PR4A 1NELA 1AH0A 5DXXA 2Z25A 4U31A 1XLBA 4ERAA 2GVEA 5AZ1A 1BWVA 3P5ZA 5EMJA 1WQ5A 3B0XA 4Y6GA 2A4AA 2DT2A 3W7QA 4FNQA 2PDIA 4Y8EA 4DELA 1JCMP 3EAUA 1OX4B 3WH6A 3MA8A 1RK6A 3HO8A 2XSAA 1TPEA 3K8KA 1AJ0A 3AALA 2HBVA 2A5HA 4AY1A 2OPJA 1Q7ZA 4EACA 4IQEA 1V6XA 1E3ZA 3BQ6A 4C7GA 3LERA 1LG1A 1O12A 1E6QM 3K4DA 3MCOA 2C8NA 1V6TA 2QEZA 3I3EA 3OQ8A 2QV5A 3MMDA 1XD1A 3DG3A 3OB8A 1TZ7A 1CLVA 4I8YA 3I6EA 1O1HA 1WDQA 3T40A 3WLSA 2P3ZA 5LXXA 2EXOA 5AFDA 4BQ2A 1PDYA 4CD8A 3EDFA 2NQZA 5DRCA 4V33A 3IAPA 1HNYA 5C8BB 1N55A 3C0SA 3EA3A 3UWYA 4A3RA 1AODA 3IVTA 3W53A 1VBRA 2XVPA 1BF6A 3ENLA 4DBWA 4G6CA 5HQLA 4BKNA 3LI1A 3T78A 2VWTA 2J9ZA 3BARA 2X7VA 3N15A 5U7SA 3THAA 3DENA 4N4QA 4DJDC 3CNYA 2D24A 4LF1A 3MMTA 3GXTA 5TQLA 2YGYA 3ZWSA 4HYRA 3HG3A 3SURA 3UXIA 4C90A 3VIGA 1FH9A 3ZQ9A 3QJAA 4GI8A 4PSPA 1U1JA 3HJZA 4NY2A 5GNXA 2Z2AA 3T09A 4AD1A 4N42A 4YVPA 4DF0A 3WQDA 3DX5A 5BOFA 4EXQA 2ISFA 4Y2WA 1JZ8A 4O19A 1M7OA 4NSBA 5HDRA 5AYIA 3FY1A 5B7YA 1GQKA 2GZXA 1PYMA 1RQHA 2W63A 4RDVA 5EMYA 4JTSA 2V5KA 4QAIA 4B5NA 2NX9A 1JAKA 2PFHA 3CUGA 4JGDA 2FVKA 4MFDA 1N2VA 5F2GA 2IPJA 4KMQA 5GVJA 1CXIA 3MB9A 3QPEA 1V6UA 1KFEA 1E72M 5E09A 4RCXA 4C6JA 2PSNA 3ANYA 3VOJA 4PUUA 1X98A 4WR3A 3L4ZA 1SSDA 1IR1A 1NU5A 3FNDA 1SM9A 3QFEA 1Y7VA 2ZICA 4JYFA 1IZJA 2NV1A 4B5VA 5JU6A 2W5FA 1E71M 1VFSA 3IJ7A 1RBAA 4Q4KA 1UWSA 3CAVA 3GG8A 5CGTA 1EGZA 3KAOA 2POZA 2HNEA 1RBLA 4XISA 3RGTA 1S2UA 3GVGA 4D6EA 4JTAA 2PAJA 1GOMA 1AJ2A 5C7VA 3RITA 1SFLA 4XZWA 4YXGA 1GT8A 4C6QA 4UTWC 4GFSA 1ZSXA 3GNOA 3LA4A 2PDUA 4LAUA 1XIHA 1ZLPA 3OVGA 4NJIA 1F05A 3WNMA 4JIPA 4YJ5A 1U30A 2DQWA 3KCLA 3PZ9A 4F2TA 5CC5A 3LU2A 4A8IA 1VPXA 1VB9A 2GYIA 1O1ZA 4I6VA 5EB8A 2VDGA 2GDQA 6REQA 2ZVIA 3FDKA 4P5UA 3AIEA 1L9WA 5L9FA 3PN8A 3TWAA 2DU2A 3SN1A 2ZUVA 2MNRA 1UKPA 3CQHA 1UD8A 3FHQA 3LPOA 3MU7A 4J3SA 4FX8A 