3Q00A

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3q00A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3q00A02
1V6DA 4CH8B 3GY3A 1HB0B 2ZHDA 1BZXE 2FX4A 2ZGJA 1C5VA 2XWBI 3F1SB 2AMPA 2A5AA 3RUOA 1OWJA 2I6QA 3SI3H 1FIZA 4WMFA 1MBMA 1XXDA 1OOKB 3VB6A 1NZQH 1O3AA 1W0YH 3MMGA 3ZZ5A 3RMNH 2VIPA 1GJ7B 1SLUB 1UVTH 2VNTA 1KTSB 4Y8YA 1O3FA 1Z6EA 4TWWA 1O5FH 1KXAA 2BLWA 4YOGA 1L0ZA 3FAOA 1NU7B 2F9BH 2B0FA 4O03A 1A1RA 1GI6A 1EZUC 1GHAF 1UTJA 2B8OH 1C2GA 1SOTA 1B7XB 4DGJA 1VJ9U 3D65E 1JXPA 3K9XB 1AHTH 1AGJA 1W13U 1YPJH 5ETXA 1GL0E 3ZZ6A 1QB6A 2GGVB 1GHAG 1V2LT 1FN6A 3S9BA 3HK3B 1QA0A 4ZKRU 1NESE 1U6QA 2DE8A 4VGCC 3GCNA 1HUTH 2Z3DA 2H6MA 2G8TA 5EGMA 2J94A 4X8TH 3PO1C 2RDLA 5TJXA 3UQVA 3A7TA 2FOEA 3ZVEA 2ZU1A 4X6OA 1ZHRA 5HM9A 1MTUA 1GJ8B 2Z7FE 1IQKA 3M7UA 1BBRK 2PLXA 3UOPA 1CVWH 1TX8A 5A09A 1FI8A 1YPLH 2QAAA 2IPHA 5C1YA 1V2UT 2ZC9H 5A8YA 4H42U 3Q00A 1BJUA 3ZZ3A 1NFXA 5CHAB 4ZKNU 2ZTYA 1ETSH 1OXGA 1AE5A 3M5OA 1ZTLA 1C5OH 4XFQA 2H9TH 1C2MA 2BD4A 4FVDA 4INLA 5DP7A 4NA8A 1SGFA 2G5NA 1Y5UT 1IQLA 1LCYA 3NPSA 1CGIE 3QTOH 2VIQA 1BHXB 1TGTA 4BAQB 2VB0A 1LPGB 1JIMA 5EXNA 5T6DA 2ILNA 3ODFA 4NIXA 2BXUH 2JETC 1JIRA 1Q2WA 2FWWA 2C4FH 1MU8B 1DVAH 4J1YA 1C5UA 5I46H 3DA9B 1Q3XA 3TITA 1P8VC 2ZGXH 1JBUH 3P8FA 4B1TA 2FYQA 4HGCA 1W3CA 3MO6A 1TQ7B 1TGSZ 2F9PA 3SU5A 4DOQA 1M9UA 4K1TA 2ZP0H 3L3TA 2UWPA 4OS2A 3SHAH 2Z9GA 2HRVA 1JRSA 1W0ZU 1L2EA 2WUCA 1MKWH 1DDJA 1SGQE 1SL3A 1MH0A 2O8UA 3OY5U 2C93B 1DICA 4XOJA 5B6OA 4AN7A 1TYNA 4KP0A 4O3TA 3ZZCA 5C5OA 2A2QH 4UFEH 2FODA 3GDUA 2XCNA 5GPIB 1ZMNA 3PMHB 3SU2A 1CT0E 2RG3A 3D62A 3EA9A 4AFUA 3DUXH 2WPHS 4AOQA 1ZSKA 2EC9H 4NWLA 1KXCA 4GAWA 1A2CH 3A8CA 1B0FA 3E0NB 4WMDA 2GKVE 3PWCA 3VXEH 1Q31A 1V2OT 3KNXA 5FHTA 2BLQA 1CQQA 1O5GH 3LGUA 5T3HA 1OPHB 1Y59T 4D9RA 2ULLA 1BBRH 3CP7A 4ASHA 1C5WB 2G00A 1O3HA 3RC4A 2OCVB 1O2KA 1RD3B 1KXDA 7ESTE 1EP6A 5GXPA 1P2KA 4GSOA 1E38B 1V2WT 5L2ZH 4A5TS 2QF3A 1LQDB 1THRH 3A7YA 1MCTA 2FX6A 7KMEH 1D3PB 1F0TA 1XUHA 1IOEA 1C2EA 4ZHMU 2ZPSA 4WMEA 2Z9KA 3KEEA 2OTVA 1GJ5H 1QL8A 1ELEE 2WPKS 3GCTF 1BTPA 2ZFQH 2KAIA 1BMLA 1V2ST 1FUJA 2VGCC 1GDUA 1O2LA 5C20A 1EPTB 2XXLA 1NTPA 1O36A 1G3CA 1AVGH 1O2XA 4AFSA 2PW8H 1O5DH 1G2MA 4Y0YE 1ESAA 2QIQA 5A0CA 4U32A 3U1JB 1OWEA 2Q6FA 3F9GA 4F49A 2H9EH 2F9UA 3B23B 4X2WA 3MNCA 2CHAC 4AB8A 4FUBA 7GCHG 1RGQA 1SHYA 2EEKA 3LH3A 3BTEE 2FXRA 2TPIZ 3RMMH 4ABFA 3SU3A 5A8ZA 5AFZH 2M5TA 2HGTH 3U8OH 1QGFA 2OC0A 4YT7H 3VEQB 1G3EA 3BTHE 3VGCB 3TJUA 4Q7YA 1ID5H 1O30A 1RTLA 3FP7E 1V2TT 4AFZA 5L2YH 1A5GH 3UFAA 2BDAA 2AFQB 3ATKA 3LC3A 1MKXH 2NU3E 1UJ1A 3HGPA 4UE7H 2BD3A 2XC0A 1TNLA 2QYIA 3QGNB 3S69A 2ZDKA 2ZIQH 2G4TA 4U01A 1LVBA 1MTNC 2PWXA 2C8XB 3WY8A 1VZQH 2STAE 1GCDA 1TBQH 2ZPRA 2QXGA 1YLDA 1DY9A 1ZPBA 3CS0A 1AWFH 5EG4A 1WAYB 5EW2H 3E0PB 3ZYEA 1TFXA 3PLBA 2OQ5A 1YP9A 2ZHWH 1S6FA 1GI5A 4NFEA 1UTPA 5E0GA 2SNWA 5HMAA 2BDYA 1GDNA 1RTKA 3P92A 2R2MB 2TGDA 1H9IE 1V2MT 2KAIB 1FY1A 4DG4A 1ZSJA 8LPRA 2HNTC 3CS7A 3GOVB 1TQ0B 3MHWU 2JH0D 2V3HH 3SQEE 3LOXA 4LZ4B 3PTBA 2OC1A 5SGAE 1XUIA 3RM2H 4FVBA 1P03A 2O8TA 1L4ZA 6LPRA 2ZDMA 2RCEA 2HNTE 4KKDA 3U8TH 2Z6BD 1D3QB 1AY6H 1GI4A 1HXFH 4X8UH 4X8SH 1P02A 1IQMA 1C4U2 1G3BA 2BY6X 4X2VA 3T62A 2FEQH 1J15A 2D1JA 4Z6AH 3LIWA 1SLXB 1C1VH 1H8DH 1EJAA 1TWXB 1C1PA 2LPRA 4RKOB 4Y11E 3SUGA 3V13A 4GPGA 1P3CA 3SJ8A 5L6NH 3HPTB 2XRCA 4THNH 3SV9A 4CR9A 2ODPA 5ESTE 3SU4A 3SUFA 2BD5A 1S6HA 1PPEE 1C5PA 2VJ1A 3TK9A 3E6PH 1BTXA 3LPRA 1S84A 2ZA5A 1YC0A 2Y80A 1DX5M 1AN1E 5ABWA 2BD7A 1A4WH 5C2ZA 2F91A 1QJ1B 1LMWB 1V2VT 1FY4A 4KTSA 1TA6A 4H6SB 1NRSH 1G9IE 2PV9B 1YKTA 2V35A 3LGWA 1KY9A 1TBRH 2Z3CA 3VGCC 2FOCA 4AYVB 1C5ZB 1ZJKA 1ACBE 3TJNA 2JETB 1LTOA 3OU0A 1HRTH 5FX6A 1GVLA 2SGAA 4KTCA 1GBIA 1P09A 3A87A 2VINA 1Z8RA 2QXJA 3V3MA 1CBWB 1DWBH 4Y76A 3AAVA 4ABEA 3HATH 3SI4H 4NA9H 2P3FH 4OGYA 1GHWH 1L4DA 3Q3KA 1OYQA 1SQTA 2VIDA 4AFQA 3ZZDA 3QZRA 1GG6B 3QTVH 2C90B 4B2BA 5A8XA 4CHAC 4MVNA 4TYDA 3SU1A 2ZNKH 1TNHA 4DIIH 3A88A 3LT3A 1BMNH 1HAHH 4I33A 1C1SA 1LPKB 4CREA 4K1SA 2SFAA 4D7GA 2PFEA 1BIOA 1HPGA 2GMTC 2ZFSA 1FY3A 2FO9A 3P70B 1LVOA 1O37A 2BYAX 4I32A 4TPIZ 3M3VA 3OTJE 1IQGA 1OSSA 1SSXA 2Y7ZA 2BDGA 1UTNA 1TE0A 5L30H 2GT8A 3SNCA 4B76A 1ZYOA 3KQDA 2SGFE 2DUCA 1N1LA 1SGDE 3TGKE 3MU4A 1K1MA 1UK3A 3A89A 5EOKA 1CT4E 1E36B 2BXTH 2PR3A 5F03A 4OS5A 1PPBH 4X1RU 3RXTA 2FYRA 4ZKSU 1J9CH 1FJSA 1EB2A 2EI6A 3SU0A 1ZGVA 4IS5A 1YF4A 5K0HA 1GMCG 4JZEH 3TNTA 4JK6A 2PUQH 2ZDVH 2BD8A 1GBHA 1GBAA 5ESBA 1BBRE 1C1RA 3RLYH 1ZMJA 3BEIB 2A32A 2WUBA 4X6NA 2ZWLH 1P12E 2FTMA 1PQAA 3SJIA 1WQVH 3RXPA 1OP8A 2BX3A 3KGPA 5DG6A 4BTIB 2V6NA 1K9OE 4I8GA 4E06H 2OBQA 1H9HE 1VITG 4GLYA 1MU6B 3DD2H 1Z7KA 1SR5C 1PPZA 3QDZB 4GCHG 2OD3B 3L33A 2SNVA 4NWKA 1GJ6A 4JK5A 1O2OA 1P2IA 2GCTB 2UUFB 1ZRBA 1LO6A 1WV7H 2IOTA 1G32B 1YM0A 1BRAA 1OWIA 3ATIA 2GT7A 2BDCA 5HGGA 1LHGH 3QX5H 4CHAB 4LZ1H 1MQ5A 1AUJA 2NU4E 5EQQA 2WYGA 4GUXA 4XSKU 5C1UA 3KCGH 4XDEA 3BEUA 1GI8B 1DANH 2ZFRH 3UOUA 1BMAA 1QRXA 1YGCH 2ZCLP 4R0IA 1SVPA 2PKAA 4ABAA 1G30B 1HV7A 4UONA 3A82A 4UFFH 1FY8E 1C9PA 3MOCA 4O9VA 