3Q07A

Ctx-m-9 s70g in complex with piperacillin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CTX-M-9 S70G mutant in complex with piperacillin
rcsb
molecule keywords Beta-lactamase
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 94
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q07A00
1HTZA 5AQAA 5A93A 4LCMA 3G32A 2Z2MB 1SDNA 3HUOA 4RX2A 2PBYA 4D2OA 1WYBA 1KVMA 1ZG6A 3A3JA 3HREA 3IHBA 1MWRA 3BFCA 2WGIA 2X71A 5TR7A 4OQ0A 5E43A 3HBRA 4QD4A 3LY3A 5CEDA 2Y2QA 3IQAA 3M6HA 1IYOA 3BM6A 1GA0A 1XP4A 1KVLA 3HUMA 3N6IA 4Y0UA 4JF4A 1Q2QA 3IF6B 5KMWA 3ZNTA 3V50A 5HAPA 3QNCA 2XDMA 4MLLA 1NZOA 3CMZA 1K4FA 5EE8A 3PBTA 5F1GA 2ZD8A 3DWZA 5HAQA 3A3DA 1L0GA 1LI9A 5GL9A 1KE4A 1QMEA 4Y0OA 2J7VA 1GHPA 3IWIA 2HDRA 1K57A 3ITAA 5HW3A 1IELA 1TDLA 5M18A 1EI5A 4RVAA 4K0XA 2Y2GA 3V3RA 3ZNYA 3W4OA 2R9XA 1ESUA 2JCHA 3PBRA 1GA9A 1E4DA 5CXWA 3VSLA 3IWOA 4OOLA 4P6BA 2Y2KA 4FH4A 3BYDA 5FQQA 2EFUA 2J9PA 3UE1A 3VP1A 3C4OA 4BLMA 3IF6C 1G68A 4DF6A 1BT5A 4JLFA 4JXGA 2V1ZA 3G31A 5HL1A 2B5RA 4K0WA 5FI7A 3W4QA 5F83A 4BL3A 1RP5A 2DCFA 1NYYA 3HUNA 2OLUA 1ESIA 3UE3A 2XD1A 4WM9A 3WWXA 1NXYA 3VP0A 2ZC6B 3N7WA 4R0QA 3LY4A 2PU4A 4KZ8A 4PM9A 4MEZA 2Y2PA 3G2YA 2OSUA 3S1YA 4WYYA 1K54A 5DVAA 3IXDA 4OPYA 3TOIA 5FQMA 4WZ5A 4BD1A 1BUEA 3IH8A 3SS3A 4X56A 5L2FA 1HVBA 2Q9MA 3FWLA 3UO9A 3C7UA 4ZJ2A 1H5XA 1JWZA 2RCXA 4KZBA 4QHCA 3NI9A 5EOOA 1SHVA 2EXAA 2Y2IA 5D3OA 4GD6A 4DDSA 1LI0A 1ONGA 1BLCA 2R9WA 5EUAA 2IWDA 3VOZA 1LL5A 4XXRA 4GB7A 5EPHA 1VQQA 4C3QA 4KQQA 5BOHA 2XR0A 3BFGA 3M6BA 2G2WA 3ZHHA 4GN2A 5FQIA 4WBGA 2XLNA 1KE0A 2ZM2A 2JC7A 1DY6A 1GHIA 1HD8A 1RGZA 3LO7A 4U0TA 4ZBEA 5TFQA 1DJAA 2XK1A 4DKIA 1JTGA 2WGWA 3G4PA 3ZVTA 4F94A 2WZXA 5DF9A 3SOIA 3W4PA 4HEFA 3Q81A 5CHMA 5FATA 3OPLA 5TGFA 4JF5A 1PIOA 3UDFA 4DE0A 2XFSA 2EX9A 3SH8A 3ZFZA 4Q8IA 2ZC7A 5CHJA 4HESA 3WRZA 4E3JA 1FOFA 2Y59A 4ZDXA 4O7DA 2XEPA 4E3KA 3ZG8B 4JKTA 4KZ6A 4QY5A 5A91A 1FR6A 5F1FA 3A3IA 4E3NA 5CGWA 1BSGA 1YLYA 2WK0A 3Q07A 4R3JA 1ZKJA 3QHYA 3V39A 4OP8A 4DRTA 5A90A 1LLBA 2OV5A 1YMXA 1BTLA 4MNRA 5GLBA 3OPPA 2WGWB 5FQKA 1K54C 1FCMA 4L0LA 4RYEA 5JYPA 2QPNA 4QU3A 5U47A 5DF8A 3CJMA 2UWXA 4WZ5C 3ZCZA 3DW0A 4XUXA 2E8IA 2P9VA 2HP9A 3IXBA 4KZ7A 4X68A 2VGJA 3HLEA 4KZAA 5GHYA 5JYOA 1ERQA 2H0YA 4QJGA 2IWBA 4U0XA 4Z9QA 1CK3A 2JBFA 1WE4A 5GLAA 1BZAA 4KZ5A 2EFXA 5A92A 1Z6FA 2BLSA 5E2HA 5KSHA 1MY8A 2V2FF 2X02A 3EQUA 3I7JA 5CTNA 1K6SA 4BJPA 3M2JA 1ES4A 4LV3A 5EECA 4X55A 4MBKA 4C75A 5HARA 3SS4A 5KSCA 1NZUA 1IKGA 4P0MA 4UA7A 4UA6A 4NETA 5EVLA 2ZJ9A 4Y0TA 1FR1A 4IBXA 4KZ9A 4OPRA 3IXHA 4UHUA 4OQIA 4E6XA 1L0EA 3ZG7B 3C7VA 3C4PA 1CEGA 1SDEA 2P9VB 1OMEA 3FKVA 3WRTA 2C6WB 4X53A 3GSGA 2J8YA 4EUZA 2H10A 1PZOA 2QZ6A 4YINA 1MXOA 1RCJA 3CG5A 4KENB 1L0DA 4IEDA 1MWUA 1HZOA 1LL9A 1FCOA 5AQ7A 1PWCA 3MFDA 3MKFA 3BFDA 5FA7A 2Y55A 2ZC5B 4B4ZA 4OQGA 2WADA 1M40A 1JTDA 3GV9A 3MZDA 4WMCA 1XPBA 3UPPA 2DRWA 4P87A 5FDHA 5I94A 2QMIA 3LEZA 1IYSA 1W7FA 3RXXA 5CERA 1XX2A 4S2OA 2Y2HA 5E2GA 1EROA 1PZPA 3UPNA 3CZDA 5GHZA 4B4XA 1XXMA 2WAFA 3HLWA 1Y54A 4N1XA 4E6WA 3UN7A 4WMCD 2BG1A 3NDEA 3IT9A 4OKPA 5E2FA 4RX3A 1E3UA 1MPLA 2JE5A 4JXWA 4OVDA 4KG5A 3N8SA 3O3VA 3O88A 4HBUA 3UDXA 2ZC4B 4BQMA 5FAOA 3S22A 2P74A 4S2LA 3VP4A 4GD8A 3NBLA 3GR2A 4E3MA 4ID4A 1BLHA 2EXBA 3PTEA 3AGDA 1KDSA 5CEBA 4PM8A 1SKFA 4R3BA 4NK3A 1KGGA 2WYXA 3RXWA 2I72A 1E3UD 2HP5A 3MKEA 3FKWA 4FH2A 5FQ9A 5DTTA 4ZJ1A 3BFEA 3WS5A 4B88A 4X69A 3AGFA 3A3EA 1IEMA 2WKEA 2ZQ7A 3G2ZA 4OONA 3TSGA 4QY6A 4XUZA 4M3KA 3VFHA 2G2UA 3P09A 4Y7PA 1AXBA 2PU2A 4EWFA 4QB8A 4GDBA 1N4OA 4EBPA 2HP6A 2A49A 1DJCA 5GHXA 4OOYA 3Q82A 4DE3A 1M6KA 2RL3A 1L2SA 3NIAA 3SH9A 5J8XA 2C5WB 1YLTA 1ZC2A 4LENA 4R4SA 1PW1A 4GOGA 3OCNA 1FSWA 1EWZA 3BEBA 4CJNA 1GHMA 3GMWA 2OLVA 2HPBA 3MZFA 4LV0A 5M19A 3UE0A 3UNWA 1IYPA 1YM1A 4PMAA 1K4EA 2WGVA 2Y4AA 4IVKA 4WZ4A 4KQRA 1MKIA 5FQJA 3V3SA 1K38A 3VMAA 1KE3A 4OOMA 3Q7VA 4EV4A 4IBRA 5AQBA 2EX6A 4CPKA 1K6RA 4DDYA 1VM1A 2EX8A 4N9LA 4ZAMA 1ES5A 3UY6A 5DTKA 1XKZA 4R4RA 3UDIA 1W5DA 4WEJA 2WZZA 2ZQAA 1YLZA 3PAEA 4LV2A 4R1GA 4R23A 3ZGAB 2X01A 1PW8A 2Y2NA 4OQHA 4S2NA 5F82A 3GRJA 3B3XA 4ZJ3A 2XD5A 2WKHA 5HFOA 4KQOA 3WS4A 3WS2A 4PM7A 4GNUA 4OPQA 4MBHA 3G35A 3NCKA 5E2EA 3OPRA 3IWQA 1CEFA 1KDWA 1YLWA 1QMFA 2ZM8A 5EVIC 1MBLA 2WUQA 4JPMA 2ZC3B 1E25A 1I2WA 3ZVWA 3BECA 3VP2A 1CI9A 3Q7VB 3UPOA 4N9KA 2ZM0A 4KZ4A 3RJUA 3NDGA 3HLGA 5DF7A 4GKUA 1TDGA 1H8YA 3M2KA 1C3BA 1XGIA 4BENA 2XGNA 3PBOA 2ZQDA 1K56A 3D4FA 5IHVA 3DWKA 2ZMAA 4N1HA 4X6TA 3BLSA 3SS5A 3HLFA 1L0FA 2HDUA 3TG9A 1NRFA 4C6YA 4N92A 5GLCA 3E2KA 3HL9A 1XA7A 4FCFA 4UA9A 5EOEA 1O07A 1U60A 5HAIA 2V20A 3PBQA 1ONHA 2ZQCA 3FV7A 4OH0A 5FI2A 5GLDA 1SCWA 4A5RA 1W8YA 1K56D 4JBFA 4JF6A 5DTSA 5FI6A 2J9OA 3O87A 1XGJA 2GDNA 1ES2A 3O86A 1MWTA 3ZG0A 3AGEA 4LCLA 1H8ZA 1W79A 3OPHA 4DXBA 1DJBA 1CI8A 2Y2JA 4S2PA 3QNBA 1IYQA 1G6AA 1W8QA 3PBNA 3LCEA 1FCNA 5FAPA 3IF5A 4S2NC 1MWSA 2CC1A 2IWCA 1BULA 2FFYA 3Q7ZA 4EBLA 1I2SA 1PYYA 2H5SA 1XA1A 4S2IA 5FSRA 1PWGA 4KG6A 5FAQA 1PI5A 4GZBA 4P85A 3W8KA 4E3OA 1K55A 2XF3A 3EQVA 4S2KA 3GQZA 4PPRA 4E3LA 4FSFA 3GTCA 2Z2LB 3MXRA 3ZDJA 4PM5A 4JXSA 4LV1A 1ZG4A 1N9BA 2XFTA 4EBNA 1RGYA 1I5QA 3FYZA 3ITBA 4OLGA 3P98A 2VGKA 3FZCA 3G30A 3N8LA 5KZHA 3S4XA 3SH7A 5EVIA 1YQSA 3GVBA 4DXCA 5CGSA 1PWDA 1FSYA 4OLDA 3VSKA 3WS0A 4OPZA 2Y91A 5M1AA 1J9MA 1JWPA 2H0TA 3V5MA 3HLCA 4E3IA 1YLJA 3A3FA 4BD0A 4WEKA 3BRMA 3OZHA 4UAAA 3BFFA 1BLSA 2HDQA 3VP3A 3G34A 1JVJA 4KZ3A 1GCEA 2ZQ8A 5G18A 3N8RA 3ZG5A 1K25A 5HX9A 1YT4A 5EVID 1FQGA 2DNSA 5CHUA 2ZLYA 1WYCA 4JXVA 2WAEA 4S2JA 3PAGA 4MBFA 2Y2OA 3HLDA 1S6RA 3MBZA 4HBTA 3DTMA 3C5AA 4S2MA 4DE2A 1KGFA 1PI4A 3N4IA 5EVIB 3WS1A 2Y2LA 3MZEA 1LHYA 1K57C 3OC2A 4BL2A 2A3UA 1BLPA 3JYIA 1S0WA 4OP5A 3OCLA 3PBSA 2Q9NA 4DE1A 1KGEA 4PM6A 3HVFA 3BLMA 4FD8A 4U3TA 1IKIA 5CRFA 1NYMA 2ZQ9A 1TVFA 4RA7A 1ALQA 5FASA 4GDNA 4KG2A 1O7EA 3IHAA 4ZTKA 3MXSA 3IXGA 2XH9A 5AQ9A 1NJ4A 3VFFA 4WELA 1NY0A 1Q2PA 2EX2A 3IH9A 3VOYA 4EQIA 4H8RA 3NY4A 1YMSA 1K55C 4YFMA 5CECA 2FFFB 4K91A 3NC8A 1ERMA 1ES3A 3E2LA 2Y2MA 3IF6A 5CTMA 3ZG9B 1JWVA 3ISGA 2XQZA 3Q1FA 4IVIA 5CGXA 2HDSA 1YLPA 3HLBA 2WKIA 1TEMA
chains in the Genus database with same CATH superfamily
