3Q07A

Ctx-m-9 s70g in complex with piperacillin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase/antibiotic
source organism Escherichia coli
publication title CTX-M-9 S70G mutant in complex with piperacillin
rcsb
total genus 94
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q07A00
3JYIA 3Q07A 4DRTA 1YMXA 5FAPA 1HZOA 4S2OA 4UA6A 1WYCA 2WKEA 3C7VA 1DJBA 4KZ8A 1PYYA 4X56A 2QPNA 5FSRA 1L0GA 3CJMA 4KZBA 3QNBA 3IT9A 5CHMA 3VMAA 1C3BA 4HEFA 3BFCA 4OONA 1FCNA 2I72A 4PMAA 5FI2A 1L0DA 4DDSA 5GLCA 1XA7A 3QNCA 4DXBA 3HLGA 1VQQA 3N8RA 5EPHA 2XR0A 3P98A 4S2KA 1K55A 5FQQA 4HBTA 3PBSA 5FI7A 1GHIA 4LCLA 4JF5A 2WGIA 4K0WA 2EFUA 4FSFA 4HESA 1ZKJA 2Z2MB 5CGWA 5KMWA 4S2JA 4GN2A 1MXOA 2WGWA 3Q7VB 4R4SA 1K57C 3IXHA 3ITAA 2EX8A 3OC2A 2XFSA 1E3UD 5EOOA 5GHXA 2EXBA 3HLCA 3M2JA 3UDFA 2HDQA 5A90A 3BFDA 4PM6A 2ZC5B 2HDUA 3PBTA 4LCMA 1LL5A 5D3OA 3MXRA 1PZOA 3AGFA 3IXBA 2IWCA 4S2NC 4ZTKA 5FQMA 1K38A 2H10A 3M6BA 5HW3A 1YLTA 5CEBA 1IKGA 1IYPA 1I2WA 4XXRA 4X55A 3VP1A 2J8YA 5FDHA 3PBOA 2HP5A 2J9PA 1BLSA 3HREA 4HBUA 4OLGA 3TSGA 4ZDXA 3LEZA 4ZBEA 3RXXA 1VM1A 2Y2HA 2WZZA 3A3IA 4OKPA 1K6RA 5GLDA 2XQZA 1MWSA 3SS5A 1SCWA 3ZG9B 3BFEA 2WUQA 3IH9A 4MBHA 4EUZA 1CI9A 4LV1A 5E2EA 3OPHA 4OPZA 1MY8A 2H0TA 4RX3A 3OPPA 3WS0A 3TG9A 1S0WA 4UA7A 4EQIA 3WS5A 1E3UA 4N1HA 5DTKA 2Y2OA 1LI9A 4DKIA 2H5SA 2V20A 2XH9A 2V2FF 3HLEA 1LI0A 3Q81A 1RP5A 1WYBA 2XK1A 4U0TA 3UDIA 2Y2GA 3O88A 3IWOA 3GTCA 4S2LA 3HUMA 3B3XA 2WKIA 1KE3A 3HLBA 3WRZA 2XGNA 5DF8A 3LCEA 1JWZA 2Y59A 3UPOA 4M3KA 1TEMA 1ONGA 4BJPA 3NC8A 5EOEA 1K25A 3AGEA 3BFFA 4IBXA 5GLBA 1ZC2A 1OMEA 1FR1A 2WAEA 1PIOA 4LV3A 4ZJ2A 1ONHA 2WK0A 4F94A 3HVFA 1IELA 4BD0A 5A92A 4N9LA 3VP2A 3W4OA 1XXMA 3TOIA 1XGJA 1RCJA 2G2UA 4QJGA 2DRWA 2Y91A 3Q7VA 4JBFA 2OSUA 2ZM8A 3EQUA 4KQRA 4WBGA 4U3TA 3WWXA 3ZGAB 1I5QA 3WS1A 1ES3A 1SHVA 2PBYA 4XUXA 5CGSA 5GHYA 1LLBA 1JWVA 3RJUA 2XLNA 5GLAA 1FCOA 4ZAMA 2ZLYA 3S22A 4FCFA 1PWDA 3VOYA 5AQBA 3ZG7B 1BLCA 3ZG8B 3UPNA 3MZEA 4ZJ3A 1EWZA 3UDXA 2VGJA 3IWIA 1IYOA 3Q7ZA 4MNRA 4RVAA 1K54C 4CPKA 4DXCA 3DWKA 5CXWA 5EVIB 3IH8A 1BLHA 4WZ4A 3VP4A 1JTGA 4KENB 3S4XA 2G2WA 1EROA 4GDBA 2HP6A 1SDEA 1W7FA 1JTDA 5CHUA 2HDSA 3N8SA 5FI6A 1FSYA 1XKZA 1Q2PA 4OLDA 4K0XA 1KDWA 3S1YA 2PU2A 4OP5A 4PM9A 5E2GA 3VP0A 4LV0A 3FZCA 1NRFA 3IF6B 2WGWB 1ES2A 5IHVA 2XDMA 3C5AA 3VP3A 4E3KA 1MBLA 3C4OA 1PW8A 4MBKA 3UPPA 2WYXA 3V3SA 1CEGA 5FQIA 3BEBA 3BM6A 3GMWA 2EX9A 2XF3A 4E3IA 3VOZA 1U60A 4P6BA 3M6HA 3SOIA 1YLJA 1FOFA 5BOHA 1ALQA 3ITBA 5HFOA 4O7DA 3C4PA 5DF9A 4N92A 5GHZA 1GA9A 4NETA 1FR6A 1BSGA 1K56A 1KDSA 2ZQCA 4OQIA 3LY4A 1G68A 1IEMA 2EX2A 1BLPA 1WE4A 4PM5A 4H8RA 3MXSA 1G6AA 1I2SA 3D4FA 2HP9A 2P9VB 3C7UA 4IVIA 4WM9A 1ESUA 3E2LA 3WS4A 4KZAA 4EV4A 4OPRA 1CEFA 2ZD8A 1L0EA 3LY3A 5E43A 5AQAA 4OOLA 4DE0A 1PZPA 2R9XA 5HAQA 4KZ3A 5TR7A 3IWQA 3Q1FA 3HLFA 4OP8A 2IWDA 4Y0UA 4JXWA 5CEDA 3GV9A 5A91A 4QU3A 1ES5A 2FFYA 1PWCA 3CG5A 3LO7A 5FASA 1SDNA 2Z2LB 2ZQ8A 3G32A 4S2MA 3Q82A 5FQJA 5FATA 1ERMA 2XD1A 1Z6FA 2EFXA 5CRFA 2QMIA 2ZJ9A 2Y2PA 4P87A 1XP4A 3G2YA 4JF6A 1NY0A 1H5XA 4PPRA 1XPBA 1YQSA 2JC7A 5FA7A 2Y2QA 3IHAA 4S2PA 4R3BA 4WZ5C 3UO9A 4IVKA 5AQ9A 3EQVA 2ZC3B 2WZXA 3AGDA 4A5RA 5FQ9A 1K4EA 1M6KA 4KZ5A 2WKHA 2OLVA 2Y2LA 4E3OA 2ZQ7A 3OPLA 3CMZA 5JYOA 2QZ6A 3ZNYA 3BFGA 2Y55A 3IF6C 3WRTA 4DF6A 5A93A 5DTTA 2VGKA 1TDLA 1YMSA 4GOGA 4KZ7A 2H0YA 3IXGA 3P09A 2A3UA 5FAQA 2RL3A 1XX2A 5CGXA 4B4ZA 1KVMA 4KG2A 5CTNA 3HBRA 3IF5A 1W5DA 1BTLA 3SS4A 3VFFA 4KQQA 4DE1A 3W4QA 3FKWA 3A3FA 2DNSA 4R4RA 2FFFB 1W79A 2Y2NA 3DWZA 4X53A 5TFQA 4FH4A 1XA1A 5M19A 3OPRA 1W8YA 3SH9A 3UE1A 3N8LA 4X6TA 2XFTA 4BD1A 1GCEA 1K4FA 1NZUA 2ZC6B 3NDEA 3FKVA 3MKEA 3NIAA 4WMCD 1EI5A 1PWGA 1K57A 1NYYA 2ZQAA 3PTEA 3HLDA 3ISGA 4FH2A 4JF4A 4R3JA 4YFMA 1BZAA 1YM1A 3IQAA 5EVIA 1TDGA 4JKTA 4PM7A 4Y0TA 2XD5A 4ZJ1A 1IYSA 5HAIA 2Y2IA 4MBFA 3PAGA 4UAAA 3V3RA 5EVLA 2J9OA 1PI5A 1KGGA 1L2SA 4QB8A 4C75A 3UY6A 3N7WA 4R1GA 3MKFA 1YLZA 4C3QA 3NDGA 4OQ0A 1QMFA 3BECA 4EWFA 3G4PA 3IF6A 1YLPA 4GKUA 5KSHA 4C6YA 3ZVTA 4YINA 4U0XA 1MKIA 2WAFA 2E8IA 2C6WB 3V39A 4BLMA 4QY5A 1S6RA 5KZHA 3O86A 4EBLA 5U47A 5DF7A 2BLSA 4GD8A 4ID4A 2P74A 1LHYA 3HL9A 1O7EA 5AQ7A 3ZCZA 1ZG6A 4BENA 1E25A 3OCLA 3NCKA 4KG6A 4LENA 3ZVWA 2C5WB 1ES4A 1HTZA 5EVID 1BUEA 3IXDA 1KGEA 1TVFA 4WMCA 4KQOA 1QMEA 1JWPA 4DE2A 4B4XA 5HAPA 1JVJA 3BLMA 