3B8IA 3AJXA 4JDYA 1K4GA 2E40A 4D8LA 3H22A 4QS6A 3W82A 1AVAA 4ZTYA 1ME7A 3ATYA 2X1IA 4NZ1A 3JVAA 1HIZA 2BFGA 2CHOA 3GG1A 5LKYA 1ADDA 1LQ2A 4XSLA 1DPMA 1XINA 4E2OA 2XM1A 2E9LA 4A4AA 3OYXA 1OC7A 4HU3A 3RF9A 4PBFA 7CGTA 1KQYA 5FL1A 2Z1VA 3H53A 3H24A 3NYDA 1YMYA 5CZ0A 1Q8JA 2BHYA 2E6FA 1RXOB 3GC2A 1H11A 1V4YA 4B90A 1LORA 3PNZA 1G67A 4IFRA 4L5ZA 1VAHA 2ISVA 2CFFA 3CMJA 3TE9A 3VOFA 1UA3A 2F6XA 1W2VA 1TVNA 4NI8A 1FH7A 3UEQA 2AGKA 3BANA 4M1RA 1VCFA 4J3WA 3NM1A 5HUOA 1BRLA 1TE1A 4JY8A 4MWAE 3EZ4A 3BV4A 1W31A 1JYVA 3ABRA 4JHOA 2QJNA 2HROA 1J0JA 3MDWA 3BLIA 1LP6A 4UTMA 4PCFA 2CCRA 4C6EA 2J74A 4W86A 1L0PA 4DWSA 3LHWA 3QEZA 3WK2A 4A3QA 3BZJA 4E0CA 4JNMA 4W87A 4LB4A 1Z9AA 4AFYA 2OSXA 4ZQMA 1M04A 4Q4MA 2XVLA 5I2UA 3O05A 1DXIA 1TPWA 4HD5A 4QM1A 1XYCA 5A5WA 3TMQA 3AQUA 2REQB 1E0WA 2A2IA 4L64A 4YWIA 1O66A 3TYUA 1FP9A 2P10A 4F0LA 3KBSA 3H4GA 4HJFA 3SDOA 4IL0A 4GKTA 2NSXA 2B0MA 4WCJA 2PDPA 4L4PA 3TQ0A 3UNDA 3FCPA 4WF7A 3GE7A 2WM0A 3S5NA 3PF3A 3OPSA 1MEIA 1OC6A 1XF0A 1CT5A 3KRZA 3S5OA 4FB7A 4Y9NA 1LRNA 4UFIA 2Z4GA 4W7WA 4QLLA 3MCMA 3W85A 3ZZ1A 4MF4A 1UMLA 3WUGA 3ALGA 3WDJA 3A5VA 1YDVA 2BGNE 3OHMB 1M03A 3G0SA 3QHOA 3WLQA 3WJXA 2O7QA 3UBPC 4HMCA 3HIJA 3QV9A 3S2NA 5DMMA 1BQGA 3W25A 7XIMA 2BOFX 1KFBA 1CGTA 3VA8A 3WY1A 4ORIA 4Q33A 2QUNA 3T8QA 1V3HA 2R1MA 1XSKA 2XVKA 4GY7A 1U5HA 3WNKA 1Q6RA 2VZUA 1SZEA 3DYOA 3WBEA 5AC5A 3DFQA 1A5SA 4TMCA 2FQIA 1MXGA 1WZMA 1S2AA 4Y90A 5A2BA 3TYZA 1F3XA 4MPQA 2J8FA 4AY8A 2Y7FA 1EIXA 4J3XA 2I1OA 3U3HA 2BP1A 4ZR8A 4NJJA 1DIKA 4R3UA 4HNOA 1I45A 1WKFA 4Z2JA 3IUHA 1G4PA 2HV5A 2G50A 3TC3A 5D30A 1JNEA 4KT2A 2OO0A 1D3GA 4P7RA 2OU4A 3B9AA 4AZ7A 3LBOA 3VM7A 3S83A 3F03K 3E9AA 3A4JA 4M80A 3MUIA 4GCXA 3WQVA 1WNOA 1S3HA 2MUCA 4FZIA 5FOOA 1LT8A 3N19B 3V5CA 3QMTA 1F74A 1S46A 2JEPA 1JZ3A 3PFRA 3S6OA 3BMVA 4O1CA 2BXVA 2Z6IA 