1HTZA 4LCMA 3G32A 2OAQ1 1WYBA 4EETB 1ZG6A 3HREA 2X71A 5FDSA 5TR7A 5E43A 4QD4A 4HHDA 3L9KA 2Y2QA 3F1PB 3IQAA 2W3HA 3HUMA 2M7UA 2B95A 3C38A 2XDMA 2W1RA 3LYXA 4MLLA 1VEUB 5F1GA 3PBTA 3DWZA 2PT7A 1L0GA 2V1BA 3R4KA 1KE4A 2HDRA 5HW3A 1TDLA 2V0UA 1EI5A 1Y28A 2JCHA 3PBRA 1GA9A 1G28A 3IWOA 3T4TA 3PYPA 3C4OA 4GS9A 3IF6C 2Z6DA 4JLFA 2V1ZA 3G31A 3W4QA 3HUNA 2I9VA 2OLUA 1ESIA 3MXQA 1F9IA 3VP0A 3MQQA 1PNEA 3V67A 4R0QA 4CLCA 3BY9A 4WYYA 5DVAA 4OPYA 3TOIA 4HI4A 4X56A 3DBAA 4EEUA 3C30A 4QHCA 2ZL1A 1SHVA 2L4RA 5D3OA 4BBTA 4DDSA 1ONGA 2IWDA 3G6OA 5EPHA 1OT9A 1G5UA 4HOIA 4NKPA 1KE0A 3HJIA 3P01A 4GJ4A 1DY6A 1RGZA 1DJAA 3EOIA 3ZVTA 3DTEA 2M1CA 2J3TD 3Q81A 3UB9A 3OPLA 1PIOA 2XFSA 3ZFZA 3SH8A 3EWKA 4Q8IA 2Y59A 4ZDXA 4E3KA 3ZG8B 4JKTA 4KZ6A 3EGXC 3KO6A 3A3IA 5CGWA 1BSGA 3Q07A 4R3JA 1WA9A 4MNRA 5GLBA 3OPPA 4KUOA 3DW0A 4UQIM 3IXBA 4X68A 2VGJA 1ERQA 2H0YA 5DJTA 3BWLA 4X1LA 2PYRA 5A92A 1Z6FA 5E2HA 3CAXA 1MY8A 4PKYA 3I7JA 1K6SA 2HGVA 5EECA 3SS4A 1NZUA 2MJ6A 2FZ0A 4Y0TA 4IBXA 4UHUA 4E6XA 4R38A 1SDEA 3WRTA 3MS6A 2C6WB 3NOUC 3MFXA 4YINA 3CG5A 3LUQA 1LL9A 5F5YA 1PWCA 1XJ2A 5HD3A 5FA7A 1LL8A 2ZC5B 3KSFA 2DRWA 2KDKA 3H82A 2QJ5A 5E2GA 3UMDA 3CZDA 3NHQA 4WMCD 3IT9A 3VE4A 5FEGA 4KG5A 3N8SA 3O88A 4HBUA 4BQMA 5C5KA 4E3MA 1SKFA 1T19A 2GNXA 2WYXA 3RXWA 2I72A 3MKEA 3WS5A 1X0OA 1P97A 4B88A 4X69A 3TSGA 4XUZA 3VFHA 3MMHA 2HJ9C 3P09A 4Y7PA 2HP6A 1DJCA 3CUEA 5GHXA 4OOYA 3Q82A 3FPWA 1M6KA 2RL3A 1OTBA 1YLTA 1PW1A 4I39A 4MDZA 4NXGA 4NXBA 1IYPA 3FG8A 2WGVA 4IVKA 4WZ4A 4KQRA 1MKIA 3LI8A 5J7EA 4OOMA 3Q7VA 1OTEA 1K6RA 2EX8A 1XKZA 2ACGA 1W5DA 4WEJA 2ZOHA 2Y2NA 3GRJA 4ZJ3A 2L1MA 3LR4A 5J4EA 5E2EA 4MBHA 3MJQA 3NCKA 1T18A 2W27A 1YLWA 1QMFA 4P6ZS 4JPMA 2KLIA 4EERA 3NDGA 4Y15A 3NULA 4BENA 4BWIA 2ZQDA 3D4FA 2NUPC 1NRJA 3DWKA 4L9GA 2P04A 1NRFA 4C6YA 3KSGA 1S67L 3KSHA 4FCFA 1SKOB 5EOEA 1O07A 2ZMFA 3PBQA 2VEAA 3FV7A 1TS0A 5HWWA 2J9OA 4DMZA 4HJ3A 1XFNA 2M7VA 1W79A 4YOFA 2A24A 1OTIA 3LCEA 1P0ZA 3LI9A 1BULA 1I2SA 1XA1A 5FSRA 5FAQA 3LR0A 4GHIA 4GZBA 4RQ9A 3LR5A 4S2KA 3GTCA 2Z2LB 3ZDJA 4ZRRA 1ZG4A 3FYZA 3ITBA 3N8LA 4PKYG 5EVIA 3GVBA 3E4QA 3KYZA 4WEKA 4Y13A 3OZHA 5FEFA 1BLSA 2HDQA 3PXPA 3G34A 2W0NA 1FQGA 3T4QA 2ZLYA 5IS1A 2Y2OA 1UWPX 3MBZA 4HBTA 4JGPA 3N4IA 3LIBA 2A3UA 3ZQ5A 1S0WA 5L8MA 3DTKA 1KGEA 3CPTB 1NYMA 4LPZA 2O9AA 2W1TB 3IHAA 5G4ZA 3TW8A 5AQ9A 3VFFA 4WELA 3HJKA 1H0MA 3F1PA 3IH9A 1NWZA 4ARZB 1YMSA 5CECA 5EM0A 3E2LA 2Y2MA 5CTMA 3ZG9B 3ISGA 3Q1FA 2G7UA 4IVIA 4JGOA 2WKIA 1VEUA 5AQAA 2JKRM 1YSPA 1SDNA 3HUOA 4RX2A 4YNRA 1KVMA 3IHBA 4Z1WA 3HBRA 1P9WA 2XA7S 1KVLA 2VK3A 1YPRA 1Q2QA 3QNCA 3CMZA 4R70A 5EE8A 4KUKA 5HAQA 1J3WA 1LI9A 1QMEA 4Y0OA 2J7VA 3IWIA 1K57A 3ITAA 4Y5FA 1IELA 5M18A 5HD5A 1ACFA 2PRFA 2Y2GA 3MSHA 5F69A 3B47A 1OJGA 1VB6A 4P6BA 2Y2KA 4FH4A 1P9RA 3BYDA 2XROA 1S1YA 4P6ZM 2EFUA 1OTDA 4HH3A 4LLOB 4BLMA 3R7WB 4O8GA 2VGLM 2B5RA 1RP5A 3SW1A 5F68A 2XD1A 1BYWA 3N7WA 1F5MA 4PM9A 3G2YA 1K54A 3S7QA 2VJWA 4WN5A 4O0PA 4I3IA 2B02A 4WZ5A 2VZWA 1BUEA 3SS3A 2Q9MA 3C7UA 4NXEA 2JKRI 1H5XA 4X25A 4KZBA 3QP1A 4FTXA 2KOIA 3E4PA 3RTYA 3DAVA 1GSWA 1LI0A 3VOZA 3GDIA 3F1NB 4WUJA 5BOHA 3M6BA 3FPVA 1VHMA 2OWJA 3O5YA 3LO7A 5TFQA 4DKIA 1JTGA 3EEHA 4F94A 3SOIA 3W4PA 4HEFA 4DE0A 3UDFA 5TGFA 4QWOA 4HESA 3WRZA 5K5BA 1FOFA 2A2LA 4ETXA 3A0SA 5HZHA 2WK0A 1ZKJA 4OP8A 4DRTA 1FILA 3IS2B 1XJ6A 1K54C 1FCMA 4QU3A 2UWXA 4WZ5C 4NEED 1DP9A 1DP8A 3KYEA 2E8IA 5HDSA 1TS8A 4KZ7A 1HLUP 5JYOA 2IWBA 4U0XA 5J3WA 1D06A 2BLSA 2LB9A 3W2ZA 5HARA 4P0MA 5EVLA 4KZ9A 3IXHA 4OQIA 2P9VB 2W3EA 3QP4A 4X53A 1W63M 3GSGA 2PDRA 3BQ8A 1MXOA 1RCJA 4IEDA 1FCOA 4H6JB 4B4ZA 4OQGA 1OPXA 5L07A 5FDHA 5I94A 3LEZA 3IBRA 4I3AA 4GLQA 4B93A 3UPNA 2WKRA 2Y2HA 1S1ZA 1Y54A 4E6WA 2XA7M 3UN7A 1Z09A 5E2FA 4RX3A 1E3UA 4NG2A 4OVDA 4JXWA 2ZC4B 3CITA 4S2LA 4GD8A 1BLHA 2EXBA 3PTEA 3AGDA 1KDSA 5CEBA 4PM8A 2OAP1 3P7NA 4NK3A 3FKWA 2EWWA 3E0YA 4ZJ1A 2WKEA 3G2ZA 2NUTC 3SZTA 3VOLA 5J8XA 3NIAA 4MN5A 4LENA 4R4SA 3OCNA 1DRMA 2UV0E 3MZFA 2OLVA 5M19A 3UNWA 4PMAA 5FQJA 2DMWA 3VMAA 2O9BA 4HY8A 3T4SA 2HF6A 2FH5A 3QP5A 4EV4A 4CPKA 5AQBA 2EX6A 4FOFA 3BJNA 2ZMVA 3QP2A 1YLZA 4NXFA 1PW8A 5F82A 2PD8A 1D7EA 2XD5A 3LEQA 1SKOA 3WS2A 1CQAA 4PM7A 1YKDA 1KDWA 2Y79A 2WUQA 4XT2B 2VV8A 3D72A 3CWFA 3VP2A 2J3WA 2AVXA 3ICYA 3HLGA 1TDGA 3M2KA 1C3BA 3QP8A 1XGIA 1H8MA 5IHVA 4N1HA 3SS5A 3TG9A 1STZA 4UA9A 2O9CA 4OH0A 2PR5A 4PAUA 2WKQA 5GLDA 4O01A 1W8YA 5DTSA 1K56D 4LRZE 4X1MA 5FI6A 1XGJA 2YKHA 2W3FA 3OPHA 1GSXA 4DXBA 3NOPC 5CX7A 1G6AA 1W8QA 1XJ4A 2GX5A 1TS7A 5HWVA 3T1SA 4MCWA 3IF5A 2CC1A 4EXOA 3Q7ZA 1PYYA 4S2IA 1PWGA 4KG6A 1K55A 2XF3A 3EQVA 4E3LA 3GQZA 4PM5A 1RGYA 1I5QA 4OLGA 2JHEA 3FZCA 3DTIA 2VV6A 4LRXC 3MF0A 4DXCA 4L9FA 2W3GA 5M1AA 2PR6A 3HLCA 1YLJA 1EW0A 3CPTA 3VP3A 2QWSA 1JVJA 2W1TA 4LGWA 5HX9A 5TBMB 3NECA 4S2JA 4MBFA 4HJ6A 4ARZA 2HZ5A 1UGUA 3C5AA 3JPUA 4DE2A 1KGFA 1PI4A 1BLPA 3F1OB 4EUVA 3IBJA 4PM6A 3HVFA 3NOTC 2QJ7A 1T1CA 1CF0A 1ALQA 4KG2A 1N9NA 4ZTKA 3IXGA 3MR0A 1NY0A 4EQIA 5HPFA 1K55C 4K91A 3NC8A 1ERMA 1Y4OA 5CGXA 1YLPA 1TEMA 5A93A 3OBFA 2PBYA 5DJUA 2HV1A 1IOUA 4Q0HA 3BFCA 3VV4A 3LFVA 3LY3A 2VV7A 1ZTUA 3BM6A 1XP4A 4Y0UA 4JF4A 3B33A 5KMWA 4QPRA 3S7PA 4FUWA 5HAPA 1MZUA 3R7WA 1K4FA 2ZD8A 4G3WA 1GSVA 5F6AA 1IFQA 3RFBA 4RVAA 3ZNYA 3KX0X 3VSLA 4GCZA 2J9PA 2O99A 3UE1A 3VP1A 1G68A 5DFXA 4DF6A 4K0WA 1NYYA 2P08A 3UE3A 1N9LA 4WM9A 3WWXA 1NXYA 2ZC6B 3UB8A 3F1NA 4JGRA 4HNBA 1NLYA 2V8CA 4MEZA 2OSUA 3S1YA 3IXDA 5FQMA 4BD1A 3MQ0A 5L2FA 2BTFP 2IA2A 1HVBA 3FWLA 1TD5A 2RCXA 1JWZA 4CLCD 2Y2IA 4EESA 1BLCA 2R9WA 5EUAA 2JKGA 1LL5A 4ETZA 1VQQA 2XR0A 3BFGA 2G2WA 3ZHHA 5FQIA 4WBGA 2XLNA 2V9AA 1HD8A 3IS2A 5DF9A 3T4LA 4I38A 5CHMA 5FATA 4JF5A 2EX9A 4Y2FA 2ZC7A 4EQ1A 2L0WA 4O7DA 2OOLA 2XEPA 4QY5A 4Y3IA 1FR6A 3D9YA 1YLYA 4D60A 3QHYA 3V39A 5A90A 3IX8A 1H3QA 2CMNA 2WGWB 4L0LA 2QPNA 5U47A 5DF8A 3CJMA 2P9VA 2HP9A 4Y17A 4KZAA 2JBFA 1BZAA 4KZ5A 5KSHA 4G3VA 4M4XA 4PHTA 5DFYA 2J3TC 4H6JA 5CTNA 1ES4A 5IU1A 4X55A 1IKGA 2ZJ9A 1FR1A 4OPRA 1L0EA 5HDCA 4EU0A 1LSVA 2ZOIA 1CEGA 1OMEA 4EUZA 3NJAA 1AWIA 1HZOA 3MFDA 1FIKA 3MKFA 2VA0A 1DP6A 2Y55A 2WADA 1JTDA 3GV9A 4WMCA 4P87A 2INWA 1N9OA 2QMIA 1IYSA 1W7FA 4HP4A 1EROA 1PZPA 4ESPA 5GHZA 1XXMA 3HLWA 2BG1A 3NDEA 1V9YA 1MPLA 2JE5A 3O3VA 3H7WB 3S22A 3T4OA 2P74A 3VP4A 3GR2A 5EV0A 5TJJA 3ZYTA 4R3BA 1KGGA 5FQ9A 5DTTA 1LT0A 2QHKA 3A3EA 5HWTA 4QY6A 2K31A 4M3KA 3UB5P 2G2UA 1AXBA 4EWFA 4QB8A 4WF0A 2B18A 4EBPA 3QP6A 1YAXA 4DE3A 3SH9A 1L2SA 2C5WB 1ZC2A 1FSWA 1EWZA 1V9ZA 4LV0A 3LIEA 1YM1A 1VETB 1K4EA 2Y4AA 4HIAA 3RH8B 1K38A 4XT2A 2OWHA 2R78A 2WKPA 4DDYA 1VM1A 4N9LA 4ZAMA 2WZZA 3ZGAB 4R23A 4OQHA 2W3DA 1LSXA 3B3XA 5HFOA 3T4KA 3WS4A 4GNUA 4OPQA 3IWQA 4BMWA 1MBLA 3BQAA 1G6OA 1I2WA 3E4OA 4F3LB 3ZVWA 3BECA 4R3AA 4HH2A 4N9KA 2GJ3A 4KZ4A 4GKUA 3GECA 2XGNA 3PR6A 4X6TA 3BLSA 4EW7A 2LB5A 3E2KA 1XA7A 1PRQA 1U60A 1ONHA 5FI2A 1TF1A 4A5RA 4JF6A 5DKKA 5EVEA 3O87A 1ES2A 3O86A 3ZG0A 4LCLA 3KSIA 3FC7A 4IUHA 1DJBA 1CI8A 2Y2JA 4S2PA 1IYQA 1S66L 3T12B 3PBNA 1FCNA 1W63Q 3UB7A 5G4YA 1MWSA 2IWCA 2FFYA 2H5SA 3H9WA 3D3OA 3LR3A 1PI5A 4P85A 3W8KA 4E3OA 5MC7A 5TBMA 4PPRA 4FSFA 4LV1A 1N9BA 4IJGA 2VGKA 5KZHA 3K2NA 3ULFA 1FSYA 4OLDA 4OPZA 3F1OA 1J9MA 1JWPA 2H0TA 3V5MA 2JN7A 2Y8HA 2K2NA 3BFFA 4KZ3A 1GCEA 3ZG5A 2QYBA 3T1XA 4K08A 1YT4A 5EVID 1T1AA 1MKMA 2DNSA 1WYCA 4JXVA 2WAEA 1S6RA 5FL3A 3DTMA 4S2MA 3CHWP 3MZEA 3T4JA 1LHYA 2JKTM 4BL2A 4OP5A 3PBSA 5L09A 3BLMA 4FD8A 4U3TA 5CRFA 2D02A 2ZQ9A 4IHQA 4GDNA 1K0KA 1ZHHB 3MXSA 1LSWA 2XH9A 1NJ4A 1Q2PA 2PAVP 4YFMA 2HDSA 3HLBA 1GHPA 4ZJ2A 5HSQA 2Z2MB 2YKFA 4D2OA 