3V5MA 5DVAA 2CC1A 2P9VA 3G34A 4R23A 3VSKA 5L2FA 2JCHA 3UNWA 3PBNA 3W8KA 3ZNTA 3HUNA 1RGYA 4Z9QA 1MPLA 2GDNA 3GVBA 3NI9A 3RXWA 3BLSA 3G35A 5M1AA 1Y54A 2ZM0A 1NXYA 1YT4A 4OOYA 3FWLA 1H8YA 5E2FA 3VFHA 4E3LA 3N4IA 3OZHA 4JXVA 3PAEA 3IHBA 4JXGA 1BT5A 2ZM2A 3MZDA 1H8ZA 2B5RA 5GL9A 3V50A 2HPBA 2Q9MA 1NJ4A 1ZG4A 3A3JA 1GHPA 3GRJA 4RYEA 4Q8IA 3BRMA 3ZG5A 5TGFA 3BYDA 4GNUA 5EVIC 4R0QA 4GZBA 5EUAA 5EE8A 1HVBA 4X68A 1K56D 4X69A 3ZHHA 3PBQA 4GB7A 4WYYA 3DTMA 3MFDA 3SS3A 5M18A 5J8XA 3HUOA 4OPYA 4DE3A 1YLYA 4MLLA 4OOMA 4NK3A 1E4DA 4KG5A 1K55C 1KGFA 1BULA 4QY6A 1FQGA 4BL2A 4Y7PA 4KZ6A 3CZDA 4D2OA 1KE4A 3G30A 4JXSA 3UE0A 4P85A 2DCFA 2Y2JA 4K91A 2EXAA 2X71A 2X01A 3WS2A 5KSCA 3M2KA 1AXBA 4QD4A 4RA7A 2IWBA 4E6XA 5DTSA 2ZC7A 3UN7A 4P0MA 2OV5A 1M40A 1FCMA 4E6WA 2ZMAA 4IBRA 3ZDJA 1SKFA 3MBZA 5F82A 2Y2KA 1DJAA 1MWTA 4N1XA 1HD8A 2PU4A 5F1FA 2JBFA 1J9MA 1YLWA 1N4OA 4IEDA 1LL9A 1FSWA 4S2NA 4JPMA 3GR2A 3A3EA 3I7JA 5FAOA 4UHUA 5HL1A 4WEJA 2WADA 4CJNA 5EECA 1PI4A 2A49A 4EBNA 3FYZA 5F1GA 2HDRA 4WELA 3HLWA 3SH7A 2X02A 4OQGA 3E2KA 2EX6A 2Y2MA 4OVDA 2BG1A 3ZFZA 5CECA 3NY4A 1MWRA 5FQKA 3G2ZA 5E2HA 1L0FA 1MWUA 1N9BA 2ZC4B 4DDYA 2JE5A 4GDNA 3VSLA 1XGIA 2V1ZA 5G18A 3OCNA 1DJCA 4XUZA 2Q9NA 4N9KA 4FD8A 2ZQDA 1ERQA 1IYQA 4OQHA 2J7VA 2Y4AA 3MZFA 5CTMA 4B88A 4LV2A 4MEZA 1NYMA 4E3JA 1KVLA 2OLUA 1RGZA 3SH8A 3NBLA 3O87A 4KZ4A 1ESIA 1O07A 4GD6A 4OH0A 4E3NA 3N6IA 3O3VA 4BL3A 4EBPA 4E3MA 3GQZA 4RX2A 4BQMA 5HX9A 2ZQ9A 1K54A 4WZ5A 3UE3A 2RCXA 3PBRA 5I94A 5JYPA 4S2IA 3W4PA 3DW0A 1CI8A 4WEKA 2WGVA 5F83A 5CERA 2R9WA 1GHMA 1PW1A 4JLFA 1IKIA 1K6SA 1CK3A 5HARA 1NZOA 3QHYA 3GSGA 3A3DA 4L0LA 1W8QA 2UWXA 1DY6A 4KZ9A 3G31A 4OPQA 1KE0A 4PM8A 4Y0OA 1GA0A 4UA9A 1Q2QA 4QHCA 5CHJA 3FV7A 3ZG0A 2XEPA
chains in the Genus database with same CATH superfamily
3JYIA 4Y13A 3U4LP 4GW9A 4KZ8A 4X56A 2QPNA 4KZBA 5CHMA 3VMAA 1C3BA 4OONA 1FCNA 4PMAA 5FI2A 2J3TD 5GLCA 1XA7A 3QNCA 4DXBA 3N8RA 1PNEA 4S2KA 5FQQA 5AJGA 2WGIA 3JVUA 5F5YA 4S2JA 3KSFA 3MXQA 1DRMA 3Q7VB 1K57C 3ITAA 2KDKA 3UDFA 1E3UD 3HLCA 3M2JA 3E4PA 4PM6A 3PBTA 3CHWP 2H10A 2ZOIA 1IYPA 1I2WA 3VP1A 2HP5A 3DAVA 4OKPA 3QP8A 3BJNA 4MBHA 4EUZA 1MY8A 3WS0A 3R4KA 1TF1A 3WS5A 2WKRA 2J3WA 1LI9A 2XH9A 1WYBA 2VX8A 2Y2GA 2ZL1B 3O88A 4PAUA 3H82A 2YKHA 4S2LA 3B3XA 1KE3A 2XGNA 5DF8A 1OJGA 5EVEA 3C30A 3NC8A 5EOEA 3AGEA 1CQAA 3BFFA 4LV3A 2WK0A 2VKSA 1SKOA 2V8CA 4BD0A 3DTEA 4MN5A 5TBMB 3W4OA 4YNRA 4JBFA 2OSUA 2ZM8A 4U3TA 4YWZA 1I5QA 2PBYA 1SHVA 1LLBA 3RJUA 2XLNA 4ZAMA 1BYWA 5AQBA 1BLCA 3ZG8B 2W3FA 2VGLS 2VGJA 4MNRA 4CPKA 1K54C 1BLHA 3VP4A 4KENB 5CHUA 3LR4A 4OLDA 4K0XA 2M1CA 3VP0A 1NRFA 2XDMA 4Z1WA 3MQOA 2E8JA 2L0WA 1VB6A 2WYXA 3S7QA 3V3SA 3BM6A 1U60A 1S1YA 3C8CA 1ALQA 3ITBA 5HFOA 5DF9A 4N92A 3LY4A 1G68A 2HP9A 3LEQA 3WS4A 3IX8A 4EV4A 3MSHA 4OPRA 4MN7A 5E43A 4JGQA 4Y17A 4OOLA 3CI6A 3IWQA 3HLFA 4JXWA 3LYXA 1ES5A 2FFYA 3LIEA 2Z2LB 3G32A 2XD1A 4ARZA 1XP4A 2XSSA 4BBVA 1XPBA 3K3CA 2ACGA 4R3BA 4WZ5C 5AQ9A 3AGDA 5FQ9A 4BBTA 2B02A 2Y2LA 2ZQ7A 3ULFA 4I39A 4GCZA 5JYOA 3PR6A 3IF6C 4DF6A 3A0VA 1OT9A 3SS4A 4KQQA 1AWIA 3VE3A 4X53A 1XJ3A 5M19A 1W8YA 4HH3A 5F69A 1STZA 1OJ5A 3MKEA 3NIAA 4WMCD 1K57A 4GLQA 4R38A 1N9OA 1L3LA 1BZAA 3IQAA 4H6JB 1LSXA 5HAIA 1MC0A 2Z6DA 4X1MA 3UB7A 4UAAA 2J9OA 4QB8A 3CPTA 2O0YA 3H9WA 1QMFA 4EWFA 3KSIA 3IF6A 4R70A 3VV4A 4G3VA 2PR6A 3ZVTA 2C6WB 5I5LA 4BLMA 4NG2A 1TS8A 3O86A 4EBLA 2BLSA 4GD8A 3HL9A 4ESPA 2W1RA 1ES4A 3T4LA 1BUEA 2YKFA 1KGEA 4DE2A 4B4XA 4NXBA 1NLYA 3V5MA 3IBRA 3VSKA 3ZNTA 4EERA 4UEYA 3BLSA 1Y54A 2ZM0A 3F1OB 3IHBA 2JKRI 3T4JA 1BT5A 2B5RA 3V50A 2HPBA 2G7UA 3A3JA 1GHPA 4HOIA 3BRMA 3BYDA 5EVIC 3PHYA 4X69A 3ZHHA 5EM1A 4GB7A 3DTMA 4II7A 3SS3A 1XJ4A 1D7EA 5J8XA 4MLLA 5HPIA 3PXPA 2VEAA 2AVXA 4KG5A 4QY6A 1FQGA 4KZ6A 2QYBA 4K91A 3KYZA 4DJ3A 2W3HA 2OV5A 3NECA 3MBZA 4N1XA 3IS2A 5HWVA 1J9MA 1GSWA 1N4OA 1LL9A 3T4QA 3GR2A 4UHUA 4WEJA 2WADA 1OTBA 3P01A 4EBNA 2HDRA 3B33A 4OQGA 4LLOB 5CECA 1T1CA 2JE5A 1PFLA 4JGPA 3OCNA 4FD8A 3B47A 2ZQDA 5FDSA 3MZFA 4LV2A 4E3JA 3EEAA 3BW6A 2OLUA 4ETZA 4I38A 2VZWA 4GD6A 4OH0A 2I9VA 1EW0A 3SW1A 2ZQ9A 1K54A 4WZ5A 5HZHA 5JYPA 4S2IA 3DW0A 4WEKA 4HJ4A 1GHMA 4JLFA 1V9YA 3UO9A 4PM8A 1Q2QA 4QHCA 2XEPA 3ZQ5A 5FAPA 2WKEA 1PYYA 2JKTI 5FSRA 1L0GA 1NLZA 3QNBA 3IT9A 2I72A 1N9NA 4UQIM 4LRXC 1VEUA 2A24B 1GHIA 4JF5A 4K0WA 4JGOA 2Z2MB 5KMWA 