2PTNA 1A0LA 2AIQA 1AZZA 3A86A 2I6SA 2AGGX 5I25A 2EA3A 3ZYDA 4H4FA 2BY5X 2ZFFH 3SU6A 1ELTA 3PROA 2BMGB 2BDIA 2WV5A 1HAXB 1SGRE 7LPRA 1MAXA 5GIBA 1GGDC 3SNBA 2ANMH 1DS2E 9LPRA 1YYY1 3UY9A 1QJ7B 1AIXH 1S0QA 1A0JA 3UQOA 3SGQE 1OP0A 1WQSA 3VB7A 1VCQA 4ABHA 1Z6JH 1GMDG 1K22H 3MO3A 4AZ2B 2O8WA 1SGCA 3O8CA 2P16A 1O2JA 3E90B 2G4UA 1HAVA 3U9AH 5A0AE 3PWBA 1SQOA 2ZU3A 1G36A 2XNIA 1SGIB 2QN5T 3LKWA 4ISIH 1AVXA 3HKJB 5DP6A 2Y81A 4JMYA 3LGVA 3S7HB 1O2IA 3UIRA 2XC4A 2ZCKP 4DIHH 1J16A 1OYTH 4JZ1A 3QK1A 1NROH 2O9QA 5DJ7A 2W3KA 1AVWA 1TIOA 2XCFA 2BVSH 2BTCE 2VH0A 1LKAA 1WCZA 3S9AA 3FZDA 1VCWA 2K1QA 1GBMA 5AF9H 1XUFA 1CGHA 2QF0A 1ZSLA 1GCTC 2Z9JA 1OWKA 2GV7A 1HAYB 1HAOH 4CH2B 3KIDU 4DJZB 1JWTA 1VCPA 3PLKA 1GMDF 1TA2A 4FUGA 1GMHG 2BM2A 1HIAA 2AGIX 1MTVA 1HYLA 2CF8H 2WPLS 1X7AC 4FU7A 7GCHF 2D2DA 2FDAA 2QA9E 1V2PT 3GY7A 1O2YA 1QBVH 1WYKA 2WV4A 1ZTJA 4MLFB 5T6GA 3G01A 1T8OA 1O3DA 3GYMA 3TPIZ 1F0UA 1BT7A 3A7VA 1S0RA 1QRZA 3RXOA 5JDUB 5DGJA 1C5NH 1ZPCA 1HNEE 3VB4A 4BXWA 1ESTA 2A45B 1K28D 3BF6H 2OXSA 5AHGH 3HK6B 3A84A 3BG4B 3B8JA 1GHXH 1TLDA 1TPPA 4AYYB 3K2UA 1DSUA 4MQAA 4U30A 4X6MA 1TMBH 1UTOA 1ZPZA 5J4QA 1BA8B 3BG8A 5GCHF 1SGEE 3W95A 2O8LA 4IMZA 2QC2A 1ARBA 4U2WA 4UFGH 2QXIA 1E34B 3T2NA 3TK6A 3ELAH 3IWMA 1TNIA 4XBCA 1GVZA 3E3TA 3P8NA 5GWZA 2C8WB 4MTBA 3SHCH 4OS6A 5LH8A 4MNWA 1K1IA 1UK2A 1C5XB 1F0SA 2BY9X 3RMLH 3NCLA 1T4UH 2UUYA 2FOHA 2A2XH 1YCPK 1SFQB 1UVSH 1AO5A 3SOSA 3O8BA 5FBEA 3BV9B 1GJBB 2ZGCA 3F6UH 1K1PA 1DOJA 1C5SA 2PGBB 3SW2B 3T28A 2V0BA 1P2OA 4FXGH 1O3EA 1OKXA 5LPRA 1NU9A 2AERH 3FFGA 4FU8A 1AE8H 1XMNB 1C4Y2 2XBWA 1K1JA 1Z8JB 3RLWH 3M3SA 1VITH 1NFUA 1O2PA 1A5IA 4FUEA 4AX9H 1FY5A 3KQBA 1IQJA 6GCHF 4GVUA 1YBWA 4RN6A 3MO9A 3ZZ4A 2A7JA 2PUXB 5DPAA 4ZKOU 1LHEH 4INHA 2ZTZA 5JBTA 4XE4A 3GDSA 1C2JA 4IGDA 3LH1A 1O5CB 4CRFA 1ETRH 2NU0E 1LDTT 1NRNH 3L6PA 2F3CE 1GHBG 4JCNA 2OC8A 2H9HA 4XBBA 3Q3XA 4D8NA 3A81A 3ZVGA 4MPVA 1QQUA 1HGTH 5IYTA 2W5EA 3STIA 1O2WA 1KLTA 4A1TA 2BQ6B 4I8LA 4Z0KA 1SOZA 1DWDH 4YZUA 2SGEE 2Y6TA 4Q80A 3QUMP 3TH2H 2FP7B 5TCAA 1YPKH 2Z94A 1JMOH 1DUEA 2VIWA 3EA7A 3AASA 1IQEA 1A7SA 1GHZA 1INCA 2IN2A 3UWJH 5F8TA 2G52A 4ZUHA 1Y5BT 1ARCA 3D49H 2PSXA 4B71A 1DITH 1C1TA 3QLPH 3F9EA 1LHDH 3PYHA 1MKWK 4MPXA 4SGBE 3S9CA 3M3TA 4X8VH 1LKBA 1A0HB 3BTTE 4E7NA 1P05A 1VGCC 2GMTB 2HPPH 3M35A 2P93A 1DLKB 2ZU2A 2W26A 1H4WA 1O3KA 1F5LA 3I29A 1TRYA 1O31A 1LHCH 3ZV8A 1O32A 1ABIH 2VWLA 3GICB 5HXFA 4A1VA 2PTCE 1P2QA 5CMXH 1BCUH 3ZZ8A 1IAUA 1V2NT 1CHOG 1O3JA 3ZZBA 1F5KU 3TH3H 3RC5A 1PQ8A 3RXQA 2BB4A 1KSNA 1Y3WA 1VR1H 2PKAB 3ATWA 5FPTA 1W11U 4DCDA 5DKMA 2VU8E 1GVKB 5E0JA 1EJNA 1QL7A 1JOUB 1C5MD 4ESTE 1EB1H 3RXIA 1H8IH 3F68H 2P3TB 1AB9C 3ATLA 1AUTC 1V2QT 1GHYH 2ZHEH 3SUDA 5BRRE 2FLBH 3TH4H 3MU1A 3ESTA 1EAWA 2ZHFH 3OX7U 4OS4A 1KYNA 2BOHB 4WF8A 3BTGE 1O2ZA 1P57B 4ZMAH 1A5HA 2A7CA 3RU4E 1O3BA 2GV6A 3TU7H 4K60A 2ZCHP 2GZ7A 4IW4E 3SGBE 1TAWA 1OP2A 2HLCA 3MI4A 2FS8A 1MKXK 1H9LB 1P3EA 1P2NA 5EODA 3VB5A 2C8ZB 1GMCF 1SPJA 1O2QA 1C5RA 1CE5A 4K69A 4Y10E 3UNQA 3A8AA 4FUJA 4Y6DA 5E8EH 3O8DA 3T26A 1C2KA 3BTME 5F8XA 4WJG2 1KIGH 1Y3UA 5JPMH 2OUAA 5JB9S 1YPHE 4MG3A 4J2YB 5HYOA 1O3LA 3E8LA 2FOAA 5EQRA 1UTKA 2ZKSA 3QWCH 2PKSC 2H5DA 1UVUH 2CV3A 4BAKB 1IQNA 1P2JA 4AGJA 2R0KA 1O3NA 2UWLA 1TABE 1B0EA 3KQEA 4MDSA 3V12A 1EP5A 3ENSB 3PB1E 3NXPA 4IMQA 1QCPA 3T5FH 1AFEH 2FI4E 4JZDH 5FXLA 1UHBA 1UO6A 4NGAH 1EX3A 2QGRA 1SLVB 3EYDA 1XUGA 1J14A 1FV9A 4X0WU 5FPSA 1ZHPA 3V7TA 3MTYA 3UR6A 3MH4A 3Q77A 5H4IB 2WYJA 3VXFH 1Z71A 1P11E 1N8OB 1V2JT 3S0NA 1C1WH 1BTYA 3NUMA 4NZLA 4YM9A 1DWCH 1DFPA 3TK5A 2XBVA 4UD9H 2J92A 2CN0H 1PQ5A 1G2LA 1DXPA 5K7RA 1IHSH 2BLOA 3VB3A 1TPSA 1D3TB 5JBAS 2FLRH 5DP3A 1F0RA 2ALVA 1FZZA 1ELFA 1HLTH 2NU2E 2A31A 4UDWH 5J4SA 3GCHC 3LC5A 4RKJB 4YT6H 1RS0A 3M5NA 1NN6A 1YPHC 3PMBB 4WH6A 3C1KA 1KDQA 1C2HA 5FPYA 3M7QA 1MBQA 3LJOA 1H1BA 2QY0B 1NRRH 3KF2A 3TJVA 2BVXH 1O3CA 3UWIA 1GBJA 1DUAA 5FCRA 1MTNB 3LU9B 1QJ6B 3F9HA 4AORA 1TNGA 2ZDLA 2ZHQH 2GP9B 1TOMH 6GCHG 1VJAU 4I8JA 2FMJA 2P3UB 2FTLE 4DW2U 3ZVFA 1ZR0A 5GDSH 2ZO3H 3UNSA 1ESBA 2FESH 2G55A 1C4V2 1DLEA 1GBLA 4FU9A 3GCHB 3UUZA 3MH7A 2OQUA 2OLGA 2WPIS 2XTTB 4O97A 1P10A 2J9NA 1GJ4H 1XXFA 3P8GA 1DSTA 2BY7X 3GY8A 4X1SU 1EJMA 3V0XA 4DT7B 3P6ZB 4ZHLU 1FLEE 4Q2KA 3ZVBA 4M7GA 2ZI2H 4LOYH 2VIVA 1FDPA 1D3DB 4I7YH 5A2MH 4IC6A 2Q1JA 1C2LA 1ETTH 1W8BH 1SFIA 2EI7A 3ZZAA 3O8RA 1TBZH 2FIRH 4O3UA 4TY7A 1PPCE 4Y8ZA 3BG4C 1BRBE 2H1UA 1W2KH 1XX9A 2P95A 1HJAC 3H7OA 4BTUB 3SNEA 1SGPE 4HTCH 2AS9A 3SQHE 1GBDA 1Z8GA 2UWOA 2Z9LA 3FVFB 4CRCA 1ZOMA 3RXUA 2B9LA 2ASUB 3GDVA 3MH6A 4K8YA 5JBCS 2C3SA 4K1EA 1ELAA 2VVUA 1TX7A 2Y7XA 6CHAC 9ESTA 3K6YA 1F5RA 2ANYA 3BTQE 1FNIA 3NKKA 1LPZB 1TOCB 2ZF0H 2FS9A 1SGNE 2BDBA 3TGIE 5F8ZA 1QB9A 1W7GH 2R0LA 2NU1E 1SGTA 1V2KT 3BSQA 3W94A 1GBBA 1Y8TA 1GHVH 4PROA 3MFJA 1T8NA 1EATA 3BTKE 1PFXC 1KXEA 2AGEX 3SV2H 4Q7XA 1S81A 1RFNA 1HAIH 1CSOE 1OS8A 2TBSA 3VPKA 3RXCA 1T31A 1C2FA 2XW9A 2ZGBH 3IITA 2Y5GA 4WY3A 4CR5A 1A3BH 1HIAB 1L1NA 3MYWA 1HAPH 4WH8A 1AKSA 1SI5H 2IJOB 4ZHAA 3A7ZA 2J95A 2GZ9A 4BAOB 