4CLCC 3A3JA 1MWRA 3LGOA 2WGIA 4OQ0A 5CEDA 3E98A 3HCYA 3PHYA 3M6HA 1IYOA 1GA0A 3N6IA 5AVEA 4WL9A 3IF6B 4MN6A 3ZNTA 3LIAA 4ME4A 3T50A 3V50A 1NZOA 2PHYA 2VX8A 3MQOA 3A3DA 5GL9A 3LICA 3UB6A 1L3LA 2GZAA 2E8JA 4K0XA 3V3RA 3W4OA 2R9XA 1ESUA 1T1BA 5CXWA 3BY8A 1E4DA 4OOLA 2JKTI 5FQQA 3A0VA 2O0YA 1BT5A 4JXGA 5HL1A 3L7HA 4BL3A 5FI7A 5F83A 2DCFA 4L9EA 1MC0A 4JGQA 3LY4A 2PU4A 4KZ8A 2Y2PA 3JVVA 3TE8A 4CLCE 2ZBBA 4AFIA 3IH8A 3UO9A 4GS9B 2KX6A 3NI9A 5EOOA 1SZVA 2EXAA 3OLOA 4GD6A 4XXRA 4GB7A 4C3QA 4KQQA 5A8BA 4CLCB 4GN2A 4DJ2A 2ZM2A 2JC7A 1GHIA 3T1QB 1S4SA 3LIFA 4U0TA 4ZBEA 2XK1A 2WGWA 3G4PA 2WZXA 3B42A 3LIDA 2ZL1B 5CHJA 4E3JA 2BASA 4GW9A 5I5LA 5A91A 4MMNA 5F1FA 4E3NA 2EWVA 4YWZA 4LRYC 1D1JA 4EEPA 1LLBA 2OV5A 1YMXA 1BTLA 4B9OA 5EFWA 5FQKA 5JYPA 4RYEA 3ZCZA 4XUXA 1NLZA 4II7A 5AJGA 3HLEA 1S4RA 5GHYA 4DJ3A 4QJGA 4Z9QA 1CK3A 1WE4A 5GLAA 2EFXA 1YSQA 3EQUA 2V2FF 2X02A 3IX3A 4BJPA 3T1RA 2VGLS 3M2JA 4LV3A 4Q0JA 4MBKA 4C75A 5KSCA 2Z6CA 4UA7A 4UA6A 4NETA 5EM1A 3CUEC 3ZG7B 3UE6A 3C7VA 3C4PA 3FKVA 2J8YA 2H10A 1PZOA 2QZ6A 1KOUA 4KENB 1L0DA 3JVUA 1MWUA 1TS6A 3U4LP 5AQ7A 3H7WA 3BFDA 1M40A 3MZDA 3UPPA 1XPBA 3RXXA 5CERA 1F98A 4IUKA 1XX2A 4S2OA 4HJ4A 3K3DA 4B4XA 5IT5A 2WAFA 4N1XA 3UMEA 4OKPA 4LFUA 3UDXA 4MN7A 5FAOA 3NBLA 4ID4A 1XJ3A 2PYPA 3H82B 1VETA 1E3UD 2HP5A 4FH2A 3BFEA 5HL6A 3AGFA 2D01A 1IEMA 2VKSA 2ZQ7A 4OONA 2V1AA 3C8CA 3S7OA 3C2WA 2PU2A 2P7JA 4GDBA 1N4OA 2A49A 2V8FA 1OJ5A 1UWNX 3VE3A 3K3CA 4GOGA 3BEBA 4R6LA 4CJNA 3TRCA 1GHMA 3GMWA 2HPBA 3UE0A 2XSSA 4I3JA 3V3SA 2XRNA 4F3LA 1KE3A 2JKFA 4CQHA 4IBRA 3U2AA 1ES5A 3UY6A 5DTKA 4R4RA 5L10A 3UDIA 2V0WA 2ZQAA 1PFLA 3PAEA 4LV2A 4R1GA 2X01A 4S2NA 2Q0OA 2WKHA 5DKLA 4KQOA 4Q0IA 3S7NA 5AVFA 3G35A 3OPRA 5KIZA 1CEFA 2ZM8A 5EVIC 2ZC3B 1E25A 1CI9A 3Q7VB 3UPOA 3RJUA 2ZM0A 5DF7A 1H8YA 3IX4A 4KQDA 1XFQA 3PBOA 1K56A 2ZMAA 2K7SA 3HLFA 1L0FA 2HDUA 4N92A 5GLCA 5HDDA 3HL9A 1OT6A 5HAIA 2V20A 4BBUA 2ZQCA 3BW6A 1SCWA 1F2KA 1CJFA 5LBRA 4JBFA 2GDNA 2PD7A 1MWTA 5HPIA 3AGEA 1H8ZA 2H28A 4G3KA 3OOVA 2VLGA 3QNBA 2HJEA 4DN0A 4BBVA 4HQAA 5FAPA 4S2NC 4EBLA 1OTAA 3MXRA 4JXSA 2EA9A 2XFTA 4EBNA 3A0RA 3CI6A 3P98A 3G30A 3S4XA 3SH7A 1YQSA 4UEYA 5CGSA 1PWDA 3CLOA 3VSKA 3WS0A 2Y91A 4WLAA 2A24B 4E3IA 3A3FA 4BD0A 3BRMA 4UAAA 2J80A 4HP9A 2ZQ8A 5G18A 3N8RA 1K25A 3TJZC 4GHIB 5CHUA 1ODVA 3PAGA 3HLDA 4UQIS 2PBDP 5EVIB 2QKPA 3WS1A 2Y2LA 3EGDC 1K57C 3OC2A 3JYIA 3OCLA 2Q9NA 4DE1A 1JNUA 1IKIA 3EEAA 1TVFA 4RA7A 5FASA 1O7EA 4E04A 3KYQA 2EX2A 1A0KA 3VOYA 4H8RA 3NY4A 2FFFB 1ES3A 3IF6A 1JWVA 2XQZA 4I5SA
chains in the Genus database with same CATH topology
1HTZA 5AQAA 5A93A 4LCMA 3G32A 2Z2MB 1SDNA 3HUOA 4RX2A 2PBYA 4D2OA 1WYBA 1KVMA 1ZG6A 3A3JA 3HREA 3IHBA 1MWRA 3BFCA 2WGIA 2X71A 5TR7A 4OQ0A 5E43A 3HBRA 4QD4A 3LY3A 5CEDA 2Y2QA 3IQAA 3M6HA 1IYOA 3BM6A 1GA0A 1XP4A 1KVLA 3HUMA 3N6IA 4Y0UA 4JF4A 1Q2QA 3IF6B 5KMWA 3ZNTA 3V50A 5HAPA 3QNCA 2XDMA 4MLLA 1NZOA 3CMZA 1K4FA 5EE8A 3PBTA 5F1GA 2ZD8A 3DWZA 5HAQA 3A3DA 1L0GA 1LI9A 5GL9A 1KE4A 1QMEA 4Y0OA 2J7VA 1GHPA 3IWIA 2HDRA 1K57A 3ITAA 5HW3A 1IELA 1TDLA 5M18A 1EI5A 4RVAA 4K0XA 2Y2GA 3V3RA 3ZNYA 3W4OA 2R9XA 1ESUA 2JCHA 3PBRA 1GA9A 1E4DA 5CXWA 3VSLA 3IWOA 4OOLA 4P6BA 2Y2KA 4FH4A 3BYDA 5FQQA 2EFUA 2J9PA 3UE1A 3VP1A 3C4OA 4BLMA 3IF6C 1G68A 4DF6A 1BT5A 4JLFA 4JXGA 2V1ZA 3G31A 5HL1A 2B5RA 4K0WA 5FI7A 3W4QA 5F83A 4BL3A 1RP5A 2DCFA 1NYYA 3HUNA 2OLUA 1ESIA 3UE3A 2XD1A 4WM9A 3WWXA 1NXYA 3VP0A 2ZC6B 3N7WA 4R0QA 3LY4A 2PU4A 4KZ8A 4PM9A 4MEZA 2Y2PA 3G2YA 2OSUA 3S1YA 4WYYA 1K54A 5DVAA 3IXDA 4OPYA 3TOIA 5FQMA 4WZ5A 4BD1A 1BUEA 3IH8A 3SS3A 4X56A 5L2FA 1HVBA 2Q9MA 3FWLA 3UO9A 3C7UA 4ZJ2A 1H5XA 1JWZA 2RCXA 4KZBA 4QHCA 3NI9A 5EOOA 1SHVA 2EXAA 2Y2IA 5D3OA 4GD6A 4DDSA 1LI0A 1ONGA 1BLCA 2R9WA 5EUAA 2IWDA 3VOZA 1LL5A 4XXRA 4GB7A 5EPHA 1VQQA 4C3QA 4KQQA 5BOHA 2XR0A 3BFGA 3M6BA 2G2WA 3ZHHA 4GN2A 5FQIA 4WBGA 2XLNA 1KE0A 2ZM2A 2JC7A 1DY6A 1GHIA 1HD8A 1RGZA 3LO7A 4U0TA 4ZBEA 5TFQA 1DJAA 2XK1A 4DKIA 1JTGA 2WGWA 3G4PA 3ZVTA 4F94A 2WZXA 5DF9A 3SOIA 3W4PA 4HEFA 3Q81A 5CHMA 5FATA 3OPLA 5TGFA 4JF5A 1PIOA 3UDFA 4DE0A 2XFSA 2EX9A 3SH8A 3ZFZA 4Q8IA 2ZC7A 5CHJA 4HESA 3WRZA 4E3JA 1FOFA 2Y59A 4ZDXA 4O7DA 2XEPA 4E3KA 3ZG8B 4JKTA 4KZ6A 4QY5A 5A91A 1FR6A 5F1FA 3A3IA 4E3NA 5CGWA 1BSGA 1YLYA 2WK0A 3Q07A 4R3JA 1ZKJA 3QHYA 3V39A 4OP8A 4DRTA 5A90A 1LLBA 2OV5A 1YMXA 1BTLA 4MNRA 5GLBA 3OPPA 2WGWB 5FQKA 1K54C 1FCMA 4L0LA 4RYEA 5JYPA 2QPNA 4QU3A 5U47A 5DF8A 3CJMA 2UWXA 4WZ5C 3ZCZA 3DW0A 4XUXA 2E8IA 2P9VA 2HP9A 3IXBA 4KZ7A 4X68A 2VGJA 3HLEA 4KZAA 5GHYA 5JYOA 1ERQA 2H0YA 4QJGA 2IWBA 4U0XA 4Z9QA 1CK3A 2JBFA 1WE4A 5GLAA 1BZAA 4KZ5A 2EFXA 5A92A 1Z6FA 2BLSA 5E2HA 5KSHA 1MY8A 2V2FF 2X02A 3EQUA 3I7JA 5CTNA 1K6SA 4BJPA 3M2JA 1ES4A 4LV3A 5EECA 4X55A 4MBKA 4C75A 5HARA 3SS4A 5KSCA 1NZUA 1IKGA 4P0MA 4UA7A 4UA6A 4NETA 5EVLA 2ZJ9A 4Y0TA 1FR1A 4IBXA 4KZ9A 4OPRA 3IXHA 4UHUA 4OQIA 4E6XA 1L0EA 3ZG7B 3C7VA 3C4PA 1CEGA 1SDEA 2P9VB 1OMEA 3FKVA 3WRTA 2C6WB 4X53A 3GSGA 2J8YA 4EUZA 2H10A 1PZOA 2QZ6A 4YINA 1MXOA 1RCJA 3CG5A 4KENB 1L0DA 4IEDA 1MWUA 1HZOA 1LL9A 1FCOA 5AQ7A 1PWCA 3MFDA 3MKFA 3BFDA 5FA7A 2Y55A 2ZC5B 4B4ZA 4OQGA 2WADA 1M40A 1JTDA 3GV9A 3MZDA 4WMCA 1XPBA 3UPPA 2DRWA 4P87A 5FDHA 5I94A 2QMIA 3LEZA 1IYSA 1W7FA 3RXXA 5CERA 1XX2A 4S2OA 2Y2HA 5E2GA 1EROA 1PZPA 3UPNA 3CZDA 5GHZA 4B4XA 1XXMA 2WAFA 3HLWA 1Y54A 4N1XA 4E6WA 3UN7A 4WMCD 2BG1A 3NDEA 3IT9A 4OKPA 5E2FA 4RX3A 1E3UA 1MPLA 2JE5A 4JXWA 4OVDA 4KG5A 3N8SA 3O3VA 3O88A 4HBUA 3UDXA 2ZC4B 4BQMA 5FAOA 3S22A 2P74A 4S2LA 3VP4A 4GD8A 3NBLA 3GR2A 4E3MA 4ID4A 1BLHA 2EXBA 3PTEA 3AGDA 1KDSA 5CEBA 4PM8A 1SKFA 4R3BA 4NK3A 1KGGA 2WYXA 3RXWA 2I72A 1E3UD 2HP5A 3MKEA 3FKWA 4FH2A 5FQ9A 5DTTA 4ZJ1A 3BFEA 3WS5A 4B88A 4X69A 3AGFA 3A3EA 1IEMA 2WKEA 2ZQ7A 3G2ZA 4OONA 3TSGA 4QY6A 4XUZA 4M3KA 3VFHA 2G2UA 3P09A 4Y7PA 1AXBA 2PU2A 4EWFA 4QB8A 4GDBA 1N4OA 4EBPA 2HP6A 2A49A 1DJCA 5GHXA 4OOYA 3Q82A 4DE3A 1M6KA 2RL3A 1L2SA 3NIAA 3SH9A 5J8XA 2C5WB 1YLTA 1ZC2A 4LENA 4R4SA 1PW1A 4GOGA 3OCNA 1FSWA 1EWZA 3BEBA 4CJNA 1GHMA 3GMWA 2OLVA 2HPBA 3MZFA 4LV0A 5M19A 3UE0A 3UNWA 1IYPA 1YM1A 4PMAA 1K4EA 2WGVA 2Y4AA 4IVKA 4WZ4A 4KQRA 1MKIA 5FQJA 3V3SA 1K38A 3VMAA 1KE3A 4OOMA 3Q7VA 4EV4A 4IBRA 5AQBA 2EX6A 4CPKA 1K6RA 4DDYA 1VM1A 2EX8A 4N9LA 4ZAMA 1ES5A 3UY6A 5DTKA 1XKZA 4R4RA 3UDIA 1W5DA 4WEJA 2WZZA 2ZQAA 1YLZA 3PAEA 4LV2A 4R1GA 4R23A 3ZGAB 2X01A 1PW8A 2Y2NA 4OQHA 4S2NA 5F82A 3GRJA 3B3XA 4ZJ3A 2XD5A 2WKHA 5HFOA 4KQOA 3WS4A 3WS2A 4PM7A 4GNUA 4OPQA 4MBHA 3G35A 3NCKA 5E2EA 3OPRA 3IWQA 1CEFA 1KDWA 1YLWA 1QMFA 2ZM8A 5EVIC 1MBLA 2WUQA 4JPMA 2ZC3B 1E25A 1I2WA 3ZVWA 3BECA 3VP2A 1CI9A 3Q7VB 3UPOA 4N9KA 2ZM0A 4KZ4A 3RJUA 3NDGA 3HLGA 5DF7A 4GKUA 1TDGA 1H8YA 3M2KA 1C3BA 1XGIA 4BENA 2XGNA 3PBOA 2ZQDA 1K56A 3D4FA 5IHVA 3DWKA 2ZMAA 4N1HA 4X6TA 3BLSA 3SS5A 3HLFA 1L0FA 2HDUA 3TG9A 1NRFA 4C6YA 4N92A 5GLCA 3E2KA 3HL9A 1XA7A 