2HVNA 1V7AA 4YWSA 4OUIA 3LEPA 9RUBA 1TPDA 1VRXA 3NOEA 2FHFA 1OFBA 1JAEA 2VQTA 2Y8VA 3F1QA 3VZZA 3AZSA 1TTQA 3MWCA 4Q3MA 1H09A 2DZTA 5EL1A 7A3HA 1PV8A 4DJDD 1YTDA 2R94A 3H54A 1WBJA 1IZCA 1V93A 2ZWZA 1HG3A 4ALDA 1UD4A 4LBUA 5F1UA 4O54A 5BMXA 3LHTA 5E6ZA 5E93A 5C54A 1XBXA 1SYTA 2XSXA 1T99A 2GUBA 1ZPTA 1ZHAA 4NNCA 4QE4A 5J8LA 4KFOA 2A3LA 1IEXA 2FVLA 1XS2A 4HTYA 3PZOA 4ZQPA 1A5NC 4AZBA 1EBHA 3QBUA 1CTNA 2D23A 3G6MA 4JPGA 1QMLA 2G37A 3OO2A 2VVNA 4CD6A 1X6LA 1TZ9A 4JIEA 2YB1A 4PUWA 2Y70A 4UFJA 5C9UA 1JNDA 3URQA 1XISA 3EX1A 1CGYA 3RLHA 2VHLA 4GABA 3KBNA 1R9YA 1EJRC 4K8EA 3V35A 2FDSA 2J7FA 4PBGA 2YXOA 1J9YA 1BSIA 3N4AA 4BFAA 3W74A 2G41A 3P93A 2XU2A 1F9CA 1OK6A 1W9XA 3AIUA 2QUVA 3G0UA 3ABOA 1TJ0A 1E70M 4BJHA 2NXGA 1S5MA 2AL1A 3R11A 4UTIA 1IXPA 3L67A 1XKYA 4GZEA 1CXKA 4AEOA 1JXKA 3FYPA 3PSWA 4TVDA 3UWWA 2QGHA 5A8QA 1E6NA 4GMEA 2CLIA 1DE5A 1SSGA 3GXIA 4AU0A 4JL2A 3KCJA 3HMCA 4H7CA 3CL8A 4LT9A 4ADSA 1QASA 2FH8A 4UMAA 1TX0A 3IARA 1TWSA 3KHJA 1ME9A 3QZ6A 4ZO6A 2EBNA 3EA1A 2PDWA 1IIHA 3FIGA 6TAAA 3WDHA 4LCQA 2PWEA 1QFEA 3DERA 3ID7A 4IGNA 1VBJA 3LG3A 4HZMA 4GPNA 1QWGA 5U4NA 3K30A 5JMUA 2NT1A 4K68A 2OWWA 4HCLA 4AD2A 2LLEA 2ABAA 1TV3A 3WF4A 6XIMA 4CQCA 2QNEA 5DF0A 1BXBA 2J4GA 1QDSA 2Y8KA 1BFNA 2AQWA 2FZDA 3DHDA 2J75A 2CZFA 2VEPA 1GEQA 4L1GA 3HG4A 2ZDSA 2WC3A 4ASTA 1HJWA 1QW8A 3GAYA 1LM1A 3VD3A 3EKGA 3SEPA 2P53A 2UY5A 1FWJC 1YX1A 1ESWA 2DZXA 5K9CA 1RH9A 3K4AA 3W7JA 2XHYA 1EHNA 3R7MA 4L4MA 2D3LA 4PTVA 1QOXA 4MKVA 4HK5A 4LBSA 2PWFA 5H8UA 7REQB 1OYCA 3H7UA 1YDNA 2FFCA 4ACYA 2BGSA 1FFRA 4DXVA 5D2VA 4AZCA 4MM1A 3CMGA 3ZVIA 4HA4A 5B80A 2WYSA 1NFGA 2GGHA 3CPRA 3PUOA 5K9DA 1VYRA 2Y6ZA 1IR2A 1DJYA 1HVQA 5ABHA 3FOKA 2QVHA 3QC3A 5CSYA 4GYFA 4HNCA 1XFCA 4XZ9A 3QKEA 3TAKA 3OZOA 5AVNA 5F2LA 5AB3A 4BQ3A 9CGTA 4J3VA 4PMVA 5KETA 1AW2A 4NILA 3BDKA 