1ELVA 3PMAB 4FUDA 3S7KB 1SQAA 1AMHA 1GI3A 2P8OB 3P8OA 1O3OA 2BVRH 8ESTE 1BTUA 3I78A 1PJPA 1EPTC 2BD2A 6CHAB 2C8YB 2ZDNA 3EGKH 5DO4H 1TONA 1ANCA 1EUFA 5EXMA 5AVDA 1EXFA 1EAUA 3FANA 2GZ8A 2DE9A 3SJKA 1L1JA 1D4PB 1PPFE 1NPMA 4Y0ZE 3SORA 1WSSH 4NZQA 2VIOA 2BQ7B 1EASA 2SGQE 1PYTC 1A46H 4WXIA 3SV7A 4NCYA 2ZQ2A 2ALPA 1GI0A 1C5YB 1HCGA 3SBKA 1WU1A 1XM1A 1C1NA 2BDHA 2V3OH 1N6YA 4NIVA 1E35B 2AH4X 2HPQH 3TVJB 2F9NA 1KLJH 3RXDA 3PV4A 2B7DH 2VWNA 1HBTH 1OX1A 4ISOA 5DP8A 1GBCA 2ODQA 1V2RT 4INKA 3QO6A 1TX6A 2RA0A 2ANWA 4CBNA 4ABGA 3ZVDA 2QCYA 2XWAA 1XUJA 1OWDA 3BTWE 2BOKA 1GI9B 4KTUA 5CHAC 4X1QU 2FI3E 4NIWA 2OC7A 3M37A 1QBOA 4ZAEA 1TNKA 2R2WU 4IN2A 1MCVA 4A6LA 2G51A 2OINA 1UCYE 3I77A 2HALA 8GCHF 4OS7A 3D23A 1QRWA 1VGCB 4IC5A 3RXKA 1QURH 1EKBB 1K2I1 2Y5HA 4ISLA 2BD9A 1TPAE 1G3DA 4FUHA 5AFYH 1RTFB 1GJ9B 1CGJE 4JZFH 3SGAE 1ABJH 4JYUH 5JYIA 2STBE 5T6FA 4ABDA 3SO3A 3UNRA 3A7WA 3GY4A 1EQ9A 4MNVA 2A5KA 1P01A 4TWYA 3SZNA 1CA0C 2CMYA 4NSYA 5FX5A 3A8BA 2A1DB 5EQSA 2H5CA 1EZQA 4YOJA 1UVPA 3UPEA 1EZXC 3BN9A 2CJIA 2R9PA 2ESTE 1O2GH 5PTPA 2EI8A 2SGDE 4UEHH 3IG6B 4NSVA 3P17H 1GI2A 3KHVA 1EOLA 1O3GA 1P0SH 2TIOA 1NO9H 1ZMLA 4CRDA 3GCTG 3GISB 1AD8H 2BQWB 1KTTB 3LONA 1G37A 4X1PU 1T7CA 1RIWC 2F9VA 2CXVA 3K6ZA 4BAMB 3SV6A 1FAKH 1F2SE 4B73A 3RXRA 3P95A 1T8MA 1N8OC 3RMOH 4B2CA 1C5QA 1E0FD 4BAHB 1MZAA 3MNSA 3SNDA 4BXSA 1HAVB 1KXBA 3A7XA 3TNSA 4BANB 1BUIA 1UCYH 2BZ6H 1A61H 4ABJA 1FONA 2HOBA 1PYTD 3RDZA 4MPWA 1TMTH 1GBTA 1GBEA 2GCTC 1TMUH 3RM0H 2A4GA 1C5LH 1IHTH 1O2UA 3SNAA 2ZEBA 1QNJA 2ZPQA 2F9OA 1GG6C 1V3XA 3M7TA 5C3NA 1C2IA 2BLVA 1VITF 4AG2A 4F4OC 1DPOA 3R3GB 2ZECA 4GCHF 1UHBB 1ANDA 4VGCB 3E91A 3M61U 2BHGA 1ZLRA 4I8HA 1AFQC 1MTSA 2XC5A 3T25A 3SN8A 1WTHD 3RXFA 3RXHA 2CF9H 3EDXB 1GHBF 3ZVAA 1O2RA 1XKAC 4B75A 4AB9A 1HAGE 1RXPA 1CU1A 3MH5A 3RP2A 1TALA 2AMQA 1THPB 1QFKH 1W7XH 1O3PB 3F9FA 1XKBC 1XVMA 3RXGA 3UTUH 4HI3A 4A1XA 4YTAA 1UMAH 2FOMB 1EAIA 1FPCH 4JZIA 1PPGE 5E2PA 1IQHA 1GDQA 1GJDB 2CHAB 3B9FH 2D26C 2JH6D 1BITA 2YNBA 3RXSA 2W3IA 3JZ1B 1KLIH 4NA7A 1AU8A 4GHQA 2ZFPH 4FUIA 2Y82A 5C67A 1NRQH 1LVMA 3Q76A 4BOHA 5IDKA 1Y3XA 4WVPE 1FPHH 4WXVA 2CGAA 1UK4A 4XBDA 1NRPH 3URDA 1QL9A 1HAZB 3MWIU 4Q7ZA 1EAXA 5DP4A 1RRKA 3STJA 2FZZA 3RU4D 2VWOA 1C1QA 5DP9A 1O0DH 2XBXA 1BRUP 3KQCA 4B74A 1GBKA 3RXMA 1O2VA 2B5TB 1T32A 1ANEA 1T4VH 2ZDAH 2YNAA 1O35A 3RU4T 3A85A 1HJAB 3AVZA 3T27A 1L1GA 2FM2A 5GCHG 1MMJN 3URCA 1SLWB 3M5MA 2D8WA 2ZU5A 1HDTH 1DT2A 1GJAB 1OWHA 1GI7B 1CO7E 3RXLA 5C5NA 2TGAA 3EE0B 1PQ7A 3EA8A 1FAXA 1MAYA 3RXVA 1UCYK 1NC6A 3TGJE 1GI1A 2J38A 5EPNA 1C1MA 1UTQA 1GPZA 1SMFE 3M36A 4I8KA 3LGIA 1SGYE 1F92A 5LPEA 3QGJA 3C27B 3GY6A 1KDQB 1YCPM 3LJJA 1EOJA 1T8LA 2Q6GA 1WUNH 2O8MA 3U69H 4DY7B 1ELGA 3ZZ7A 1AFQB 1S85A 2GTBA 2VH6A 3OYPA 3PLPA 3HGNA 4FUFA 3RXAA 1W12U 2A0QB 2HWLB 3BEFB 1BTWA 1PPHE 3QN7A 1THSH 1CT2E 4IBLH 3SV8A 1XVOA 3FP8E 4ZH8A 1XUKA 1S83A 1TGBA 1C9TA 1HJ8A 2A4QA 1N6XA 2VGCB 3OSYA 3PTNA 4X6PA 1WTGH 1ZRKA 4NG9H 2QV1A 3OY6U 2PKSB 2WINI 3BIVH 4ABIA 1W14U 4Y8XA 3BIUH 2ZQ1A 1QIXB 1MD7A 1D6RA 1YPGH 4ABBA 1D6WA 4QT8C 3U1IB 4A92A 4ZROA 1ZZZA 5E0HA 1F7ZA 1O5EH 4YESB 4I31A 1LHFH 1D9IA 1GGDB 5LPFA 2P94A 3EAJA 4CRBA 1P9UA 3E16B 2XYAA 1K21H 1O5BB 1SC8U 4MNYA 1FQ3A 5EU8A 1J17T 3H5CB 1O38A 3DT0H 1YCPH 2FOFA 3SUEA 3TJOA 1Y3YA 2ZGHA 1K1OA 1Z1IA 4CRGA 3N7OA 4WWYA 1MQ6A 3MNXA 2J2UA 1MD8A 1FXYA 1P06A 1TB6H 1Z1JA 2ANKH 3E1XB 4RSPA 2PGQB 2ZG0H 1BJVA 1GMHF 4CRAA 2VVVA 4ZXYH 2J34A 4ISHH 1QR3E 1DM4B 1MUEB 2HVXA 1BHXF 4LK4A 4E7RG 2GCHG 4NFFA 1S82A 2AIPA 4JYVH 2LNCA 2VVCA 2NWNA 4YLUA 1TRNA 1QBNA 2Q6DA 1YPMH 4X1NU 2PHBA 4KGAA 2Y5FA 3VFEA 2A4RA 4MPUA 2GCHF 1ZTKA 3GY5A 3AW0A 1HFDA 4KELA 3TIUA 1YLCA 1YPEH 3T29A 1TPOA 3ATMA 5C1XA 4UFDH 2AYWA 4ZXXH 3RXEA 1DWEH 3PO1B 1AWHB 1QHRB 1Z8IB 4FUCA 1O2HA 1RIWB 4JYTA 1EZSC 4A7IB 3RXBA 4X2YA 1C1UH 1KXFA 1O5AB 4LXBH 4Y7BA 1O2TA 2H2ZA 3DHKH 4Y71A 2P59A 1ZGIA 8KME2 1DE7H 4Y79A 1AZ8A 4ISNA 2WPJS 4X2XA 4DVAU 2Z9IA 1E37B 1FMGA 1LVYA 1HXEH 1BTHH 3UR9A 4AGKA 1AQ7A 3AW1A 3MNBA 1QA7A 4TY6A 1GJCB 2GVFA 5JB8S 1BB0B 3K65B 2A7HA 4NIYA 3ITIA 1CA8B 1DY8A 1FN8A 1P9SA 1SGFG 2ZFTA 5FCKA 1QY6A 1K1NA 3GY2A 5EW1H 2SGPE 3ZV9A 3EQ0H 1O39A 4R8TB 4YLQH 1ANBA 1QQ4A 1C2DA 1NM6A 3ZZ9A 5HM2A 1J8AA 5DP5A 1GL1A 1NT1A 2A4OA 2VWMA 4D9QA 3A8DA 3TLOA 2RA3A 2OBOA 1GBFA 1SB1H 1B5GH 3UREA 1SBWA 2HNTF 3M5LA 1SHHB 3QZQA 4K8BA 2TGPZ 1CHGA 8GCHG 1BTZA 3FZZA 2GDDA 1SG8B 1O33A 2FPZA 2G81E 2TRMA 1O2MA 5EPYA 1BOQA 5BPEA 1O3MA 4TPYA 2G5VA 1C5TA 4CBOA 3HKIB 2P8OC 1A3EH 1AB9B 3BTFE 2ZTXA 3NK8A 3PM3A 1NY22 4K5ZA 3DFJA 1AKSB 4OS1A 5G4BA 1QTFA 2FOGA 3H7TA 1CBWC 2FI5E 2W7SA 3RXJA 4D76A 1FIWA 4OGXA 2R3UA 1HJ9A 4K3JA 1GCTB 3AAUA 3GCOA 2BY8X 1TGCA 3MU0A 2JH5D 4IN1A 5F6MA 4B2AA 1O34A 1W10U 3DFLA 1ZHMA 2W7UA 4SGAE 3PMJA 2GDEH 4K2YA 1ELDE 2YOLA 3A83A 2TGTA 2AEIH 1ELCA 1NFYA 2ODYB 1UVOA 2OP9A 3LDXH 3JZ2B 1QB1A 2AMDA 2A5IA 1Y5AT 2ZU4A 3RC6A 2PSYA 1BRCE 1BQYA 4BTTB 4MNXA 4YO9A 1NFWA 3FP6E 1NS3A 1S5SA 4DURA 1IQIA 5FAHA 4YOIA 3KL6A 3U8RH 5A0BA 5LGOA 1CHOF 5GJ4B 1P2MA 1TNJA 2R3YA 1P04A 1BDAA 3NWUA 1Y3VA 5CE1A 1BMMH 1DXWA 2UUKB 4D7FA 1UTLM 1K1LA 5EXLA 2UUJB 1MZDA 1O3IA 3R0FA 3A80A 1O2NA 3MU5A 1RJXB 1JRTA 2QXHA 3NZIA 1WOFA 5DK1A 2F83A 1TGNA 4H6TA 1ORFA 1UTMA 1ZJDA 5E2OA 4BNRA 1O2SA 2GD4B 3ODDA 1TRMA 3SJ9A 1WBGB 2JKHA 1EPTA 1MTWA 5TCCA 3LGTA 3ZVCA 1AI8H 3CENA 2THFB 2J4IA 4HFPB 1ELBA 3Q3YA 1IQFA 6ESTA 5JBBS 2FOBA 2Z3EA 4HZHA 3GYLB 3SJOA 4E05H 2ZZUH 3LGYA 1LQEA 2XBYA 5FBIA 1GWAA 3BTDE 4AG1A 3U98H 2BZAA 1CA0B 2BX4A 3KN2A 2GX4A 4GHTA 2WPMS 1C1OA 3MU8A 4Y7AA