4XT2A 4R3AA 2WGWA 1N9LA 3IXHA 3MFXA 5EOOA 5GHXA 2EXBA 3BFDA 2HDUA 5MC7A 5TJJA 4PHTA 3IXBA 4EXOA 3MQ0A 1YLTA 4X55A 3TSGA 4OLGA 2J9PA 3HREA 1BLSA 1S67L 2PT7A 3PBOA 4DJ2A 4E04A 3LEZA 3A3IA 5GLDA 3SS5A 3ZG9B 1F98A 1LSVA 4LV1A 2PYPA 3OPHA 2H0TA 3OPPA 1S0WA 4UA7A 4BBUA 4DKIA 2H5SA 4O01A 3HLEA 3O5YA 1LI0A 4HIAA 1RP5A 2XK1A 1V9ZA 3UDIA 2FH5A 3H7WB 5DJTA 3HLBA 4M3KA 1TEMA 2ZBBA 4BJPA 3LIDA 4IBXA 1OMEA 2L4RA 2DMWA 3V67A 1IELA 3JPUA 5A92A 4HY8A 4N9LA 4Q0IA 1XXMA 1K0KA 5FEGA 1XGJA 3Q7VA 3EQUA 4KQRA 2PDRA 4XUXA 5CGSA 5GHYA 3S22A 4FCFA 3UE6A 3VOYA 4R6LA 4ZJ3A 1EWZA 2PD7A 3IWIA 3UB9A 5EVIB 1S4SA 3T12B 2G2WA 1EROA 1JTDA 1XKZA 3NHQA 4OP5A 3TJZC 5AVFA 4FOFA 2WGWB 3VP3A 1XJ6A 4E3KA 1MBLA 1T18A 4MBKA 4Q0HA 3UPPA 2UV0E 3VOZA 2KX6A 3M6HA 1FOFA 5BOHA 3C4PA 5HD5A 4NETA 3NOPC 4G3WA 2VV8A 2ZQCA 3T1XA 3BWLA 2QJ7A 1IEMA 3A0RA 2EX2A 1WE4A 4H8RA 1I2SA 2W27A 3C7UA 1ESUA 4KZAA 3RH8B 1SKOB 4DE0A 5HAQA 3Q1FA 5CEDA 3T4KA 5DJUA 1PWCA 3F1PB 2PBDP 2ZQ8A 3DBAA 2V1BA 1G6OA 3BQAA 3Q82A 4GJ4A 1Z6FA 2EFXA 5CRFA 2W3EA 4CLCC 4P87A 3G2YA 4JF6A 4X25A 1NY0A 5FA7A 3H7WA 4FTXA 4S2PA 3QP4A 3EQVA 2ZC3B 3L9KA 4A5RA 2VK3A 4P6ZS 3CMZA 3KSGA 3E0YA 5HPFA 1TDLA 4GOGA 3IXGA 1ACFA 3P09A 2RL3A 3LICA 2CMNA 2KLIA 3HBRA 3IF5A 3VFFA 2XA7S 3TE8A 2FFFB 5AVEA 4FH4A 2J3TC 3OPRA 3UE1A 3N8LA 4X6TA 4BD1A 3NDEA 3P7NA 3PTEA 4JF4A 1YM1A 1D06A 5EVIA 5HDDA 4Y0TA 4ZJ1A 1IYSA 3V3RA 3EEHA 3N7WA 4C3QA 3BECA 3G4PA 2E8IA 3V39A 1S6RA 4MCWA 5KZHA 1VETA 2P74A 1LHYA 1E25A 3NCKA 3ZVWA 5EVID 4K08A 3IXDA 4LFUA 1TVFA 3NOTC 5L2FA 2W3GA 1MPLA 2GDNA 1NXYA 3UMDA 1H3QA 1YT4A 4OOYA 1H8YA 4HI4A 2INWA 4JXVA 3F1PA 1VHMA 4JXGA 2GX5A 2ZM2A 2Q9MA 3UB8A 1ZG4A 3ZG5A 3MF0A 5EUAA 4GZBA 3GDIA 5EM0A 1X0OA 4GS9A 4JGRA 1F9IA 2B18A 3KYQA 2ZMFA 2P04A 4OPYA 4DE3A 4CQHA 1K55C 1KGFA 3CPTB 3HJKA 1NRJA 3G30A 4D2OA 2EXAA 5KSCA 2X01A 2ZC7A 2O9BA 1M40A 1FCMA 2EWWA 3ZDJA 1SKFA 2JKTM 2NUPC 1HD8A 3VE4A 1FSWA 4S2NA 4JPMA 3I7JA 3A3EA 4CJNA 5F1GA 2ZOHA 4WELA 3HLWA 3EGXC 2BG1A 5FQKA 5E2HA 1N9BA 2ZC4B 4HHDA 4ME4A 4FUWA 4N9KA 1ERQA 1IYQA 4OQHA 2Y4AA 5CTMA 4MN6A 3W2ZA 4MEZA 1NYMA 2HJEA 5IT5A 3SH8A 1ESIA 2V0WA 4E3NA 4BL3A 3O3VA 3LIFA 4E3MA 3T1RA 2RCXA 4WLAA 5I94A 3W4PA 2XA7M 5L09A 5F83A 5HSQA 1UGUA 4WF0A 1DY6A 4KZ9A 1KE0A 4MMNA 1GA0A 3FV7A 4EW7A 1XJ2A 4DRTA 1WYCA 3C7VA 4KUKA 1P97A 3S7PA 3T1SA 4HEFA 3BFCA 3H82B 4DDSA 1L0DA 3KX0X 3HLGA 1VQQA 5EPHA 3T4OA 4LCLA 3U2AA 4FSFA 4HESA 1ZKJA 5CGWA 1HLUP 3HCYA 4GN2A 2EX8A 2XFSA 2HDQA 1DP9A 3MS6A 5A90A 2ZC5B 4LCMA 5D3OA 1LL5A 3IX3A 3IS2B 4ZTKA 3M6BA 5HW3A 5CEBA 1IKGA 2HZ5A 2FZ0A 2XROA 2J8YA 5FDHA 4ZDXA 1J3WA 4HBUA 5IU1A 1VM1A 2WZZA 4NXGA 2XQZA 1MWSA 1SCWA 3IH9A 2ZMVA 1CI9A 5E2EA 4OPZA 4RX3A 4EQIA 4N1HA 1OTEA 2Y2OA 3T1QB 1OTIA 1TS6A 3E98A 2V2FF 3Q81A 1FILA 3L7HA 4DMZA 3IWOA 3VOLA 3HUMA 2WKIA 2V0UA 3LCEA 4HJ6A 2GZAA 3QP1A 2IA2A 2A24A 3GECA 1PIOA 4ZJ2A 5F68A 4F94A 4QPRA 5L07A 4Q0JA 1JNUA 2QWSA 2LB5A 3R7WB 1RCJA 2G2UA 3D9YA 1UWNX 3WWXA 1CJFA 3BY8A 5GLAA 1FCOA 4I5SA 2ZLYA 4ARZB 5L10A 4M4XA 2JKRM 3MZEA 1IYOA 3Q7ZA 2LB9A 4RVAA 5CXWA 3C2WA 4WZ4A 1JTGA 3S4XA 4GDBA 3S7OA 2W1TB 1W7FA 2HDSA 5FI6A 1FSYA 2EA9A 1Q2PA 5E2GA 4LV0A 3FZCA 5IHVA 2D01A 3C5AA 1PW8A 3A0SA 2QJ5A 1OT6A 3BEBA 4P6BA 3SOIA 4P6ZM 5GHZA 1BSGA 1K56A 3QP6A 4OQIA 1BLPA 2O9AA 3MXSA 1G6AA 5DKLA 3D4FA 2P9VB 4IVIA 3S7NA 1GSXA 5HWTA 1CEFA 3LY3A 5AQAA 1PZPA 5TBMA 4Y0UA 4OP8A 2IWDA 5A91A 2HJ9C 3KYEA 1Y28A 4QU3A 3LO7A 3CG5A 5FASA 1IOUA 4S2MA 1ERMA 2QMIA 2BASA 2ZJ9A 3QP2A 3D3OA 1H5XA 2W0NA 4IVKA 3JVVA 2WZXA 1D1JA 4F3LA 2PD8A 4KZ5A 2WKHA 5EV0A 5KIZA 3B42A 3OPLA 3ZNYA 3BFGA 2Y55A 3WRTA 1GSVA 5DTTA 2VGKA 2PHYA 1H8MA 1W63M 5FAQA 5CGXA 1DP8A 1XX2A 1KVMA 4KG2A 1W5DA 1BTLA 2OAQ1 2P08A 2DNSA 3A3FA 3ICYA 1W79A 2Y2NA 3DWZA 1G28A 3T4SA 5K5BA 1K4FA 1NZUA 2ZC6B 3ZYTA 3FKVA 3IBJA 1NYYA 3ISGA 4FH2A 3OOVA 3K2NA 4L9GA 4PM7A 2Y79A 2XD5A 4LGWA 3OLOA 1PI5A 1L2SA 4Y15A 3UY6A 4I3IA 4R1GA 3MKFA 1TD5A 3NDGA 4CLCB 1TS7A 2M7VA 2M7UA 4GKUA 4C6YA 4YINA 1KOUA 1MKIA 2PYRA 2WAFA 4EUVA 4NEED 4BWIA 5U47A 4ID4A 4Y3IA 2QHKA 1O7EA 1ZG6A 4BENA 3OCLA 4KG6A 5HDSA 2OWHA 4KQOA 3T50A 1QMEA 5HAPA 5DVAA 3CLOA 2CC1A 2P9VA 4L9EA 3UNWA 3PBNA 4EEUA 1RGYA 3UB5P 2VLGA 3GVBA 3DTKA 5G4ZA 3FWLA 1LSWA 3VFHA 4E3LA 3OZHA 4O0PA 1H8ZA 4RQ9A 2K7SA 2Z6CA 3GRJA 4RYEA 4GNUA 1HVBA 1DP6A 4X68A 1K56D 3PBQA 4H6JA 3MFDA 5M18A 