1V08A 2B7QA 3XINA 4O4WA 3TVAA 1FHVA 1DWHM 2WKJA 1XYMA 3HQOA 1GKRA 5AN7A 3VDGA 1A80A 3KTXA 3W81A 1EH9A 4C1NB 3R8HA 3TTQA 3FS2A 1BYCA 4OOUA 2YR1A 4LU0A 1RK5A 4E3VA 3CPGA 4W89A 2OVLA 4EOUA 3PWAA 3KX6A 1QK2A 3GYCA 1D9EA 3W7GA 1O60A 4UTUA 1EKOA 4O53A 3I4EA 1SGJA 3LTSA 4G1NA 2C3ZA 4PB4A 4HJWA 5A3HA 1R5YA 1C8YA 1H0IA 2CKSA 5CZTA 1H50A 1EC7A 4OT7A 4WY0F 1OX6A 3PG8A 2DZUA 5CJNA 3BCFA 4S3FA 3TJXA 1EP1A 2E6AA 4IIDA 1H7NA 4HT3A 1S2TA 4OBRA 1LOSA 4E4PA 1DTUA 3HG2A 3L4WA 3ABZA 1QPRA 1KBBA 4RZ6A 3BAYA 2VRQA 4QIUA 2HSAA 5ECUA 4WXZA 4HSOA 3BJTA 4PUNA 3TP4A 5DANA 2V67A 1F3EA 1ZJAA 1RR2A 3USBA 1EC8A 3VKBA 4W9TA 4JFSA 5EYWA 3T0BA 2A7RA 4WD0A 4KIEA 3E74A 4NZFA 1J2BA 3V0TA 1UJQA 4A29A 1SW3A 2VOTA 4ZSTA 4DI8A 3H4XA 3NR0A 1IE7C 3MS8A 4RE3A 4U2ZA 4S3JA 4GI6A 4UQBA 4PULA 3MKVA 3M0YA 3CIVA 2VGIA 5G2HA 1GQNA 1TMHA 3SCPA 2C0HA 4XBSA 4C65A 1W37A 1PVNA 3PULA 4IJRA 2BVDA 3URAA 1HL2A 1RA5A 3GVWA 4HCDA 1YIXA 2PZ0A 2VFDA 2F6UA 1ZBVA 1M3UA 2BXYA 1GG1A 1X97A 2ACSA 1T0OA 3N34A 2FB3A 3NSNA 3RFAA 3V3WA 2VUNA 4YU1A 1BXCA 3STCA 3D6NA 3PJWA 3TAOA 2VCCA 3KDNA 4C60A 1LQAA 4JYDA 3EWDA 4QS5A 4CD4A 3B3DA 4MLJA 3CL6A 4RNJA 3NL2A 3M64A 4XSMA 3DXIA 2H9AB 2WSPA 4OKDA 1WXJA 4N9EA 3LENA 1O5RA 1OGSA 4FIQA 1ZJHA 5EA9A 3T0CA 2PU1A 4BS0A 1GOOA 4KF1A 2VFGA 3BG5A 4FS9A 1LCOA 3FX4A 1P6CA 3LDVA 1OJXA 2XH7A 2YB4A 4TOQA 3CO8A 2WANA 4BHYA 3TSMA 1UWRA 2YL8A 4GXMA 4QJ1A 2J7EA 2E1WA 3V75A 1H1NA 3TZNA 1X1OA 1R86A 1IIGA 3IIPA 2GJNA 4ZOBA 3PZUA 5XIAA 3VIMA 1YEYA 4DI9A 4ZXOA 2D0GA 4QXIA 3L4TA 3NDYA 5A6TC 1GVRA 4CCEA 4JIQA 2GWGA 5DBUA 1TTIA 3UJSA 1RY0A 1AW1A 4NU7A 3VINA 4LFYA 3G3DA 1HKWA 1O68A 4IX2A 1U2YA 1JF6A 2ZUSA 2WZHA 3FGCB 1WO2A 3CUIA 3EDJA 3I68A 3VX0A 3T0TA 4M51A 3WF3A 1W3NA 5L6UA 1VFTA 2ZX6A 5LSMA 4IP5A 5C9XA 3ZXWA 1W1B1 5LGXA 3TV8A 3A47A 1MEWA 3MANA 3PBMA 3PPHA 4IFOA 3NGFA 