3Q00A

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3q00A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3q00A02
4CBOA 1HDTH 3PROA 1CA0C 2ZTYA 4DVAU 2ESTE 5IYTA 3P6ZB 2OLGA 1VCQA 3GYLB 3PWCA 3LU9B 1TRMA 2Y5FA 1OP0A 2BLWA 3OSYA 2FS8A 2VVVA 1GBAA 1BBRK 4ABAA 1P3CA 1C5XB 1G3DA 2BXTH 3ENSB 1CHOF 4BXWA 1UTPA 2BDGA 2BOHB 5T6FA 4CRFA 7ESTE 1TWXB 2NU3E 4X1RU 5AVDA 4WY3A 1BRCE 2H2ZA 1G3EA 1A5IA 4D76A 3P8GA 3KNXA 2VVCA 4OS5A 2HPPH 1CSOE 1YLCA 1K28D 1GBCA 1BMAA 1JXPA 2J34A 5EXMA 5GPIB 1P12E 1Y5UT 2XBVA 2HGTH 4HZHA 1CT0E 2GCHG 1O3LA 2ZNKH 3A7XA 2P59A 3WY8A 1NZQH 3KGPA 1GBFA 3RXGA 5ABWA 1MBQA 1KYNA 3NKKA 4I8JA 2ZDNA 1GDUA 3PTBA 5TCCA 5FXLA 2F9OA 4CRAA 1RS0A 1ETTH 2Z3DA 5JB9S 5FBIA 2W7SA 1QJ1B 2JH6D 4ABDA 3BSQA 1MTNB 1GHBG 2BDCA 2PGQB 4ZH8A 2GTBA 3UQVA 1FAXA 2KAIA 1UCYK 7GCHG 1GI8B 1J14A 2QY0B 3GYMA 1D9IA 1UHBB 1A4WH 1O35A 2C8ZB 3GICB 4IC5A 1FY5A 5EGMA 3RU4D 3RXCA 1Q3XA 1O5CB 2F9NA 1HJAC 2QA9E 2UUJB 2GMTB 1CO7E 5LPRA 5E2OA 4I7YH 1L1JA 4AFUA 3B9FH 3LGWA 3RXQA 4Y0ZE 1V2KT 2RA3A 5L2ZH 4OS4A 4BTUB 4X8UH 3KF2A 3TJOA 2PR3A 1GBHA 1QQ4A 1Z1JA 2WINI 2GGVB 3LKWA 1NFUA 2ZFRH 1C2HA 2ANWA 1V2ST 2Q1JA 1SFIA 3PMHB 1YYY1 4MLFB 5I46H 1GI5A 3P70B 3P8NA 1U6QA 1PQAA 3E90B 1F0TA 3A7ZA 1O2SA 1QNJA 3GCNA 1O3JA 5CMXH 1XM1A 1BTYA 2ZCLP 1QIXB 5GIBA 3PWBA 4JK6A 1O3DA 1MD8A 5DP3A 2ZGBH 1DSTA 2FI3E 1BRAA 3QTVH 2ZU5A 2UWOA 3ATLA 1HBTH 3PTNA 3RMOH 1H9HE 4XSKU 1NU9A 3VB7A 2B8OH 1QBVH 4WH6A 5BRRE 2WPIS 5HGGA 4SGBE 3ZZ4A 3I78A 1SLWB 1CU1A 1RD3B 5GDSH 2BHGA 5DP5A 2A31A 3M7QA 1SQTA 1P0SH 1WAYB 4XE4A 1SPJA 4K3JA 2FOMB 3TLOA 4HI3A 3ZZBA 1UVPA 2XW9A 1W0ZU 1S81A 1ELDE 3LDXH 1SGIB 1EOJA 2JETB 1AKSB 2EC9H 1O2RA 3IITA 2ZGHA 3TVJB 1DXPA 1O2WA 2H9TH 3MFJA 1W0YH 4UFEH 1T4VH 4QT8C 3PMJA 5DJ7A 1CBWC 1C5WB 2F9PA 3TIUA 1CHGA 4CREA 1SMFE 1HAIH 3RXIA 2A5IA 1UTJA 1ZHPA 1K21H 1WTGH 4LXBH 1UK3A 4K1SA 1MTWA 1DWDH 2VIWA 3DFJA 3L3TA 2TGTA 3ZVBA 1O2GH 2JKHA 2ZDVH 2ZZUH 1T8LA 2XCFA 4KELA 3LGIA 1AFQC 5LPEA 1YPJH 1P2IA 1D3PB 4K2YA 2A45B 3BG8A 4MG3A 3VB3A 3BEIB 1TX6A 5GXPA 3D62A 4IN2A 1XUFA 1AE5A 1ZGVA 2R3YA 2XTTB 3MU5A 2UUKB 1AWHB 2BDIA 5C3NA 1FN8A 1HAVB 3TK9A 5A8YA 1WQSA 1PQ5A 5T6GA 2YNBA 4CHAB 3VB6A 2V3HH 3RXHA 4Q80A 4TYDA 1BJUA 3A7YA 1HNEE 3UIRA 1G2LA 3KHVA 1LHGH 2SGPE 3CENA 3U8TH 3Q76A 3GY2A 2ULLA 2F9UA 4H6TA 4ZMAH 1OSSA 2J4IA 4BAMB 2P8OC 1MAYA 3I29A 3SJKA 1QB6A 5C5OA 1G30B 1C2JA 1DWCH 1QRZA 4GHTA 4WJG2 5A0CA 1SLUB 1HCGA 3URDA 1AU8A 2XC0A 1CVWH 5LPFA 5J4QA 2Z9IA 4KTUA 5FHTA 2GZ9A 3A85A 3GDSA 4O9VA 3RXUA 1DUAA 2Y6TA 3U98H 3GDUA 2PUQH 2ANMH 4OGXA 1UTLM 4GVUA 2VNTA 1N8OC 2OXSA 4A6LA 3VB4A 1OPHB 3OX7U 1UTQA 2GZ8A 3ZVCA 1XKBC 3N7OA 1UVSH 2BLVA 1LVOA 1RRKA 4YLUA 2LPRA 1T32A 3RXJA 2CHAB 2CXVA 1ANDA 1GBBA 3ODDA 3D65E 4AN7A 4WH8A 4NA7A 2G4UA 4NCYA 5JYIA 2XC5A 1KY9A 2EI6A 3SORA 1O34A 4HTCH 1IHTH 3MH5A 1MAXA 3Q77A 4OS2A 1AZ8A 2FTMA 3SGBE 1RJXB 4OS7A 1XXFA 1GCDA 1O32A 1FY3A 4FU7A 1UTNA 1ZMJA 2FLBH 3SGAE 2CV3A 1GVZA 2FWWA 1LVYA 2FLRH 1EPTC 1E38B 1OS8A 1ZZZA 1THSH 1GG6B 3M7UA 2Y7ZA 2ANYA 2VIVA 2Z3CA 1HB0B 2ZGCA 1K9OE 2BLOA 3ZYDA 4JZIA 5FCKA 3RMMH 1JMOH 2QN5T 3UWJH 1ELGA 2ZFQH 4ZHAA 2V6NA 4K1EA 6GCHF 1YCPH 2GDEH 3OY6U 4AYYB 5C5NA 3LC3A 2BY7X 1BDAA 3BIUH 2BXUH 1LPGB 1HAYB 3EE0B 2IOTA 2WPLS 1E35B 3BTDE 1ZPBA 1V2MT 3HKIB 2O8UA 1YP9A 3FZZA 1K1NA 4NIWA 4YT7H 2GCTC 3VGCC 1LHCH 2O8TA 3U1JB 4KKDA 2WPJS 1QJ7B 2ZU2A 1IAUA 4X8TH 1OYQA 1QHRB 1AN1E 2BDAA 2P3UB 3TPIZ 1O2ZA 2P94A 4MPXA 1A5HA 4Q7ZA 2H6MA 4R0IA 4KTSA 4CR9A 3TJUA 1ZPZA 3HATH 1AGJA 1XUIA 1C9PA 1H1BA 5EU8A 1GI7B 1B7XB 1A7SA 4X1SU 1ELFA 2QXJA 5C1XA 5JDUB 1XX9A 3EQ0H 1LQEA 4GLYA 1F0RA 1G37A 2Z3EA 3KL6A 2BTCE 3RLWH 4I8KA 3GY6A 2J95A 1N6YA 3RC5A 3SGQE 4F4OC 3K9XB 5EQRA 2QCYA 5EODA 1MKXK 5CHAB 1A0LA 3RXTA 4E7RG 2GCHF 4ZAEA 3SU1A 1ZOMA 2TBSA 2BX4A 4ZXXH 3UFAA 2TGDA 3GCTG 4BXSA 1FUJA 2PSXA 4IMZA 3FP7E 4BAOB 1DT2A 1P01A 4HFPB 4Y7BA 4IBLH 3BTEE 3GY7A 5DGJA 1GHBF 1P2NA 3EA8A 2AMDA 3S9CA 3LGVA 3H7TA 2GZ7A 1G36A 3TNTA 1IOEA 3QK1A 1XXDA 4D9QA 3LC5A 1EJAA 1TX8A 2SFAA 3QN7A 3M37A 1SB1H 3H7OA 2AYWA 3SV9A 4MVNA 1TFXA 1EZQA 3RLYH 5EXNA 4INHA 3QZQA 1AE8H 4FUCA 4R8TB 4X2VA 4MNWA 3PO1B 1L4ZA 2AGGX 2ZGXH 2ASUB 1PPHE 5EXLA 4ASHA 1O3PB 2HOBA 2P3FH 3B8JA 4XFQA 2C93B 1PYTC 1YC0A 1GDNA 4X2XA 4I33A 1O2NA 4WVPE 1GGDC 3RXSA 4ISLA 2HVXA 2JH5D 4IC6A 1QA0A 5EQSA 2O8WA 1QBOA 3O8RA 1CE5A 1TQ7B 1OWHA 5C20A 3BIVH 1G3BA 1YF4A 1ZHRA 2ZPSA 1GHVH 1TGCA 2ANKH 5EW1H 1C1MA 1KDQB 1GVKB 5EQQA 2BDYA 1C1WH 1C5VA 4YLQH 1UJ1A 1DVAH 1C2KA 1ETRH 1EJMA 1ELCA 4UFGH 3TU7H 3A83A 4BOHA 2BY8X 2I6QA 2F9BH 3IWMA 4GAWA 1BUIA 1DICA 1TAWA 4XOJA 3E16B 1OP8A 3D23A 2XWBI 1HPGA 1DS2E 1DLKB 1RTFB 2QF0A 2C3SA 4AG2A 4NIXA 4YOGA 1NPMA 3SQHE 4DG4A 2BZAA 4X2YA 5FPYA 1H4WA 2BZ6H 3RC6A 4BTTB 1XMNB 5DP9A 3TH2H 1UO6A 4BTIB 1VCWA 3UNQA 1J15A 3SN8A 1WSSH 4I31A 5I25A 3SW2B 1HIAA 3GOVB 4MNVA 3KQEA 2FDAA 3TGIE 3M3TA 2PLXA 1GBEA 2BX3A 1BBRH 2ZHEH 3S7KB 1TMUH 5A8ZA 1ZJDA 2ZA5A 1W2KH 1ZLRA 4X6PA 3A87A 1O0DH 2FO9A 2BB4A 1SGTA 4ZROA 5A0BA 3SUGA 1GI9B 2P16A 2VH6A 3QDZB 1HLTH 4Y6DA 4X8VH 4FUFA 