4FCFA 4UA9A 5EOEA 1O07A 1U60A 5HAIA 2V20A 3PBQA 1ONHA 2ZQCA 3FV7A 4OH0A 5FI2A 5GLDA 1SCWA 4A5RA 1W8YA 1K56D 4JBFA 4JF6A 5DTSA 5FI6A 2J9OA 3O87A 1XGJA 2GDNA 1ES2A 3O86A 1MWTA 3ZG0A 3AGEA 4LCLA 1H8ZA 1W79A 3OPHA 4DXBA 1DJBA 1CI8A 2Y2JA 4S2PA 3QNBA 1IYQA 1G6AA 1W8QA 3PBNA 3LCEA 1FCNA 5FAPA 3IF5A 4S2NC 1MWSA 2CC1A 2IWCA 1BULA 2FFYA 3Q7ZA 4EBLA 1I2SA 1PYYA 2H5SA 1XA1A 4S2IA 5FSRA 1PWGA 4KG6A 5FAQA 1PI5A 4GZBA 4P85A 3W8KA 4E3OA 1K55A 2XF3A 3EQVA 4S2KA 3GQZA 4PPRA 4E3LA 4FSFA 3GTCA 2Z2LB 3MXRA 3ZDJA 4PM5A 4JXSA 4LV1A 1ZG4A 1N9BA 2XFTA 4EBNA 1RGYA 1I5QA 3FYZA 3ITBA 4OLGA 3P98A 2VGKA 3FZCA 3G30A 3N8LA 5KZHA 3S4XA 3SH7A 5EVIA 1YQSA 3GVBA 4DXCA 5CGSA 1PWDA 1FSYA 4OLDA 3VSKA 3WS0A 4OPZA 2Y91A 5M1AA 1J9MA 1JWPA 2H0TA 3V5MA 3HLCA 4E3IA 1YLJA 3A3FA 4BD0A 4WEKA 3BRMA 3OZHA 4UAAA 3BFFA 1BLSA 2HDQA 3VP3A 3G34A 1JVJA 4KZ3A 1GCEA 2ZQ8A 5G18A 3N8RA 3ZG5A 1K25A 5HX9A 1YT4A 5EVID 1FQGA 2DNSA 5CHUA 2ZLYA 1WYCA 4JXVA 2WAEA 4S2JA 3PAGA 4MBFA 2Y2OA 3HLDA 1S6RA 3MBZA 4HBTA 3DTMA 3C5AA 4S2MA 4DE2A 1KGFA 1PI4A 3N4IA 5EVIB 3WS1A 2Y2LA 3MZEA 1LHYA 1K57C 3OC2A 4BL2A 2A3UA 1BLPA 3JYIA 1S0WA 4OP5A 3OCLA 3PBSA 2Q9NA 4DE1A 1KGEA 4PM6A 3HVFA 3BLMA 4FD8A 4U3TA 1IKIA 5CRFA 1NYMA 2ZQ9A 1TVFA 4RA7A 1ALQA 5FASA 4GDNA 4KG2A 1O7EA 3IHAA 4ZTKA 3MXSA 3IXGA 2XH9A 5AQ9A 1NJ4A 3VFFA 4WELA 1NY0A 1Q2PA 2EX2A 3IH9A 3VOYA 4EQIA 4H8RA 3NY4A 1YMSA 1K55C 4YFMA 5CECA 2FFFB 4K91A 3NC8A 1ERMA 1ES3A 3E2LA 2Y2MA 3IF6A 5CTMA 3ZG9B 1JWVA 3ISGA 2XQZA 3Q1FA 4IVIA 5CGXA 2HDSA 1YLPA 3HLBA 2WKIA 1TEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTZ A;  5AQA A;  5A93 A;  4LCM A;  3G32 A;  2Z2M B;  1SDN A;  3HUO A;  4RX2 A;  2PBY A;  4D2O A;  1WYB A;  1KVM A;  1ZG6 A;  3A3J A;  3HRE A;  3IHB A;  1MWR A;  3BFC A;  2WGI A;  2X71 A;  5TR7 A;  4OQ0 A;  5E43 A;  3HBR A;  4QD4 A;  3LY3 A;  5CED A;  2Y2Q A;  3IQA A;  3M6H A;  1IYO A;  3BM6 A;  1GA0 A;  1XP4 A;  1KVL A;  3HUM A;  3N6I A;  4Y0U A;  4JF4 A;  1Q2Q A;  3IF6 B;  5KMW A;  3ZNT A;  3V50 A;  5HAP A;  3QNC A;  2XDM A;  4MLL A;  1NZO A;  3CMZ A;  1K4F A;  5EE8 A;  3PBT A;  5F1G A;  2ZD8 A;  3DWZ A;  5HAQ A;  3A3D A;  1L0G A;  1LI9 A;  5GL9 A;  1KE4 A;  1QME A;  4Y0O A;  2J7V A;  1GHP A;  3IWI A;  2HDR A;  1K57 A;  3ITA A;  5HW3 A;  1IEL A;  1TDL A;  5M18 A;  1EI5 A;  4RVA A;  4K0X A;  2Y2G A;  3V3R A;  3ZNY A;  3W4O A;  2R9X A;  1ESU A;  2JCH A;  3PBR A;  1GA9 A;  1E4D A;  5CXW A;  3VSL A;  3IWO A;  4OOL A;  4P6B A;  2Y2K A;  4FH4 A;  3BYD A;  5FQQ A;  2EFU A;  2J9P A;  3UE1 A;  3VP1 A;  3C4O A;  4BLM A;  3IF6 C;  1G68 A;  4DF6 A;  1BT5 A;  4JLF A;  4JXG A;  2V1Z A;  3G31 A;  5HL1 A;  2B5R A;  4K0W A;  5FI7 A;  3W4Q A;  5F83 A;  4BL3 A;  1RP5 A;  2DCF A;  1NYY A;  3HUN A;  2OLU A;  1ESI A;  3UE3 A;  2XD1 A;  4WM9 A;  3WWX A;  1NXY A;  3VP0 A;  2ZC6 B;  3N7W A;  4R0Q A;  3LY4 A;  2PU4 A;  4KZ8 A;  4PM9 A;  4MEZ A;  2Y2P A;  3G2Y A;  2OSU A;  3S1Y A;  4WYY A;  1K54 A;  5DVA A;  3IXD A;  4OPY A;  3TOI A;  5FQM A;  4WZ5 A;  4BD1 A;  1BUE A;  3IH8 A;  3SS3 A;  4X56 A;  5L2F A;  1HVB A;  2Q9M A;  3FWL A;  3UO9 A;  3C7U A;  4ZJ2 A;  1H5X A;  1JWZ A;  2RCX A;  4KZB A;  4QHC A;  3NI9 A;  5EOO A;  1SHV A;  2EXA A;  2Y2I A;  5D3O A;  4GD6 A;  4DDS A;  1LI0 A;  1ONG A;  1BLC A;  2R9W A;  5EUA A;  2IWD A;  3VOZ A;  1LL5 A;  4XXR A;  4GB7 A;  5EPH A;  1VQQ A;  4C3Q A;  4KQQ A;  5BOH A;  2XR0 A;  3BFG A;  3M6B A;  2G2W A;  3ZHH A;  4GN2 A;  5FQI A;  4WBG A;  2XLN A;  1KE0 A;  2ZM2 A;  2JC7 A;  1DY6 A;  1GHI A;  1HD8 A;  1RGZ A;  3LO7 A;  4U0T A;  4ZBE A;  5TFQ A;  1DJA A;  2XK1 A;  4DKI A;  1JTG A;  2WGW A;  3G4P A;  3ZVT A;  4F94 A;  2WZX A;  5DF9 A;  3SOI A;  3W4P A;  4HEF A;  3Q81 A;  5CHM A;  5FAT A;  3OPL A;  5TGF A;  4JF5 A;  1PIO A;  3UDF A;  4DE0 A;  2XFS A;  2EX9 A;  3SH8 A;  3ZFZ A;  4Q8I A;  2ZC7 A;  5CHJ A;  4HES A;  3WRZ A;  4E3J A;  1FOF A;  2Y59 A;  4ZDX A;  4O7D A;  2XEP A;  4E3K A;  3ZG8 B;  4JKT A;  4KZ6 A;  4QY5 A;  5A91 A;  1FR6 A;  5F1F A;  3A3I A;  4E3N A;  5CGW A;  1BSG A;  1YLY A;  2WK0 A;  3Q07 A;  4R3J A;  1ZKJ A;  3QHY A;  3V39 A;  4OP8 A;  4DRT A;  5A90 A;  1LLB A;  2OV5 A;  1YMX A;  1BTL A;  4MNR A;  5GLB A;  3OPP A;  2WGW B;  5FQK A;  1K54 C;  1FCM A;  4L0L A;  4RYE A;  5JYP A;  2QPN A;  4QU3 A;  5U47 A;  5DF8 A;  3CJM A;  2UWX A;  4WZ5 C;  3ZCZ A;  3DW0 A;  4XUX A;  2E8I A;  2P9V A;  2HP9 A;  3IXB A;  4KZ7 A;  4X68 A;  2VGJ A;  3HLE A;  4KZA A;  5GHY A;  5JYO A;  1ERQ A;  2H0Y A;  4QJG A;  2IWB A;  4U0X A;  4Z9Q A;  1CK3 A;  2JBF A;  1WE4 A;  5GLA A;  1BZA A;  4KZ5 A;  2EFX A;  5A92 A;  1Z6F A;  2BLS A;  5E2H A;  5KSH A;  1MY8 A;  2V2F F;  2X02 A;  3EQU A;  3I7J A;  5CTN A;  1K6S A;  4BJP A;  3M2J A;  1ES4 A;  4LV3 A;  5EEC A;  4X55 A;  4MBK A;  4C75 A;  5HAR A;  3SS4 A;  5KSC A;  1NZU A;  1IKG A;  4P0M A;  4UA7 A;  4UA6 A;  4NET A;  5EVL A;  2ZJ9 A;  4Y0T A;  1FR1 A;  4IBX A;  4KZ9 A;  4OPR A;  3IXH A;  4UHU A;  4OQI A;  4E6X A;  1L0E A;  3ZG7 B;  3C7V A;  3C4P A;  1CEG A;  1SDE A;  2P9V B;  1OME A;  3FKV A;  3WRT A;  2C6W B;  4X53 A;  3GSG A;  2J8Y A;  4EUZ A;  2H10 A;  1PZO A;  2QZ6 A;  4YIN A;  1MXO A;  1RCJ A;  3CG5 A;  4KEN B;  1L0D A;  4IED A;  1MWU A;  1HZO A;  1LL9 A;  1FCO A;  5AQ7 A;  1PWC A;  3MFD A;  3MKF A;  3BFD A;  5FA7 A;  2Y55 A;  2ZC5 B;  4B4Z A;  4OQG A;  2WAD A;  1M40 A;  1JTD A;  3GV9 A;  3MZD A;  4WMC A;  1XPB A;  3UPP A;  2DRW A;  4P87 A;  5FDH A;  5I94 A;  2QMI A;  3LEZ A;  1IYS A;  1W7F A;  3RXX A;  5CER A;  1XX2 A;  4S2O A;  2Y2H A;  5E2G A;  1ERO A;  1PZP A;  3UPN A;  3CZD A;  5GHZ A;  4B4X A;  1XXM A;  2WAF A;  3HLW A;  1Y54 A;  4N1X A;  4E6W A;  3UN7 A;  4WMC D;  2BG1 A;  3NDE A;  3IT9 A;  4OKP A;  5E2F A;  4RX3 A;  1E3U A;  1MPL A;  2JE5 A;  4JXW A;  4OVD A;  4KG5 A;  3N8S A;  3O3V A;  3O88 A;  4HBU A;  3UDX A;  2ZC4 B;  4BQM A;  5FAO A;  3S22 A;  2P74 A;  4S2L A;  3VP4 A;  4GD8 A;  3NBL A;  3GR2 A;  4E3M A;  4ID4 A;  1BLH A;  2EXB A;  3PTE A;  3AGD A;  1KDS A;  5CEB A;  4PM8 A;  1SKF A;  4R3B A;  4NK3 A;  1KGG A;  2WYX A;  3RXW A;  2I72 A;  1E3U D;  2HP5 A;  3MKE A;  3FKW A;  4FH2 A;  5FQ9 A;  5DTT A;  4ZJ1 A;  3BFE A;  3WS5 A;  4B88 A;  4X69 A;  3AGF A;  3A3E A;  1IEM A;  2WKE A;  2ZQ7 A;  3G2Z A;  4OON A;  3TSG A;  4QY6 A;  4XUZ A;  4M3K A;  3VFH A;  2G2U A;  3P09 A;  4Y7P A;  1AXB A;  2PU2 A;  4EWF A;  4QB8 A;  4GDB A;  1N4O A;  4EBP A;  2HP6 A;  2A49 A;  1DJC A;  5GHX A;  4OOY A;  3Q82 A;  4DE3 A;  1M6K A;  2RL3 A;  1L2S A;  3NIA A;  3SH9 A;  5J8X A;  2C5W B;  1YLT A;  1ZC2 A;  4LEN A;  4R4S A;  1PW1 A;  4GOG A;  3OCN A;  1FSW A;  1EWZ A;  3BEB A;  4CJN A;  1GHM A;  3GMW A;  2OLV A;  2HPB A;  3MZF A;  4LV0 A;  5M19 A;  3UE0 A;  3UNW A;  1IYP A;  1YM1 A;  4PMA A;  1K4E A;  2WGV A;  2Y4A A;  4IVK A;  4WZ4 