chains in the Genus database with same CATH superfamily
1V6DA 4CH8B 3GY3A 1HB0B 2ZHDA 1BZXE 2FX4A 2ZGJA 1C5VA 2XWBI 3F1SB 2AMPA 2A5AA 3RUOA 1OWJA 2I6QA 3SI3H 1FIZA 4WMFA 1MBMA 1XXDA 1OOKB 3VB6A 1NZQH 1O3AA 1W0YH 3MMGA 3ZZ5A 3RMNH 2VIPA 1GJ7B 1SLUB 1UVTH 2VNTA 1KTSB 4Y8YA 3CNRA 1WXRA 1O3FA 1Z6EA 4TWWA 1O5FH 1KXAA 2BLWA 4YOGA 1L0ZA 3FAOA 1NU7B 2F9BH 2B0FA 4O03A 2YMSD 1A1RA 1GI6A 1EZUC 1GHAF 1UTJA 2B8OH 1C2GA 1SOTA 1B7XB 4DGJA 5KECA 1VJ9U 3D65E 1JXPA 3K9XB 1AHTH 1AGJA 1W13U 1YPJH 5ETXA 1GL0E 3ZZ6A 1QB6A 2GGVB 1GHAG 1V2LT 1FN6A 3S9BA 5C94A 3HK3B 1QA0A 2LELA 4ZKRU 1NESE 1U6QA 2DE8A 4VGCC 3GCNA 1HUTH 2Z3DA 2H6MA 2G8TA 5EGMA 2J94A 4X8TH 3PO1C 2RDLA 5TJXA 3UQVA 3A7TA 2FOEA 3MQKC 3ZVEA 2ZU1A 4X6OA 1ZHRA 2JJ2D 5HM9A 1MTUA 1GJ8B 2Z7FE 1IQKA 3M7UA 1BBRK 2PLXA 3UOPA 1CVWH 1TX8A 5A09A 1FI8A 1YPLH 2QAAA 2IPHA 5C1YA 1V2UT 2ZC9H 5A8YA 4H42U 3Q00A 1BJUA 3OEHD 3ZZ3A 1NFXA 5CHAB 4ZKNU 2ZTYA 4B6FA 1ETSH 1OXGA 1AE5A 3M5OA 1ZTLA 1C5OH 4XFQA 2H9TH 1C2MA 2BD4A 4FVDA 4INLA 5DP7A 4NA8A 1SGFA 2G5NA 1Y5UT 1IQLA 1LCYA 3KQ5A 3NPSA 1CGIE 3QTOH 2KM0A 2VIQA 1BHXB 1TGTA 4BAQB 2VB0A 1LPGB 3N7DA 1JIMA 5EXNA 5T6DA 2ILNA 3ODFA 4NIXA 2BXUH 2JETC 1JIRA 3N99A 4DT4A 1Q2WA 2FWWA 2C4FH 1MU8B 1DVAH 4J1YA 1C5UA 1YWUA 5I46H 3DA9B 1Q3XA 3TITA 1P8VC 2ZGXH 1JBUH 3P8FA 4B1TA 2FYQA 2L6OA 4HGCA 1W3CA 3MO6A 1TQ7B 1TGSZ 2F9PA 3SU5A 4DOQA 1M9UA 4K1TA 2ZP0H 3L3TA 2UWPA 4OS2A 2F4LA 3SHAH 2Z9GA 2HRVA 1JRSA 1W0ZU 1L2EA 1MKWH 2WUCA 1DDJA 1SGQE 1SL3A 1MH0A 2O8UA 2WHXA 3OY5U 2C93B 1DICA 4XOJA 5B6OA 4AN7A 1TYNA 4KP0A 4O3TA 4RT0A 3ZZCA 5C5OA 2A2QH 4UFEH 2FODA 3GDUA 2XCNA 5GPIB 1ZMNA 3PMHB 3SU2A 1CT0E 4TT3D 2RG3A 3D62A 3EA9A 4AFUA 3DUXH 5CDFE 2WPHS 4AOQA 3SYJA 1ZSKA 2EC9H 4NWLA 1KXCA 4GAWA 1A2CH 3A8CA 1B0FA 3E0NB 4WMDA 2GKVE 3PWCA 3VXEH 1Q31A 1V2OT 3KNXA 5FHTA 2BLQA 1CQQA 1O5GH 3LGUA 5T3HA 1OPHB 1Y59T 4D9RA 2ULLA 1BBRH 3CP7A 4ASHA 1C5WB 2G00A 1O3HA 3RC4A 2OCVB 1O2KA 1RD3B 1KXDA 7ESTE 1EP6A 5GXPA 1P2KA 4GSOA 1E38B 1V2WT 5L2ZH 4A5TS 2QF3A 2KCYA 1LQDB 1THRH 3A7YA 1MCTA 2FX6A 7KMEH 1D3PB 1F0TA 1XUHA 1IOEA 1C2EA 4ZHMU 2ZPSA 4WMEA 2Z9KA 3KEEA 2OTVA 1GJ5H 1QL8A 1ELEE 2WPKS 3GCTF 1BTPA 2ZFQH 2KAIA 1BMLA 1V2ST 1FUJA 2VGCC 1GDUA 1O2LA 5C20A 1EPTB 1NTPA 1O36A 1G3CA 1AVGH 1O2XA 2XXLA 2F43B 4AFSA 1WDIA 1BMFD 2PW8H 1O5DH 1G2MA 4Y0YE 1ESAA 2QIQA 5A0CA 4U32A 3U1JB 1OWEA 2Q6FA 3F9GA 4F49A 2H9EH 2F9UA 3B23B 4X2WA 3MNCA 2CHAC 4AB8A 4FUBA 7GCHG 1RGQA 1SHYA 2EEKA 3LH3A 3BTEE 2FXRA 2TPIZ 3RMMH 4ABFA 3SU3A 5A8ZA 4AC9A 5AFZH 2IJD1 2M5TA 2HGTH 3U8OH 1QGFA 2OC0A 4YT7H 3VEQB 1G3EA 3BTHE 3VGCB 3TJUA 4Q7YA 1ID5H 4I86A 1O30A 1RTLA 3FP7E 1V2TT 4AFZA 5L2YH 1A5GH 3UFAA 1E79D 2BDAA 2AFQB 3KYFA 3ATKA 3LC3A 1MKXH 2NU3E 1UJ1A 3HGPA 4UE7H 2BD3A 2XC0A 1TNLA 2QYIA 3QGNB 3S69A 2ZDKA 2ZIQH 2G4TA 4U01A 1LVBA 1MTNC 2PP6A 2PWXA 2C8XB 3WY8A 1VZQH 2STAE 1GCDA 1TBQH 2ZPRA 2QXGA 1YLDA 1DY9A 1ZPBA 3CS0A 1AWFH 5EG4A 1WAYB 5EW2H 3E0PB 3ZYEA 1TFXA 3PLBA 2OQ5A 1YP9A 2ZHWH 1S6FA 1GI5A 4NFEA 1UTPA 5E0GA 2SNWA 5HMAA 2BDYA 1GDNA 1RTKA 3P92A 2R2MB 2TGDA 1H9IE 1V2MT 2KAIB 4Q63A 1FY1A 4DG4A 1ZSJA 8LPRA 2HNTC 3CS7A 3GOVB 1TQ0B 3MHWU 2JH0D 2V3HH 3W1EA 3SQEE 3LOXA 4LZ4B 3PTBA 5C0TA 2OC1A 5SGAE 1XUIA 3RM2H 4FVBA 1P03A 2O8TA 1L4ZA 6LPRA 2ZDMA 2RCEA 2HNTE 4KKDA 3U8TH 2Z6BD 1D3QB 1AY6H 1GI4A 1HXFH 4X8UH 4X8SH 1P02A 1IQMA 1C4U2 2WZQA 1G3BA 2BY6X 4X2VA 4XRNA 3T62A 2FEQH 1J15A 2D1JA 4Z6AH 3LIWA 1SLXB 1C1VH 1H8DH 1EJAA 1TWXB 1C1PA 2LPRA 4RKOB 4Y11E 3SUGA 3V13A 4GPGA 1P3CA 3SJ8A 5L6NH 3HPTB 2XRCA 4THNH 3SV9A 4CR9A 2ODPA 5ESTE 3SU4A 3SUFA 2BD5A 1S6HA 1PPEE 1C5PA 2VJ1A 3TK9A 3E6PH 1BTXA 3LPRA 1S84A 2ZA5A 1YC0A 2Y80A 1DX5M 1AN1E 5ABWA 2BD7A 1A4WH 5C2ZA 2F91A 1QJ1B 1LMWB 1V2VT 1FY4A 4KTSA 1TA6A 4H6SB 1NRSH 1G9IE 2PV9B 1YKTA 2V35A 3LGWA 1KY9A 1TBRH 4XD7D 2Z3CA 3VGCC 2FOCA 4AYVB 1C5ZB 1ZJKA 1ACBE 4P00A 3TJNA 2JETB 1LTOA 3OU0A 1HRTH 5FX6A 1GVLA 2SGAA 4KTCA 1GBIA 1P09A 3A87A 2VINA 1Z8RA 2QE7D 2QXJA 3V3MA 1CBWB 5T1VA 1DWBH 4Y76A 3AAVA 4ABEA 3HATH 3SI4H 1H8HD 2P3FH 4NA9H 4OGYA 1GHWH 1L4DA 3Q3KA 1OYQA 1SQTA 2VIDA 4AFQA 3ZZDA 3QZRA 3OTPA 1GG6B 3QTVH 2C90B 4B2BA 5A8XA 2V7QD 4CHAC 4MVNA 4TYDA 3SU1A 2ZNKH 1TNHA 4DIIH 3A88A 3LT3A 1BMNH 1HAHH 4I33A 1C1SA 1LPKB 4CREA 4K1SA 2SFAA 4D7GA 2PFEA 1BIOA 1HPGA 2GMTC 2ZFSA 1FY3A 2FO9A 3P70B 1LVOA 1O37A 2BYAX 4I32A 4TPIZ 3M3VA 3OTJE 1IQGA 1OSSA 1SSXA 2Y7ZA 2BDGA 1UTNA 1TE0A 5L30H 2GT8A 3SNCA 4B76A 1ZYOA 3KQDA 2SGFE 2DUCA 1N1LA 1SGDE 3TGKE 3MU4A 1K1MA 1UK3A 3A89A 5EOKA 1CT4E 1E36B 2BXTH 2PR3A 5F03A 4OS5A 1PPBH 4X1RU 3RXTA 2FYRA 