3BG4C 1FMGA 1FI8A 1A3BH 1Y59T 1BT7A 3ZZDA 1VITG 1OWIA 1TNIA 1QBNA 3Q3XA 2BVXH 1ZR0A 4GCHG 4MTBA 4WXIA 1Z71A 1K1PA 1ANCA 2FZZA 1TNHA 1HGTH 2AS9A 5F03A 1YKTA 3SV6A 3SI4H 1O2MA 3FAOA 1XUJA 1E36B 4Y8ZA 3STIA 4AZ2B 1BTHH 3LGTA 1TB6H 4AGKA 4Z0KA 3L6PA 4AFSA 2XWAA 5FPTA 3SU5A 1GHZA 2F9VA 4UFDH 3NUMA 2Y80A 1EPTB 3LOXA 3SU0A 1QJ6B 1FIZA 1BTXA 1S83A 2GV6A 2JH0D 2B5TB 3ZVFA 2FIRH 3LJOA 3AASA 1TABE 2Q6DA 3SU6A 2Z9GA 4YT6H 3RXVA 1RFNA 2XCNA 1SOZA 2A5AA 4MDSA 1GPZA 3P8OA 2YNAA 1AIXH 4CR5A 1SGQE 2ZHFH 1H8DH 4U2WA 2BDHA 2OC1A 3VXFH 3RXMA 1Z7KA 1SGFA 2O8MA 1GVLA 1V6DA 5LGOA 1OX1A 2A32A 2GT8A 4Y76A 1MKWK 1O2LA 2ZO3H 1QGFA 1HAGE 1AFEH 1TNGA 4NSYA 1IQJA 3KCGH 1FPHH 4PROA 1G32B 3PLKA 1GBJA 1YPKH 1K1MA 1A5GH 1SBWA 1SOTA 3EYDA 2VJ1A 3HK6B 4IS5A 1P09A 1O2KA 1A2CH 2FYQA 1Y5BT 2R0KA 5AFYH 1SG8B 1CA8B 5JBTA 2WPHS 3URCA 3E0NB 2CF9H 1LTOA 1Y3UA 2FEQH 1P3EA 3ZZCA 2FODA 1IHSH 4H42U 1K1IA 4A7IB 4WMDA 4B76A 4Y8XA 4ISNA 2BM2A 3BTHE 4UONA 1GBTA 1C1SA 1J16A 4Y79A 1LHEH 2VIOA 4NZQA 1TPPA 2Y82A 3CP7A 2OP9A 4GHQA 1O3KA 1PJPA 2G81E 3MYWA 3RXPA 2WV4A 3DA9B 2OQ5A 1TGBA 4TPYA 2H5DA 2FYRA 2IJOB 1PPFE 3BTFE 2ZHDA 2G51A 1FPCH 1P2JA 3SBKA 1WCZA 2GX4A 1ZMLA 1P11E 1MTSA 4X1PU 2XBXA 4VGCC 2ZPRA 1AB9B 1TIOA 2PUXB 3MNXA 3NCLA 3V7TA 4H4FA 2FOCA 1WU1A 2PWXA 1OWKA 3T28A 3SNBA 4AYVB 4OS6A 4BAKB 2WV5A 4BAQB 4X1NU 4TWWA 1W14U 1O2IA 2TIOA 4NSVA 3MO3A 3RDZA 4AG1A 2THFB 2BQ7B 3M35A 4B74A 1VGCC 4YOJA 1T31A 1ELBA 1Z8IB 1TGNA 3F68H 5EG4A 2PSYA 1EOLA 1QY6A 1W7XH 1GI1A 1P8VC 7LPRA 1O5GH 1O5EH 4JK5A 3ZZ8A 1QA7A 1GMCG 1Y5AT 2QIQA 4MNXA 1KLTA 2VB0A 5DP6A 1F5RA 1YPEH 2FMJA 4A5TS 4DOQA 3CS0A 1C5ZB 4ISOA 3ZV8A 4D8NA 3GCHB 2G4TA 1O2YA 2CN0H 1QURH 5JBCS 1QRWA 4B2CA 4FUBA 3B23B 3PB1E 4B75A 6CHAC 1GMHG 4FUGA 5DPAA 1IQFA 2ZDKA 1W13U 1NFWA 2H9HA 2HRVA 1VITH 1OOKB 5JBAS 3M7TA 1GCTB 1YM0A 4ZXYH 5FPSA 1B5GH 1N1LA 2LNCA 3GCTF 2C8YB 1NO9H 1TA2A 1TLDA 4J1YA 2XYAA 1BITA 3H5CB 1AVWA 4A1VA 2BQ6B 3ZV9A 3MU8A 4GPGA 1LCYA 3T25A 2J92A 1RTLA 3M3SA 3RM0H 2OC7A 4E7NA 3O8CA 1GBKA 5EW2H 5AF9H 3QTOH 3QO6A 4YESB 3PLPA 1DXWA 3HK3B 2ZTXA 1D3DB 4RKOB 1O3NA 2FOHA 2BVRH 3U9AH 1HXFH 2BD4A 2PHBA 1DE7H 2ZP0H 1O2VA 3BV9B 2A5KA 4K60A 1ZPCA 1SGFG 1DOJA 4LOYH 4MQAA 2XBWA 3MNBA 1W10U 2AFQB 2ZU3A 3Q3KA 3UNSA 4INKA 1Y3WA 1MCTA 3Q00A 4H6SB 4X6MA 4ZKSU 1MZAA 3V3MA 2IN2A 3FANA 3NPSA 3GY8A 3T2NA 4K8YA 2SGQE 1YGCH 2QGRA 4JYVH 2ZEBA 2D26C 1GMDG 3HGNA 1RIWC 2AGEX 3BTGE 2FOFA 2BVSH 4DCDA 1TOCB 1J17T 5EOKA 4X6NA 1O37A 1KTTB 1THPB 3SJ9A 1EATA 1EP6A 1CA0B 1KXDA 2WPKS 1YBWA 3K2UA 4FU8A 3MO9A 2PFEA 3DFLA 3ATKA 3ATIA 5E2PA 3SV2H 3RXLA 1JRSA 3SHAH 1ANBA 1ESAA 4HGCA 3PM3A 4D9RA 3A7TA 1TNLA 5F8ZA 1GJ8B 8LPRA 1RXPA 1YPLH 2PKAB 2DE9A 3GY4A 4AFZA 1O36A 3ATMA 1DY9A 4TY6A 2HNTC 1SGNE 2O8LA 9LPRA 1C1UH 2F91A 3O8BA 3MWIU 3U1IB 1TGSZ 3LH1A 1S0RA 2EEKA 1K1OA 1Z6EA 1F5LA 1ZMNA 2ZF0H 3E1XB 2J9NA 1TQ0B 1W8BH 3TH4H 1H8IH 4X2WA 4Y10E 3LPRA 2P3TB 4J2YB 1F0SA 1DX5M 1KTSB 1TONA 1Z8JB 1C1TA 5FAHA 5L2YH 3QX5H 1C5QA 5F8XA 2Y7XA 1RTKA 2OCVB 4GCHF 1O3HA 4LZ1H 3ELAH 3ZZ6A 2BD3A 1H9LB 1HRTH 1A0HB 1TBRH 4ZKOU 1ELAA 3UNRA 2D1JA 4BANB 3RUOA 1PPGE 3ATWA 3I77A 2H1UA 1DWEH 1SFQB 1GJBB 2ZPQA 1RGQA 1LVMA 3S7HB 4D7FA 1LO6A 1ZRBA 4YTAA 3TH3H 2OBOA 1T7CA 3U69H 4YOIA 1VJAU 1HJAB 2VGCC 1GJ9B 3MU0A 2PKSC 5C2ZA 2TGPZ 4WXVA 3SUEA 3DHKH 3U8OH 1CQQA 1KXFA 2AH4X 2HWLB 1EQ9A 3RXBA 1S82A 5AFZH 4B71A 2XRCA 4ABGA 2H5CA 1NM6A 3S9BA 1UHBA 1EKBB 2TRMA 1ESBA 5K7RA 2SGFE 1MQ5A 2ZHWH 5A09A 2B7DH 2W3KA 3ZVDA 1FDPA 3A82A 1C2EA 3LH3A 4NWKA 4ABEA 2FM2A 2HALA 1TX7A 5FBEA 2Z6BD 4U01A 1L1NA 1O5FH 1NT1A 4ZKNU 2QC2A 1MH0A 4B2AA 2AIQA 3D49H 4NWLA 4CRBA 1VZQH 4IN1A 1V2LT 2GV7A 8ESTE 1C1NA 1FV9A 2GKVE 1BRUP 4NIYA 3A8DA 4FUIA 1S0QA 2GD4B 3TK5A 3EA9A 2UWPA 1MTUA 5E0JA 1NROH 3RXAA 1E37B 3A80A 1TNKA 5H4IB 2KAIB 2AERH 1QFKH 5FX5A 4A92A 1ID5H 1QB1A 4D7GA 4Y0YE 2BY5X 2A0QB 3C27B 3ZZ5A 5HM2A 3IG6B 5DO4H 1Y3XA 1HXEH 6ESTA 1SQAA 3KQDA 3A84A 1F7ZA 4AORA 2A2XH 1MTNC 1BMLA 1B0FA 1FY1A 2ZDLA 5FCRA 4I8HA 4YO9A 5JBBS 5LH8A 7GCHF 2GP9B 2CMYA 1FIWA 3DT0H 2C8XB 2C90B 3RP2A 4INLA 1LDTT 1UMAH 2TGAA 1O3IA 3BTME 2G5NA 2GMTC 1LPZB 3R3GB 2W26A 1P2MA 1NRRH 2IPHA 3M36A 2VVUA 2FOAA 1CBWB 2BD7A 1Y8TA 3UOUA 1SLVB 2Z9KA 2ZU1A 3LGYA 1S84A 1FNIA 3SU3A 2ZC9H 1C5OH 5B6OA 2Q6FA 4MPVA 1GL0E 1DLEA 1AKSA 5DP4A 1BOQA 1EAUA 1O3FA 2ZQ1A 1HJ8A 2P93A 4UD9H 1YPGH 1C1VH 1AY6H 1O3MA 3KIDU 1F2SE 2Z9LA 2F83A 4KTCA 1BIOA 1AFQB 3UQOA 1KIGH 2WUBA 1C2LA 1MCVA 3QWCH 1XUKA 2Y81A 2CGAA 3DD2H 4NGAH 4BAHB 1WTHD 1GMCF 3OU0A 3A88A 3OYPA 1S85A 3ZZ3A 7KMEH 5DK1A 4UDWH 3FVFB 3ZZAA 1QQUA 3TGJE 2NU2E 2V35A 3M61U 1NESE 2VH0A 2A7JA 2ZDMA 2G8TA 1NY22 2P8OB 1K22H 1L0ZA 2K1QA 1GMHF 4X6OA 3SUDA 3KN2A 1HAVA 3TITA 3SNCA 5DG6A 1T8NA 2DE8A 3ZVAA 1BHXF 3SNAA 3SU4A 2FESH 2ZFPH 3C1KA 1YCPM 2FI4E 9ESTA 1UVUH 1C5YB 2JETC 3MH4A 1GHAG 3MI4A 2ZFTA 4Y7AA 3S0NA 1T8OA 1N8OB 4FVBA 4AGJA 1SQOA 2ZCHP 5TCAA 1TGTA 1NRSH 1SR5C 1TA6A 4DIHH 4UE7H 4X8SH 4AB8A 2R3UA 2R2MB 4UEHH 3M3VA 5L30H 1O39A 1HAPH 3OTJE 1OYTH 3GCOA 4WF8A 4ZUHA 1W11U 2M5TA 1O3BA 2A4RA 5C67A 1SGRE 