A;  4KQR A;  1MKI A;  5FQJ A;  3V3S A;  1K38 A;  3VMA A;  1KE3 A;  4OOM A;  3Q7V A;  4EV4 A;  4IBR A;  5AQB A;  2EX6 A;  4CPK A;  1K6R A;  4DDY A;  1VM1 A;  2EX8 A;  4N9L A;  4ZAM A;  1ES5 A;  3UY6 A;  5DTK A;  1XKZ A;  4R4R A;  3UDI A;  1W5D A;  4WEJ A;  2WZZ A;  2ZQA A;  1YLZ A;  3PAE A;  4LV2 A;  4R1G A;  4R23 A;  3ZGA B;  2X01 A;  1PW8 A;  2Y2N A;  4OQH A;  4S2N A;  5F82 A;  3GRJ A;  3B3X A;  4ZJ3 A;  2XD5 A;  2WKH A;  5HFO A;  4KQO A;  3WS4 A;  3WS2 A;  4PM7 A;  4GNU A;  4OPQ A;  4MBH A;  3G35 A;  3NCK A;  5E2E A;  3OPR A;  3IWQ A;  1CEF A;  1KDW A;  1YLW A;  1QMF A;  2ZM8 A;  5EVI C;  1MBL A;  2WUQ A;  4JPM A;  2ZC3 B;  1E25 A;  1I2W A;  3ZVW A;  3BEC A;  3VP2 A;  1CI9 A;  3Q7V B;  3UPO A;  4N9K A;  2ZM0 A;  4KZ4 A;  3RJU A;  3NDG A;  3HLG A;  5DF7 A;  4GKU A;  1TDG A;  1H8Y A;  3M2K A;  1C3B A;  1XGI A;  4BEN A;  2XGN A;  3PBO A;  2ZQD A;  1K56 A;  3D4F A;  5IHV A;  3DWK A;  2ZMA A;  4N1H A;  4X6T A;  3BLS A;  3SS5 A;  3HLF A;  1L0F A;  2HDU A;  3TG9 A;  1NRF A;  4C6Y A;  4N92 A;  5GLC A;  3E2K A;  3HL9 A;  1XA7 A;  4FCF A;  4UA9 A;  5EOE A;  1O07 A;  1U60 A;  5HAI A;  2V20 A;  3PBQ A;  1ONH A;  2ZQC A;  3FV7 A;  4OH0 A;  5FI2 A;  5GLD A;  1SCW A;  4A5R A;  1W8Y A;  1K56 D;  4JBF A;  4JF6 A;  5DTS A;  5FI6 A;  2J9O A;  3O87 A;  1XGJ A;  2GDN A;  1ES2 A;  3O86 A;  1MWT A;  3ZG0 A;  3AGE A;  4LCL A;  1H8Z A;  1W79 A;  3OPH A;  4DXB A;  1DJB A;  1CI8 A;  2Y2J A;  4S2P A;  3QNB A;  1IYQ A;  1G6A A;  1W8Q A;  3PBN A;  3LCE A;  1FCN A;  5FAP A;  3IF5 A;  4S2N C;  1MWS A;  2CC1 A;  2IWC A;  1BUL A;  2FFY A;  3Q7Z A;  4EBL A;  1I2S A;  1PYY A;  2H5S A;  1XA1 A;  4S2I A;  5FSR A;  1PWG A;  4KG6 A;  5FAQ A;  1PI5 A;  4GZB A;  4P85 A;  3W8K A;  4E3O A;  1K55 A;  2XF3 A;  3EQV A;  4S2K A;  3GQZ A;  4PPR A;  4E3L A;  4FSF A;  3GTC A;  2Z2L B;  3MXR A;  3ZDJ A;  4PM5 A;  4JXS A;  4LV1 A;  1ZG4 A;  1N9B A;  2XFT A;  4EBN A;  1RGY A;  1I5Q A;  3FYZ A;  3ITB A;  4OLG A;  3P98 A;  2VGK A;  3FZC A;  3G30 A;  3N8L A;  5KZH A;  3S4X A;  3SH7 A;  5EVI A;  1YQS A;  3GVB A;  4DXC A;  5CGS A;  1PWD A;  1FSY A;  4OLD A;  3VSK A;  3WS0 A;  4OPZ A;  2Y91 A;  5M1A A;  1J9M A;  1JWP A;  2H0T A;  3V5M A;  3HLC A;  4E3I A;  1YLJ A;  3A3F A;  4BD0 A;  4WEK A;  3BRM A;  3OZH A;  4UAA A;  3BFF A;  1BLS A;  2HDQ A;  3VP3 A;  3G34 A;  1JVJ A;  4KZ3 A;  1GCE A;  2ZQ8 A;  5G18 A;  3N8R A;  3ZG5 A;  1K25 A;  5HX9 A;  1YT4 A;  5EVI D;  1FQG A;  2DNS A;  5CHU A;  2ZLY A;  1WYC A;  4JXV A;  2WAE A;  4S2J A;  3PAG A;  4MBF A;  2Y2O A;  3HLD A;  1S6R A;  3MBZ A;  4HBT A;  3DTM A;  3C5A A;  4S2M A;  4DE2 A;  1KGF A;  1PI4 A;  3N4I A;  5EVI B;  3WS1 A;  2Y2L A;  3MZE A;  1LHY A;  1K57 C;  3OC2 A;  4BL2 A;  2A3U A;  1BLP A;  3JYI A;  1S0W A;  4OP5 A;  3OCL A;  3PBS A;  2Q9N A;  4DE1 A;  1KGE A;  4PM6 A;  3HVF A;  3BLM A;  4FD8 A;  4U3T A;  1IKI A;  5CRF A;  1NYM A;  2ZQ9 A;  1TVF A;  4RA7 A;  1ALQ A;  5FAS A;  4GDN A;  4KG2 A;  1O7E A;  3IHA A;  4ZTK A;  3MXS A;  3IXG A;  2XH9 A;  5AQ9 A;  1NJ4 A;  3VFF A;  4WEL A;  1NY0 A;  1Q2P A;  2EX2 A;  3IH9 A;  3VOY A;  4EQI A;  4H8R A;  3NY4 A;  1YMS A;  1K55 C;  4YFM A;  5CEC A;  2FFF B;  4K91 A;  3NC8 A;  1ERM A;  1ES3 A;  3E2L A;  2Y2M A;  3IF6 A;  5CTM A;  3ZG9 B;  1JWV A;  3ISG A;  2XQZ A;  3Q1F A;  4IVI A;  5CGX A;  2HDS A;  1YLP A;  3HLB A;  2WKI A;  1TEM A; 
#chains in the Genus database with same CATH topology
 1HTZ A;  4LCM A;  3G32 A;  2OAQ 1;  1WYB A;  4EET B;  1ZG6 A;  3HRE A;  2X71 A;  5FDS A;  5TR7 A;  5E43 A;  4QD4 A;  4HHD A;  3L9K A;  2Y2Q A;  3F1P B;  3IQA A;  2W3H A;  3HUM A;  2M7U A;  2B95 A;  3C38 A;  2XDM A;  2W1R A;  3LYX A;  4MLL A;  1VEU B;  5F1G A;  3PBT A;  3DWZ A;  2PT7 A;  1L0G A;  2V1B A;  3R4K A;  1KE4 A;  2HDR A;  5HW3 A;  1TDL A;  2V0U A;  1EI5 A;  1Y28 A;  2JCH A;  3PBR A;  1GA9 A;  1G28 A;  3IWO A;  3T4T A;  3PYP A;  3C4O A;  4GS9 A;  3IF6 C;  2Z6D A;  4JLF A;  2V1Z A;  3G31 A;  3W4Q A;  3HUN A;  2I9V A;  2OLU A;  1ESI A;  3MXQ A;  1F9I A;  3VP0 A;  3MQQ A;  1PNE A;  3V67 A;  4R0Q A;  4CLC A;  3BY9 A;  4WYY A;  5DVA A;  4OPY A;  3TOI A;  4HI4 A;  4X56 A;  3DBA A;  4EEU A;  3C30 A;  4QHC A;  2ZL1 A;  1SHV A;  2L4R A;  5D3O A;  4BBT A;  4DDS A;  1ONG A;  2IWD A;  3G6O A;  5EPH A;  1OT9 A;  1G5U A;  4HOI A;  4NKP A;  1KE0 A;  3HJI A;  3P01 A;  4GJ4 A;  1DY6 A;  1RGZ A;  1DJA A;  3EOI A;  3ZVT A;  3DTE A;  2M1C A;  2J3T D;  3Q81 A;  3UB9 A;  3OPL A;  1PIO A;  2XFS A;  3ZFZ A;  3SH8 A;  3EWK A;  4Q8I A;  2Y59 A;  4ZDX A;  4E3K A;  3ZG8 B;  4JKT A;  4KZ6 A;  3EGX C;  3KO6 A;  3A3I A;  5CGW A;  1BSG A;  3Q07 A;  4R3J A;  1WA9 A;  4MNR A;  5GLB A;  3OPP A;  4KUO A;  3DW0 A;  4UQI M;  3IXB A;  4X68 A;  2VGJ A;  1ERQ A;  2H0Y A;  5DJT A;  3BWL A;  4X1L A;  2PYR A;  5A92 A;  1Z6F A;  5E2H A;  3CAX A;  1MY8 A;  4PKY A;  3I7J A;  1K6S A;  2HGV A;  5EEC A;  3SS4 A;  1NZU A;  2MJ6 A;  2FZ0 A;  4Y0T A;  4IBX A;  4UHU A;  4E6X A;  4R38 A;  1SDE A;  3WRT A;  3MS6 A;  2C6W B;  3NOU C;  3MFX A;  4YIN A;  3CG5 A;  3LUQ A;  1LL9 A;  5F5Y A;  1PWC A;  1XJ2 A;  5HD3 A;  5FA7 A;  1LL8 A;  2ZC5 B;  3KSF A;  2DRW A;  2KDK A;  3H82 A;  2QJ5 A;  5E2G A;  3UMD A;  3CZD A;  3NHQ A;  4WMC D;  3IT9 A;  3VE4 A;  5FEG A;  4KG5 A;  3N8S A;  3O88 A;  4HBU A;  4BQM A;  5C5K A;  4E3M A;  1SKF A;  1T19 A;  2GNX A;  2WYX A;  3RXW A;  2I72 A;  3MKE A;  3WS5 A;  1X0O A;  1P97 A;  4B88 A;  4X69 A;  3TSG A;  4XUZ A;  3VFH A;  3MMH A;  2HJ9 C;  3P09 A;  4Y7P A;  2HP6 A;  1DJC A;  3CUE A;  5GHX A;  4OOY A;  3Q82 A;  3FPW A;  1M6K A;  2RL3 A;  1OTB A;  1YLT A;  1PW1 A;  4I39 A;  4MDZ A;  4NXG A;  4NXB A;  1IYP A;  3FG8 A;  2WGV A;  4IVK A;  4WZ4 A;  4KQR A;  1MKI A;  3LI8 A;  5J7E A;  4OOM A;  3Q7V A;  1OTE A;  1K6R A;  2EX8 A;  1XKZ A;  2ACG A;  1W5D A;  4WEJ A;  2ZOH A;  2Y2N A;  3GRJ A;  4ZJ3 A;  2L1M A;  3LR4 A;  5J4E A;  5E2E A;  4MBH A;  3MJQ A;  3NCK A;  1T18 A;  2W27 A;  1YLW A;  1QMF A;  4P6Z S;  4JPM A;  2KLI A;  4EER A;  3NDG A;  4Y15 A;  3NUL A;  4BEN A;  4BWI A;  2ZQD A;  3D4F A;  2NUP C;  1NRJ A;  3DWK A;  4L9G A;  2P04 A;  1NRF A;  4C6Y A;  3KSG A;  1S67 L;  3KSH A;  4FCF A;  1SKO B;  5EOE A;  1O07 A;  2ZMF A;  3PBQ A;  2VEA A;  3FV7 A;  1TS0 A;  5HWW A;  2J9O A;  4DMZ A;  4HJ3 A;  1XFN A;  2M7V A;  1W79 A;  4YOF A;  2A24 A;  1OTI A;  3LCE A;  1P0Z A;  3LI9 A;  1BUL A;  1I2S A;  1XA1 A;  5FSR A;  5FAQ A;  3LR0 A;  4GHI A;  4GZB A;  4RQ9 A;  3LR5 A;  4S2K A;  3GTC A;  2Z2L B;  3ZDJ A;  4ZRR A;  1ZG4 A;  3FYZ A;  3ITB A;  3N8L A;  4PKY G;  5EVI A;  3GVB A;  3E4Q A;  3KYZ A;  4WEK A;  4Y13 A;  3OZH A;  5FEF A;  1BLS A;  2HDQ A;  3PXP A;  3G34 A;  2W0N A;  1FQG A;  3T4Q A;  2ZLY A;  5IS1 A;  2Y2O A;  1UWP X;  3MBZ A;  4HBT A;  4JGP A;  