3HUOA 4HP4A 4NK3A 1E4DA 4Y7PA 5L8MA 4JXSA 1S66L 2DCFA 2Y2JA 2X71A 3KO6A 3WS2A 2XRNA 3M2KA 4QD4A 4HJ3A 2IWBA 4E6XA 4HP9A 2GNXA 3UN7A 2Y2KA 2B95A 2PU4A 2JBFA 4EETB 1YLWA 2W3DA 2P7JA 1XFQA 5HL1A 5EECA 2A49A 3FYZA 2BTFP 2L1MA 5IS1A 5C5KA 2V1AA 2X02A 3ZFZA 3NY4A 1MWRA 1L0FA 1MWUA 1ZTUA 4DDYA 3MJQA 3RFBA 1XGIA 2V1ZA 2VGLM 4GHIA 1F2KA 4NKPA 3KSHA 1YPRA 2J7VA 3TW8A 4B88A 4WUJA 1KVLA 4LRZE 1RGZA 3NBLA 2ZL1A 4KQDA 1O07A 1A0KA 4NXEA 5EFWA 1T1AA 4GS9B 4EBPA 3GQZA 4WN5A 4IHQA 3UE3A 3PBRA 2WGVA 3RTYA 1K6SA 5HARA 2Q0OA 1NZOA 3QHYA 4L9FA 4HH2A 5A8BA 5J4EA 1W8QA 2O99A 4WL9A 4OPQA 5CHJA 4Y0OA 4UA9A 5DFXA 3Q07A 1YMXA 1HZOA 4S2OA 4UA6A 1DJBA 2K2NA 3CJMA 2VA0A 4G3KA 4EESA 2WKPA 1OTDA 2D02A 1MKMA 3LUQA 1F5MA 5HWWA 1IFQA 2XR0A 3P98A 1K55A 4HBTA 3PBSA 1XFNA 5FI7A 2NUTC 2EFUA 1P9RA 3PYPA 3MMHA 4Y5FA 1MXOA 5G4YA 4R4SA 3OC2A 1OPXA 5DFYA 3MXRA 1PZOA 3AGFA 4S2NC 2IWCA 5FQMA 1K38A 4XXRA 3LIBA 2HF6A 4ZBEA 3RXXA 2Y2HA 1K6RA 4PKYG 3BFEA 2WUQA 3MR0A 3LFVA 4EQ1A 3D72A 4GHIB 4CLCD 3TG9A 3SZTA 1W63Q 1E3UA 5DTKA 2H28A 2V20A 2PRFA 3IX4A 4EEPA 4U0TA 4ZRRA 3UMEA 1NWZA 3GTCA 3CWFA 2JKFA 3WRZA 1JWZA 2Y59A 3UPOA 3G6OA 1ONGA 1VEUB 1OTAA 1K25A 5GLBA 1ZC2A 1FR1A 2WAEA 1ONHA 4KUOA 3HVFA 1S4RA 5FL3A 1S1ZA 2PAVP 3VP2A 3TOIA 1YSPA 4QJGA 2DRWA 2Y91A 3CUEA 4WBGA 4IJGA 4CLCE 3ZGAB 4B93A 3WS1A 1ES3A 1JWVA 2PR5A 4ETXA 4IUKA 1PWDA 3FC7A 3ZG7B 1LT0A 3UPNA 4LPZA 3UDXA 4DXCA 2VJWA 3DWKA 4Y2FA 3IH8A 2QKPA 3HJIA 2HP6A 1SDEA 3N8SA 2O9CA 1KDWA 3S1YA 1FIKA 2PU2A 4PM9A 3IF6B 3NULA 1ES2A 1SZVA 1T1BA 1CF0A 3C4OA 1CEGA 5FQIA 2EWVA 3GMWA 2EX9A 2XF3A 4E3IA 2J80A 1YLJA 1YAXA 3DTIA 4O7DA 1GA9A 1FR6A 3LIAA 1P0ZA 1KDSA 4I3AA 4X1LA 4PM5A 4QWOA 4WM9A 3E2LA 3CITA 2ZD8A 1L0EA 2R9XA 2GJ3A 2Y8HA 4KZ3A 5TR7A 3GV9A 3F1OA 3NOUC 2V9AA 3FPVA 1Y4OA 5J3WA 1SDNA 5FQJA 2WKQA 5FATA 4IUHA 3C38A 2Y2PA 4UQIS 5CX7A 4PPRA 1YQSA 3BY9A 2JC7A 2Y2QA 3IHAA 5FEFA 5HL6A 1K4EA 1M6KA 2OLVA 1T19A 3LI9A 4E3OA 2OOLA 1UWPX 1PRQA 2QZ6A 1P9WA 5A93A 1YMSA 4KZ7A 2H0YA 2A3UA 4B4ZA 5CTNA 3R7WA 5F6AA 3F1NA 3EOIA 4DE1A 3W4QA 3FKWA 4R4RA 4HQAA 2JHEA 1YKDA 5TFQA 1XA1A 3SH9A 2XFTA 1GCEA 3FPWA 3FG8A 1EI5A 1PWGA 4LRYC 1TS0A 2ZQAA 3HLDA 4B9OA 4R3JA 4YFMA 1TDGA 4D60A 4JKTA 2Y2IA 3EWKA 4MBFA 3PAGA 2W1TA 5EVLA 1KGGA 4YOFA 4C75A 3LGOA 4HNBA 4AFIA 1YLZA 4OQ0A 2K31A 5J7EA 1YLPA 5KSHA 4U0XA 2KOIA 4QY5A 3EGDC 1MZUA 5DF7A 5AQ7A 3ZCZA 4MDZA 4LENA 2C5WB 3CAXA 1HTZA 4F3LB 4WMCA 1JWPA 1JVJA 3BLMA 3G34A 4R23A 2JCHA 3W8KA 3HUNA 4Z9QA 3NI9A 3RXWA 3G35A 5M1AA 5HDCA 1LL8A 2HV1A 5DKKA 3LI8A 5E2FA 3N4IA 3PAEA 2R78A 3MZDA 5GL9A 2OAP1 1NJ4A 4Q8IA 3LR0A 4NXFA 5TGFA 4R0QA 3LR3A 5EE8A 3LR5A 4WYYA 2A2LA 3OBFA 1YLYA 4OOMA 1BULA 4BL2A 3NJAA 3CZDA 4PKYA 2HGVA 1KE4A 2JN7A 1ODVA 3K3DA 3UE0A 4P85A 4XT2B 1AXBA 4CLCA 4RA7A 3F1NB 3QP5A 5DTSA 4I3JA 4P0MA 2V8FA 4E6WA 2ZMAA 4IBRA 5F82A 1DJAA 1H0MA 1MWTA 5F1FA 1VETB 4IEDA 5FAOA 3TRCA 1PI4A 3SH7A 3BQ8A 3E2KA 2EX6A 2Y2MA 4OVDA 4BMWA 3CUEC 3G2ZA 4EU0A 5HD3A 4GDNA 3VSLA 2VV6A 1WA9A 5G18A 4XUZA 1DJCA 2MJ6A 2Q9NA 3MQQA 1ZHHB 3O87A 4KZ4A 1Z09A 3T4TA 4O8GA 3N6IA 3E4QA 1G5UA 4RX2A 2VV7A 3E4OA 1YSQA 4BQMA 5HX9A 1CI8A 5CERA 2R9WA 1PW1A 1IKIA 2OWJA 1CK3A 5LBRA 3GSGA 3A3DA 4L0LA 4DN0A 2UWXA 3UB6A 3G31A 2JKGA 3ZG0A
chains in the Genus database with same CATH topology
3JYIA 3Q07A 4DRTA 1YMXA 5FAPA 1HZOA 4S2OA 4UA6A 1WYCA 2WKEA 3C7VA 1DJBA 4KZ8A 1PYYA 4X56A 2QPNA 5FSRA 1L0GA 3CJMA 4KZBA 3QNBA 3IT9A 5CHMA 3VMAA 1C3BA 4HEFA 3BFCA 4OONA 1FCNA 2I72A 4PMAA 5FI2A 1L0DA 4DDSA 5GLCA 1XA7A 3QNCA 4DXBA 3HLGA 1VQQA 3N8RA 5EPHA 2XR0A 3P98A 4S2KA 1K55A 5FQQA 4HBTA 3PBSA 5FI7A 1GHIA 4LCLA 4JF5A 2WGIA 4K0WA 2EFUA 4FSFA 4HESA 1ZKJA 2Z2MB 5CGWA 5KMWA 4S2JA 4GN2A 1MXOA 2WGWA 3Q7VB 4R4SA 1K57C 3IXHA 3ITAA 2EX8A 3OC2A 2XFSA 1E3UD 5EOOA 5GHXA 2EXBA 3HLCA 3M2JA 3UDFA 2HDQA 5A90A 3BFDA 4PM6A 2ZC5B 2HDUA 3PBTA 4LCMA 1LL5A 5D3OA 3MXRA 1PZOA 3AGFA 3IXBA 2IWCA 4S2NC 4ZTKA 5FQMA 1K38A 2H10A 3M6BA 5HW3A 1YLTA 5CEBA 1IKGA 1IYPA 1I2WA 4XXRA 4X55A 3VP1A 2J8YA 5FDHA 3PBOA 2HP5A 2J9PA 1BLSA 3HREA 4HBUA 4OLGA 3TSGA 4ZDXA 3LEZA 4ZBEA 3RXXA 1VM1A 2Y2HA 2WZZA 3A3IA 4OKPA 1K6RA 5GLDA 2XQZA 1MWSA 3SS5A 1SCWA 3ZG9B 3BFEA 2WUQA 3IH9A 4MBHA 4EUZA 1CI9A 4LV1A 5E2EA 3OPHA 4OPZA 1MY8A 2H0TA 4RX3A 3OPPA 3WS0A 3TG9A 1S0WA 4UA7A 4EQIA 3WS5A 1E3UA 4N1HA 5DTKA 2Y2OA 1LI9A 4DKIA 2H5SA 2V20A 