1AUTC 1EX3A 1XVMA 1C2IA 2VIPA 4UFFH 3V12A 1ARBA 1DANH 4RSPA 4SGAE 1C4V2 4CH2B 2ZU4A 1QTFA 1O2TA 1EAXA 2QV1A 1O2UA 4I32A 1K1JA 1O3GA 4IMQA 3T27A 4CHAC 2Y5HA 1FY4A 1ELTA 3FFGA 2ZWLH 2FOBA 1F0UA 6GCHG 2FS9A 2V0BA 3MO6A 1EASA 1UCYH 2ZGJA 4E05H 1O30A 1GI3A 3A7WA 1GMDF 4CH8B 2AEIH 3W95A 1ZJKA 4ZHLU 1ZTJA 2Z94A 1V2JT 1P2QA 2PKSB 3BTKE 3PMBB 1SI5H 3EAJA 2STBE 5JPMH 5E0HA 3ODFA 1S6HA 1IQNA 2GCTB 3VGCB 2ZCKP 6LPRA 3T62A 5A8XA 4O3UA 3NXPA 1EZUC 3SZNA 1PPZA 5PTPA 1ESTA 3F9FA 2EI8A 3A8CA 3F9GA 3PV4A 1C9TA 2EI7A 1EAIA 1A61H 2SGAA 1BTUA 2FTLE 1AI8H 2YOLA 2G00A 1K2I1 2ALPA 3GY5A 4I8GA 2NWNA 2UUYA 1IQIA 1FQ3A 2CHAC 2RG3A 3M5NA 1V2NT 4AFQA 1SVPA 2O9QA 4U30A 4K1TA 1D6WA 1NRNH 2FX4A 3MU1A 1GJ5H 4O97A 3T29A 5SGAE 1TPAE 1GDQA 2PV9B 1PPCE 4OGYA 5EPYA 1MZDA 5C1YA 2Z9JA 1UTOA 2G55A 1DUEA 1W7GH 4E06H 1UVOA 1FY8E 2HPQH 5AHGH 4O3TA 1FXYA 3F6UH 1JWTA 1GG6C 1VJ9U 1O2XA 3AAUA 1V2PT 1LQDB 3ZZ9A 1BBRE 1C1RA 1GI2A 4FUEA 1C5RA 5HMAA 3PYHA 4A1XA 2ILNA 1C4Y2 5E8EH 1PQ7A 1KXBA 3AW0A 2PGBB 3HPTB 2BQWB 1TPSA 3VEQB 3SQEE 5HYOA 1GJDB 4ZKRU 2A4GA 1UTMA 4JZEH 3STJA 1P03A 1SLXB 4IGDA 1O2HA 4U32A 2I6SA 1FONA 1MU8B 1GJCB 1Q2WA 3MNSA 1L4DA 5DP8A 5GCHG 8KME2 3HGPA 1NN6A 4ISHH 3SJ8A 4LK4A 3SJIA 1P10A 4JZ1A 2ZFSA 3R0FA 1W3CA 1WV7H 1AHTH 5ETXA 4ISIH 1C2GA 1A3EH 1EB1H 1ACBE 2ZTZA 2H9EH 4X1QU 1GJAB 3G01A 1OP2A 1ZGIA 1QRXA 1LMWB 1S6FA 1Z1IA 3TJVA 4WMEA 2WUCA 5HXFA 2QXGA 1DWBH 1GGDB 1H9IE 1LKAA 1BTZA 1SHHB 1O5AB 2QXHA 3OY5U 1TBQH 1UCYE 5K0HA 1CGHA 1JIRA 3M5OA 1ZSLA 1P06A 3RXRA 1TPOA 1V2QT 1O5BB 2OC0A 4I8LA 4DIIH 1QCPA 4X0WU 2R2WU 1EB2A 4TY7A 2G52A 1C1OA 2TPIZ 5F8TA 4THNH 1P05A 5DKMA 3RXKA 2FI5E 5CHAC 2OC8A 1LVBA 3QGNB 3GY3A 1P04A 1Q31A 1HUTH 1O2JA 1CGIE 3P8FA 1UK2A 3SU2A 2EA3A 2HNTE 3SO3A 4B73A 1IQHA 1T8MA 4ZHMU 5E0GA 5ESBA 2STAE 8GCHG 3LT3A 2HLCA 1N6XA 5GWZA 1AVGH 1C2DA 2HNTF 1V2UT 1A1RA 1P57B 1KDQA 1LHFH 2SNWA 4RN6A 2CJIA 3SUFA 2OTVA 1IQMA 2B9LA 1E34B 4CRCA 2VIDA 4KP0A 1EZSC 3VXEH 1O3CA 2A2QH 1FAKH 1QR3E 1PYTD 3F9EA 3F9HA 4Y8YA 1HJ9A 1L2EA 1P2KA 1SL3A 3EGKH 5HM9A 1Z8GA 4ABIA 2XC4A 1HAXB 1V2TT 3AW1A 1ZYOA 2VIQA 3UR9A 1GI6A 1LKBA 1MUEB 1NFYA 3PO1C 1VR1H 2AIPA 2FP7B 3SNEA 1WOFA 2C8WB 4JZFH 4MPUA 4MNYA 1HV7A 3BG4B 1IQLA 1C1QA 4DW2U 2AMPA 2QAAA 3MOCA 1TNJA 3K6ZA 5TJXA 3TGKE 3HKJB 3GISB 2VWNA 3E6PH 1MBMA 2ZFFH 4TPIZ 1QL9A 2OD3B 1ABIH 1JIMA 3GDVA 1C5MD 3QLPH 1D4PB 2DUCA 1IQEA 2W5EA 4GUXA 1G3CA 1BMMH 3T26A 4GSOA 2GVFA 2F3CE 1C5SA 1JRTA 1O2OA 4Y11E 3M5MA 4ABBA 2RCEA 4RKJB 5C1UA 3RU4E 1B0EA 1V3XA 2PTCE 3LJJA 5GJ4B 1FZZA 2OBQA 1JOUB 4A1TA 3E8LA 1HIAB 1D3QB 1DFPA 1F92A 3Q3YA 2ZQ2A 2BD2A 1O38A 2AGIX 3V13A 4DGJA 1AWFH 1QL7A 1FJSA 1EPTA 3E91A 1TBZH 1PPBH 1FLEE 1THRH 3FP6E 3A7VA 1O3AA 2BLQA 5F6MA 1CHOG 1LHDH 1C5PA 1GL1A 1ZTLA 3KQCA 1AMHA 2BD9A 3NK8A 3ITIA 3P95A 1D6RA 2VINA 3PMAB 4OS1A 1GHAF 2A7CA 3P17H 2VWLA 3BF6H 1BHXB 1KLJH 3SJOA 1KXEA 3EDXB 1P9SA 1CGJE 3RXEA 3MH6A 2VU8E 4CBNA 3K6YA 1GI0A 1GBIA 1G2MA 1C5TA 1HYLA 2BY6X 3S9AA 1NRPH 1O33A 1TE0A 1C5UA 2QXIA 1WBGB 3NZIA 1NU7B 4BNRA 2RA0A 3CS7A 1VITF 1DPOA 3A81A 2PW8H 4Z6AH 4FUDA 1CT2E 1AZZA 1ZSJA 2WYGA 1BRBE 1O2PA 1ORFA 1WQVH 1GWAA 3BEUA 4XDEA 1MKXH 1NTPA 2ZG0H 1PFXC 1V2RT 4NZLA 1TRNA 2SGDE 3MHWU 3QUMP 3A86A 2B0FA 1IQKA 2RDLA 4XBDA 3SHCH 3L33A 2XNIA 5CE1A 4LZ4B 3SV8A 5T6DA 3AAVA 2Z7FE 3UWIA 4AOQA 1C2FA 2R0LA 1SGEE 3UOPA 3ZVGA 1Y3VA 4VGCB 3MTYA 3RU4T 1C2MA 2J2UA 4ESTE 1UK4A 3MMGA 3LGUA 1G9IE 2ZKSA 1ARCA 5ESTE 3RMLH 1DY8A 3RXFA 1TOMH 2ZHQH 4XBBA 4ABJA 1SHYA 1V2WT 1NC6A 3S69A 3UY9A 3SV7A 2NU1E 4NFEA 1VGCB 3UUZA 2D2DA 3E3TA 1E0FD 2XXLA 2FPZA 1O5DH 2XBYA 1OXGA 2BDBA 5L6NH 1BZXE 1EUFA 2GDDA 2AMQA 1O31A 2FXRA 3A8AA 2Q6GA 2A7HA 1Z6JH 3BTTE 3QGJA 3SNDA 1SC8U 1P9UA 3O8DA 1KXAA 3ZVEA 1XVOA 3M5LA 4NA9H 1AD8H 1GJ4H 4NIVA 1NRQH 2BOKA 3V0XA 5FX6A 2C4FH 3KEEA 1ETSH 3UPEA 1AVXA 1OWEA 2CF8H 4NFFA 1M9UA 1MTVA 2J38A 1XUHA 1WUNH 3KQBA 6CHAB 4IW4E 4XBCA 4AX9H 3ZZ7A 1TYNA 2GT7A 1V2VT 1BJVA 1EZXC 3BN9A 3DUXH 1YCPK 1GI4A 1ZHMA 1ELEE 3U8RH 5T3HA 4WMFA 1OWDA 1DITH 1AO5A 1FN6A 2SNVA 2PTNA 4K69A 2ODYB 1MMJN 4NG9H 3FZDA 4FXGH 2ZI2H 1IQGA 3SOSA 3ESTA 2ZIQH 3RXDA 1AB9C 1HFDA 2BD5A 5JB8S 3TNSA 2V3OH 5IDKA 3VPKA 1J9CH 3RM2H 1DSUA 1SSXA 2BY9X 3RC4A 2P95A 1J8AA 1AUJA 1NS3A 1EJNA 4DY7B 5GCHF 3MNCA 1ZSKA 2OUAA 2ALVA 3TK6A 3T5FH 2R9PA 4DURA 4KGAA 2UWLA 3RXOA 4O03A 3VFEA 1SGYE 1ABJH 1YPHE 1CT4E 1BA8B 2QYIA 1HAOH 3E0PB 3MU4A 3UR6A 1OKXA 1KSNA 4FVDA 4FUJA 1BCUH 4FUHA 4CRDA 3ZYEA 4Y71A 2W7UA 1YLDA 2A4QA 2WYJA 4JZDH 2NU0E 3F1SB 4CRGA 1GJ6A 1KXCA 4YM9A 4WWYA 2OINA 1GBDA 3BTWE 1QB9A 1LPKB 1QL8A 2G5VA 2ZDAH 3GCHC 4M7GA 1Y3YA 1O3EA 4DT7B 1BTPA 3A89A 1BB0B 1YPMH 3LIWA 1RIWB 2ODPA 2A1DB 1BTWA 1GHWH 3VB5A 1K1LA 1NFXA 4MPWA 1SGPE 3K65B 4Q7YA 1BMNH 1DDJA 3A8BA 1S5SA 3PLBA 4JYTA 1D3TB 1W12U 1V2OT 2ZECA 3W94A 2QF3A 1KLIH 1OWJA 3UTUH 3SI3H 2SGEE 1GCTC 3NWUA 1ANEA 1BQYA 1X7AC 2BMGB 1ZTKA 8GCHF 1UTKA 4YZUA 1EXFA 2A4OA 1F5KU 1XKAC 5DP7A 1O3OA 1INCA 4ABFA 1C1PA 4JMYA 2UUFB 3MH7A 3FP8E 1PQ8A 1C5LH 1SGDE 1MKWH 1MQ6A 4Q2KA 4JCNA 2W3IA 3AVZA 5J4SA 1XUGA 4NA8A 4AB9A 5A2MH 1MU6B 2FOEA 1Z8RA 1EAWA 3BEFB 4K8BA 1UVTH 1C4U2 2ODQA 2BYAX 1AQ7A 1TALA 1P02A 4FU9A 1A46H 1P2OA 1WYKA 1GBMA 1HAZB 1TMTH 2PKAA 5BPEA 1HAHH 1GHXH 3EA7A 4F49A 3QZRA 3P92A 3UREA 5G4BA 4B1TA 2WPMS 3TJNA 4DJZB 1A0JA 1MD7A 1O2QA 1TRYA 1EP5A 4JYUH 1GHYH 5EPNA 1VCPA 1GJ7B 2J94A 1T4UH 2D8WA 1YPHC 4B2BA 3JZ1B 2Y5GA 2OQUA 3RMNH 1ELVA 1PPEE 2FOGA 2VWOA 4TWYA 2VWMA 4K5ZA 5A0AE 1DM4B 3LONA 1TMBH 3BTQE 1L1GA 4ABHA 2FX6A 4Q7XA 1C5NH 1ZRKA 1JBUH 1SGCA 2VGCB 1GBLA 3JZ2B 2BD8A 2NU4E