3N4I A;  3LIB A;  2A3U A;  3ZQ5 A;  1S0W A;  5L8M A;  3DTK A;  1KGE A;  3CPT B;  1NYM A;  4LPZ A;  2O9A A;  2W1T B;  3IHA A;  5G4Z A;  3TW8 A;  5AQ9 A;  3VFF A;  4WEL A;  3HJK A;  1H0M A;  3F1P A;  3IH9 A;  1NWZ A;  4ARZ B;  1YMS A;  5CEC A;  5EM0 A;  3E2L A;  2Y2M A;  5CTM A;  3ZG9 B;  3ISG A;  3Q1F A;  2G7U A;  4IVI A;  4JGO A;  2WKI A;  1VEU A;  5AQA A;  2JKR M;  1YSP A;  1SDN A;  3HUO A;  4RX2 A;  4YNR A;  1KVM A;  3IHB A;  4Z1W A;  3HBR A;  1P9W A;  2XA7 S;  1KVL A;  2VK3 A;  1YPR A;  1Q2Q A;  3QNC A;  3CMZ A;  4R70 A;  5EE8 A;  4KUK A;  5HAQ A;  1J3W A;  1LI9 A;  1QME A;  4Y0O A;  2J7V A;  3IWI A;  1K57 A;  3ITA A;  4Y5F A;  1IEL A;  5M18 A;  5HD5 A;  1ACF A;  2PRF A;  2Y2G A;  3MSH A;  5F69 A;  3B47 A;  1OJG A;  1VB6 A;  4P6B A;  2Y2K A;  4FH4 A;  1P9R A;  3BYD A;  2XRO A;  1S1Y A;  4P6Z M;  2EFU A;  1OTD A;  4HH3 A;  4LLO B;  4BLM A;  3R7W B;  4O8G A;  2VGL M;  2B5R A;  1RP5 A;  3SW1 A;  5F68 A;  2XD1 A;  1BYW A;  3N7W A;  1F5M A;  4PM9 A;  3G2Y A;  1K54 A;  3S7Q A;  2VJW A;  4WN5 A;  4O0P A;  4I3I A;  2B02 A;  4WZ5 A;  2VZW A;  1BUE A;  3SS3 A;  2Q9M A;  3C7U A;  4NXE A;  2JKR I;  1H5X A;  4X25 A;  4KZB A;  3QP1 A;  4FTX A;  2KOI A;  3E4P A;  3RTY A;  3DAV A;  1GSW A;  1LI0 A;  3VOZ A;  3GDI A;  3F1N B;  4WUJ A;  5BOH A;  3M6B A;  3FPV A;  1VHM A;  2OWJ A;  3O5Y A;  3LO7 A;  5TFQ A;  4DKI A;  1JTG A;  3EEH A;  4F94 A;  3SOI A;  3W4P A;  4HEF A;  4DE0 A;  3UDF A;  5TGF A;  4QWO A;  4HES A;  3WRZ A;  5K5B A;  1FOF A;  2A2L A;  4ETX A;  3A0S A;  5HZH A;  2WK0 A;  1ZKJ A;  4OP8 A;  4DRT A;  1FIL A;  3IS2 B;  1XJ6 A;  1K54 C;  1FCM A;  4QU3 A;  2UWX A;  4WZ5 C;  4NEE D;  1DP9 A;  1DP8 A;  3KYE A;  2E8I A;  5HDS A;  1TS8 A;  4KZ7 A;  1HLU P;  5JYO A;  2IWB A;  4U0X A;  5J3W A;  1D06 A;  2BLS A;  2LB9 A;  3W2Z A;  5HAR A;  4P0M A;  5EVL A;  4KZ9 A;  3IXH A;  4OQI A;  2P9V B;  2W3E A;  3QP4 A;  4X53 A;  1W63 M;  3GSG A;  2PDR A;  3BQ8 A;  1MXO A;  1RCJ A;  4IED A;  1FCO A;  4H6J B;  4B4Z A;  4OQG A;  1OPX A;  5L07 A;  5FDH A;  5I94 A;  3LEZ A;  3IBR A;  4I3A A;  4GLQ A;  4B93 A;  3UPN A;  2WKR A;  2Y2H A;  1S1Z A;  1Y54 A;  4E6W A;  2XA7 M;  3UN7 A;  1Z09 A;  5E2F A;  4RX3 A;  1E3U A;  4NG2 A;  4OVD A;  4JXW A;  2ZC4 B;  3CIT A;  4S2L A;  4GD8 A;  1BLH A;  2EXB A;  3PTE A;  3AGD A;  1KDS A;  5CEB A;  4PM8 A;  2OAP 1;  3P7N A;  4NK3 A;  3FKW A;  2EWW A;  3E0Y A;  4ZJ1 A;  2WKE A;  3G2Z A;  2NUT C;  3SZT A;  3VOL A;  5J8X A;  3NIA A;  4MN5 A;  4LEN A;  4R4S A;  3OCN A;  1DRM A;  2UV0 E;  3MZF A;  2OLV A;  5M19 A;  3UNW A;  4PMA A;  5FQJ A;  2DMW A;  3VMA A;  2O9B A;  4HY8 A;  3T4S A;  2HF6 A;  2FH5 A;  3QP5 A;  4EV4 A;  4CPK A;  5AQB A;  2EX6 A;  4FOF A;  3BJN A;  2ZMV A;  3QP2 A;  1YLZ A;  4NXF A;  1PW8 A;  5F82 A;  2PD8 A;  1D7E A;  2XD5 A;  3LEQ A;  1SKO A;  3WS2 A;  1CQA A;  4PM7 A;  1YKD A;  1KDW A;  2Y79 A;  2WUQ A;  4XT2 B;  2VV8 A;  3D72 A;  3CWF A;  3VP2 A;  2J3W A;  2AVX A;  3ICY A;  3HLG A;  1TDG A;  3M2K A;  1C3B A;  3QP8 A;  1XGI A;  1H8M A;  5IHV A;  4N1H A;  3SS5 A;  3TG9 A;  1STZ A;  4UA9 A;  2O9C A;  4OH0 A;  2PR5 A;  4PAU A;  2WKQ A;  5GLD A;  4O01 A;  1W8Y A;  5DTS A;  1K56 D;  4LRZ E;  4X1M A;  5FI6 A;  1XGJ A;  2YKH A;  2W3F A;  3OPH A;  1GSX A;  4DXB A;  3NOP C;  5CX7 A;  1G6A A;  1W8Q A;  1XJ4 A;  2GX5 A;  1TS7 A;  5HWV A;  3T1S A;  4MCW A;  3IF5 A;  2CC1 A;  4EXO A;  3Q7Z A;  1PYY A;  4S2I A;  1PWG A;  4KG6 A;  1K55 A;  2XF3 A;  3EQV A;  4E3L A;  3GQZ A;  4PM5 A;  1RGY A;  1I5Q A;  4OLG A;  2JHE A;  3FZC A;  3DTI A;  2VV6 A;  4LRX C;  3MF0 A;  4DXC A;  4L9F A;  2W3G A;  5M1A A;  2PR6 A;  3HLC A;  1YLJ A;  1EW0 A;  3CPT A;  3VP3 A;  2QWS A;  1JVJ A;  2W1T A;  4LGW A;  5HX9 A;  5TBM B;  3NEC A;  4S2J A;  4MBF A;  4HJ6 A;  4ARZ A;  2HZ5 A;  1UGU A;  3C5A A;  3JPU A;  4DE2 A;  1KGF A;  1PI4 A;  1BLP A;  3F1O B;  4EUV A;  3IBJ A;  4PM6 A;  3HVF A;  3NOT C;  2QJ7 A;  1T1C A;  1CF0 A;  1ALQ A;  4KG2 A;  1N9N A;  4ZTK A;  3IXG A;  3MR0 A;  1NY0 A;  4EQI A;  5HPF A;  1K55 C;  4K91 A;  3NC8 A;  1ERM A;  1Y4O A;  5CGX A;  1YLP A;  1TEM A;  5A93 A;  3OBF A;  2PBY A;  5DJU A;  2HV1 A;  1IOU A;  4Q0H A;  3BFC A;  3VV4 A;  3LFV A;  3LY3 A;  2VV7 A;  1ZTU A;  3BM6 A;  1XP4 A;  4Y0U A;  4JF4 A;  3B33 A;  5KMW A;  4QPR A;  3S7P A;  4FUW A;  5HAP A;  1MZU A;  3R7W A;  1K4F A;  2ZD8 A;  4G3W A;  1GSV A;  5F6A A;  1IFQ A;  3RFB A;  4RVA A;  3ZNY A;  3KX0 X;  3VSL A;  4GCZ A;  2J9P A;  2O99 A;  3UE1 A;  3VP1 A;  1G68 A;  5DFX A;  4DF6 A;  4K0W A;  1NYY A;  2P08 A;  3UE3 A;  1N9L A;  4WM9 A;  3WWX A;  1NXY A;  2ZC6 B;  3UB8 A;  3F1N A;  4JGR A;  4HNB A;  1NLY A;  2V8C A;  4MEZ A;  2OSU A;  3S1Y A;  3IXD A;  5FQM A;  4BD1 A;  3MQ0 A;  5L2F A;  2BTF P;  2IA2 A;  1HVB A;  3FWL A;  1TD5 A;  2RCX A;  1JWZ A;  4CLC D;  2Y2I A;  4EES A;  1BLC A;  2R9W A;  5EUA A;  2JKG A;  1LL5 A;  4ETZ A;  1VQQ A;  2XR0 A;  3BFG A;  2G2W A;  3ZHH A;  5FQI A;  4WBG A;  2XLN A;  2V9A A;  1HD8 A;  3IS2 A;  5DF9 A;  3T4L A;  4I38 A;  5CHM A;  5FAT A;  4JF5 A;  2EX9 A;  4Y2F A;  2ZC7 A;  4EQ1 A;  2L0W A;  4O7D A;  2OOL A;  2XEP A;  4QY5 A;  4Y3I A;  1FR6 A;  3D9Y A;  1YLY A;  4D60 A;  3QHY A;  3V39 A;  5A90 A;  3IX8 A;  1H3Q A;  2CMN A;  2WGW B;  4L0L A;  2QPN A;  5U47 A;  5DF8 A;  3CJM A;  2P9V A;  2HP9 A;  4Y17 A;  4KZA A;  2JBF A;  1BZA A;  4KZ5 A;  5KSH A;  4G3V A;  4M4X A;  4PHT A;  5DFY A;  2J3T C;  4H6J A;  5CTN A;  1ES4 A;  5IU1 A;  4X55 A;  1IKG A;  2ZJ9 A;  1FR1 A;  4OPR A;  1L0E A;  5HDC A;  4EU0 A;  1LSV A;  2ZOI A;  1CEG A;  1OME A;  4EUZ A;  3NJA A;  1AWI A;  1HZO A;  3MFD A;  1FIK A;  3MKF A;  2VA0 A;  1DP6 A;  2Y55 A;  2WAD A;  1JTD A;  3GV9 A;  4WMC A;  4P87 A;  2INW A;  1N9O A;  2QMI A;  1IYS A;  1W7F A;  4HP4 A;  1ERO A;  1PZP A;  4ESP A;  5GHZ A;  1XXM A;  3HLW A;  2BG1 A;  3NDE A;  1V9Y A;  1MPL A;  2JE5 A;  3O3V A;  3H7W B;  3S22 A;  3T4O A;  2P74 A;  3VP4 A;  3GR2 A;  5EV0 A;  5TJJ A;  3ZYT A;  4R3B A;  1KGG A;  5FQ9 A;  5DTT A;  1LT0 A;  2QHK A;  3A3E A;  5HWT A;  4QY6 A;  2K31 A;  4M3K A;  3UB5 P;  2G2U A;  1AXB A;  4EWF A;  4QB8 A;  4WF0 A;  2B18 A;  4EBP A;  3QP6 A;  1YAX A;  4DE3 A;  3SH9 A;  1L2S A;  2C5W B;  1ZC2 A;  1FSW A;  1EWZ A;  1V9Z A;  4LV0 A;  3LIE A;  1YM1 A;  1VET B;  1K4E A;  2Y4A A;  4HIA A;  3RH8 B;  1K38 A;  4XT2 A;  2OWH A;  2R78 A;  2WKP A;  4DDY A;  1VM1 A;  4N9L A;  4ZAM A;  2WZZ A;  3ZGA B;  4R23 A;  4OQH A;  2W3D A;  1LSX A;  3B3X A;  5HFO A;  3T4K A;  3WS4 A;  4GNU A;  4OPQ A;  3IWQ A;  4BMW A;  1MBL A;  3BQA A;  1G6O A;  1I2W A;  3E4O A;  4F3L B;  3ZVW A;  3BEC A;  4R3A A;  4HH2 A;  4N9K A;  2GJ3 A;  4KZ4 A;  4GKU A;  3GEC A;  2XGN A;  3PR6 A;  4X6T A;  3BLS A;  4EW7 A;  2LB5 A;  3E2K A;  1XA7 A;  1PRQ A;  1U60 