2XH9A 2V2FF 3HLEA 1LI0A 3Q81A 1RP5A 1WYBA 2XK1A 4U0TA 3UDIA 2Y2GA 3O88A 3IWOA 3GTCA 4S2LA 3HUMA 3B3XA 2WKIA 1KE3A 3HLBA 3WRZA 2XGNA 5DF8A 3LCEA 1JWZA 2Y59A 3UPOA 4M3KA 1TEMA 1ONGA 4BJPA 3NC8A 5EOEA 1K25A 3AGEA 3BFFA 4IBXA 5GLBA 1ZC2A 1OMEA 1FR1A 2WAEA 1PIOA 4LV3A 4ZJ2A 1ONHA 2WK0A 4F94A 3HVFA 1IELA 4BD0A 5A92A 4N9LA 3VP2A 3W4OA 1XXMA 3TOIA 1XGJA 1RCJA 2G2UA 4QJGA 2DRWA 2Y91A 3Q7VA 4JBFA 2OSUA 2ZM8A 3EQUA 4KQRA 4WBGA 4U3TA 3WWXA 3ZGAB 1I5QA 3WS1A 1ES3A 1SHVA 2PBYA 4XUXA 5CGSA 5GHYA 1LLBA 1JWVA 3RJUA 2XLNA 5GLAA 1FCOA 4ZAMA 2ZLYA 3S22A 4FCFA 1PWDA 3VOYA 5AQBA 3ZG7B 1BLCA 3ZG8B 3UPNA 3MZEA 4ZJ3A 1EWZA 3UDXA 2VGJA 3IWIA 1IYOA 3Q7ZA 4MNRA 4RVAA 1K54C 4CPKA 4DXCA 3DWKA 5CXWA 5EVIB 3IH8A 1BLHA 4WZ4A 3VP4A 1JTGA 4KENB 3S4XA 2G2WA 1EROA 4GDBA 2HP6A 1SDEA 1W7FA 1JTDA 5CHUA 2HDSA 3N8SA 5FI6A 1FSYA 1XKZA 1Q2PA 4OLDA 4K0XA 1KDWA 3S1YA 2PU2A 4OP5A 4PM9A 5E2GA 3VP0A 4LV0A 3FZCA 1NRFA 3IF6B 2WGWB 1ES2A 5IHVA 2XDMA 3C5AA 3VP3A 4E3KA 1MBLA 3C4OA 1PW8A 4MBKA 3UPPA 2WYXA 3V3SA 1CEGA 5FQIA 3BEBA 3BM6A 3GMWA 2EX9A 2XF3A 4E3IA 3VOZA 1U60A 4P6BA 3M6HA 3SOIA 1YLJA 1FOFA 5BOHA 1ALQA 3ITBA 5HFOA 4O7DA 3C4PA 5DF9A 4N92A 5GHZA 1GA9A 4NETA 1FR6A 1BSGA 1K56A 1KDSA 2ZQCA 4OQIA 3LY4A 1G68A 1IEMA 2EX2A 1BLPA 1WE4A 4PM5A 4H8RA 3MXSA 1G6AA 1I2SA 3D4FA 2HP9A 2P9VB 3C7UA 4IVIA 4WM9A 1ESUA 3E2LA 3WS4A 4KZAA 4EV4A 4OPRA 1CEFA 2ZD8A 1L0EA 3LY3A 5E43A 5AQAA 4OOLA 4DE0A 1PZPA 2R9XA 5HAQA 4KZ3A 5TR7A 3IWQA 3Q1FA 3HLFA 4OP8A 2IWDA 4Y0UA 4JXWA 5CEDA 3GV9A 5A91A 4QU3A 1ES5A 2FFYA 1PWCA 3CG5A 3LO7A 5FASA 1SDNA 2Z2LB 2ZQ8A 3G32A 4S2MA 3Q82A 5FQJA 5FATA 1ERMA 2XD1A 1Z6FA 2EFXA 5CRFA 2QMIA 2ZJ9A 2Y2PA 4P87A 1XP4A 3G2YA 4JF6A 1NY0A 1H5XA 4PPRA 1XPBA 1YQSA 2JC7A 5FA7A 2Y2QA 3IHAA 4S2PA 4R3BA 4WZ5C 3UO9A 4IVKA 5AQ9A 3EQVA 2ZC3B 2WZXA 3AGDA 4A5RA 5FQ9A 1K4EA 1M6KA 4KZ5A 2WKHA 2OLVA 2Y2LA 4E3OA 2ZQ7A 3OPLA 3CMZA 5JYOA 2QZ6A 3ZNYA 3BFGA 2Y55A 3IF6C 3WRTA 4DF6A 5A93A 5DTTA 2VGKA 1TDLA 1YMSA 4GOGA 4KZ7A 2H0YA 3IXGA 3P09A 2A3UA 5FAQA 2RL3A 1XX2A 5CGXA 4B4ZA 1KVMA 4KG2A 5CTNA 3HBRA 3IF5A 1W5DA 1BTLA 3SS4A 3VFFA 4KQQA 4DE1A 3W4QA 3FKWA 3A3FA 2DNSA 4R4RA 2FFFB 1W79A 2Y2NA 3DWZA 4X53A 5TFQA 4FH4A 1XA1A 5M19A 3OPRA 1W8YA 3SH9A 3UE1A 3N8LA 4X6TA 2XFTA 4BD1A 1GCEA 1K4FA 1NZUA 2ZC6B 3NDEA 3FKVA 3MKEA 3NIAA 4WMCD 1EI5A 1PWGA 1K57A 1NYYA 2ZQAA 3PTEA 3HLDA 3ISGA 4FH2A 4JF4A 4R3JA 4YFMA 1BZAA 1YM1A 3IQAA 5EVIA 1TDGA 4JKTA 4PM7A 4Y0TA 2XD5A 4ZJ1A 1IYSA 5HAIA 2Y2IA 4MBFA 3PAGA 4UAAA 3V3RA 5EVLA 2J9OA 1PI5A 1KGGA 1L2SA 4QB8A 4C75A 3UY6A 3N7WA 4R1GA 3MKFA 1YLZA 4C3QA 3NDGA 4OQ0A 1QMFA 3BECA 4EWFA 3G4PA 3IF6A 1YLPA 4GKUA 5KSHA 4C6YA 3ZVTA 4YINA 4U0XA 1MKIA 2WAFA 2E8IA 2C6WB 3V39A 4BLMA 4QY5A 1S6RA 5KZHA 3O86A 4EBLA 5U47A 5DF7A 2BLSA 4GD8A 4ID4A 2P74A 1LHYA 3HL9A 1O7EA 5AQ7A 3ZCZA 1ZG6A 4BENA 1E25A 3OCLA 3NCKA 4KG6A 4LENA 3ZVWA 2C5WB 1ES4A 1HTZA 5EVID 1BUEA 3IXDA 1KGEA 1TVFA 4WMCA 4KQOA 1QMEA 1JWPA 4DE2A 4B4XA 5HAPA 1JVJA 3BLMA 3V5MA 5DVAA 2CC1A 2P9VA 3G34A 4R23A 3VSKA 5L2FA 2JCHA 3UNWA 3PBNA 3W8KA 3ZNTA 3HUNA 1RGYA 4Z9QA 1MPLA 2GDNA 3GVBA 3NI9A 3RXWA 3BLSA 3G35A 5M1AA 1Y54A 2ZM0A 1NXYA 1YT4A 4OOYA 3FWLA 1H8YA 5E2FA 3VFHA 4E3LA 3N4IA 3OZHA 4JXVA 3PAEA 3IHBA 4JXGA 1BT5A 2ZM2A 3MZDA 1H8ZA 2B5RA 5GL9A 3V50A 2HPBA 2Q9MA 1NJ4A 1ZG4A 3A3JA 1GHPA 3GRJA 4RYEA 4Q8IA 3BRMA 3ZG5A 5TGFA 3BYDA 4GNUA 5EVIC 4R0QA 4GZBA 5EUAA 5EE8A 1HVBA 4X68A 1K56D 4X69A 3ZHHA 3PBQA 4GB7A 4WYYA 3DTMA 3MFDA 3SS3A 5M18A 5J8XA 3HUOA 4OPYA 4DE3A 1YLYA 4MLLA 4OOMA 4NK3A 1E4DA 4KG5A 1K55C 1KGFA 1BULA 4QY6A 1FQGA 4BL2A 4Y7PA 4KZ6A 3CZDA 4D2OA 1KE4A 3G30A 4JXSA 3UE0A 4P85A 2DCFA 2Y2JA 4K91A 2EXAA 2X71A 2X01A 3WS2A 5KSCA 3M2KA 1AXBA 4QD4A 4RA7A 2IWBA 4E6XA 5DTSA 2ZC7A 3UN7A 4P0MA 2OV5A 1M40A 1FCMA 4E6WA 2ZMAA 4IBRA 3ZDJA 1SKFA 3MBZA 5F82A 2Y2KA 1DJAA 1MWTA 4N1XA 1HD8A 2PU4A 5F1FA 2JBFA 1J9MA 1YLWA 1N4OA 4IEDA 1LL9A 1FSWA 4S2NA 4JPMA 3GR2A 3A3EA 3I7JA 5FAOA 4UHUA 5HL1A 4WEJA 2WADA 4CJNA 5EECA 1PI4A 2A49A 4EBNA 3FYZA 5F1GA 2HDRA 4WELA 3HLWA 3SH7A 2X02A 4OQGA 3E2KA 2EX6A 2Y2MA 4OVDA 2BG1A 3ZFZA 5CECA 3NY4A 1MWRA 5FQKA 3G2ZA 5E2HA 1L0FA 1MWUA 1N9BA 2ZC4B 4DDYA 2JE5A 4GDNA 3VSLA 1XGIA 2V1ZA 5G18A 3OCNA 1DJCA 4XUZA 2Q9NA 4N9KA 4FD8A 2ZQDA 1ERQA 1IYQA 4OQHA 2J7VA 2Y4AA 3MZFA 5CTMA 4B88A 4LV2A 4MEZA 1NYMA 4E3JA 1KVLA 2OLUA 1RGZA 3SH8A 3NBLA 