5HXMA 3TTYA 5ABEA 4U5IA 4LAKA 3EB3A 3OVQA 2WHLA 1VP5A 1O4UA 4E2BA 3DH7A 1ISXA 5AYBA 5C70A 1UD5A 2OQLA 1W1VA 4QHRA 4YVXA 3WX7A 3QW4B 2F7FA 4DZ5A 4AW7A 3GSMA 5E0CA 5C9RA 4G1KA 3EBVA 1LUCA 4PMNA 5MKGA 3KVJA 3W24A 3CB8A 2ZWYA 2GFTA 4N0RA 3NQ8A 4OZOA 2MANA 4H9YA 2G3IA 4L4OA 4DPPA 2VZOA 1V7YA 1PXGA 2IKIA 4LV4A 3VC5A 2QLYA 2YA1A 4BF9A 5M17A 4FOKA 4ZO7A 4IP7A 2XGZA 1J5SA 3LCWA 2ON3A 3P3BA 2PWGA 4A6GA 1NF7A 3SQLA 3IWPA 1UP2A 1I2PA 1UH3A 4JR5A 3NO5A 3VGHA 1D3CA 3K2GA 4F0KA 1NEYA 2QULA 3GVRA 1K6WA 4AIEA 3NCOA 4U28A 1WKEA 2J47A 4O14A 1KD0A 3D5HA 1JUEA 3CIWA 2JF6A 3MV01 3WDIA 2BX7A 3QQ1A 2R1LA 4ZO9A 1FXQA 3TX9A 3BJFA 3S9YA 2HK0A 3CH9A 4QQ3A 2PMQA 2VURA 3LN3A 2NVDA 3REQA 2NW0A 4F79A 1XP3A 4FIRA 2Y88A 5AHIA 2ZX7A 3TA6A 4UTWA 5PTDA 2NUWA 4ZOEA 5HQEA 2VVSA 4E4FA 4B5UA 1K70A 3P7YA 1R9ZA 3BLKA 3QYQA 4DO5A 2OG9A 3A3WA 4IFKB 1F6PA 3OVRA 4RE4A 4AY7A 3IV8A 4J1OA 1UBSA 1LL7A 3IRSA 3TSDA 1XCXA 1KFWA 3CQ0A 4IUGA 4D6IA 3BC9A 1W8GA 4NI3A 4IPLA 1P6BA 1ZFJA 1K7XA 1JCTA 4PFHA 4PL1A 1RALA 4GD0A 4OUEA 4GGHA 3UA4A 1RQBA 1KBKA 1ML1A 1ZCOA 1OC5A 4Q8VA 3PTKA 4L9YA 3TTOA 3H7VA 3HPZA 1XYLA 3A9BA 2PWUA 1HX0A 4MIMA 1TWDA 3S2JA 3ISIX 3KCOA 1KV8A 5D8ZA 4ZL1A 1F2JA 5KINA 1IF2A 1M5WA 3LCFA 3C0JA 1OWQA 2GJXA 3NO3A 4QTGA 1M7PA 4NP7A 3N29A 3QR1A 4INFA 1E73M 1GOKA 3WELA 1UD6A 1E4MM 3LBCA 1K9TA 1YPFA 2Q3OA 1PB0A 3RLVA 4F3HA 4H01A 1QK0A 1PKYA 3ARTA 1MSSA 3ARRA 3O6AA 3W1NA 2GUUA 2VJXA 1HKMA 1H63A 2EPLX 5C7HA 1WDSA 2A6LA 1J11A 3MI3A 2CEQA 3W6MA 4AXKA 4W84A 4AF0B 4UFLA 3M9YA 3SCOA 3RIKA 3U2OA 3W76A 4HTBA 4E5TA 3EXRA 3LHUA 3L4UA 2NLYA 1YRRA 3WNPA 4EVZA 5CZKA 1FWFC 1V6WA 3VX1A 4OTKA 3DGBA 3W83A 5DQPA 1QNPA 4KCUA 2WO5A 3FYOA 1V8EA 3A24A 3WLHA 3LPFA 3ATZA 3STFA 1K1DA 4I8DA 3T1GA 1XLDA 2KAUC 3TQVA 1UMYA 1XUZA 3M46A 3SUVA 2GOUA 3GDLA 1TVLA 1QI2A 2CHRA 2PDGA 1F73A 3TJIA 