chains in the Genus database with same CATH superfamily
4CBOA 1HDTH 3PROA 1CA0C 2ZTYA 4DVAU 2ESTE 5IYTA 3P6ZB 2OLGA 1VCQA 4Q63A 5C94A 3GYLB 3PWCA 3LU9B 1TRMA 2Y5FA 1OP0A 2BLWA 3OSYA 4FOUC 2FS8A 2VVVA 1GBAA 1BBRK 4ABAA 1P3CA 1C5XB 1G3DA 2BXTH 3ENSB 1CHOF 4BXWA 1UTPA 2BDGA 2BOHB 5T6FA 3OEHD 4CRFA 7ESTE 1TWXB 2NU3E 4X1RU 5AVDA 5C0TA 4WY3A 1BRCE 2H2ZA 1G3EA 1A5IA 4D76A 3P8GA 3KNXA 2VVCA 4OS5A 2HPPH 1CSOE 1YLCA 1K28D 1GBCA 1BMAA 1JXPA 2J34A 5EXMA 5GPIB 1P12E 1Y5UT 2XBVA 2HGTH 4HZHA 3U28C 1CT0E 2GCHG 1O3LA 2ZNKH 3A7XA 2P59A 3WY8A 1NZQH 3KGPA 1GBFA 3RXGA 5ABWA 1MBQA 1KYNA 1W0JD 4F48B 3NKKA 4I8JA 2ZDNA 1GDUA 3PTBA 5TCCA 5FXLA 2F9OA 3KYGA 4CRAA 1RS0A 1ETTH 2Z3DA 3WWBA 5JB9S 5FBIA 2W7SA 1QJ1B 2JH6D 4ABDA 3BSQA 1E1RD 1MTNB 1GHBG 2BDCA 2PGQB 4TT3D 4ZH8A 1SKYE 2GTBA 3UQVA 1FAXA 2KAIA 1UCYK 7GCHG 1GI8B 1J14A 2QY0B 3GYMA 1D9IA 1UHBB 1A4WH 1O35A 2C8ZB 3GICB 4IC5A 1FY5A 5EGMA 3RU4D 3RXCA 1Q3XA 1O5CB 2F9NA 1HJAC 2QA9E 2UUJB 2GMTB 1CO7E 5LPRA 5E2OA 4I7YH 1L1JA 4AFUA 3B9FH 3LGWA 3RXQA 4Y0ZE 1V2KT 2RA3A 5L2ZH 4OS4A 4BTUB 2W6ID 4X8UH 3KF2A 3TJOA 2PR3A 1GBHA 1QQ4A 1Z1JA 2WINI 2GGVB 3LKWA 1NFUA 2ZFRH 3F2GA 1C2HA 2ANWA 1V2ST 2Q1JA 1SFIA 3PMHB 1YYY1 4HG6A 4MLFB 5I46H 1GI5A 3P70B 3P8NA 1U6QA 1PQAA 3E90B 1F0TA 3A7ZA 1O2SA 1QNJA 3GCNA 1O3JA 5CMXH 1XM1A 1BTYA 2ZCLP 5FL7D 1QIXB 5GIBA 3PWBA 4JK6A 1O3DA 1MD8A 5DP3A 2ZGBH 1DSTA 5CHBA 2FI3E 1BRAA 3QTVH 2ZU5A 2UWOA 3ATLA 1HBTH 3PTNA 3RMOH 1H9HE 4XSKU 1NU9A 3VB7A 2B8OH 1QBVH 4WH6A 5BRRE 2WPIS 5HGGA 4SGBE 3ZZ4A 3I78A 1SLWB 1CU1A 1RD3B 5GDSH 2BHGA 5DP5A 2A31A 3M7QA 1SQTA 1P0SH 1WAYB 4XE4A 1SPJA 4K3JA 2FOMB 5HIYA 3TLOA 4HI3A 3ZZBA 1UVPA 2XW9A 1W0ZU 1S81A 2AHME 1ELDE 3LDXH 1SGIB 1EOJA 2JETB 1AKSB 2EC9H 1O2RA 3IITA 2ZGHA 5KGOA 1DXPA 3TVJB 1O2WA 2H9TH 3MFJA 1W0YH 4UFEH 1T4VH 4QT8C 3PMJA 5DJ7A 1CBWC 1C5WB 2F9PA 3TIUA 1CHGA 4CREA 1SMFE 1HAIH 3RXIA 2A5IA 1UTJA 1ZHPA 1K21H 1WTGH 4LXBH 1UK3A 4K1SA 1MTWA 1DWDH 2VIWA 3DFJA 3L3TA 2TGTA 3ZVBA 4XD7D 1EFRD 1O2GH 2JKHA 2ZDVH 2ZZUH 1T8LA 2XCFA 4KELA 3LGIA 1AFQC 5LPEA 1YPJH 1P2IA 1D3PB 4K2YA 2A45B 3BG8A 4MG3A 3VB3A 3BEIB 1TX6A 5GXPA 3D62A 4IN2A 3FN8A 1XUFA 1AE5A 1ZGVA 2R3YA 2XTTB 3MU5A 2RDEA 2UUKB 1AWHB 2BDIA 5C3NA 1FN8A 1HAVB 3TK9A 5A8YA 1WQSA 1PQ5A 5T6GA 2YNBA 4CHAB 3VB6A 2V3HH 3RXHA 4Q80A 4TYDA 1BJUA 3A7YA 1HNEE 3UIRA 1G2LA 3KHVA 1LHGH 2SGPE 3CENA 3U8TH 3Q76A 3GY2A 2ULLA 2F9UA 4H6TA 4ZMAH 1OSSA 2J4IA 4BAMB 2P8OC 1MAYA 3I29A 3SJKA 1QB6A 5C5OA 1G30B 1C2JA 1DWCH 1QRZA 4GHTA 4WJG2 5A0CA 1SLUB 1HCGA 3URDA 1AU8A 2XC0A 1CVWH 5LPFA 5J4QA 1W0KD 2Z9IA 4KTUA 5FHTA 2GZ9A 2KCOA 3A85A 3GDSA 4O9VA 3RXUA 1DUAA 2Y6TA 3U98H 3GDUA 2PUQH 2ANMH 4P00A 4OGXA 1UTLM 4GVUA 2LELA 2VNTA 1N8OC 2OXSA 4A6LA 3VB4A 1OPHB 3OX7U 1UTQA 2GZ8A 3ZVCA 1XKBC 3CNRA 3N7OA 1UVSH 2BLVA 1LVOA 1RRKA 2J98A 4YLUA 2LPRA 1T32A 3RXJA 2CHAB 2CXVA 1ANDA 1GBBA 3ODDA 3D65E 4AN7A 4WH8A 4NA7A 2G4UA 1UW7A 4NCYA 5JYIA 2XC5A 1KY9A 2EI6A 3SORA 2JIZD 1O34A 4HTCH 1IHTH 3MH5A 1MAXA 3Q77A 4OS2A 1AZ8A 2FTMA 3SGBE 1RJXB 4OS7A 1XXFA 1GCDA 1O32A 1FY3A 4FU7A 1UTNA 1ZMJA 2FLBH 3SGAE 2CV3A 1GVZA 2FWWA 1LVYA 2FLRH 1EPTC 1E38B 1OS8A 1ZZZA 1THSH 1GG6B 3M7UA 2Y7ZA 2ANYA 2VIVA 2Z3CA 1HB0B 2ZGCA 1K9OE 2BLOA 3ZYDA 4JZIA 5FCKA 3RMMH 1JMOH 4RI0A 2QN5T 3UWJH 1ELGA 2ZFQH 4ZHAA 2V6NA 4K1EA 6GCHF 1YCPH 2GDEH 3OY6U 4AYYB 5C5NA 3LC3A 2BY7X 1BDAA 3BIUH 2BXUH 1LPGB 2F4LA 2F43B 1HAYB 3EE0B 2IOTA 2WPLS 1E35B 3BTDE 2V3MA 1ZPBA 1V2MT 3HKIB 2O8UA 1YP9A 3FZZA 1K1NA 4NIWA 4YT7H 2GCTC 3VGCC 1LHCH 2O8TA 3U1JB 4KKDA 2WPJS 1QJ7B 2ZU2A 1IAUA 4X8TH 1OYQA 1QHRB 1AN1E 2BDAA 2P3UB 3TPIZ 1O2ZA 2P94A 4MPXA 5CDFE 1A5HA 4Q7ZA 2H6MA 4R0IA 4KTSA 4CR9A 1BMFD 3TJUA 1ZPZA 3HATH 1AGJA 1XUIA 1C9PA 1H1BA 5EU8A 1GI7B 1B7XB 1A7SA 4X1SU 1ELFA 2QXJA 5C1XA 5JDUB 1XX9A 3EQ0H 1LQEA 4GLYA 1F0RA 1G37A 2Z3EA 3KL6A 2BTCE 3RLWH 4I8KA 3GY6A 2J95A 1N6YA 3RC5A 3SGQE 4F4OC 3K9XB 5EQRA 2QCYA 5EODA 1MKXK 5CHAB 1A0LA 3RXTA 4E7RG 2GCHF 4ZAEA 3SU1A 1ZOMA 2TBSA 5DSFA 2BX4A 4ZXXH 3UFAA 2TGDA 3GCTG 4BXSA 1FUJA 2PSXA 4IMZA 3FP7E 4BAOB 1DT2A 1P01A 4HFPB 4Y7BA 4IBLH 2PP6A 3BTEE 4RT1A 3GY7A 5DGJA 1GHBF 1P2NA 3EA8A 2AMDA 3S9CA 3LGVA 3H7TA 2GZ7A 1G36A 3TNTA 1IOEA 3QK1A 1XXDA 4D9QA 3LC5A 2K0QA 1EJAA 1TX8A 2SFAA 3QN7A 3M37A 1SB1H 3H7OA 2AYWA 3SV9A 4MVNA 3N7EA 3OAAD 1TFXA 1EZQA 3RLYH 5EXNA 4INHA 3QZQA 1AE8H 4FUCA 4R8TB 4X2VA 4MNWA 3PO1B 1L4ZA 2AGGX 2ZGXH 2ASUB 1PPHE 5EXLA 4ASHA 1O3PB 2HOBA 2P3FH 3W1EA 3B8JA 4ACBA 4XFQA 2C93B 1PYTC 2HVYB 1YC0A 1GDNA 4X2XA 2M2AA 2YMSB 4I33A 1O2NA 4WVPE 1GGDC 3RXSA 4ISLA 2HVXA 2JH5D 