3O87A 4KZ4A 1ESIA 1O07A 4GD6A 4OH0A 4E3NA 3N6IA 3O3VA 4BL3A 4EBPA 4E3MA 3GQZA 4RX2A 4BQMA 5HX9A 2ZQ9A 1K54A 4WZ5A 3UE3A 2RCXA 3PBRA 5I94A 5JYPA 4S2IA 3W4PA 3DW0A 1CI8A 4WEKA 2WGVA 5F83A 5CERA 2R9WA 1GHMA 1PW1A 4JLFA 1IKIA 1K6SA 1CK3A 5HARA 1NZOA 3QHYA 3GSGA 3A3DA 4L0LA 1W8QA 2UWXA 1DY6A 4KZ9A 3G31A 4OPQA 1KE0A 4PM8A 4Y0OA 1GA0A 4UA9A 1Q2QA 4QHCA 5CHJA 3FV7A 3ZG0A 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYI A;  3Q07 A;  4DRT A;  1YMX A;  5FAP A;  1HZO A;  4S2O A;  4UA6 A;  1WYC A;  2WKE A;  3C7V A;  1DJB A;  4KZ8 A;  1PYY A;  4X56 A;  2QPN A;  5FSR A;  1L0G A;  3CJM A;  4KZB A;  3QNB A;  3IT9 A;  5CHM A;  3VMA A;  1C3B A;  4HEF A;  3BFC A;  4OON A;  1FCN A;  2I72 A;  4PMA A;  5FI2 A;  1L0D A;  4DDS A;  5GLC A;  1XA7 A;  3QNC A;  4DXB A;  3HLG A;  1VQQ A;  3N8R A;  5EPH A;  2XR0 A;  3P98 A;  4S2K A;  1K55 A;  5FQQ A;  4HBT A;  3PBS A;  5FI7 A;  1GHI A;  4LCL A;  4JF5 A;  2WGI A;  4K0W A;  2EFU A;  4FSF A;  4HES A;  1ZKJ A;  2Z2M B;  5CGW A;  5KMW A;  4S2J A;  4GN2 A;  1MXO A;  2WGW A;  3Q7V B;  4R4S A;  1K57 C;  3IXH A;  3ITA A;  2EX8 A;  3OC2 A;  2XFS A;  1E3U D;  5EOO A;  5GHX A;  2EXB A;  3HLC A;  3M2J A;  3UDF A;  2HDQ A;  5A90 A;  3BFD A;  4PM6 A;  2ZC5 B;  2HDU A;  3PBT A;  4LCM A;  1LL5 A;  5D3O A;  3MXR A;  1PZO A;  3AGF A;  3IXB A;  2IWC A;  4S2N C;  4ZTK A;  5FQM A;  1K38 A;  2H10 A;  3M6B A;  5HW3 A;  1YLT A;  5CEB A;  1IKG A;  1IYP A;  1I2W A;  4XXR A;  4X55 A;  3VP1 A;  2J8Y A;  5FDH A;  3PBO A;  2HP5 A;  2J9P A;  1BLS A;  3HRE A;  4HBU A;  4OLG A;  3TSG A;  4ZDX A;  3LEZ A;  4ZBE A;  3RXX A;  1VM1 A;  2Y2H A;  2WZZ A;  3A3I A;  4OKP A;  1K6R A;  5GLD A;  2XQZ A;  1MWS A;  3SS5 A;  1SCW A;  3ZG9 B;  3BFE A;  2WUQ A;  3IH9 A;  4MBH A;  4EUZ A;  1CI9 A;  4LV1 A;  5E2E A;  3OPH A;  4OPZ A;  1MY8 A;  2H0T A;  4RX3 A;  3OPP A;  3WS0 A;  3TG9 A;  1S0W A;  4UA7 A;  4EQI A;  3WS5 A;  1E3U A;  4N1H A;  5DTK A;  2Y2O A;  1LI9 A;  4DKI A;  2H5S A;  2V20 A;  2XH9 A;  2V2F F;  3HLE A;  1LI0 A;  3Q81 A;  1RP5 A;  1WYB A;  2XK1 A;  4U0T A;  3UDI A;  2Y2G A;  3O88 A;  3IWO A;  3GTC A;  4S2L A;  3HUM A;  3B3X A;  2WKI A;  1KE3 A;  3HLB A;  3WRZ A;  2XGN A;  5DF8 A;  3LCE A;  1JWZ A;  2Y59 A;  3UPO A;  4M3K A;  1TEM A;  1ONG A;  4BJP A;  3NC8 A;  5EOE A;  1K25 A;  3AGE A;  3BFF A;  4IBX A;  5GLB A;  1ZC2 A;  1OME A;  1FR1 A;  2WAE A;  1PIO A;  4LV3 A;  4ZJ2 A;  1ONH A;  2WK0 A;  4F94 A;  3HVF A;  1IEL A;  4BD0 A;  5A92 A;  4N9L A;  3VP2 A;  3W4O A;  1XXM A;  3TOI A;  1XGJ A;  1RCJ A;  2G2U A;  4QJG A;  2DRW A;  2Y91 A;  3Q7V A;  4JBF A;  2OSU A;  2ZM8 A;  3EQU A;  4KQR A;  4WBG A;  4U3T A;  3WWX A;  3ZGA B;  1I5Q A;  3WS1 A;  1ES3 A;  1SHV A;  2PBY A;  4XUX A;  5CGS A;  5GHY A;  1LLB A;  1JWV A;  3RJU A;  2XLN A;  5GLA A;  1FCO A;  4ZAM A;  2ZLY A;  3S22 A;  4FCF A;  1PWD A;  3VOY A;  5AQB A;  3ZG7 B;  1BLC A;  3ZG8 B;  3UPN A;  3MZE A;  4ZJ3 A;  1EWZ A;  3UDX A;  2VGJ A;  3IWI A;  1IYO A;  3Q7Z A;  4MNR A;  4RVA A;  1K54 C;  4CPK A;  4DXC A;  3DWK A;  5CXW A;  5EVI B;  3IH8 A;  1BLH A;  4WZ4 A;  3VP4 A;  1JTG A;  4KEN B;  3S4X A;  2G2W A;  1ERO A;  4GDB A;  2HP6 A;  1SDE A;  1W7F A;  1JTD A;  5CHU A;  2HDS A;  3N8S A;  5FI6 A;  1FSY A;  1XKZ A;  1Q2P A;  4OLD A;  4K0X A;  1KDW A;  3S1Y A;  2PU2 A;  4OP5 A;  4PM9 A;  5E2G A;  3VP0 A;  4LV0 A;  3FZC A;  1NRF A;  3IF6 B;  2WGW B;  1ES2 A;  5IHV A;  2XDM A;  3C5A A;  3VP3 A;  4E3K A;  1MBL A;  3C4O A;  1PW8 A;  4MBK A;  3UPP A;  2WYX A;  3V3S A;  1CEG A;  5FQI A;  3BEB A;  3BM6 A;  3GMW A;  2EX9 A;  2XF3 A;  4E3I A;  3VOZ A;  1U60 A;  4P6B A;  3M6H A;  3SOI A;  1YLJ A;  1FOF A;  5BOH A;  1ALQ A;  3ITB A;  5HFO A;  4O7D A;  3C4P A;  5DF9 A;  4N92 A;  5GHZ A;  1GA9 A;  4NET A;  1FR6 A;  1BSG A;  1K56 A;  1KDS A;  2ZQC A;  4OQI A;  3LY4 A;  1G68 A;  1IEM A;  2EX2 A;  1BLP A;  1WE4 A;  4PM5 A;  4H8R A;  3MXS A;  1G6A A;  1I2S A;  3D4F A;  2HP9 A;  2P9V B;  3C7U A;  4IVI A;  4WM9 A;  1ESU A;  3E2L A;  3WS4 A;  4KZA A;  4EV4 A;  4OPR A;  1CEF A;  2ZD8 A;  1L0E A;  3LY3 A;  5E43 A;  5AQA A;  4OOL A;  4DE0 A;  1PZP A;  2R9X A;  5HAQ A;  4KZ3 A;  5TR7 A;  3IWQ A;  3Q1F A;  3HLF A;  4OP8 A;  2IWD A;  4Y0U A;  4JXW A;  5CED A;  3GV9 A;  5A91 A;  4QU3 A;  1ES5 A;  2FFY A;  