4ZKSU 1J9CH 1FJSA 1EB2A 2EI6A 3SU0A 1ZGVA 4IS5A 1YF4A 5K0HA 1GMCG 4JZEH 3TNTA 4JK6A 2PUQH 2ZDVH 2BD8A 1GBHA 3PV5A 4ACBA 1GBAA 5ESBA 1BBRE 1C1RA 3RLYH 1ZMJA 3ZIAD 3BEIB 1SKYE 2A32A 2WUBA 4X6NA 2ZWLH 1P12E 2FTMA 1PQAA 3SJIA 1WQVH 3RXPA 1OP8A 2BX3A 3KGPA 5DG6A 4BTIB 2V6NA 1K9OE 4I8GA 4E06H 2OBQA 1H9HE 1VITG 2VBCA 4GLYA 1MU6B 3DD2H 1Z7KA 1SR5C 1PPZA 3QDZB 4GCHG 2OD3B 3L33A 2SNVA 4NWKA 1GJ6A 4JK5A 1O2OA 1P2IA 2GCTB 2UUFB 1ZRBA 1LO6A 1WV7H 2IOTA 1G32B 1YM0A 1BRAA 1OWIA 3ATIA 2GT7A 2BDCA 5HGGA 1LHGH 3QX5H 4CHAB 4LZ1H 5DSFA 1K0HA 1MQ5A 1AUJA 2NU4E 5EQQA 2WYGA 4GUXA 4XSKU 5C1UA 3KCGH 4XDEA 3BEUA 1GI8B 1DANH 2ZFRH 3UOUA 1BMAA 1QRXA 1YGCH 2ZCLP 4R0IA 1SVPA 2PKAA 4ABAA 1G30B 1HV7A 4UONA 3A82A 4UFFH 3SZEA 1FY8E 1C9PA 3MOCA 4O9VA 1OHHD 2PTNA 5IK2D 1A0LA 2AIQA 1AZZA 3A86A 2I6SA 3UB0A 2AGGX 3OEED 5I25A 2EA3A 3ZYDA 4H4FA 2BY5X 2ZFFH 3SU6A 1ELTA 3PROA 2BMGB 2BDIA 2WV5A 1HAXB 1SGRE 7LPRA 1MAXA 5GIBA 1GGDC 3SNBA 2ANMH 1DS2E 9LPRA 1YYY1 3UY9A 1QJ7B 1AIXH 1S0QA 1NBME 1A0JA 3UQOA 3SGQE 1OP0A 1WQSA 2WPDD 1VCQA 3VB7A 1Z6JH 4ABHA 1GMDG 1K22H 3MO3A 4AZ2B 2O8WA 1SGCA 3O8CA 2P16A 1O2JA 3E90B 2G4UA 1HAVA 3U9AH 5A0AE 3PWBA 1SQOA 2ZU3A 1G36A 2XNIA 1SGIB 2QN5T 3LKWA 4ISIH 1AVXA 3HKJB 5DP6A 2Y81A 4JMYA 3LGVA 3S7HB 1O2IA 3UIRA 2XC4A 2ZCKP 4DIHH 1J16A 1OYTH 4JZ1A 3QK1A 1NROH 4FETA 2O9QA 5DJ7A 2W3KA 1AVWA 3WWBA 1TIOA 2XCFA 4FOUC 4HG6A 2BVSH 2BTCE 2VH0A 1LKAA 1WCZA 3S9AA 3FZDA 1VCWA 2K1QA 1GBMA 5AF9H 1XUFA 3PRBA 1CGHA 2QF0A 1ZSLA 1GCTC 2Z9JA 1OWKA 2GV7A 1HAYB 1HAOH 4CH2B 3KIDU 4DJZB 1JWTA 4OM9A 1VCPA 3PLKA 1GMDF 1TA2A 4FUGA 1GMHG 2BM2A 1HIAA 2AGIX 3N7EA 1MTVA 1HYLA 2CF8H 2WPLS 2HVYB 1X7AC 4FU7A 7GCHF 2D2DA 2FDAA 2QA9E 4F48B 1V2PT 3GY7A 1O2YA 1QBVH 1WYKA 1ZTJA 2WV4A 3OFND 4MLFB 5T6GA 3G01A 1T8OA 1O3DA 3GYMA 3TPIZ 1YY3A 1F0UA 3F2HA 1BT7A 3A7VA 1S0RA 1QRZA 3RXOA 5JDUB 5DGJA 1C5NH 1ZPCA 1HNEE 3VB4A 4BXWA 1ESTA 2A45B 1K28D 3BF6H 2OXSA 5AHGH 3HK6B 3A84A 3BG4B 3B8JA 1GHXH 1TLDA 1TPPA 4AYYB 3K2UA 1DSUA 4MQAA 4U30A 4X6MA 1TMBH 1UTOA 1ZPZA 5J4QA 1BA8B 3BG8A 5GCHF 1SGEE 3W95A 2O8LA 4IMZA 2QC2A 1ARBA 4U2WA 4UFGH 2QXIA 1E34B 3AK5A 3T2NA 3TK6A 3ELAH 3IWMA 1TNIA 3F2GA 4XBCA 1GVZA 2IPQX 3E3TA 3P8NA 5GWZA 2C8WB 4MTBA 3SHCH 4OS6A 5LH8A 4MNWA 1K1IA 1UK2A 1C5XB 1F0SA 2BY9X 3RMLH 3NCLA 1T4UH 2UUYA 2FOHA 1E1RD 2A2XH 1YCPK 3UAIC 1SFQB 1UVSH 1AO5A 3SOSA 3O8BA 5FBEA 3BV9B 1GJBB 2ZGCA 3F6UH 1K1PA 1DOJA 1C5SA 2PGBB 3SW2B 3T28A 2V0BA 1P2OA 4FXGH 1O3EA 1OKXA 5LPRA 1NU9A 2AERH 2J97A 3FFGA 4FU8A 1AE8H 4B6EA 1XMNB 1C4Y2 2XBWA 5KEDA 1K1JA 1Z8JB 3RLWH 2XNDD 3M3SA 1VITH 1NFUA 1O2PA 1A5IA 4FUEA 4AX9H 3WW7A 1FY5A 3KQBA 1IQJA 6GCHF 4GVUA 1YBWA 4RN6A 3MO9A 3ZZ4A 2A7JA 2PUXB 5DPAA 4ZKOU 1LHEH 4INHA 2ZTZA 5JBTA 4XE4A 1S6LA 3GDSA 1C2JA 4IGDA 3LH1A 1O5CB 4CRFA 1ETRH 2NU0E 1LDTT 1NRNH 3L6PA 2F3CE 2JIZD 1GHBG 4JCNA 2OC8A 5EIYA 2H9HA 4XBBA 3Q3XA 4D8NA 3A81A 3ZVGA 4MPVA 1QQUA 1HGTH 5IYTA 2W5EA 3STIA 2YMSC 1O2WA 1KLTA 4A1TA 2BQ6B 4I8LA 4Z0KA 1SOZA 1DWDH 4YZUA 2W6ID 2SGEE 2Y6TA 3EE7A 4Q80A 3QUMP 3TH2H 2FP7B 5TCAA 1YPKH 2Z94A 1JMOH 1DUEA 2VIWA 3EA7A 3AASA 3DSGA 1IQEA 1A7SA 1GHZA 1INCA 2IN2A 3UWJH 5F8TA 2G52A 4ZUHA 1Y5BT 1ARCA 3D49H 2PSXA 4B71A 1DITH 1C1TA 3QLPH 1H8ED 3F9EA 1LHDH 3PYHA 1MKWK 4MPXA 4SGBE 3S9CA 3M3TA 4X8VH 1LKBA 1A0HB 3BTTE 4E7NA 1P05A 1VGCC 2GMTB 2HPPH 3M35A 2P93A 1DLKB 2ZU2A 1H4WA 2W26A 1O3KA 1F5LA 3I29A 1TRYA 1O31A 1LHCH 3ZV8A 1O32A 1ABIH 2VWLA 3GICB 5HXFA 4A1VA 4Q4LA 2PTCE 1P2QA 5CMXH 1BCUH 3ZZ8A 3F0PA 1IAUA 2V3MA 1V2NT 1CHOG 1O3JA 3ZZBA 1F5KU 3TH3H 3RC5A 2J98A 1PQ8A 3RXQA 2BB4A 1KSNA 1Y3WA 1VR1H 2PKAB 3ATWA 5FPTA 1W11U 4DCDA 5DKMA 2VU8E 1GVKB 5E0JA 1EJNA 1QL7A 1JOUB 1C5MD 4ESTE 1EB1H 3RXIA 1H8IH 3F68H 2P3TB 1AB9C 4RI0A 3ATLA 1AUTC 1V2QT 1GHYH 2ZHEH 3SUDA 5BRRE 2FLBH 3TH4H 3MU1A 3ESTA 1EAWA 2ZHFH 3OX7U 4OS4A 1KYNA 2BOHB 4WF8A 3BTGE 1O2ZA 1P57B 4ZMAH 1A5HA 2A7CA 3RU4E 3GS9A 1O3BA 2GV6A 1KMHB 3TU7H 4K60A 2ZCHP 3FO8D 2GZ7A 4IW4E 3SGBE 1TAWA 2KR7A 1OP2A 2HLCA 3MI4A 2FS8A 1MKXK 1H9LB 5GNDA 1P3EA 1P2NA 5EODA 3VB5A 2C8ZB 1GMCF 1SPJA 1O2QA 1C5RA 1CE5A 4K69A 4Y10E 3UNQA 3A8AA 4FUJA 4Y6DA 5E8EH 3O8DA 3T26A 1C2KA 3BTME 5F8XA 4WJG2 1KIGH 1Y3UA 5JPMH 2OUAA 5JB9S 1YPHE 4MG3A 4J2YB 5HYOA 1O3LA 3E8LA 2GJGA 2YMSB 2FOAA 5EQRA 1UTKA 2ZKSA 2K0QA 3QWCH 2PKSC 2H5DA 1UVUH 2CV3A 4BAKB 1IQNA 1P2JA 4AGJA 1NBMD 2R0KA 1O3NA 2UWLA 1TABE 1B0EA 3KQEA 4MDSA 3V12A 1EP5A 3ENSB 3PB1E 3NXPA 4IMQA 1QCPA 3T5FH 1AFEH 2FI4E 4JZDH 5FXLA 1UHBA 1UO6A 4NGAH 1EX3A 2QGRA 1SLVB 3EYDA 1XUGA 1J14A 3OE7D 1FV9A 4X0WU 5FPSA 1ZHPA 3V7TA 4ZCNA 3MTYA 3UR6A 3MH4A 3Q77A 5H4IB 3FKSD 2EY4C 2WYJA 3VXFH 5HIZA 1Z71A 1P11E 1N8OB 1V2JT 3DSOA 3S0NA 1C1WH 1BTYA 3NUMA 5CHBA 4NZLA 4YM9A 1DWCH 1DFPA 3TK5A 2XBVA 4UD9H 2J92A 2CN0H 1PQ5A 1YLNA 1G2LA 1DXPA 5K7RA 1IHSH 2BLOA 3VB3A 1TPSA 1D3TB 5JBAS 2AHME 2FLRH 5DP3A 1F0RA 2ALVA 1FZZA 1ELFA 1HLTH 2NU2E 2A31A 4UDWH 5J4SA 3GCHC 3LC5A 4RKJB 4YT6H 1RS0A 3M5NA 1NN6A 1YPHC 3PMBB 4WH6A 2KFWA 3C1KA 1KDQA 1C2HA 5FPYA 3M7QA 1MBQA 3LJOA 1H1BA 2QY0B 2QF5A 1NRRH 3KF2A 3TJVA 2BVXH 1O3CA 