1AL7A 2X16A 2WSQA 3WBWA 1R3VA 3U7VA 1XGEA 1F3TA 2J6VA 3NXFA 1F4HA 1BD0A 3BH4A 2EPMX 2J13A 4F8XA 1TV4A 1R47A 5CAKA 4L65A 4IIEA 2B4GA 1WDWA 3BV7A 5HWNA 5MHBA 5FAJA 1XDJA 2YXGA 3AMLA 2NXHA 1C7SA 2FMOA 3SR7A 4AH7A 4IJCA 3PJUA 2QCCA 3TN5A 4XO7A 1KFCA 1XLCA 2AGTA 1EIBA 3THDA 4C6CA 2HCVA 3ONCA 2OZ8A 1QATA 4ZE5A 1N8IA 2BZNA 3DIPA 4GQBA 2ZXBA 2E8ZA 3BOLA 3TTEA 1KBLA 3NZRA 1JI2A 1IEWA 1GJWA 3W7RA 4AZHA 3APYA 5JUVA 4C6DA 4RDYA 1C9DA 4H2HA 1PWLA 3WQ4A 1Z32X 2B7PA 5FEXA 3V18A 3TR9A 3NL5A 3UXLA 3GNNA 4DBDA 3NQBA 1FWTA 4XAGA 4D1IA 4P8VA 4O8AA 2VZSA 3PZGA 4DAIA 3NIYA 4AIBA 1LRTA 1KR1A 2X0SA 3GD6A 2EPHA 1MZRA 3CV7A 3GIQA 1XHGA 3RX3A 5IHRA 1A49A 4QP0A 4HYWA 3O1NA 5LNUA 3QFWA 1YNQA 5KZEA 4RKAA 1EGVA 3J7HA 5H6HA 3FFSA 1R0MA 1TMQA 5AHEA 1L6GA 3OTRA 3MVIA 3RYSA 1W3JA 2GQ9A 1HL9A 5MF5A 1MWOA 5E9AA 4FOJA 4HA1A 2YA2A 3ZJ8A 3LHZA 2ZX5A 4GJIA 1US3A 4N4PA 3KTSA 3M7WA 5DCBA 3AIVA 5ECVA 1ZUAX 4UFKA 4JTKA 1UZ1A 3Q45A 3QR3A 2WMHA 4R7JA 4CQ8A 3RILA 3SAZA 1GTEA 2AAMA 3R13A 3PJTA 1QNVA 4DEFA 4JHZA 3SQSA 3VNDA 1JZ5A 3MP4A 3OYZA 3E2RA 1LBMA 1U33A 3S2LA 1FHDA 4JTJA 2QPSA 1EP2A 5E1QA 1D3HA 3G1YA 3T0AA 4HMDA 1ZY9A 4PUDA 2R91A 4B4FA 1DOSA 3CHFA 1EDGA 2J25A 2VZVA 1ITCA 2Q8XA 3VKAA 3AWOA 3RCMA 3MW7A 5JBDA 3N25A 4QBXA 2Q3RA 3BW4A 4M82A 2G4FA 3BMWA 3N12A 3SN0A 1L6FA 3RJXA 2RGLA 1UD3A 3WLOA 3W71A 1CZ1A 1G1YA 1FCUA 1J2WA 3DKLA 1FA2A 4OWGA 1VFOA 3B0YA 5I24A 3OIXA 4DYJA 2CBVA 1CGVA 4R7OA 1V0KA 1CGUA 3G2GA 4EPDC 3ZT7A 3SFKA 3H2OA 2ESCA 3L5MA 1SMDA 1J10A 2ISDA 3SGZA 2RDTA 2WHJA 1SJBA 3F2CA 1XLFA 3NQ2A 4XVDA 3E2SA 4C6MA 4BQ4A 4YTSA 1LTDA 1JZ4A 4DO4A 1BHGA 1YNYA 1WDPA 5A8GA 3S46A 3I65A 4C1LA 1ZGDA 2V5BA 6ALDA 3B9OA 4H8UA 1F8MA 3VDHA 3PK7A 3B9DA 4ZA0A 1EZWA 4GYPC 1EXBA 5DO8A 4H7VA 3PC0A 1THFD 1SPQA 3M5XA 4B2DD 2Z6JA 3VXGA 2WJDA 2VGBA 3UCQA 4NJGA 2OGJA 3NYZA 3NQAA 