A;  1ONH A;  5FI2 A;  1TF1 A;  4A5R A;  4JF6 A;  5DKK A;  5EVE A;  3O87 A;  1ES2 A;  3O86 A;  3ZG0 A;  4LCL A;  3KSI A;  3FC7 A;  4IUH A;  1DJB A;  1CI8 A;  2Y2J A;  4S2P A;  1IYQ A;  1S66 L;  3T12 B;  3PBN A;  1FCN A;  1W63 Q;  3UB7 A;  5G4Y A;  1MWS A;  2IWC A;  2FFY A;  2H5S A;  3H9W A;  3D3O A;  3LR3 A;  1PI5 A;  4P85 A;  3W8K A;  4E3O A;  5MC7 A;  5TBM A;  4PPR A;  4FSF A;  4LV1 A;  1N9B A;  4IJG A;  2VGK A;  5KZH A;  3K2N A;  3ULF A;  1FSY A;  4OLD A;  4OPZ A;  3F1O A;  1J9M A;  1JWP A;  2H0T A;  3V5M A;  2JN7 A;  2Y8H A;  2K2N A;  3BFF A;  4KZ3 A;  1GCE A;  3ZG5 A;  2QYB A;  3T1X A;  4K08 A;  1YT4 A;  5EVI D;  1T1A A;  1MKM A;  2DNS A;  1WYC A;  4JXV A;  2WAE A;  1S6R A;  5FL3 A;  3DTM A;  4S2M A;  3CHW P;  3MZE A;  3T4J A;  1LHY A;  2JKT M;  4BL2 A;  4OP5 A;  3PBS A;  5L09 A;  3BLM A;  4FD8 A;  4U3T A;  5CRF A;  2D02 A;  2ZQ9 A;  4IHQ A;  4GDN A;  1K0K A;  1ZHH B;  3MXS A;  1LSW A;  2XH9 A;  1NJ4 A;  1Q2P A;  2PAV P;  4YFM A;  2HDS A;  3HLB A;  1GHP A;  4ZJ2 A;  5HSQ A;  2Z2M B;  2YKF A;  4D2O A;  4CLC C;  3A3J A;  1MWR A;  3LGO A;  2WGI A;  4OQ0 A;  5CED A;  3E98 A;  3HCY A;  3PHY A;  3M6H A;  1IYO A;  1GA0 A;  3N6I A;  5AVE A;  4WL9 A;  3IF6 B;  4MN6 A;  3ZNT A;  3LIA A;  4ME4 A;  3T50 A;  3V50 A;  1NZO A;  2PHY A;  2VX8 A;  3MQO A;  3A3D A;  5GL9 A;  3LIC A;  3UB6 A;  1L3L A;  2GZA A;  2E8J A;  4K0X A;  3V3R A;  3W4O A;  2R9X A;  1ESU A;  1T1B A;  5CXW A;  3BY8 A;  1E4D A;  4OOL A;  2JKT I;  5FQQ A;  3A0V A;  2O0Y A;  1BT5 A;  4JXG A;  5HL1 A;  3L7H A;  4BL3 A;  5FI7 A;  5F83 A;  2DCF A;  4L9E A;  1MC0 A;  4JGQ A;  3LY4 A;  2PU4 A;  4KZ8 A;  2Y2P A;  3JVV A;  3TE8 A;  4CLC E;  2ZBB A;  4AFI A;  3IH8 A;  3UO9 A;  4GS9 B;  2KX6 A;  3NI9 A;  5EOO A;  1SZV A;  2EXA A;  3OLO A;  4GD6 A;  4XXR A;  4GB7 A;  4C3Q A;  4KQQ A;  5A8B A;  4CLC B;  4GN2 A;  4DJ2 A;  2ZM2 A;  2JC7 A;  1GHI A;  3T1Q B;  1S4S A;  3LIF A;  4U0T A;  4ZBE A;  2XK1 A;  2WGW A;  3G4P A;  2WZX A;  3B42 A;  3LID A;  2ZL1 B;  5CHJ A;  4E3J A;  2BAS A;  4GW9 A;  5I5L A;  5A91 A;  4MMN A;  5F1F A;  4E3N A;  2EWV A;  4YWZ A;  4LRY C;  1D1J A;  4EEP A;  1LLB A;  2OV5 A;  1YMX A;  1BTL A;  4B9O A;  5EFW A;  5FQK A;  5JYP A;  4RYE A;  3ZCZ A;  4XUX A;  1NLZ A;  4II7 A;  5AJG A;  3HLE A;  1S4R A;  5GHY A;  4DJ3 A;  4QJG A;  4Z9Q A;  1CK3 A;  1WE4 A;  5GLA A;  2EFX A;  1YSQ A;  3EQU A;  2V2F F;  2X02 A;  3IX3 A;  4BJP A;  3T1R A;  2VGL S;  3M2J A;  4LV3 A;  4Q0J A;  4MBK A;  4C75 A;  5KSC A;  2Z6C A;  4UA7 A;  4UA6 A;  4NET A;  5EM1 A;  3CUE C;  3ZG7 B;  3UE6 A;  3C7V A;  3C4P A;  3FKV A;  2J8Y A;  2H10 A;  1PZO A;  2QZ6 A;  1KOU A;  4KEN B;  1L0D A;  3JVU A;  1MWU A;  1TS6 A;  3U4L P;  5AQ7 A;  3H7W A;  3BFD A;  1M40 A;  3MZD A;  3UPP A;  1XPB A;  3RXX A;  5CER A;  1F98 A;  4IUK A;  1XX2 A;  4S2O A;  4HJ4 A;  3K3D A;  4B4X A;  5IT5 A;  2WAF A;  4N1X A;  3UME A;  4OKP A;  4LFU A;  3UDX A;  4MN7 A;  5FAO A;  3NBL A;  4ID4 A;  1XJ3 A;  2PYP A;  3H82 B;  1VET A;  1E3U D;  2HP5 A;  4FH2 A;  3BFE A;  5HL6 A;  3AGF A;  2D01 A;  1IEM A;  2VKS A;  2ZQ7 A;  4OON A;  2V1A A;  3C8C A;  3S7O A;  3C2W A;  2PU2 A;  2P7J A;  4GDB A;  1N4O A;  2A49 A;  2V8F A;  1OJ5 A;  1UWN X;  3VE3 A;  3K3C A;  4GOG A;  3BEB A;  4R6L A;  4CJN A;  3TRC A;  1GHM A;  3GMW A;  2HPB A;  3UE0 A;  2XSS A;  4I3J A;  3V3S A;  2XRN A;  4F3L A;  1KE3 A;  2JKF A;  4CQH A;  4IBR A;  3U2A A;  1ES5 A;  3UY6 A;  5DTK A;  4R4R A;  5L10 A;  3UDI A;  2V0W A;  2ZQA A;  1PFL A;  3PAE A;  4LV2 A;  4R1G A;  2X01 A;  4S2N A;  2Q0O A;  2WKH A;  5DKL A;  4KQO A;  4Q0I A;  3S7N A;  5AVF A;  3G35 A;  3OPR A;  5KIZ A;  1CEF A;  2ZM8 A;  5EVI C;  2ZC3 B;  1E25 A;  1CI9 A;  3Q7V B;  3UPO A;  3RJU A;  2ZM0 A;  5DF7 A;  1H8Y A;  3IX4 A;  4KQD A;  1XFQ A;  3PBO A;  1K56 A;  2ZMA A;  2K7S A;  3HLF A;  1L0F A;  2HDU A;  4N92 A;  5GLC A;  5HDD A;  3HL9 A;  1OT6 A;  5HAI A;  2V20 A;  4BBU A;  2ZQC A;  3BW6 A;  1SCW A;  1F2K A;  1CJF A;  5LBR A;  4JBF A;  2GDN A;  2PD7 A;  1MWT A;  5HPI A;  3AGE A;  1H8Z A;  2H28 A;  4G3K A;  3OOV A;  2VLG A;  3QNB A;  2HJE A;  4DN0 A;  4BBV A;  4HQA A;  5FAP A;  4S2N C;  4EBL A;  1OTA A;  3MXR A;  4JXS A;  2EA9 A;  2XFT A;  4EBN A;  3A0R A;  3CI6 A;  3P98 A;  3G30 A;  3S4X A;  3SH7 A;  1YQS A;  4UEY A;  5CGS A;  1PWD A;  3CLO A;  3VSK A;  3WS0 A;  2Y91 A;  4WLA A;  2A24 B;  4E3I A;  3A3F A;  4BD0 A;  3BRM A;  4UAA A;  2J80 A;  4HP9 A;  2ZQ8 A;  5G18 A;  3N8R A;  1K25 A;  3TJZ C;  4GHI B;  5CHU A;  1ODV A;  3PAG A;  3HLD A;  4UQI S;  2PBD P;  5EVI B;  2QKP A;  3WS1 A;  2Y2L A;  3EGD C;  1K57 C;  3OC2 A;  3JYI A;  3OCL A;  2Q9N A;  4DE1 A;  1JNU A;  1IKI A;  3EEA A;  1TVF A;  4RA7 A;  5FAS A;  1O7E A;  4E04 A;  3KYQ A;  2EX2 A;  1A0K A;  3VOY A;  4H8R A;  3NY4 A;  2FFF B;  1ES3 A;  3IF6 A;  1JWV A;  2XQZ A;  4I5S A; 
#chains in the Genus database with same CATH homology
 1HTZ A;  5AQA A;  5A93 A;  4LCM A;  3G32 A;  2Z2M B;  1SDN A;  3HUO A;  4RX2 A;  2PBY A;  4D2O A;  1WYB A;  1KVM A;  1ZG6 A;  3A3J A;  3HRE A;  3IHB A;  1MWR A;  3BFC A;  2WGI A;  2X71 A;  5TR7 A;  4OQ0 A;  5E43 A;  3HBR A;  4QD4 A;  3LY3 A;  5CED A;  2Y2Q A;  3IQA A;  3M6H A;  1IYO A;  3BM6 A;  1GA0 A;  1XP4 A;  1KVL A;  3HUM A;  3N6I A;  4Y0U A;  4JF4 A;  1Q2Q A;  3IF6 B;  5KMW A;  3ZNT A;  3V50 A;  5HAP A;  3QNC A;  2XDM A;  4MLL A;  1NZO A;  3CMZ A;  1K4F A;  5EE8 A;  3PBT A;  5F1G A;  2ZD8 A;  3DWZ A;  5HAQ A;  3A3D A;  1L0G A;  1LI9 A;  5GL9 A;  1KE4 A;  1QME A;  4Y0O A;  2J7V A;  1GHP A;  3IWI A;  2HDR A;  1K57 A;  3ITA A;  5HW3 A;  1IEL A;  1TDL A;  5M18 A;  1EI5 A;  4RVA A;  4K0X A;  2Y2G A;  3V3R A;  3ZNY A;  3W4O A;  2R9X A;  1ESU A;  2JCH A;  3PBR A;  1GA9 A;  1E4D A;  5CXW A;  3VSL A;  3IWO A;  4OOL A;  4P6B A;  2Y2K A;  4FH4 A;  3BYD A;  5FQQ A;  2EFU A;  2J9P A;  3UE1 A;  3VP1 A;  3C4O A;  4BLM A;  3IF6 C;  1G68 A;  4DF6 A;  1BT5 A;  4JLF A;  4JXG A;  2V1Z A;  3G31 A;  5HL1 A;  2B5R A;  4K0W A;  5FI7 A;  3W4Q A;  5F83 A;  4BL3 A;  1RP5 A;  2DCF A;  1NYY A;  3HUN A;  2OLU A;  1ESI A;  3UE3 A;  2XD1 A;  4WM9 A;  3WWX A;  1NXY A;  3VP0 A;  2ZC6 B;  3N7W A;  4R0Q A;  3LY4 A;  2PU4 A;  4KZ8 A;  4PM9 A;  4MEZ A;  2Y2P A;  3G2Y A;  2OSU A;  3S1Y A;  4WYY A;  1K54 A;  5DVA A;  3IXD A;  4OPY A;  3TOI A;  5FQM A;  4WZ5 A;  4BD1 A;  1BUE A;  3IH8 A;  3SS3 A;  4X56 A;  5L2F A;  1HVB A;  2Q9M A;  3FWL A;  3UO9 A;  3C7U A;  4ZJ2 A;  1H5X A;  1JWZ A;  2RCX A;  4KZB A;  4QHC A;  3NI9 A;  5EOO A;  1SHV A;  2EXA A;  2Y2I A;  5D3O A;  4GD6 A;  4DDS A;  1LI0 A;  1ONG A;  1BLC A;  2R9W A;  5EUA A;  2IWD A;  3VOZ A;  1LL5 A;  4XXR A;  4GB7 A;  5EPH A;  1VQQ A;  4C3Q A;  4KQQ A;  5BOH A;  2XR0 A;  3BFG A;  3M6B A;  2G2W A;  3ZHH A;  4GN2 A;  5FQI A;  