1PWC A;  3CG5 A;  3LO7 A;  5FAS A;  1SDN A;  2Z2L B;  2ZQ8 A;  3G32 A;  4S2M A;  3Q82 A;  5FQJ A;  5FAT A;  1ERM A;  2XD1 A;  1Z6F A;  2EFX A;  5CRF A;  2QMI A;  2ZJ9 A;  2Y2P A;  4P87 A;  1XP4 A;  3G2Y A;  4JF6 A;  1NY0 A;  1H5X A;  4PPR A;  1XPB A;  1YQS A;  2JC7 A;  5FA7 A;  2Y2Q A;  3IHA A;  4S2P A;  4R3B A;  4WZ5 C;  3UO9 A;  4IVK A;  5AQ9 A;  3EQV A;  2ZC3 B;  2WZX A;  3AGD A;  4A5R A;  5FQ9 A;  1K4E A;  1M6K A;  4KZ5 A;  2WKH A;  2OLV A;  2Y2L A;  4E3O A;  2ZQ7 A;  3OPL A;  3CMZ A;  5JYO A;  2QZ6 A;  3ZNY A;  3BFG A;  2Y55 A;  3IF6 C;  3WRT A;  4DF6 A;  5A93 A;  5DTT A;  2VGK A;  1TDL A;  1YMS A;  4GOG A;  4KZ7 A;  2H0Y A;  3IXG A;  3P09 A;  2A3U A;  5FAQ A;  2RL3 A;  1XX2 A;  5CGX A;  4B4Z A;  1KVM A;  4KG2 A;  5CTN A;  3HBR A;  3IF5 A;  1W5D A;  1BTL A;  3SS4 A;  3VFF A;  4KQQ A;  4DE1 A;  3W4Q A;  3FKW A;  3A3F A;  2DNS A;  4R4R A;  2FFF B;  1W79 A;  2Y2N A;  3DWZ A;  4X53 A;  5TFQ A;  4FH4 A;  1XA1 A;  5M19 A;  3OPR A;  1W8Y A;  3SH9 A;  3UE1 A;  3N8L A;  4X6T A;  2XFT A;  4BD1 A;  1GCE A;  1K4F A;  1NZU A;  2ZC6 B;  3NDE A;  3FKV A;  3MKE A;  3NIA A;  4WMC D;  1EI5 A;  1PWG A;  1K57 A;  1NYY A;  2ZQA A;  3PTE A;  3HLD A;  3ISG A;  4FH2 A;  4JF4 A;  4R3J A;  4YFM A;  1BZA A;  1YM1 A;  3IQA A;  5EVI A;  1TDG A;  4JKT A;  4PM7 A;  4Y0T A;  2XD5 A;  4ZJ1 A;  1IYS A;  5HAI A;  2Y2I A;  4MBF A;  3PAG A;  4UAA A;  3V3R A;  5EVL A;  2J9O A;  1PI5 A;  1KGG A;  1L2S A;  4QB8 A;  4C75 A;  3UY6 A;  3N7W A;  4R1G A;  3MKF A;  1YLZ A;  4C3Q A;  3NDG A;  4OQ0 A;  1QMF A;  3BEC A;  4EWF A;  3G4P A;  3IF6 A;  1YLP A;  4GKU A;  5KSH A;  4C6Y A;  3ZVT A;  4YIN A;  4U0X A;  1MKI A;  2WAF A;  2E8I A;  2C6W B;  3V39 A;  4BLM A;  4QY5 A;  1S6R A;  5KZH A;  3O86 A;  4EBL A;  5U47 A;  5DF7 A;  2BLS A;  4GD8 A;  4ID4 A;  2P74 A;  1LHY A;  3HL9 A;  1O7E A;  5AQ7 A;  3ZCZ A;  1ZG6 A;  4BEN A;  1E25 A;  3OCL A;  3NCK A;  4KG6 A;  4LEN A;  3ZVW A;  2C5W B;  1ES4 A;  1HTZ A;  5EVI D;  1BUE A;  3IXD A;  1KGE A;  1TVF A;  4WMC A;  4KQO A;  1QME A;  1JWP A;  4DE2 A;  4B4X A;  5HAP A;  1JVJ A;  3BLM A;  3V5M A;  5DVA A;  2CC1 A;  2P9V A;  3G34 A;  4R23 A;  3VSK A;  5L2F A;  2JCH A;  3UNW A;  3PBN A;  3W8K A;  3ZNT A;  3HUN A;  1RGY A;  4Z9Q A;  1MPL A;  2GDN A;  3GVB A;  3NI9 A;  3RXW A;  3BLS A;  3G35 A;  5M1A A;  1Y54 A;  2ZM0 A;  1NXY A;  1YT4 A;  4OOY A;  3FWL A;  1H8Y A;  5E2F A;  3VFH A;  4E3L A;  3N4I A;  3OZH A;  4JXV A;  3PAE A;  3IHB A;  4JXG A;  1BT5 A;  2ZM2 A;  3MZD A;  1H8Z A;  2B5R A;  5GL9 A;  3V50 A;  2HPB A;  2Q9M A;  1NJ4 A;  1ZG4 A;  3A3J A;  1GHP A;  3GRJ A;  4RYE A;  4Q8I A;  3BRM A;  3ZG5 A;  5TGF A;  3BYD A;  4GNU A;  5EVI C;  4R0Q A;  4GZB A;  5EUA A;  5EE8 A;  1HVB A;  4X68 A;  1K56 D;  4X69 A;  3ZHH A;  3PBQ A;  4GB7 A;  4WYY A;  3DTM A;  3MFD A;  3SS3 A;  5M18 A;  5J8X A;  3HUO A;  4OPY A;  4DE3 A;  1YLY A;  4MLL A;  4OOM A;  4NK3 A;  1E4D A;  4KG5 A;  1K55 C;  1KGF A;  1BUL A;  4QY6 A;  1FQG A;  4BL2 A;  4Y7P A;  4KZ6 A;  3CZD A;  4D2O A;  1KE4 A;  3G30 A;  4JXS A;  3UE0 A;  4P85 A;  2DCF A;  2Y2J A;  4K91 A;  2EXA A;  2X71 A;  2X01 A;  3WS2 A;  5KSC A;  3M2K A;  1AXB A;  4QD4 A;  4RA7 A;  2IWB A;  4E6X A;  5DTS A;  2ZC7 A;  3UN7 A;  4P0M A;  2OV5 A;  1M40 A;  1FCM A;  4E6W A;  2ZMA A;  4IBR A;  3ZDJ A;  1SKF A;  3MBZ A;  5F82 A;  2Y2K A;  1DJA A;  1MWT A;  4N1X A;  1HD8 A;  2PU4 A;  5F1F A;  2JBF A;  1J9M A;  1YLW A;  1N4O A;  4IED A;  1LL9 A;  1FSW A;  4S2N A;  4JPM A;  3GR2 A;  3A3E A;  3I7J A;  5FAO A;  4UHU A;  5HL1 A;  4WEJ A;  2WAD A;  4CJN A;  5EEC A;  1PI4 A;  2A49 A;  4EBN A;  3FYZ A;  5F1G A;  2HDR A;  4WEL A;  3HLW A;  3SH7 A;  2X02 A;  4OQG A;  3E2K A;  2EX6 A;  2Y2M A;  4OVD A;  2BG1 A;  3ZFZ A;  5CEC A;  3NY4 A;  1MWR A;  5FQK A;  3G2Z A;  5E2H A;  1L0F A;  1MWU A;  1N9B A;  2ZC4 B;  4DDY A;  2JE5 A;  4GDN A;  3VSL A;  1XGI A;  2V1Z A;  5G18 A;  3OCN A;  1DJC A;  4XUZ A;  2Q9N A;  4N9K A;  4FD8 A;  2ZQD A;  1ERQ A;  1IYQ A;  4OQH A;  2J7V A;  2Y4A A;  3MZF A;  5CTM A;  4B88 A;  4LV2 A;  4MEZ A;  1NYM A;  4E3J A;  1KVL A;  2OLU A;  1RGZ A;  3SH8 A;  3NBL A;  3O87 A;  4KZ4 A;  1ESI A;  1O07 A;  4GD6 A;  4OH0 A;  4E3N A;  3N6I A;  3O3V A;  4BL3 A;  4EBP A;  4E3M A;  3GQZ A;  4RX2 A;  4BQM A;  5HX9 A;  2ZQ9 A;  1K54 A;  4WZ5 A;  3UE3 A;  2RCX A;  3PBR A;  5I94 A;  5JYP A;  4S2I A;  3W4P A;  3DW0 A;  1CI8 A;  4WEK A;  2WGV A;  5F83 A;  5CER A;  2R9W A;  1GHM A;  1PW1 A;  4JLF A;  1IKI A;  1K6S A;  1CK3 A;  5HAR A;  1NZO A;  3QHY A;  3GSG A;  3A3D A;  4L0L A;  1W8Q A;  2UWX A;  1DY6 A;  4KZ9 A;  3G31 A;  4OPQ A;  1KE0 A;  4PM8 A;  4Y0O A;  1GA0 A;  4UA9 A;  1Q2Q A;  4QHC A;  5CHJ A;  3FV7 A;  3ZG0 A;  2XEP A; 