3UWIA 1GBJA 1DUAA 5FCRA 1MTNB 3LU9B 1QJ6B 3F9HA 4AORA 1TNGA 2ZDLA 2ZHQH 2GP9B 1TOMH 6GCHG 1VJAU 5HIYA 4I8JA 2FMJA 2P3UB 2FTLE 4DW2U 3ZVFA 1ZR0A 5GDSH 2ZO3H 3UNSA 1ESBA 2FESH 2G55A 1C4V2 1DLEA 1GBLA 4FU9A 3GCHB 3UUZA 3MH7A 2OQUA 2OLGA 2WPIS 2XTTB 4O97A 1P10A 5C0UA 2J9NA 1GJ4H 1XXFA 3P8GA 1DSTA 2BY7X 3GY8A 4X1SU 1EJMA 3V0XA 4DT7B 3P6ZB 4ZHLU 1FLEE 4Q2KA 3ZVBA 3F3BA 4M7GA 2ZI2H 4LOYH 2VIVA 1FDPA 1D3DB 4I7YH 5A2MH 4IC6A 2Q1JA 1C2LA 1ETTH 1W8BH 1SFIA 2EI7A 3ZZAA 3O8RA 1TBZH 2FIRH 4O3UA 4TY7A 1PPCE 4Y8ZA 3BG4C 1BRBE 2H1UA 1W2KH 1XX9A 2P95A 1HJAC 3H7OA 4BTUB 3SNEA 1SGPE 4HTCH 2AS9A 3SQHE 1GBDA 4P02A 1Z8GA 2UWOA 2Z9LA 3FVFB 4CRCA 1ZOMA 3RXUA 2B9LA 2ASUB 3GDVA 3MH6A 4K8YA 5JBCS 1MABB 2C3SA 4K1EA 1ELAA 2VVUA 1TX7A 5EJLA 2Y7XA 6CHAC 9ESTA 3K6YA 1F5RA 2ANYA 3BTQE 1FNIA 3NKKA 1LPZB 1TOCB 2ZF0H 2FS9A 1SGNE 2BDBA 3TGIE 5F8ZA 1QB9A 1W7GH 2R0LA 2NU1E 1SGTA 1V2KT 3BSQA 3W94A 1GBBA 1FX0B 1Y8TA 1GHVH 4PROA 3MFJA 2JJ1D 1T8NA 1EATA 3BTKE 1PFXC 1KXEA 2AGEX 3SV2H 4Q7XA 1S81A 1RFNA 1HAIH 1CSOE 1OS8A 2TBSA 3VPKA 3RXCA 1T31A 1C2FA 2XW9A 2KCPA 2ZGBH 3IITA 2Y5GA 4WY3A 4CR5A 1VKYA 1A3BH 1HIAB 1L1NA 3MYWA 1HAPH 4WH8A 1AKSA 1SI5H 4YXWD 2IJOB 4ZHAA 3A7ZA 2J95A 2GZ9A 5KGOA 4BAOB 1ELVA 3PMAB 4FUDA 5HKKD 3S7KB 1SQAA 1AMHA 1GI3A 2EQNA 2P8OB 3P8OA 1O3OA 2BVRH 2KZ4A 8ESTE 1BTUA 3I78A 2CK3D 1PJPA 1EPTC 2BD2A 6CHAB 2C8YB 2ZDNA 3EGKH 5DO4H 1TONA 1ANCA 1EUFA 5EXMA 5AVDA 1EXFA 1EAUA 3FANA 2GZ8A 2DE9A 3SJKA 1L1JA 1D4PB 1PPFE 2OK5A 1NPMA 4Y0ZE 3SORA 1WSSH 4NZQA 2BQ7B 2VIOA 1EASA 2SGQE 1PYTC 1A46H 4WXIA 3SV7A 3VG8A 4NCYA 2ZQ2A 2ALPA 1GI0A 1C5YB 1HCGA 3SBKA 1WU1A 1XM1A 1C1NA 2BDHA 2V3OH 1N6YA 4NIVA 1E35B 2AH4X 2HPQH 3TVJB 2F9NA 2K8IA 1KLJH 3RXDA 3PV4A 2B7DH 2VWNA 1HBTH 1OX1A 4ISOA 5DP8A 1GBCA 2ODQA 1V2RT 4INKA 3QO6A 1TX6A 2RA0A 2ANWA 4CBNA 4ABGA 3ZVDA 2QCYA 2XWAA 1XUJA 1OWDA 3BTWE 2BOKA 1GI9B 4KTUA 5CHAC 4X1QU 2FI3E 4NIWA 2OC7A 3M37A 1QBOA 4ZAEA 1TNKA 2R2WU 4IN2A 1MCVA 4A6LA 2G51A 2OINA 1UCYE 3I77A 2HALA 8GCHF 4OS7A 3D23A 1QRWA 1VGCB 4IC5A 3RXKA 3FOAA 1QURH 1EKBB 1K2I1 2Y5HA 4ISLA 2BD9A 1TPAE 1G3DA 4FUHA 3OAAD 5AFYH 1RTFB 1GJ9B 1CGJE 4JZFH 3SGAE 1ABJH 4JYUH 5JYIA 2STBE 5T6FA 4ABDA 3SO3A 3UNRA 3A7WA 3GY4A 1EQ9A 4MNVA 2A5KA 1P01A 4TWYA 3SZNA 1CA0C 2CMYA 1W0KD 4NSYA 2KCAA 5FX5A 3A8BA 2A1DB 5EQSA 2H5CA 1EZQA 4YOJA 1UVPA 3UPEA 1EZXC 3BN9A 2CJIA 2R9PA 2ESTE 5DN6D 1O2GH 5PTPA 2EI8A 2SGDE 4UEHH 3IG6B 4NSVA 3P17H 1GI2A 3KHVA 1EOLA 1O3GA 2TIOA 1P0SH 1NO9H 1ZMLA 4CRDA 3GCTG 3GISB 1AD8H 2BQWB 1KTTB 3LONA 1G37A 4X1PU 1T7CA 1RIWC 2F9VA 2CXVA 3K6ZA 4BAMB 3SV6A 1FAKH 1F2SE 4B73A 3RXRA 3P95A 1T8MA 1N8OC 3RMOH 4B2CA 1C5QA 1E0FD 4BAHB 1MZAA 3MNSA 3SNDA 4BXSA 2J5UA 1HAVB 1KXBA 3A7XA 3TNSA 4BANB 1BUIA 1UCYH 2BZ6H 1A61H 4ABJA 1FONA 2HOBA 1PYTD 3RDZA 4MPWA 1TMTH 2KX4A 3F0OA 1GBTA 1GBEA 2GCTC 1TMUH 3RM0H 2A4GA 1C5LH 1IHTH 1O2UA 3SNAA 2ZEBA 5EJ1A 1QNJA 2ZPQA 2F9OA 1GG6C 1V3XA 3M7TA 5C3NA 1C2IA 2BLVA 1VITF 4AG2A 4F4OC 1DPOA 3R3GB 2HLDD 2ZECA 4GCHF 1UHBB 1ANDA 4VGCB 3E91A 3M61U 2BHGA 1ZLRA 4I8HA 1AFQC 1MTSA 2XC5A 3T25A 3SN8A 1WTHD 3RXFA 3RXHA 2CF9H 3EDXB 1GHBF 3H09A 3ZVAA 1O2RA 1XKAC 4B75A 4AB9A 1HAGE 1RXPA 1CU1A 3MH5A 3RP2A 1TALA 2AMQA 1THPB 1QFKH 1W7XH 1O3PB 1SQRA 3F9FA 1XKBC 1XVMA 3RXGA 3UTUH 4HI3A 4A1XA 4YTAA 1UMAH 2FOMB 1EAIA 1FPCH 4JZIA 1PPGE 5E2PA 1IQHA 1GDQA 1GJDB 2CHAB 3B9FH 2D26C 2JH6D 1BITA 2YNBA 3RXSA 1UW7A 2W3IA 3JZ1B 1KLIH 4NA7A 1AU8A 4GHQA 2ZFPH 4FUIA 2Y82A 5C67A 1NRQH 1LVMA 3Q76A 4BOHA 2J98B 5IDKA 1Y3XA 4WVPE 1FPHH 4WXVA 2CGAA 1UK4A 4XBDA 1NRPH 3URDA 1QL9A 1HAZB 3MWIU 4Q7ZA 1EAXA 5DP4A 1RRKA 3STJA 2FZZA 3RU4D 2VWOA 1C1QA 5DP9A 1O0DH 2XBXA 1BRUP 3KQCA 4B74A 1GBKA 3RXMA 1O2VA 2B5TB 1T32A 1ANEA 2QF4A 1T4VH 2ZDAH 2YNAA 1O35A 3RU4T 2LP6A 3A85A 1HJAB 3AVZA 3T27A 1L1GA 2FM2A 5GCHG 1MMJN 3NRLA 3URCA 1SLWB 3M5MA 2D8WA 2ZU5A 1HDTH 1DT2A 1GJAB 1OWHA 1GI7B 1CO7E 3RXLA 5C5NA 2TGAA 3EE0B 4TSFD 1PQ7A 3EA8A 1FAXA 1MAYA 3RXVA 1UCYK 1NC6A 3TGJE 1GI1A 2J38A 5EPNA 1C1MA 1UTQA 1GPZA 3PRDA 1SMFE 3M36A 1E1QD 3LGIA 4I8KA 1SGYE 1F92A 5LPEA 3QGJA 3C27B 3GY6A 3KYGA 1KDQB 1YCPM 3LJJA 1EOJA 1T8LA 2Q6GA 2O8MA 1WUNH 3U69H 4DY7B 1ELGA 3ZZ7A 1AFQB 1S85A 2GTBA 2VH6A 3OYPA 3PV2A 3PLPA 3HGNA 4FUFA 3RXAA 1W12U 2A0QB 2HWLB 3BEFB 1BTWA 1PPHE 3QN7A 1THSH 1CT2E 4IBLH 3SV8A 1XVOA 3FP8E 4ZH8A 1XUKA 1S83A 1TGBA 1C9TA 1HJ8A 2A4QA 1N6XA 2VGCB 3OSYA 3PTNA 4X6PA 1WTGH 1ZRKA 4NG9H 2QV1A 3OY6U 2PKSB 2WINI 3BIVH 4ABIA 2M2AA 1W14U 4Y8XA 3BIUH 2ZQ1A 1QIXB 1MD7A 1D6RA 1YPGH 4ABBA 1D6WA 4QT8C 3U1IB 4A92A 4ZROA 1ZZZA 5E0HA 1F7ZA 1O5EH 4YESB 4I31A 1LHFH 1D9IA 1GGDB 5LPFA 2P94A 3EAJA 4CRBA 1P9UA 3E16B 2XYAA 1K21H 1O5BB 1SC8U 4MNYA 1FQ3A 5EU8A 1J17T 3H5CB 1O38A 2XOKD 3DT0H 1YCPH 2FOFA 3SUEA 3TJOA 1Y3YA 2ZGHA 1K1OA 1Z1IA 4CRGA 3N7OA 4WWYA 3DCLA 1MQ6A 3MNXA 2J2UA 1MD8A 1FXYA 1P06A 1TB6H 1Z1JA 2ANKH 3E1XB 4RSPA 2PGQB 2ZG0H 1BJVA 1GMHF 4CRAA 2VVVA 4ZXYH 2J34A 4ISHH 1QR3E 1DM4B 1MUEB 2HVXA 1BHXF 4LK4A 4E7RG 3DSPA 2GCHG 3FN8A 4NFFA 1S82A 2AIPA 4JYVH 2LNCA 2VVCA 2NWNA 4YLUA 1TRNA 1QBNA 2Q6DA 1YPMH 4X1NU 