4WBG A;  2XLN A;  1KE0 A;  2ZM2 A;  2JC7 A;  1DY6 A;  1GHI A;  1HD8 A;  1RGZ A;  3LO7 A;  4U0T A;  4ZBE A;  5TFQ A;  1DJA A;  2XK1 A;  4DKI A;  1JTG A;  2WGW A;  3G4P A;  3ZVT A;  4F94 A;  2WZX A;  5DF9 A;  3SOI A;  3W4P A;  4HEF A;  3Q81 A;  5CHM A;  5FAT A;  3OPL A;  5TGF A;  4JF5 A;  1PIO A;  3UDF A;  4DE0 A;  2XFS A;  2EX9 A;  3SH8 A;  3ZFZ A;  4Q8I A;  2ZC7 A;  5CHJ A;  4HES A;  3WRZ A;  4E3J A;  1FOF A;  2Y59 A;  4ZDX A;  4O7D A;  2XEP A;  4E3K A;  3ZG8 B;  4JKT A;  4KZ6 A;  4QY5 A;  5A91 A;  1FR6 A;  5F1F A;  3A3I A;  4E3N A;  5CGW A;  1BSG A;  1YLY A;  2WK0 A;  3Q07 A;  4R3J A;  1ZKJ A;  3QHY A;  3V39 A;  4OP8 A;  4DRT A;  5A90 A;  1LLB A;  2OV5 A;  1YMX A;  1BTL A;  4MNR A;  5GLB A;  3OPP A;  2WGW B;  5FQK A;  1K54 C;  1FCM A;  4L0L A;  4RYE A;  5JYP A;  2QPN A;  4QU3 A;  5U47 A;  5DF8 A;  3CJM A;  2UWX A;  4WZ5 C;  3ZCZ A;  3DW0 A;  4XUX A;  2E8I A;  2P9V A;  2HP9 A;  3IXB A;  4KZ7 A;  4X68 A;  2VGJ A;  3HLE A;  4KZA A;  5GHY A;  5JYO A;  1ERQ A;  2H0Y A;  4QJG A;  2IWB A;  4U0X A;  4Z9Q A;  1CK3 A;  2JBF A;  1WE4 A;  5GLA A;  1BZA A;  4KZ5 A;  2EFX A;  5A92 A;  1Z6F A;  2BLS A;  5E2H A;  5KSH A;  1MY8 A;  2V2F F;  2X02 A;  3EQU A;  3I7J A;  5CTN A;  1K6S A;  4BJP A;  3M2J A;  1ES4 A;  4LV3 A;  5EEC A;  4X55 A;  4MBK A;  4C75 A;  5HAR A;  3SS4 A;  5KSC A;  1NZU A;  1IKG A;  4P0M A;  4UA7 A;  4UA6 A;  4NET A;  5EVL A;  2ZJ9 A;  4Y0T A;  1FR1 A;  4IBX A;  4KZ9 A;  4OPR A;  3IXH A;  4UHU A;  4OQI A;  4E6X A;  1L0E A;  3ZG7 B;  3C7V A;  3C4P A;  1CEG A;  1SDE A;  2P9V B;  1OME A;  3FKV A;  3WRT A;  2C6W B;  4X53 A;  3GSG A;  2J8Y A;  4EUZ A;  2H10 A;  1PZO A;  2QZ6 A;  4YIN A;  1MXO A;  1RCJ A;  3CG5 A;  4KEN B;  1L0D A;  4IED A;  1MWU A;  1HZO A;  1LL9 A;  1FCO A;  5AQ7 A;  1PWC A;  3MFD A;  3MKF A;  3BFD A;  5FA7 A;  2Y55 A;  2ZC5 B;  4B4Z A;  4OQG A;  2WAD A;  1M40 A;  1JTD A;  3GV9 A;  3MZD A;  4WMC A;  1XPB A;  3UPP A;  2DRW A;  4P87 A;  5FDH A;  5I94 A;  2QMI A;  3LEZ A;  1IYS A;  1W7F A;  3RXX A;  5CER A;  1XX2 A;  4S2O A;  2Y2H A;  5E2G A;  1ERO A;  1PZP A;  3UPN A;  3CZD A;  5GHZ A;  4B4X A;  1XXM A;  2WAF A;  3HLW A;  1Y54 A;  4N1X A;  4E6W A;  3UN7 A;  4WMC D;  2BG1 A;  3NDE A;  3IT9 A;  4OKP A;  5E2F A;  4RX3 A;  1E3U A;  1MPL A;  2JE5 A;  4JXW A;  4OVD A;  4KG5 A;  3N8S A;  3O3V A;  3O88 A;  4HBU A;  3UDX A;  2ZC4 B;  4BQM A;  5FAO A;  3S22 A;  2P74 A;  4S2L A;  3VP4 A;  4GD8 A;  3NBL A;  3GR2 A;  4E3M A;  4ID4 A;  1BLH A;  2EXB A;  3PTE A;  3AGD A;  1KDS A;  5CEB A;  4PM8 A;  1SKF A;  4R3B A;  4NK3 A;  1KGG A;  2WYX A;  3RXW A;  2I72 A;  1E3U D;  2HP5 A;  3MKE A;  3FKW A;  4FH2 A;  5FQ9 A;  5DTT A;  4ZJ1 A;  3BFE A;  3WS5 A;  4B88 A;  4X69 A;  3AGF A;  3A3E A;  1IEM A;  2WKE A;  2ZQ7 A;  3G2Z A;  4OON A;  3TSG A;  4QY6 A;  4XUZ A;  4M3K A;  3VFH A;  2G2U A;  3P09 A;  4Y7P A;  1AXB A;  2PU2 A;  4EWF A;  4QB8 A;  4GDB A;  1N4O A;  4EBP A;  2HP6 A;  2A49 A;  1DJC A;  5GHX A;  4OOY A;  3Q82 A;  4DE3 A;  1M6K A;  2RL3 A;  1L2S A;  3NIA A;  3SH9 A;  5J8X A;  2C5W B;  1YLT A;  1ZC2 A;  4LEN A;  4R4S A;  1PW1 A;  4GOG A;  3OCN A;  1FSW A;  1EWZ A;  3BEB A;  4CJN A;  1GHM A;  3GMW A;  2OLV A;  2HPB A;  3MZF A;  4LV0 A;  5M19 A;  3UE0 A;  3UNW A;  1IYP A;  1YM1 A;  4PMA A;  1K4E A;  2WGV A;  2Y4A A;  4IVK A;  4WZ4 A;  4KQR A;  1MKI A;  5FQJ A;  3V3S A;  1K38 A;  3VMA A;  1KE3 A;  4OOM A;  3Q7V A;  4EV4 A;  4IBR A;  5AQB A;  2EX6 A;  4CPK A;  1K6R A;  4DDY A;  1VM1 A;  2EX8 A;  4N9L A;  4ZAM A;  1ES5 A;  3UY6 A;  5DTK A;  1XKZ A;  4R4R A;  3UDI A;  1W5D A;  4WEJ A;  2WZZ A;  2ZQA A;  1YLZ A;  3PAE A;  4LV2 A;  4R1G A;  4R23 A;  3ZGA B;  2X01 A;  1PW8 A;  2Y2N A;  4OQH A;  4S2N A;  5F82 A;  3GRJ A;  3B3X A;  4ZJ3 A;  2XD5 A;  2WKH A;  5HFO A;  4KQO A;  3WS4 A;  3WS2 A;  4PM7 A;  4GNU A;  4OPQ A;  4MBH A;  3G35 A;  3NCK A;  5E2E A;  3OPR A;  3IWQ A;  1CEF A;  1KDW A;  1YLW A;  1QMF A;  2ZM8 A;  5EVI C;  1MBL A;  2WUQ A;  4JPM A;  2ZC3 B;  1E25 A;  1I2W A;  3ZVW A;  3BEC A;  3VP2 A;  1CI9 A;  3Q7V B;  3UPO A;  4N9K A;  2ZM0 A;  4KZ4 A;  3RJU A;  3NDG A;  3HLG A;  5DF7 A;  4GKU A;  1TDG A;  1H8Y A;  3M2K A;  1C3B A;  1XGI A;  4BEN A;  2XGN A;  3PBO A;  2ZQD A;  1K56 A;  3D4F A;  5IHV A;  3DWK A;  2ZMA A;  4N1H A;  4X6T A;  3BLS A;  3SS5 A;  3HLF A;  1L0F A;  2HDU A;  3TG9 A;  1NRF A;  4C6Y A;  4N92 A;  5GLC A;  3E2K A;  3HL9 A;  1XA7 A;  4FCF A;  4UA9 A;  5EOE A;  1O07 A;  1U60 A;  5HAI A;  2V20 A;  3PBQ A;  1ONH A;  2ZQC A;  3FV7 A;  4OH0 A;  5FI2 A;  5GLD A;  1SCW A;  4A5R A;  1W8Y A;  1K56 D;  4JBF A;  4JF6 A;  5DTS A;  5FI6 A;  2J9O A;  3O87 A;  1XGJ A;  2GDN A;  1ES2 A;  3O86 A;  1MWT A;  3ZG0 A;  3AGE A;  4LCL A;  1H8Z A;  1W79 A;  3OPH A;  4DXB A;  1DJB A;  1CI8 A;  2Y2J A;  4S2P A;  3QNB A;  1IYQ A;  1G6A A;  1W8Q A;  3PBN A;  3LCE A;  1FCN A;  5FAP A;  3IF5 A;  4S2N C;  1MWS A;  2CC1 A;  2IWC A;  1BUL A;  2FFY A;  3Q7Z A;  4EBL A;  1I2S A;  1PYY A;  2H5S A;  1XA1 A;  4S2I A;  5FSR A;  1PWG A;  4KG6 A;  5FAQ A;  1PI5 A;  4GZB A;  4P85 A;  3W8K A;  4E3O A;  1K55 A;  2XF3 A;  3EQV A;  4S2K A;  3GQZ A;  4PPR A;  4E3L A;  4FSF A;  3GTC A;  2Z2L B;  3MXR A;  3ZDJ A;  4PM5 A;  4JXS A;  4LV1 A;  1ZG4 A;  1N9B A;  2XFT A;  4EBN A;  1RGY A;  1I5Q A;  3FYZ A;  3ITB A;  4OLG A;  3P98 A;  2VGK A;  3FZC A;  3G30 A;  3N8L A;  5KZH A;  3S4X A;  3SH7 A;  5EVI A;  1YQS A;  3GVB A;  4DXC A;  5CGS A;  1PWD A;  1FSY A;  4OLD A;  3VSK A;  3WS0 A;  4OPZ A;  2Y91 A;  5M1A A;  1J9M A;  1JWP A;  2H0T A;  3V5M A;  3HLC A;  4E3I A;  1YLJ A;  3A3F A;  4BD0 A;  4WEK A;  3BRM A;  3OZH A;  4UAA A;  3BFF A;  1BLS A;  2HDQ A;  3VP3 A;  3G34 A;  1JVJ A;  4KZ3 A;  1GCE A;  2ZQ8 A;  5G18 A;  3N8R A;  3ZG5 A;  1K25 A;  5HX9 A;  1YT4 A;  5EVI D;  1FQG A;  2DNS A;  5CHU A;  2ZLY A;  1WYC A;  4JXV A;  2WAE A;  4S2J A;  3PAG A;  4MBF A;  2Y2O A;  3HLD A;  1S6R A;  3MBZ A;  4HBT A;  3DTM A;  3C5A A;  4S2M A;  4DE2 A;  1KGF A;  1PI4 A;  3N4I A;  5EVI B;  3WS1 A;  2Y2L A;  3MZE A;  1LHY A;  1K57 C;  3OC2 A;  4BL2 A;  2A3U A;  1BLP A;  3JYI A;  1S0W A;  4OP5 A;  3OCL A;  3PBS A;  2Q9N A;  4DE1 A;  1KGE A;  4PM6 A;  3HVF A;  3BLM A;  4FD8 A;  4U3T A;  1IKI A;  5CRF A;  1NYM A;  2ZQ9 A;  1TVF A;  4RA7 A;  1ALQ A;  5FAS A;  4GDN A;  4KG2 A;  1O7E A;  3IHA A;  4ZTK A;  3MXS A;  3IXG A;  2XH9 A;  5AQ9 A;  1NJ4 A;  3VFF A;  4WEL A;  1NY0 A;  1Q2P A;  2EX2 A;  3IH9 A;  3VOY A;  4EQI A;  4H8R A;  3NY4 A;  1YMS A;  1K55 C;  4YFM A;  5CEC A;  2FFF B;  4K91 A;  3NC8 A;  1ERM A;  1ES3 A;  3E2L A;  2Y2M A;  3IF6 A;  5CTM A;  3ZG9 B;  1JWV A;  3ISG A;  2XQZ A;  3Q1F A;  4IVI A;  5CGX A;  2HDS A;  1YLP A;  3HLB A;  2WKI A;  1TEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...