4IC6A 1QA0A 3ZIAD 5EQSA 2O8WA 1QBOA 3O8RA 1CE5A 1TQ7B 2KZ4A 1OWHA 5C20A 3BIVH 1G3BA 1YF4A 1ZHRA 2ZPSA 1GHVH 1TGCA 2ANKH 5EW1H 1C1MA 1KDQB 1GVKB 5EQQA 2BDYA 1C1WH 1C5VA 4YLQH 1UJ1A 1DVAH 1C2KA 1ETRH 1EJMA 1YY3A 1ELCA 4UFGH 3TU7H 3A83A 4BOHA 2BY8X 2I6QA 2F9BH 3IWMA 4GAWA 1BUIA 1DICA 1TAWA 4XOJA 3E16B 1OP8A 3D23A 2XWBI 1HPGA 1DS2E 1DLKB 1RTFB 2QF0A 2C3SA 4AG2A 3WWFA 4NIXA 4YOGA 1NPMA 3SQHE 4DG4A 2BZAA 4X2YA 5FPYA 1H4WA 2BZ6H 3RC6A 4BTTB 1XMNB 5DP9A 3TH2H 1UO6A 4BTIB 1VCWA 3UNQA 1J15A 2KX4A 3SN8A 1WSSH 4I31A 5I25A 1H8ED 3SW2B 1HIAA 3GOVB 4MNVA 3KQEA 2FDAA 3TGIE 3M3TA 2PLXA 1GBEA 2BX3A 1BBRH 2ZHEH 3S7KB 1TMUH 5A8ZA 1ZJDA 2ZA5A 1W2KH 1ZLRA 4X6PA 3A87A 1O0DH 2FO9A 2BB4A 1SGTA 4ZROA 2V7QD 5A0BA 3SUGA 1GI9B 2P16A 2VH6A 3QDZB 1HLTH 4Y6DA 4X8VH 4FUFA 3BG4C 1FMGA 1FI8A 1A3BH 1Y59T 1BT7A 3ZZDA 1VITG 1OWIA 1TNIA 1QBNA 3Q3XA 2BVXH 1ZR0A 4GCHG 4MTBA 4WXIA 1Z71A 1K1PA 3MQKC 1ANCA 2FZZA 1TNHA 1HGTH 2AS9A 5F03A 1YKTA 3SV6A 3SI4H 1O2MA 3FAOA 1XUJA 1E36B 1KMHB 4Y8ZA 3STIA 4AZ2B 1BTHH 3LGTA 1TB6H 4AGKA 4Z0KA 3L6PA 4AFSA 2XWAA 5FPTA 3SU5A 1GHZA 2F9VA 4UFDH 3NUMA 2Y80A 1EPTB 3LOXA 3SU0A 1QJ6B 1FIZA 3FKSD 1BTXA 1S83A 2GV6A 2JH0D 2B5TB 3ZVFA 2FIRH 3LJOA 3F2HA 3AASA 1TABE 2Q6DA 3SU6A 2Z9GA 4YT6H 3RXVA 1RFNA 2XCNA 1SOZA 2A5AA 4MDSA 1GPZA 3P8OA 2YNAA 1AIXH 2WHXA 4CR5A 1SGQE 2ZHFH 1H8DH 2KCAA 2BDHA 4P02A 2OC1A 4U2WA 3VXFH 3RXMA 1Z7KA 1SGFA 2O8MA 1GVLA 1V6DA 5LGOA 1OX1A 2A32A 2GT8A 3KYFA 4Y76A 1MKWK 1O2LA 2JDID 2ZO3H 1QGFA 1HAGE 1AFEH 1TNGA 4NSYA 2LP6A 1IQJA 3KCGH 1FPHH 4PROA 1G32B 2XNDD 3PLKA 1GBJA 1YPKH 1K1MA 1A5GH 1SBWA 1SOTA 3EYDA 2VJ1A 3HK6B 4IS5A 1P09A 1O2KA 1A2CH 2FYQA 1Y5BT 2R0KA 5AFYH 1SG8B 1CA8B 3AK5A 5JBTA 2WPHS 3URCA 3E0NB 2CF9H 1LTOA 1Y3UA 2FEQH 1P3EA 3ZZCA 2FODA 1IHSH 4H42U 1K1IA 4A7IB 4WMDA 4B76A 4Y8XA 4ISNA 2BM2A 3BTHE 4UONA 1GBTA 1C1SA 1J16A 4Y79A 1LHEH 2VIOA 4NZQA 1TPPA 2Y82A 3CP7A 2OP9A 4GHQA 1O3KA 1PJPA 2G81E 3MYWA 3RXPA 2WV4A 3DA9B 2OQ5A 1TGBA 4TPYA 2H5DA 2FYRA 2IJOB 1PPFE 3BTFE 2ZHDA 2G51A 1FPCH 1P2JA 3SBKA 1WCZA 2GX4A 1ZMLA 1P11E 1MTSA 4X1PU 3UAIC 2XBXA 4VGCC 5KECA 2ZPRA 1AB9B 1TIOA 4B6FA 2PUXB 3MNXA 2QE7D 3NCLA 3V7TA 4H4FA 3OE7D 2FOCA 1WU1A 2PWXA 1OWKA 3T28A 3SNBA 4AYVB 4OS6A 4BAKB 2WV5A 4BAQB 4X1NU 4TWWA 1W14U 4B6EA 2WV9A 3FO8D 1O2IA 2TIOA 4NSVA 3MO3A 3RDZA 4AG1A 2THFB 2BQ7B 4OM9A 3M35A 4B74A 1VGCC 4YOJA 1T31A 1ELBA 1Z8IB 1TGNA 3F68H 4ACAA 5EG4A 2PSYA 1EOLA 1QY6A 1W7XH 1GI1A 1P8VC 3PRDA 1O5GH 1O5EH 4JK5A 7LPRA 3ZZ8A 1E1QD 1QA7A 1GMCG 1Y5AT 2QIQA 4MNXA 1KLTA 2VB0A 5DP6A 1F5RA 1YPEH 2FMJA 4A5TS 4DOQA 3CS0A 1C5ZB 4ISOA 3ZV8A 4D8NA 3GCHB 2G4TA 4F55A 1O2YA 2CN0H 1QURH 5JBCS 1QRWA 4B2CA 4FUBA 3B23B 3PB1E 4B75A 6CHAC 1GMHG 2QF4A 4FUGA 5DPAA 1IQFA 2ZDKA 1W13U 1NFWA 2H9HA 2HRVA 1VITH 5EJZA 1OOKB 3FOAA 5JBAS 3M7TA 1GCTB 1YM0A 4ZXYH 5FPSA 1B5GH 1N1LA 2LNCA 3GCTF 2C8YB 1NO9H 1TA2A 1TLDA 4J1YA 2XYAA 1BITA 3H5CB 1AVWA 3DCLA 4A1VA 2BQ6B 3ZV9A 2KCYA 3MU8A 4GPGA 1LCYA 3T25A 2J92A 1RTLA 1K0HA 3M3SA 3RM0H 2OC7A 4E7NA 3O8CA 1GBKA 2EQNA 5EW2H 5AF9H 3QTOH 3QO6A 1H8HD 4YESB 3PLPA 1DXWA 3HK3B 2ZTXA 1D3DB 4RKOB 1O3NA 2FOHA 2BVRH 3U9AH 1HXFH 2BD4A 2PHBA 1DE7H 2ZP0H 3N99A 1O2VA 3BV9B 2A5KA 4K60A 1ZPCA 1SGFG 1DOJA 4LOYH 4MQAA 2XBWA 2WZQA 3MNBA 1W10U 2AFQB 2KCPA 2ZU3A 3Q3KA 3UNSA 4INKA 1Y3WA 1MCTA 3Q00A 4H6SB 4X6MA 4ZKSU 1MZAA 3V3MA 2IN2A 3FANA 3NPSA 3GY8A 3T2NA 4K8YA 2SGQE 3EE7A 1YGCH 2QGRA 4JYVH 2ZEBA 3H09A 2D26C 3PV5A 1GMDG 3HGNA 1RIWC 2AGEX 3BTGE 2FOFA 2BVSH 4DCDA 1TOCB 1J17T 5EOKA 4X6NA 5DN6D 1O37A 3NRLA 1KTTB 1THPB 3SJ9A 1EATA 1EP6A 1CA0B 1KXDA 3N7DA 2WPKS 5GNDA 1YBWA 3K2UA 4FU8A 3MO9A 2PFEA 3DFLA 3ATKA 3ATIA 5E2PA 3SV2H 3RXLA 1JRSA 3SHAH 1ANBA 1ESAA 4HGCA 3PM3A 4D9RA 3A7TA 1TNLA 5F8ZA 1GJ8B 8LPRA 1RXPA 1YPLH 2PKAB 2DE9A 3GY4A 4AFZA 1O36A 3ATMA 1DY9A 4TY6A 2HNTC 1SGNE 2O8LA 9LPRA 1C1UH 2W6JD 2F91A 3O8BA 3MWIU 3U1IB 1TGSZ 3LH1A 1S0RA 2EEKA 1K1OA 1Z6EA 1F5LA 1ZMNA 2ZF0H 3E1XB 2J9NA 1TQ0B 1W8BH 3TH4H 5EJ1A 1H8IH 4X2WA 4Y10E 3LPRA 2P3TB 4J2YB 1F0SA 1DX5M 1KTSB 1TONA 1Z8JB 1C1TA 5FAHA 5L2YH 3QX5H 1C5QA 5F8XA 3PV2A 2Y7XA 1RTKA 2OCVB 4GCHF 1YLNA 1O3HA 2QF5A 4LZ1H 3ELAH 3ZZ6A 1MABB 2BD3A 1H9LB 1HRTH 1A0HB 1TBRH 4ZKOU 1ELAA 3UNRA 2D1JA 4BANB 3RUOA 1PPGE 3ATWA 3I77A 3OTPA 2H1UA 1DWEH 1SFQB 1GJBB 2ZPQA 1RGQA 1LVMA 3S7HB 4D7FA 1LO6A 1ZRBA 4YTAA 3TH3H 2OBOA 1T7CA 3U69H 4YOIA 1VJAU 1HJAB 2VGCC 1GJ9B 3MU0A 2PKSC 5C2ZA 2TGPZ 4WXVA 3SUEA 3DHKH 3U8OH 1CQQA 1KXFA 1SQRA 2AH4X 2HWLB 1EQ9A 3RXBA 1S82A 5AFZH 4B71A 2XRCA 4ABGA 2H5CA 1NM6A 3S9BA 1UHBA 1EKBB 2TRMA 1ESBA 5K7RA 2SGFE 1MQ5A 2ZHWH 5A09A 2B7DH 2W3KA 3ZVDA 1FDPA 3A82A 1C2EA 2J5UA 3LH3A 4NWKA 4ABEA 2FM2A 2HALA 1TX7A 5FBEA 2Z6BD 4U01A 1L1NA 1O5FH 1NT1A 4ZKNU 2QC2A 1MH0A 4B2AA 2AIQA 3D49H 4NWLA 4CRBA 1VZQH 4IN1A 1V2LT 2GV7A 8ESTE 1C1NA 1FV9A 2GKVE 1BRUP 4NIYA 3A8DA 4FUIA 1S0QA 2GD4B 3TK5A 3EA9A 2UWPA 1MTUA 5E0JA 1NROH 3RXAA 1E37B 2CK3D 3A80A 1TNKA 5H4IB 2KAIB 2AERH 1QFKH 5FX5A 4A92A 1ID5H 1QB1A 4D7GA 4Y0YE 2BY5X 2A0QB 4ASUD 3C27B 3ZZ5A 5HM2A 3IG6B 5DO4H 1Y3XA 1HXEH 6ESTA 1SQAA 