2PHBA 4KGAA 2Y5FA 3VFEA 2A4RA 4MPUA 2GCHF 1ZTKA 3GY5A 3AW0A 1HFDA 4KELA 5EJZA 3TIUA 1YLCA 1YPEH 3T29A 1TPOA 3ATMA 5B6LA 5C1XA 4UFDH 2AYWA 4ZXXH 3RXEA 1DWEH 3PO1B 1AWHB 1QHRB 1Z8IB 4FUCA 1O2HA 1RIWB 4JYTA 1EZSC 4A7IB 3RXBA 5C17A 4X2YA 1C1UH 1KXFA 1O5AB 4LXBH 4Y7BA 1O2TA 2H2ZA 3DHKH 2WV9A 4Y71A 3U28C 2P59A 1ZGIA 8KME2 2WSSD 1DE7H 4Y79A 1AZ8A 4ISNA 2WPJS 4X2XA 4DVAU 2Z9IA 1E37B 1FMGA 1LVYA 1HXEH 1BTHH 3UR9A 4AGKA 1AQ7A 3AW1A 3WWFA 3MNBA 1QA7A 4TY6A 1GJCB 2GVFA 5JB8S 1BB0B 4RT1A 3K65B 2A7HA 4NIYA 3ITIA 1CA8B 1DY8A 1FN8A 1P9SA 1SGFG 2RFKC 2ZFTA 5FCKA 1QY6A 1K1NA 3GY2A 5EW1H 2SGPE 3ZV9A 3EQ0H 1O39A 1W0JD 4R8TB 4YLQH 1ANBA 1QQ4A 1C2DA 1NM6A 3ZZ9A 5HM2A 1J8AA 5DP5A 1GL1A 1NT1A 2A4OA 2VWMA 4D9QA 4M9FA 3A8DA 3TLOA 2RA3A 2OBOA 1GBFA 1SB1H 1B5GH 3UREA 1SBWA 2HNTF 3M5LA 1SHHB 3QZQA 4K8BA 2TGPZ 1CHGA 8GCHG 1BTZA 3FZZA 2GDDA 1SG8B 1O33A 2FPZA 2G81E 2TRMA 1O2MA 5EPYA 1BOQA 5BPEA 4F55A 1O3MA 4TPYA 2G5VA 1C5TA 4CBOA 3HKIB 2P8OC 1A3EH 1AB9B 3BTFE 2ZTXA 3NK8A 3PM3A 1NY22 4K5ZA 3DFJA 1AKSB 2KCOA 4OS1A 5G4BA 1QTFA 2FOGA 3H7TA 1CBWC 2FI5E 2W7SA 3RXJA 4D76A 1FIWA 4OGXA 4ACAA 2R3UA 1HJ9A 4K3JA 1GCTB 3AAUA 3GCOA 2BY8X 1TGCA 3MU0A 2JH5D 4IN1A 5F6MA 4B2AA 1O34A 1W10U 3DFLA 1ZHMA 2W7UA 2W6JD 4SGAE 3PMJA 2GDEH 3F2FA 4K2YA 1ELDE 2YOLA 3A83A 2TGTA 2AEIH 1ELCA 4Z1MD 1NFYA 2ODYB 1UVOA 2OP9A 3LDXH 3JZ2B 1QB1A 2AMDA 2A5IA 1Y5AT 2ZU4A 3RC6A 2PSYA 4ASUD 1BRCE 1BQYA 4BTTB 4MNXA 4YO9A 1NFWA 3FP6E 1NS3A 1S5SA 4DURA 1IQIA 5FAHA 4YOIA 3KL6A 2L74A 3U8RH 5A0BA 5LGOA 1CHOF 5GJ4B 1P2MA 1TNJA 2R3YA 1P04A 1BDAA 3NWUA 1Y3VA 5CE1A 1BMMH 1DXWA 2UUKB 4D7FA 1UTLM 1K1LA 5EXLA 2UUJB 1MZDA 1O3IA 3R0FA 3A80A 1O2NA 3MU5A 1RJXB 1JRTA 2QXHA 3NZIA 1QZ8A 1WOFA 5DK1A 2F83A 1TGNA 4H6TA 1ORFA 1UTMA 1ZJDA 5E2OA 2RDEA 4BNRA 1EFRD 1O2SA 2GD4B 3ODDA 1TRMA 3SJ9A 1WBGB 2JKHA 1EPTA 1MTWA 5TCCA 3LGTA 3ZVCA 1AI8H 3CENA 2THFB 2J4IA 4HFPB 1ELBA 1COWD 3Q3YA 5FL7D 1IQFA 6ESTA 2JDID 5JBBS 2FOBA 2Z3EA 4HZHA 3GYLB 3SJOA 4E05H 2ZZUH 3LGYA 1LQEA 2XBYA 5FBIA 1GWAA 3BTDE 4AG1A 3U98H 2BZAA 1CA0B 2BX4A 3KN2A 2GX4A 4GHTA 2WPMS 1C1OA 5F53A 3MU8A 4Y7AA
chains in the Genus database with same CATH topology
1V6DA 4CH8B 3GY3A 1HB0B 2ZHDA 1BZXE 2FX4A 2ZGJA 1C5VA 2XWBI 3F1SB 2AMPA 2A5AA 3RUOA 1OWJA 2I6QA 3SI3H 1FIZA 4WMFA 1MBMA 1XXDA 1OOKB 3VB6A 1NZQH 1O3AA 1W0YH 3MMGA 3ZZ5A 3RMNH 2VIPA 1GJ7B 1SLUB 1UVTH 2VNTA 1KTSB 4Y8YA 1O3FA 1Z6EA 4TWWA 1O5FH 1KXAA 2BLWA 4YOGA 1L0ZA 3FAOA 1NU7B 2F9BH 2B0FA 4O03A 1A1RA 1GI6A 1EZUC 1GHAF 1UTJA 2B8OH 1C2GA 1SOTA 1B7XB 4DGJA 1VJ9U 3D65E 1JXPA 3K9XB 1AHTH 1AGJA 1W13U 1YPJH 5ETXA 1GL0E 3ZZ6A 1QB6A 2GGVB 1GHAG 1V2LT 1FN6A 3S9BA 3HK3B 1QA0A 4ZKRU 1NESE 1U6QA 2DE8A 4VGCC 3GCNA 1HUTH 2Z3DA 2H6MA 2G8TA 5EGMA 2J94A 4X8TH 3PO1C 2RDLA 5TJXA 3UQVA 3A7TA 2FOEA 3ZVEA 2ZU1A 4X6OA 1ZHRA 5HM9A 1MTUA 1GJ8B 2Z7FE 1IQKA 3M7UA 1BBRK 2PLXA 3UOPA 1CVWH 1TX8A 5A09A 1FI8A 1YPLH 2QAAA 2IPHA 5C1YA 1V2UT 2ZC9H 5A8YA 4H42U 3Q00A 1BJUA 3ZZ3A 1NFXA 5CHAB 4ZKNU 2ZTYA 1ETSH 1OXGA 1AE5A 3M5OA 1ZTLA 1C5OH 4XFQA 2H9TH 1C2MA 2BD4A 4FVDA 4INLA 5DP7A 4NA8A 1SGFA 2G5NA 1Y5UT 1IQLA 1LCYA 3NPSA 1CGIE 3QTOH 2VIQA 1BHXB 1TGTA 4BAQB 2VB0A 1LPGB 1JIMA 5EXNA 5T6DA 2ILNA 3ODFA 4NIXA 2BXUH 2JETC 1JIRA 1Q2WA 2FWWA 2C4FH 1MU8B 1DVAH 4J1YA 1C5UA 5I46H 3DA9B 1Q3XA 3TITA 1P8VC 2ZGXH 1JBUH 3P8FA 4B1TA 2FYQA 4HGCA 1W3CA 3MO6A 1TQ7B 1TGSZ 2F9PA 3SU5A 4DOQA 1M9UA 4K1TA 2ZP0H 3L3TA 2UWPA 4OS2A 3SHAH 2Z9GA 2HRVA 1JRSA 1W0ZU 1L2EA 2WUCA 1MKWH 1DDJA 1SGQE 1SL3A 1MH0A 2O8UA 3OY5U 2C93B 1DICA 4XOJA 5B6OA 4AN7A 1TYNA 4KP0A 4O3TA 3ZZCA 5C5OA 2A2QH 4UFEH 2FODA 3GDUA 2XCNA 5GPIB 1ZMNA 3PMHB 3SU2A 1CT0E 2RG3A 3D62A 3EA9A 4AFUA 3DUXH 2WPHS 4AOQA 1ZSKA 2EC9H 4NWLA 1KXCA 4GAWA 1A2CH 3A8CA 1B0FA 3E0NB 4WMDA 2GKVE 3PWCA 3VXEH 1Q31A 1V2OT 3KNXA 5FHTA 2BLQA 1CQQA 1O5GH 3LGUA 5T3HA 1OPHB 1Y59T 4D9RA 2ULLA 1BBRH 3CP7A 4ASHA 1C5WB 2G00A 1O3HA 3RC4A 2OCVB 1O2KA 1RD3B 1KXDA 7ESTE 1EP6A 5GXPA 1P2KA 4GSOA 1E38B 1V2WT 5L2ZH 4A5TS 2QF3A 1LQDB 1THRH 3A7YA 1MCTA 2FX6A 7KMEH 1D3PB 1F0TA 1XUHA 1IOEA 1C2EA 4ZHMU 2ZPSA 4WMEA 2Z9KA 3KEEA 2OTVA 1GJ5H 1QL8A 1ELEE 2WPKS 3GCTF 1BTPA 2ZFQH 2KAIA 1BMLA 1V2ST 1FUJA 2VGCC 1GDUA 1O2LA 5C20A 1EPTB 2XXLA 1NTPA 1O36A 1G3CA 1AVGH 1O2XA 4AFSA 2PW8H 1O5DH 1G2MA 4Y0YE 1ESAA 2QIQA 5A0CA 4U32A 3U1JB 1OWEA 2Q6FA 3F9GA 4F49A 2H9EH 2F9UA 3B23B 4X2WA 3MNCA 2CHAC 4AB8A 4FUBA 7GCHG 1RGQA 1SHYA 2EEKA 3LH3A 3BTEE 2FXRA 2TPIZ 3RMMH 4ABFA 3SU3A 5A8ZA 5AFZH 2M5TA 2HGTH 3U8OH 1QGFA 2OC0A 4YT7H 3VEQB 1G3EA 3BTHE 3VGCB 3TJUA 4Q7YA 1ID5H 1O30A 1RTLA 3FP7E 1V2TT 4AFZA 5L2YH 1A5GH 3UFAA 2BDAA 2AFQB 3ATKA 3LC3A 1MKXH 2NU3E 1UJ1A 3HGPA 4UE7H 2BD3A 2XC0A 1TNLA 2QYIA 3QGNB 3S69A 2ZDKA 2ZIQH 2G4TA 4U01A 1LVBA 1MTNC 2PWXA 2C8XB 3WY8A 1VZQH 2STAE 1GCDA 1TBQH 2ZPRA 2QXGA 1YLDA 1DY9A 1ZPBA 3CS0A 1AWFH 5EG4A 1WAYB 5EW2H 3E0PB 3ZYEA 1TFXA 3PLBA 2OQ5A 1YP9A 2ZHWH 1S6FA 1GI5A 4NFEA 1UTPA 5E0GA 2SNWA 5HMAA 2BDYA 1GDNA 1RTKA 3P92A 2R2MB 2TGDA 1H9IE 1V2MT 2KAIB 1FY1A 4DG4A 1ZSJA 8LPRA 2HNTC 3CS7A 3GOVB 1TQ0B 3MHWU 2JH0D 2V3HH 3SQEE 