4YS1A 1Z89A 2ZUNA 3UG3A 3VILA 3EDKA 3SJ3A 2VC9A 2XGBA 2EPKX 3AMCA 4AZ6A 4EANA 3GAKA 3NAVA 3UGRA 2ZXDA 1SJAA 1TPUA 1M6JA 4LVFA 2QCMA 3SCRA 1WXZA 4M7TA 1GYNA 3GR4A 2AQOA 2H6RA 4RX0A 3WFAA 4PUJA 5D37A 2VM8A 4OGZA 1REQA 1C91A 1EQCA 2V63A 5LIYX 3A3XA 1QNRA 4HHHA 1WUFA 4U10A 2PF0A 2OWCA 4MWAC 4RNFA 1S5WA 2ZRWA 3FXGA 3LHVA 3GXFA 4HN4A 1W8SA 3U2ZA 2P50A 5FJJA 4CNUA 3R10A 1R38A 3O06A 4FX6M 3OGSA 4J2MA 5IDIA 4LS2A 4ROQA 4OFCA 4LQ1A 1B1YA 4GGBA 5I00A 4AHPA 3P0WA 1HKVA 4ATDA 4AMAA 1GGOA 1JYWA 4IIFA 1DIOA 2DSVA 3PBGA 1XH0A 3WN6A 3PZQA 1V0LA 1OF6A 5HMEA 2HTMA 1SU5A 4M7SA 5T9CE 2C1HA 4OE7A 4K3ZA 1JPMA 3K13A 3N18A 5KZ6A 1E9YB 3MT1A 3TA9A 4QE5A 3JRKA 1Q8AA 1XW8A 4ERGA 5C6MA 3A6OA 3LCLA 5C71A 5HATA 1HW6A 4IPIA 1NP2A 4O8RA 4J5NA 4V1XA 4KRZA 3EEZA 4PMUA 3M1ZA 4DF1A 4IMAA 4LY4A 4O0QA 2BV9A 1UBPC 3CYJA 1V0MA 2I17A 4Q8WA 4WKAA 1W9BM 3LS9A 4RDWA 4E4UA 4WLCA 2EO7A 1WZAA 4AEEA 1J5TA 3PAOA 4OJYA 2CWXA 3QR0A 3S4TA 3W1XA 2PDCA 3FV9A 1N82A 1TKKA 3LD5A 1NARA 1XLHA 2R82A 3GC4A 4RDZA 5BMWA 4Z2KA 4JEJA 2WMIB 4O11A 4XX6A 4JHMA 3BOXA 3BURA 2NQ5A 1KV5A 1VFHA 3W2UA 3WQPA 4ZTXA 3B8DA 5JIWA 1ME8A 3NZ1A 2ZX8A 4N9DA 1W9VA 4CLMA 4PODA 4CGTA 2ASHA 1IGWA 2DZBA 1FWGC 1V79A 1G69A 2C16A 4UQCA 1ZBCA 2Z1SA 3NQCA 2TPSA 3MQTA 1TR9A 4HU0A 2D0FA 1Q13A 4X2PA 4W5UA 3ITCA 3WLNA 5A8PA 1UOZA 4MADA 1IYXA 1B9ZA 3LPGA 3DZ1A 4A35A 2XN2A 1SVDA 2CLEA 5G4EA 6TIMA 4KBXA 1IQ8A 2QDHA 4KIRA 1RLCL 2IPFA 2ANUA 3GTFA 4CNNA 2BLEA 4ZFMA 4O10A 1YKWA 1X8FA 2AMGA 3U7BA 1HVXA 4PSRA 4PRTA 4A05A 3CUXA 4HK7A 3SCSA 1G9HA 1K7EA 4X0NA 3UT0A 1XH2A 3MKCA 1EEPA 4Z0SA 1UR0A 1DBTA 3P5YA 1J96A 4LRSA 4JXCA 1PEZA 4N9BA 3E38A 3ERPA 3ARXA 1XCFA 3FA4A 5DBTA 4PTDA 3WBAA 1S2CA 1UA7A 4HNTA 4CU7A 4EX4A 3W7KA 3S42A 4AAJA 2A85A 2ZZ3A 1K8XA 2DSZA 4FP1A 3UNTA 3W88A 1XPGA 3NO1A 2A6NA 3WEMA 3LMYA 2G0WA 5IBXC 1JZ6A