3KQDA 3A84A 1F7ZA 4AORA 2A2XH 1QZ8A 3DSOA 1MTNC 1BMLA 1B0FA 1FY1A 2ZDLA 5FCRA 4I8HA 4YO9A 5JBBS 5LH8A 7GCHF 2GP9B 2CMYA 1FIWA 3DT0H 2C8XB 2C90B 3RP2A 4INLA 1LDTT 1WXRA 1UMAH 2TGAA 1O3IA 3BTME 5C17A 2G5NA 2GMTC 1LPZB 3R3GB 2W26A 1P2MA 1NRRH 2IPHA 3M36A 2VVUA 2FOAA 1CBWB 2BD7A 4M9FA 1Y8TA 3UOUA 1SLVB 2Z9KA 2ZU1A 2XOKD 3LGYA 1S84A 1FNIA 3SU3A 2ZC9H 1C5OH 5B6OA 2Q6FA 4MPVA 1GL0E 1DLEA 1AKSA 5DP4A 1BOQA 1EAUA 1O3FA 2ZQ1A 1HJ8A 2P93A 4UD9H 1YPGH 1C1VH 1AY6H 1O3MA 3KIDU 1F2SE 2Z9LA 2F83A 4KTCA 1BIOA 1AFQB 3UQOA 1KIGH 2WUBA 1C2LA 1MCVA 3QWCH 1XUKA 2Y81A 2CGAA 3DD2H 4NGAH 4BAHB 1WTHD 1GMCF 3OU0A 3A88A 3OYPA 5EIYA 1S85A 3ZZ3A 7KMEH 5DK1A 4UDWH 3FVFB 3ZZAA 1QQUA 3TGJE 2NU2E 2V35A 3M61U 1NESE 2VH0A 2A7JA 2ZDMA 3F0PA 2G8TA 1NY22 4ZCNA 2P8OB 1K22H 1L0ZA 2K1QA 1GMHF 4X6OA 3SUDA 3KN2A 1HAVA 2L6OA 3TITA 3SNCA 5DG6A 1T8NA 2DE8A 3ZVAA 1BHXF 3SNAA 3SU4A 2FESH 2ZFPH 3C1KA 1YCPM 2FI4E 9ESTA 1UVUH 1C5YB 1E79D 2JETC 3MH4A 1GHAG 3MI4A 2ZFTA 4Y7AA 3S0NA 1T8OA 1N8OB 4FVBA 4AGJA 1SQOA 2JJ1D 2ZCHP 5TCAA 1TGTA 1NRSH 1SR5C 1TA6A 4DIHH 3SZEA 4UE7H 4X8SH 4AB8A 2R3UA 2R2MB 4UEHH 3M3VA 5L30H 1O39A 1HAPH 3OTJE 1OYTH 3GCOA 4WF8A 4ZUHA 1W11U 2M5TA 5C0UA 1O3BA 2A4RA 5C67A 1SGRE 1AUTC 1EX3A 1XVMA 1C2IA 2VIPA 4UFFH 3V12A 1ARBA 1DANH 4RSPA 4SGAE 1C4V2 4CH2B 2ZU4A 1QTFA 1O2TA 1EAXA 2QV1A 1O2UA 4I32A 1K1JA 1O3GA 4IMQA 3T27A 4CHAC 2Y5HA 1FY4A 1ELTA 3FFGA 2ZWLH 2FOBA 1F0UA 6GCHG 2FS9A 2V0BA 3MO6A 1EASA 1UCYH 2ZGJA 4E05H 1O30A 1GI3A 3A7WA 1GMDF 3GS9A 4CH8B 2AEIH 3W95A 1ZJKA 4ZHLU 1ZTJA 2Z94A 1V2JT 1P2QA 2PKSB 3BTKE 3PMBB 1SI5H 3EAJA 2STBE 5JPMH 5E0HA 2JJ2D 3ODFA 1S6HA 1IQNA 2GCTB 3VGCB 2ZCKP 6LPRA 2J98B 3T62A 5A8XA 4O3UA 3NXPA 1EZUC 3SZNA 1PPZA 5PTPA 1ESTA 3F9FA 2EI8A 3A8CA 3F9GA 3PV4A 1C9TA 2EI7A 3F3BA 1EAIA 1A61H 2SGAA 1BTUA 1OHHD 2FTLE 1COWD 1AI8H 2YOLA 2G00A 1K2I1 2ALPA 3GY5A 4I8GA 2NWNA 2UUYA 1IQIA 1FQ3A 2CHAC 2RG3A 3M5NA 3SYJA 3UB0A 1V2NT 3DSPA 4AFQA 1SVPA 2O9QA 4U30A 4K1TA 1D6WA 1NRNH 2FX4A 3MU1A 1GJ5H 4O97A 3T29A 5SGAE 1TPAE 1GDQA 5KEDA 2PV9B 1PPCE 4OGYA 5EPYA 1MZDA 5C1YA 2Z9JA 1UTOA 2G55A 1DUEA 1W7GH 4E06H 1UVOA 1FY8E 2HPQH 5AHGH 4O3TA 1FXYA 3F6UH 1JWTA 1GG6C 1VJ9U 1O2XA 3AAUA 1V2PT 1LQDB 3ZZ9A 1BBRE 1C1RA 3VG8A 1GI2A 4FUEA 1C5RA 5HMAA 3PYHA 4A1XA 2ILNA 1C4Y2 5E8EH 1PQ7A 1KXBA 3AW0A 2PGBB 3HPTB 2BQWB 1TPSA 3VEQB 3SQEE 5HYOA 1GJDB 4ZKRU 2A4GA 1UTMA 2L74A 4JZEH 3STJA 1P03A 1SLXB 4IGDA 1O2HA 4U32A 2I6SA 1FONA 1MU8B 1GJCB 1Q2WA 3MNSA 1L4DA 5DP8A 5GCHG 8KME2 3HGPA 1NN6A 4ISHH 3SJ8A 4LK4A 3SJIA 1P10A 4JZ1A 2ZFSA 3R0FA 1W3CA 1WV7H 4TSFD 1AHTH 5ETXA 1NBME 4ISIH 1C2GA 4DT4A 1A3EH 1EB1H 1ACBE 5HKKD 2ZTZA 2H9EH 4X1QU 1GJAB 3G01A 1OP2A 1ZGIA 1QRXA 1LMWB 1S6FA 1Z1IA 3TJVA 4WMEA 2WUCA 5HXFA 2QXGA 1DWBH 1GGDB 1H9IE 1LKAA 1BTZA 1SHHB 1O5AB 2QXHA 5F53A 2EY4C 3OY5U 1TBQH 1UCYE 5K0HA 1CGHA 1JIRA 3M5OA 1ZSLA 1P06A 3RXRA 1TPOA 1V2QT 1O5BB 2OC0A 4I8LA 4DIIH 1QCPA 4X0WU 2R2WU 1EB2A 4TY7A 2G52A 1C1OA 2GJGA 2TPIZ 5F8TA 4THNH 1P05A 5DKMA 3RXKA 2FI5E 5CHAC 5T1VA 2OC8A 1LVBA 3QGNB 3GY3A 1P04A 1Q31A 3KQ5A 1HUTH 1O2JA 1CGIE 3P8FA 1UK2A 3SU2A 2EA3A 2HNTE 3SO3A 4B73A 1IQHA 1T8MA 4ZHMU 5E0GA 5ESBA 2STAE 8GCHG 3LT3A 2HLCA 1N6XA 5GWZA 1AVGH 1C2DA 2HNTF 1V2UT 1A1RA 2HLDD 1P57B 1KDQA 1LHFH 2SNWA 4RN6A 2CJIA 3SUFA 2OTVA 1IQMA 2B9LA 1YWUA 1E34B 4CRCA 2VIDA 4KP0A 1EZSC 3VXEH 1O3CA 2A2QH 1FAKH 1QR3E 1PYTD 3F9EA 3F9HA 4Y8YA 1HJ9A 1L2EA 1P2KA 1SL3A 3EGKH 5HM9A 2KM0A 1Z8GA 4ABIA 2XC4A 1HAXB 1V2TT 3AW1A 1ZYOA 2VIQA 3UR9A 1GI6A 1LKBA 1MUEB 1NFYA 3PO1C 1VR1H 2AIPA 2FP7B 3SNEA 1WOFA 2C8WB 3OFND 4JZFH 4MPUA 4MNYA 1HV7A 3BG4B 1IQLA 1C1QA 4DW2U 2AMPA 2YMSC 1S6LA 2QAAA 4RT0A 3MOCA 1TNJA 3K6ZA 5TJXA 3TGKE 3HKJB 3GISB 2VWNA 3E6PH 1MBMA 2ZFFH 4TPIZ 1QL9A 2OD3B 1ABIH 1JIMA 3GDVA 1C5MD 3QLPH 1D4PB 2DUCA 1IQEA 2W5EA 4GUXA 2J97A 1G3CA 1BMMH 3T26A 4GSOA 2GVFA 2F3CE 1C5SA 1JRTA 1O2OA 4Y11E 3M5MA 4ABBA 2RCEA 4RKJB 5C1UA 3RU4E 1B0EA 1V3XA 2PTCE 3LJJA 5GJ4B 1FZZA 2OBQA 1JOUB 4A1TA 3E8LA 1HIAB 1D3QB 1DFPA 1F92A 3Q3YA 2ZQ2A 2BD2A 2WPDD 1O38A 2AGIX 3V13A 4DGJA 1AWFH 1QL7A 1FJSA 1EPTA 3E91A 1TBZH 5B6LA 1PPBH 1FLEE 1THRH 3FP6E 3A7VA 1O3AA 2BLQA 5F6MA 1CHOG 1LHDH 1C5PA 1GL1A 1ZTLA 3KQCA 1AMHA 2BD9A 3NK8A 3ITIA 3P95A 4AC9A 1D6RA 2VINA 3PMAB 4OS1A 1GHAF 2A7CA 3P17H 2VWLA 3BF6H 1BHXB 1KLJH 3SJOA 1KXEA 3EDXB 1P9SA 1CGJE 3RXEA 3MH6A 2VU8E 4CBNA 3K6YA 1GI0A 1GBIA 1G2MA 1C5TA 1HYLA 2BY6X 3S9AA 1NRPH 1O33A 5HIZA 1TE0A 1VKYA 1C5UA 2QXIA 1WBGB 3NZIA 1NU7B 4BNRA 2RA0A 3CS7A 1VITF 1DPOA 3A81A 2PW8H 4Z6AH 4FUDA 1CT2E 1AZZA 1ZSJA 2WYGA 1BRBE 1O2PA 1ORFA 1WQVH 1GWAA 3BEUA 4XDEA 2IJD1 1MKXH 1NTPA 2ZG0H 1PFXC 1V2RT 4NZLA 1TRNA 2SGDE 3MHWU 3QUMP 3A86A 2B0FA 1IQKA 2RDLA 4XBDA 3SHCH 3L33A 2XNIA 5CE1A 4LZ4B 3SV8A 5T6DA 3AAVA 2Z7FE 3PRBA 3UWIA 4AOQA 1C2FA 2R0LA 1SGEE 3UOPA 3ZVGA 1Y3VA 2KR7A 4VGCB 3MTYA 3RU4T 1C2MA 2J2UA 4ESTE 2RFKC 1UK4A 3MMGA 3LGUA 1G9IE 2ZKSA 2IPQX 1ARCA 3OEED 5ESTE 3RMLH 1DY8A 3RXFA 3F0OA 1TOMH 2ZHQH 4XBBA 4ABJA 1SHYA 1V2WT 1NC6A 3S69A 3UY9A 3SV7A 2NU1E 4NFEA 1VGCB 3UUZA 2D2DA 3E3TA 1E0FD 