3LOXA 4LZ4B 3PTBA 2OC1A 5SGAE 1XUIA 3RM2H 4FVBA 1P03A 2O8TA 1L4ZA 6LPRA 2ZDMA 2RCEA 2HNTE 4KKDA 3U8TH 2Z6BD 1D3QB 1AY6H 1GI4A 1HXFH 4X8UH 4X8SH 1P02A 1IQMA 1C4U2 1G3BA 2BY6X 4X2VA 3T62A 2FEQH 1J15A 2D1JA 4Z6AH 3LIWA 1SLXB 1C1VH 1H8DH 1EJAA 1TWXB 1C1PA 2LPRA 4RKOB 4Y11E 3SUGA 3V13A 4GPGA 1P3CA 3SJ8A 5L6NH 3HPTB 2XRCA 4THNH 3SV9A 4CR9A 2ODPA 5ESTE 3SU4A 3SUFA 2BD5A 1S6HA 1PPEE 1C5PA 2VJ1A 3TK9A 3E6PH 1BTXA 3LPRA 1S84A 2ZA5A 1YC0A 2Y80A 1DX5M 1AN1E 5ABWA 2BD7A 1A4WH 5C2ZA 2F91A 1QJ1B 1LMWB 1V2VT 1FY4A 4KTSA 1TA6A 4H6SB 1NRSH 1G9IE 2PV9B 1YKTA 2V35A 3LGWA 1KY9A 1TBRH 2Z3CA 3VGCC 2FOCA 4AYVB 1C5ZB 1ZJKA 1ACBE 3TJNA 2JETB 1LTOA 3OU0A 1HRTH 5FX6A 1GVLA 2SGAA 4KTCA 1GBIA 1P09A 3A87A 2VINA 1Z8RA 2QXJA 3V3MA 1CBWB 1DWBH 4Y76A 3AAVA 4ABEA 3HATH 3SI4H 4NA9H 2P3FH 4OGYA 1GHWH 1L4DA 3Q3KA 1OYQA 1SQTA 2VIDA 4AFQA 3ZZDA 3QZRA 1GG6B 3QTVH 2C90B 4B2BA 5A8XA 4CHAC 4MVNA 4TYDA 3SU1A 2ZNKH 1TNHA 4DIIH 3A88A 3LT3A 1BMNH 1HAHH 4I33A 1C1SA 1LPKB 4CREA 4K1SA 2SFAA 4D7GA 2PFEA 1BIOA 1HPGA 2GMTC 2ZFSA 1FY3A 2FO9A 3P70B 1LVOA 1O37A 2BYAX 4I32A 4TPIZ 3M3VA 3OTJE 1IQGA 1OSSA 1SSXA 2Y7ZA 2BDGA 1UTNA 1TE0A 5L30H 2GT8A 3SNCA 4B76A 1ZYOA 3KQDA 2SGFE 2DUCA 1N1LA 1SGDE 3TGKE 3MU4A 1K1MA 1UK3A 3A89A 5EOKA 1CT4E 1E36B 2BXTH 2PR3A 5F03A 4OS5A 1PPBH 4X1RU 3RXTA 2FYRA 4ZKSU 1J9CH 1FJSA 1EB2A 2EI6A 3SU0A 1ZGVA 4IS5A 1YF4A 5K0HA 1GMCG 4JZEH 3TNTA 4JK6A 2PUQH 2ZDVH 2BD8A 1GBHA 1GBAA 5ESBA 1BBRE 1C1RA 3RLYH 1ZMJA 3BEIB 2A32A 2WUBA 4X6NA 2ZWLH 1P12E 2FTMA 1PQAA 3SJIA 1WQVH 3RXPA 1OP8A 2BX3A 3KGPA 5DG6A 4BTIB 2V6NA 1K9OE 4I8GA 4E06H 2OBQA 1H9HE 1VITG 4GLYA 1MU6B 3DD2H 1Z7KA 1SR5C 1PPZA 3QDZB 4GCHG 2OD3B 3L33A 2SNVA 4NWKA 1GJ6A 4JK5A 1O2OA 1P2IA 2GCTB 2UUFB 1ZRBA 1LO6A 1WV7H 2IOTA 1G32B 1YM0A 1BRAA 1OWIA 3ATIA 2GT7A 2BDCA 5HGGA 1LHGH 3QX5H 4CHAB 4LZ1H 1MQ5A 1AUJA 2NU4E 5EQQA 2WYGA 4GUXA 4XSKU 5C1UA 3KCGH 4XDEA 3BEUA 1GI8B 1DANH 2ZFRH 3UOUA 1BMAA 1QRXA 1YGCH 2ZCLP 4R0IA 1SVPA 2PKAA 4ABAA 1G30B 1HV7A 4UONA 3A82A 4UFFH 1FY8E 1C9PA 3MOCA 4O9VA 2PTNA 1A0LA 2AIQA 1AZZA 3A86A 2I6SA 2AGGX 5I25A 2EA3A 3ZYDA 4H4FA 2BY5X 2ZFFH 3SU6A 1ELTA 3PROA 2BMGB 2BDIA 2WV5A 1HAXB 1SGRE 7LPRA 1MAXA 5GIBA 1GGDC 3SNBA 2ANMH 1DS2E 9LPRA 1YYY1 3UY9A 1QJ7B 1AIXH 1S0QA 1A0JA 3UQOA 3SGQE 1OP0A 1WQSA 3VB7A 1VCQA 4ABHA 1Z6JH 1GMDG 1K22H 3MO3A 4AZ2B 2O8WA 1SGCA 3O8CA 2P16A 1O2JA 3E90B 2G4UA 1HAVA 3U9AH 5A0AE 3PWBA 1SQOA 2ZU3A 1G36A 2XNIA 1SGIB 2QN5T 3LKWA 4ISIH 1AVXA 3HKJB 5DP6A 2Y81A 4JMYA 3LGVA 3S7HB 1O2IA 3UIRA 2XC4A 2ZCKP 4DIHH 1J16A 1OYTH 4JZ1A 3QK1A 1NROH 2O9QA 5DJ7A 2W3KA 1AVWA 1TIOA 2XCFA 2BVSH 2BTCE 2VH0A 1LKAA 1WCZA 3S9AA 3FZDA 1VCWA 2K1QA 1GBMA 5AF9H 1XUFA 1CGHA 2QF0A 1ZSLA 1GCTC 2Z9JA 1OWKA 2GV7A 1HAYB 1HAOH 4CH2B 3KIDU 4DJZB 1JWTA 1VCPA 3PLKA 1GMDF 1TA2A 4FUGA 1GMHG 2BM2A 1HIAA 2AGIX 1MTVA 1HYLA 2CF8H 2WPLS 1X7AC 4FU7A 7GCHF 2D2DA 2FDAA 2QA9E 1V2PT 3GY7A 1O2YA 1QBVH 1WYKA 2WV4A 1ZTJA 4MLFB 5T6GA 3G01A 1T8OA 1O3DA 3GYMA 3TPIZ 1F0UA 1BT7A 3A7VA 1S0RA 1QRZA 3RXOA 5JDUB 5DGJA 1C5NH 1ZPCA 1HNEE 3VB4A 4BXWA 1ESTA 2A45B 1K28D 3BF6H 2OXSA 5AHGH 3HK6B 3A84A 3BG4B 3B8JA 1GHXH 1TLDA 1TPPA 4AYYB 3K2UA 1DSUA 4MQAA 4U30A 4X6MA 1TMBH 1UTOA 1ZPZA 5J4QA 1BA8B 3BG8A 5GCHF 1SGEE 3W95A 2O8LA 4IMZA 2QC2A 1ARBA 4U2WA 4UFGH 2QXIA 1E34B 3T2NA 3TK6A 3ELAH 3IWMA 1TNIA 4XBCA 1GVZA 3E3TA 3P8NA 5GWZA 2C8WB 4MTBA 3SHCH 4OS6A 5LH8A 4MNWA 1K1IA 1UK2A 1C5XB 1F0SA 2BY9X 3RMLH 3NCLA 1T4UH 2UUYA 2FOHA 2A2XH 1YCPK 1SFQB 1UVSH 1AO5A 3SOSA 3O8BA 5FBEA 3BV9B 1GJBB 2ZGCA 3F6UH 1K1PA 1DOJA 1C5SA 2PGBB 3SW2B 3T28A 2V0BA 1P2OA 4FXGH 1O3EA 1OKXA 5LPRA 1NU9A 2AERH 3FFGA 4FU8A 1AE8H 1XMNB 1C4Y2 2XBWA 1K1JA 1Z8JB 3RLWH 3M3SA 1VITH 1NFUA 1O2PA 1A5IA 4FUEA 4AX9H 1FY5A 3KQBA 1IQJA 6GCHF 4GVUA 1YBWA 4RN6A 3MO9A 3ZZ4A 2A7JA 2PUXB 5DPAA 4ZKOU 1LHEH 4INHA 2ZTZA 5JBTA 4XE4A 3GDSA 1C2JA 4IGDA 3LH1A 1O5CB 4CRFA 1ETRH 2NU0E 1LDTT 1NRNH 3L6PA 2F3CE 1GHBG 4JCNA 2OC8A 2H9HA 4XBBA 3Q3XA 4D8NA 3A81A 3ZVGA 4MPVA 1QQUA 1HGTH 5IYTA 2W5EA 3STIA 1O2WA 1KLTA 4A1TA 2BQ6B 4I8LA 4Z0KA 1SOZA 1DWDH 4YZUA 2SGEE 2Y6TA 4Q80A 3QUMP 3TH2H 2FP7B 5TCAA 1YPKH 2Z94A 1JMOH 1DUEA 2VIWA 3EA7A 3AASA 1IQEA 1A7SA 1GHZA 1INCA 2IN2A 3UWJH 5F8TA 2G52A 4ZUHA 1Y5BT 1ARCA 3D49H 2PSXA 4B71A 1DITH 1C1TA 3QLPH 3F9EA 1LHDH 3PYHA 1MKWK 4MPXA 4SGBE 3S9CA 3M3TA 4X8VH 1LKBA 1A0HB 3BTTE 4E7NA 1P05A 1VGCC 2GMTB 2HPPH 3M35A 2P93A 1DLKB 2ZU2A 2W26A 1H4WA 1O3KA 1F5LA 3I29A 1TRYA 1O31A 1LHCH 3ZV8A 1O32A 1ABIH 2VWLA 3GICB 5HXFA 4A1VA 2PTCE 1P2QA 5CMXH 1BCUH 3ZZ8A 1IAUA 1V2NT 1CHOG 1O3JA 3ZZBA 1F5KU 3TH3H 3RC5A 1PQ8A 3RXQA 2BB4A 1KSNA 1Y3WA 1VR1H 2PKAB 3ATWA 5FPTA 1W11U 4DCDA 5DKMA 2VU8E 1GVKB 5E0JA 1EJNA 1QL7A 1JOUB 1C5MD 4ESTE 1EB1H 3RXIA 1H8IH 3F68H 2P3TB 1AB9C 3ATLA 1AUTC 1V2QT 1GHYH 2ZHEH 3SUDA 5BRRE 2FLBH 3TH4H 3MU1A 3ESTA 1EAWA 2ZHFH 3OX7U 4OS4A 1KYNA 2BOHB 4WF8A 3BTGE 1O2ZA 1P57B 4ZMAH 1A5HA 2A7CA 3RU4E 1O3BA 2GV6A 3TU7H 4K60A 2ZCHP 2GZ7A 4IW4E 3SGBE 1TAWA 1OP2A 2HLCA 3MI4A 2FS8A 1MKXK 1H9LB 1P3EA 1P2NA 5EODA 3VB5A 2C8ZB 1GMCF 1SPJA 1O2QA 1C5RA 1CE5A