3F2FA 2XXLA 2FPZA 1O5DH 2XBYA 1OXGA 2BDBA 5L6NH 1BZXE 1EUFA 2GDDA 2AMQA 1O31A 2FXRA 3A8AA 2Q6GA 2A7HA 1Z6JH 3BTTE 3QGJA 3SNDA 1SC8U 1P9UA 3O8DA 4I86A 1KXAA 3ZVEA 1XVOA 3M5LA 4NA9H 1AD8H 1GJ4H 4NIVA 1NRQH 2BOKA 3V0XA 5FX6A 2C4FH 3KEEA 1ETSH 3UPEA 1AVXA 2K8IA 1OWEA 2CF8H 4NFFA 1M9UA 1MTVA 2J38A 1XUHA 1WUNH 3KQBA 6CHAB 4IW4E 4XBCA 4AX9H 3ZZ7A 2KFWA 1TYNA 2GT7A 1V2VT 1BJVA 1EZXC 4FETA 3BN9A 3DUXH 1YCPK 1GI4A 1ZHMA 1ELEE 3U8RH 5T3HA 4WMFA 1OWDA 1DITH 2OK5A 1AO5A 1FN6A 2SNVA 1FX0B 2PTNA 4K69A 2ODYB 1MMJN 4NG9H 3FZDA 4FXGH 2ZI2H 1IQGA 3SOSA 3ESTA 2ZIQH 3RXDA 1AB9C 1HFDA 2BD5A 5IK2D 3TNSA 5JB8S 4Q4LA 2V3OH 5IDKA 3VPKA 1J9CH 3RM2H 1DSUA 1SSXA 2BY9X 3RC4A 2P95A 1J8AA 1AUJA 1NS3A 1EJNA 4DY7B 5GCHF 2WSSD 3MNCA 1ZSKA 2OUAA 2ALVA 3TK6A 3T5FH 2R9PA 4DURA 4KGAA 2UWLA 3RXOA 4O03A 3VFEA 1SGYE 1ABJH 1WDIA 1YPHE 1CT4E 1BA8B 2QYIA 3WW7A 1HAOH 3E0PB 3MU4A 3UR6A 1OKXA 1KSNA 4FVDA 4FUJA 1BCUH 4FUHA 4CRDA 3ZYEA 4Y71A 2W7UA 1YLDA 2A4QA 2WYJA 4JZDH 2NU0E 3F1SB 4Z1MD 4CRGA 1GJ6A 1KXCA 4YM9A 3DSGA 4WWYA 2OINA 1GBDA 3BTWE 1QB9A 1LPKB 1QL8A 2G5VA 2ZDAH 3GCHC 4M7GA 1Y3YA 1O3EA 4DT7B 1BTPA 3A89A 1BB0B 1YPMH 3LIWA 1RIWB 2ODPA 2A1DB 1BTWA 1GHWH 3VB5A 1K1LA 1NFXA 4MPWA 1SGPE 3K65B 4Q7YA 1BMNH 1DDJA 3A8BA 1S5SA 3PLBA 4JYTA 1D3TB 1W12U 1V2OT 2ZECA 3W94A 2QF3A 1KLIH 1OWJA 3UTUH 3SI3H 2SGEE 1GCTC 3NWUA 1ANEA 1BQYA 1X7AC 2BMGB 1ZTKA 8GCHF 1UTKA 4YZUA 1EXFA 2A4OA 1F5KU 1XKAC 5DP7A 1O3OA 1INCA 4ABFA 1C1PA 4JMYA 2UUFB 3MH7A 3FP8E 1PQ8A 1C5LH 1SGDE 1MKWH 1MQ6A 4Q2KA 4JCNA 4XRNA 4YXWD 2W3IA 3AVZA 5J4SA 1XUGA 4NA8A 4AB9A 5A2MH 1MU6B 2FOEA 1Z8RA 1EAWA 2YMSD 3BEFB 4K8BA 1UVTH 1C4U2 2ODQA 2BYAX 1AQ7A 1TALA 1P02A 4FU9A 1A46H 1P2OA 1WYKA 1GBMA 1HAZB 1TMTH 2PKAA 1NBMD 5BPEA 1HAHH 1GHXH 3EA7A 4F49A 3QZRA 3P92A 2VBCA 3UREA 5G4BA 4B1TA 2WPMS 3TJNA 4DJZB 1A0JA 1MD7A 1O2QA 1TRYA 1EP5A 4JYUH 1GHYH 5EPNA 1VCPA 1GJ7B 2J94A 1T4UH 2D8WA 5EJLA 1YPHC 4B2BA 3JZ1B 2Y5GA 2OQUA 3RMNH 1ELVA 1PPEE 2FOGA 2VWOA 4TWYA 2VWMA 4K5ZA 5A0AE 1DM4B 3LONA 1TMBH 3BTQE 1L1GA 4ABHA 2FX6A 4Q7XA 1C5NH 1ZRKA 1JBUH 1SGCA 2VGCB 1GBLA 3JZ2B 2BD8A 2NU4E
chains in the Genus database with same CATH topology
4CBOA 1HDTH 3PROA 1CA0C 2ZTYA 4DVAU 2ESTE 5IYTA 3P6ZB 2OLGA 1VCQA 3GYLB 3PWCA 3LU9B 1TRMA 2Y5FA 1OP0A 2BLWA 3OSYA 2FS8A 2VVVA 1GBAA 1BBRK 4ABAA 1P3CA 1C5XB 1G3DA 2BXTH 3ENSB 1CHOF 4BXWA 1UTPA 2BDGA 2BOHB 5T6FA 4CRFA 7ESTE 1TWXB 2NU3E 4X1RU 5AVDA 4WY3A 1BRCE 2H2ZA 1G3EA 1A5IA 4D76A 3P8GA 3KNXA 2VVCA 4OS5A 2HPPH 1CSOE 1YLCA 1K28D 1GBCA 1BMAA 1JXPA 2J34A 5EXMA 5GPIB 1P12E 1Y5UT 2XBVA 2HGTH 4HZHA 1CT0E 2GCHG 1O3LA 2ZNKH 3A7XA 2P59A 3WY8A 1NZQH 3KGPA 1GBFA 3RXGA 5ABWA 1MBQA 1KYNA 3NKKA 4I8JA 2ZDNA 1GDUA 3PTBA 5TCCA 5FXLA 2F9OA 4CRAA 1RS0A 1ETTH 2Z3DA 5JB9S 5FBIA 2W7SA 1QJ1B 2JH6D 4ABDA 3BSQA 1MTNB 1GHBG 2BDCA 2PGQB 4ZH8A 2GTBA 3UQVA 1FAXA 2KAIA 1UCYK 7GCHG 1GI8B 1J14A 2QY0B 3GYMA 1D9IA 1UHBB 1A4WH 1O35A 2C8ZB 3GICB 4IC5A 1FY5A 5EGMA 3RU4D 3RXCA 1Q3XA 1O5CB 2F9NA 1HJAC 2QA9E 2UUJB 2GMTB 1CO7E 5LPRA 5E2OA 4I7YH 1L1JA 4AFUA 3B9FH 3LGWA 3RXQA 4Y0ZE 1V2KT 2RA3A 5L2ZH 4OS4A 4BTUB 4X8UH 3KF2A 3TJOA 2PR3A 1GBHA 1QQ4A 1Z1JA 2WINI 2GGVB 3LKWA 1NFUA 2ZFRH 1C2HA 2ANWA 1V2ST 2Q1JA 1SFIA 3PMHB 1YYY1 4MLFB 5I46H 1GI5A 3P70B 3P8NA 1U6QA 1PQAA 3E90B 1F0TA 3A7ZA 1O2SA 1QNJA 3GCNA 1O3JA 5CMXH 1XM1A 1BTYA 2ZCLP 1QIXB 5GIBA 3PWBA 4JK6A 1O3DA 1MD8A 5DP3A 2ZGBH 1DSTA 2FI3E 1BRAA 3QTVH 2ZU5A 2UWOA 3ATLA 1HBTH 3PTNA 3RMOH 1H9HE 4XSKU 1NU9A 3VB7A 2B8OH 1QBVH 4WH6A 5BRRE 2WPIS 5HGGA 4SGBE 3ZZ4A 3I78A 1SLWB 1CU1A 1RD3B 5GDSH 2BHGA 5DP5A 2A31A 3M7QA 1SQTA 1P0SH 1WAYB 4XE4A 1SPJA 4K3JA 2FOMB 3TLOA 4HI3A 3ZZBA 1UVPA 2XW9A 1W0ZU 1S81A 1ELDE 3LDXH 1SGIB 1EOJA 2JETB 1AKSB 2EC9H 1O2RA 3IITA 2ZGHA 3TVJB 1DXPA 1O2WA 2H9TH 3MFJA 1W0YH 4UFEH 1T4VH 4QT8C 3PMJA 5DJ7A 1CBWC 1C5WB 2F9PA 3TIUA 1CHGA 4CREA 1SMFE 1HAIH 3RXIA 2A5IA 1UTJA 1ZHPA 1K21H 1WTGH 4LXBH 1UK3A 4K1SA 1MTWA 1DWDH 2VIWA 3DFJA 3L3TA 2TGTA 3ZVBA 1O2GH 2JKHA 2ZDVH 2ZZUH 1T8LA 2XCFA 4KELA 3LGIA 1AFQC 5LPEA 1YPJH 1P2IA 1D3PB 4K2YA 2A45B 3BG8A 4MG3A 3VB3A 3BEIB 1TX6A 5GXPA 3D62A 4IN2A 1XUFA 1AE5A 1ZGVA 2R3YA 2XTTB 3MU5A 2UUKB 1AWHB 2BDIA 5C3NA 1FN8A 1HAVB 3TK9A 5A8YA 1WQSA 1PQ5A 5T6GA 2YNBA 4CHAB 3VB6A 2V3HH 3RXHA 4Q80A 4TYDA 1BJUA 3A7YA 1HNEE 3UIRA 1G2LA 3KHVA 1LHGH 2SGPE 3CENA 3U8TH 3Q76A 3GY2A 2ULLA 2F9UA 4H6TA 4ZMAH 1OSSA 2J4IA 4BAMB 2P8OC 1MAYA 3I29A 3SJKA 1QB6A 5C5OA 1G30B 1C2JA 1DWCH 1QRZA 4GHTA 4WJG2 5A0CA 1SLUB 1HCGA 3URDA 1AU8A 2XC0A 1CVWH 5LPFA 5J4QA 2Z9IA 4KTUA 5FHTA 2GZ9A 3A85A 3GDSA 4O9VA 3RXUA 1DUAA 2Y6TA 3U98H 3GDUA 2PUQH 2ANMH 4OGXA 1UTLM 4GVUA 2VNTA 1N8OC 2OXSA 4A6LA 3VB4A 1OPHB 3OX7U 1UTQA 2GZ8A 3ZVCA 1XKBC 3N7OA 1UVSH 2BLVA 1LVOA 1RRKA 4YLUA 2LPRA 1T32A 3RXJA 2CHAB 2CXVA 1ANDA 1GBBA 3ODDA 3D65E 4AN7A 4WH8A 4NA7A 2G4UA 4NCYA 5JYIA 2XC5A 1KY9A 2EI6A 3SORA 1O34A 4HTCH 1IHTH 3MH5A 1MAXA 3Q77A 4OS2A 1AZ8A 2FTMA 3SGBE 1RJXB 4OS7A 1XXFA 1GCDA 1O32A 1FY3A 4FU7A 1UTNA 1ZMJA 2FLBH 3SGAE 2CV3A 1GVZA 2FWWA 1LVYA 2FLRH 1EPTC 1E38B 1OS8A 1ZZZA 1THSH 1GG6B 3M7UA 2Y7ZA 2ANYA 2VIVA 2Z3CA 1HB0B 2ZGCA 1K9OE 2BLOA 3ZYDA 4JZIA 5FCKA 3RMMH 1JMOH 2QN5T 3UWJH 1ELGA 2ZFQH 4ZHAA 2V6NA 4K1EA 6GCHF 1YCPH 2GDEH 3OY6U 4AYYB 5C5NA 3LC3A 2BY7X 1BDAA 3BIUH 2BXUH 1LPGB 1HAYB 3EE0B 2IOTA 2WPLS 1E35B 3BTDE 1ZPBA 1V2MT 3HKIB 2O8UA 1YP9A 3FZZA 1K1NA 4NIWA 4YT7H 2GCTC 3VGCC 1LHCH 2O8TA 3U1JB 4KKDA 2WPJS 1QJ7B 2ZU2A 1IAUA 4X8TH 1OYQA 1QHRB 1AN1E 2BDAA 2P3UB 3TPIZ 1O2ZA 2P94A 4MPXA 1A5HA 4Q7ZA 2H6MA 4R0IA 4KTSA 4CR9A 3TJUA 1ZPZA 3HATH 1AGJA 1XUIA 1C9PA 1H1BA 5EU8A 1GI7B 1B7XB 1A7SA 4X1SU 1ELFA 2QXJA 5C1XA 5JDUB 1XX9A 3EQ0H 1LQEA 4GLYA 1F0RA 1G37A 2Z3EA 3KL6A 2BTCE 3RLWH 4I8KA 3GY6A 2J95A 1N6YA 3RC5A 3SGQE 4F4OC 3K9XB 5EQRA 2QCYA 5EODA 1MKXK 5CHAB 1A0LA 3RXTA 4E7RG 2GCHF 4ZAEA 3SU1A 1ZOMA 2TBSA 2BX4A 4ZXXH 3UFAA 2TGDA 3GCTG 4BXSA 1FUJA 2PSXA 4IMZA 3FP7E 4BAOB 1DT2A 1P01A 4HFPB 4Y7BA 4IBLH 3BTEE 3GY7A 5DGJA 1GHBF 1P2NA 3EA8A 2AMDA 3S9CA 3LGVA 3H7TA 2GZ7A 1G36A 3TNTA 1IOEA 3QK1A 1XXDA 4D9QA 3LC5A 1EJAA 1TX8A 2SFAA 3QN7A 3M37A 1SB1H 3H7OA 2AYWA 3SV9A 4MVNA 1TFXA 1EZQA 3RLYH 5EXNA 4INHA 3QZQA 1AE8H 4FUCA 4R8TB 4X2VA 4MNWA 3PO1B 1L4ZA 2AGGX 2ZGXH 2ASUB 1PPHE 5EXLA 4ASHA 1O3PB 2HOBA 2P3FH 3B8JA 4XFQA 2C93B 1PYTC 1YC0A 1GDNA 4X2XA 4I33A 1O2NA 4WVPE 1GGDC 3RXSA 4ISLA 2HVXA 2JH5D 4IC6A 1QA0A 5EQSA 2O8WA 1QBOA 3O8RA 1CE5A 1TQ7B 1OWHA 5C20A 3BIVH 1G3BA 1YF4A 1ZHRA 2ZPSA 1GHVH 1TGCA 2ANKH 5EW1H 1C1MA 1KDQB 1GVKB 5EQQA 2BDYA 1C1WH 1C5VA 4YLQH 1UJ1A 1DVAH 1C2KA 1ETRH 1EJMA 1ELCA 4UFGH 3TU7H 3A83A 4BOHA 2BY8X 2I6QA 2F9BH 3IWMA 4GAWA 1BUIA 1DICA 1TAWA 4XOJA 3E16B 1OP8A 3D23A 2XWBI 1HPGA 1DS2E 1DLKB 1RTFB 2QF0A 2C3SA 4AG2A 4NIXA 4YOGA 1NPMA 3SQHE 4DG4A 2BZAA 4X2YA 5FPYA 1H4WA 2BZ6H 3RC6A 4BTTB 1XMNB 5DP9A 3TH2H 1UO6A 4BTIB 1VCWA 3UNQA 1J15A 3SN8A 1WSSH 4I31A 5I25A 3SW2B 1HIAA 3GOVB 4MNVA 3KQEA 2FDAA 3TGIE 3M3TA 2PLXA 1GBEA 2BX3A 1BBRH 2ZHEH 3S7KB 1TMUH 5A8ZA 1ZJDA 2ZA5A 1W2KH 1ZLRA 4X6PA 3A87A 1O0DH 2FO9A 2BB4A 1SGTA 4ZROA 5A0BA 3SUGA 1GI9B 2P16A 2VH6A 3QDZB 1HLTH 4Y6DA 4X8VH 4FUFA 3BG4C 1FMGA 1FI8A 1A3BH 1Y59T 1BT7A 3ZZDA 1VITG 1OWIA 1TNIA 1QBNA 3Q3XA 2BVXH 1ZR0A 4GCHG 4MTBA 4WXIA 1Z71A 1K1PA 1ANCA 2FZZA 1TNHA 1HGTH 2AS9A 5F03A 1YKTA 3SV6A 3SI4H 1O2MA 3FAOA 1XUJA 1E36B 4Y8ZA 3STIA 4AZ2B 1BTHH 3LGTA 1TB6H 4AGKA 4Z0KA 3L6PA 4AFSA 2XWAA 5FPTA 3SU5A 1GHZA 2F9VA 4UFDH 3NUMA 2Y80A 1EPTB 3LOXA 3SU0A 1QJ6B 1FIZA 1BTXA 1S83A 2GV6A 2JH0D 2B5TB 3ZVFA 2FIRH 3LJOA 3AASA 1TABE 2Q6DA 3SU6A 2Z9GA 4YT6H 3RXVA 1RFNA 2XCNA 1SOZA 2A5AA 4MDSA 1GPZA 3P8OA 2YNAA 1AIXH 4CR5A 1SGQE 2ZHFH 1H8DH 4U2WA 2BDHA 2OC1A 3VXFH 3RXMA 1Z7KA 1SGFA 2O8MA 1GVLA 1V6DA 5LGOA 1OX1A 2A32A 2GT8A 4Y76A 1MKWK 1O2LA 2ZO3H 1QGFA 1HAGE 1AFEH 1TNGA 4NSYA 1IQJA 3KCGH 1FPHH 4PROA 1G32B 3PLKA 1GBJA 1YPKH 1K1MA 1A5GH 1SBWA 1SOTA 3EYDA 2VJ1A 3HK6B 4IS5A 1P09A 1O2KA 1A2CH 2FYQA 1Y5BT 2R0KA 5AFYH 1SG8B 1CA8B 5JBTA 2WPHS 3URCA 3E0NB 2CF9H 1LTOA 1Y3UA 2FEQH 1P3EA 3ZZCA 2FODA 1IHSH 4H42U 1K1IA 4A7IB 4WMDA 4B76A 4Y8XA 4ISNA 2BM2A 3BTHE 4UONA 1GBTA 1C1SA 1J16A 4Y79A 1LHEH 2VIOA 4NZQA 1TPPA 2Y82A 3CP7A 2OP9A 4GHQA 1O3KA 1PJPA 2G81E 3MYWA 3RXPA 2WV4A 3DA9B 2OQ5A 1TGBA 4TPYA 2H5DA 2FYRA 2IJOB 1PPFE 3BTFE 2ZHDA 2G51A 1FPCH 1P2JA 3SBKA 1WCZA 2GX4A 1ZMLA 1P11E 1MTSA 4X1PU 2XBXA 4VGCC 2ZPRA 1AB9B 1TIOA 2PUXB 3MNXA 3NCLA 3V7TA 4H4FA 2FOCA 1WU1A 2PWXA 1OWKA 3T28A 3SNBA 4AYVB 4OS6A 4BAKB 2WV5A 4BAQB 4X1NU 4TWWA 1W14U 1O2IA 2TIOA 4NSVA 3MO3A 3RDZA 4AG1A 2THFB 2BQ7B 3M35A 4B74A 1VGCC 4YOJA 1T31A 1ELBA 1Z8IB 1TGNA 3F68H 5EG4A 2PSYA 1EOLA 1QY6A 1W7XH 1GI1A 1P8VC 7LPRA 1O5GH 1O5EH 4JK5A 3ZZ8A 1QA7A 1GMCG 1Y5AT 2QIQA 4MNXA 1KLTA 2VB0A 5DP6A 1F5RA 1YPEH 2FMJA 4A5TS 4DOQA 3CS0A 1C5ZB 4ISOA 3ZV8A 4D8NA 3GCHB 2G4TA 1O2YA 2CN0H 1QURH 5JBCS 1QRWA 4B2CA 4FUBA 3B23B 3PB1E 4B75A 6CHAC 1GMHG 4FUGA 5DPAA 1IQFA 2ZDKA 1W13U 1NFWA 2H9HA 2HRVA 1VITH 1OOKB 5JBAS 3M7TA 1GCTB 1YM0A 4ZXYH 5FPSA 1B5GH 1N1LA 2LNCA 3GCTF 2C8YB 1NO9H 1TA2A 1TLDA 4J1YA 2XYAA 1BITA 3H5CB 1AVWA 4A1VA 2BQ6B 3ZV9A 3MU8A 4GPGA 1LCYA 3T25A 2J92A 1RTLA 3M3SA 3RM0H 2OC7A 4E7NA 3O8CA 1GBKA 5EW2H 5AF9H 3QTOH 3QO6A 4YESB 3PLPA 1DXWA 3HK3B 2ZTXA 1D3DB 4RKOB 1O3NA 2FOHA 2BVRH 3U9AH 1HXFH 2BD4A 2PHBA 1DE7H 2ZP0H 1O2VA 3BV9B 2A5KA 4K60A 1ZPCA 1SGFG 1DOJA 4LOYH 4MQAA 2XBWA 3MNBA 1W10U 2AFQB 2ZU3A 3Q3KA 3UNSA 4INKA 1Y3WA 1MCTA 3Q00A 4H6SB 4X6MA 4ZKSU 1MZAA 3V3MA 2IN2A 3FANA 3NPSA 3GY8A 3T2NA 4K8YA 2SGQE 1YGCH 2QGRA 4JYVH 2ZEBA 2D26C 1GMDG 3HGNA 1RIWC 2AGEX 3BTGE 2FOFA 2BVSH 4DCDA 1TOCB 1J17T 5EOKA 4X6NA 1O37A 1KTTB 1THPB 3SJ9A 1EATA 1EP6A 1CA0B 1KXDA 2WPKS 1YBWA 3K2UA 4FU8A 3MO9A 2PFEA 3DFLA 3ATKA 3ATIA 5E2PA 3SV2H 3RXLA 1JRSA 3SHAH 1ANBA 1ESAA 4HGCA 3PM3A 4D9RA 3A7TA 1TNLA 5F8ZA 1GJ8B 8LPRA 1RXPA 1YPLH 2PKAB 2DE9A 3GY4A 4AFZA 1O36A 3ATMA 1DY9A 4TY6A 2HNTC 1SGNE 2O8LA 9LPRA 1C1UH 2F91A 3O8BA 3MWIU 3U1IB 1TGSZ 3LH1A 1S0RA 2EEKA 1K1OA 1Z6EA 1F5LA 1ZMNA 2ZF0H 3E1XB 2J9NA 1TQ0B 1W8BH 3TH4H 1H8IH 4X2WA 4Y10E 3LPRA 2P3TB 4J2YB 1F0SA 1DX5M 1KTSB 1TONA 1Z8JB 1C1TA 5FAHA 5L2YH 3QX5H 1C5QA 5F8XA 2Y7XA 1RTKA 2OCVB