#chains in the Genus database with same CATH topology
 3JYI A;  4Y13 A;  3U4L P;  4GW9 A;  4KZ8 A;  4X56 A;  2QPN A;  4KZB A;  5CHM A;  3VMA A;  1C3B A;  4OON A;  1FCN A;  4PMA A;  5FI2 A;  2J3T D;  5GLC A;  1XA7 A;  3QNC A;  4DXB A;  3N8R A;  1PNE A;  4S2K A;  5FQQ A;  5AJG A;  2WGI A;  3JVU A;  5F5Y A;  4S2J A;  3KSF A;  3MXQ A;  1DRM A;  3Q7V B;  1K57 C;  3ITA A;  2KDK A;  3UDF A;  1E3U D;  3HLC A;  3M2J A;  3E4P A;  4PM6 A;  3PBT A;  3CHW P;  2H10 A;  2ZOI A;  1IYP A;  1I2W A;  3VP1 A;  2HP5 A;  3DAV A;  4OKP A;  3QP8 A;  3BJN A;  4MBH A;  4EUZ A;  1MY8 A;  3WS0 A;  3R4K A;  1TF1 A;  3WS5 A;  2WKR A;  2J3W A;  1LI9 A;  2XH9 A;  1WYB A;  2VX8 A;  2Y2G A;  2ZL1 B;  3O88 A;  4PAU A;  3H82 A;  2YKH A;  4S2L A;  3B3X A;  1KE3 A;  2XGN A;  5DF8 A;  1OJG A;  5EVE A;  3C30 A;  3NC8 A;  5EOE A;  3AGE A;  1CQA A;  3BFF A;  4LV3 A;  2WK0 A;  2VKS A;  1SKO A;  2V8C A;  4BD0 A;  3DTE A;  4MN5 A;  5TBM B;  3W4O A;  4YNR A;  4JBF A;  2OSU A;  2ZM8 A;  4U3T A;  4YWZ A;  1I5Q A;  2PBY A;  1SHV A;  1LLB A;  3RJU A;  2XLN A;  4ZAM A;  1BYW A;  5AQB A;  1BLC A;  3ZG8 B;  2W3F A;  2VGL S;  2VGJ A;  4MNR A;  4CPK A;  1K54 C;  1BLH A;  3VP4 A;  4KEN B;  5CHU A;  3LR4 A;  4OLD A;  4K0X A;  2M1C A;  3VP0 A;  1NRF A;  2XDM A;  4Z1W A;  3MQO A;  2E8J A;  2L0W A;  1VB6 A;  2WYX A;  3S7Q A;  3V3S A;  3BM6 A;  1U60 A;  1S1Y A;  3C8C A;  1ALQ A;  3ITB A;  5HFO A;  5DF9 A;  4N92 A;  3LY4 A;  1G68 A;  2HP9 A;  3LEQ A;  3WS4 A;  3IX8 A;  4EV4 A;  3MSH A;  4OPR A;  4MN7 A;  5E43 A;  4JGQ A;  4Y17 A;  4OOL A;  3CI6 A;  3IWQ A;  3HLF A;  4JXW A;  3LYX A;  1ES5 A;  2FFY A;  3LIE A;  2Z2L B;  3G32 A;  2XD1 A;  4ARZ A;  1XP4 A;  2XSS A;  4BBV A;  1XPB A;  3K3C A;  2ACG A;  4R3B A;  4WZ5 C;  5AQ9 A;  3AGD A;  5FQ9 A;  4BBT A;  2B02 A;  2Y2L A;  2ZQ7 A;  3ULF A;  4I39 A;  4GCZ A;  5JYO A;  3PR6 A;  3IF6 C;  4DF6 A;  3A0V A;  1OT9 A;  3SS4 A;  4KQQ A;  1AWI A;  3VE3 A;  4X53 A;  1XJ3 A;  5M19 A;  1W8Y A;  4HH3 A;  5F69 A;  1STZ A;  1OJ5 A;  3MKE A;  3NIA A;  4WMC D;  1K57 A;  4GLQ A;  4R38 A;  1N9O A;  1L3L A;  1BZA A;  3IQA A;  4H6J B;  1LSX A;  5HAI A;  1MC0 A;  2Z6D A;  4X1M A;  3UB7 A;  4UAA A;  2J9O A;  4QB8 A;  3CPT A;  2O0Y A;  3H9W A;  1QMF A;  4EWF A;  3KSI A;  3IF6 A;  4R70 A;  3VV4 A;  4G3V A;  2PR6 A;  3ZVT A;  2C6W B;  5I5L A;  4BLM A;  4NG2 A;  1TS8 A;  3O86 A;  4EBL A;  2BLS A;  4GD8 A;  3HL9 A;  4ESP A;  2W1R A;  1ES4 A;  3T4L A;  1BUE A;  2YKF A;  1KGE A;  4DE2 A;  4B4X A;  4NXB A;  1NLY A;  3V5M A;  3IBR A;  3VSK A;  3ZNT A;  4EER A;  4UEY A;  3BLS A;  1Y54 A;  2ZM0 A;  3F1O B;  3IHB A;  2JKR I;  3T4J A;  1BT5 A;  2B5R A;  3V50 A;  2HPB A;  2G7U A;  3A3J A;  1GHP A;  4HOI A;  3BRM A;  3BYD A;  5EVI C;  3PHY A;  4X69 A;  3ZHH A;  5EM1 A;  4GB7 A;  3DTM A;  4II7 A;  3SS3 A;  1XJ4 A;  1D7E A;  5J8X A;  4MLL A;  5HPI A;  3PXP A;  2VEA A;  2AVX A;  4KG5 A;  4QY6 A;  1FQG A;  4KZ6 A;  2QYB A;  4K91 A;  3KYZ A;  4DJ3 A;  2W3H A;  2OV5 A;  3NEC A;  3MBZ A;  4N1X A;  3IS2 A;  5HWV A;  1J9M A;  1GSW A;  1N4O A;  1LL9 A;  3T4Q A;  3GR2 A;  4UHU A;  4WEJ A;  2WAD A;  1OTB A;  3P01 A;  4EBN A;  2HDR A;  3B33 A;  4OQG A;  4LLO B;  5CEC A;  1T1C A;  2JE5 A;  1PFL A;  4JGP A;  3OCN A;  4FD8 A;  3B47 A;  2ZQD A;  5FDS A;  3MZF A;  4LV2 A;  4E3J A;  3EEA A;  3BW6 A;  2OLU A;  4ETZ A;  4I38 A;  2VZW A;  4GD6 A;  4OH0 A;  2I9V A;  1EW0 A;  3SW1 A;  2ZQ9 A;  1K54 A;  4WZ5 A;  5HZH A;  5JYP A;  4S2I A;  3DW0 A;  4WEK A;  4HJ4 A;  1GHM A;  4JLF A;  1V9Y A;  3UO9 A;  4PM8 A;  1Q2Q A;  4QHC A;  2XEP A;  3ZQ5 A;  5FAP A;  2WKE A;  1PYY A;  2JKT I;  5FSR A;  1L0G A;  1NLZ A;  3QNB A;  3IT9 A;  2I72 A;  1N9N A;  4UQI M;  4LRX C;  1VEU A;  2A24 B;  1GHI A;  4JF5 A;  4K0W A;  4JGO A;  2Z2M B;  5KMW A;  4XT2 A;  4R3A A;  2WGW A;  1N9L A;  3IXH A;  3MFX A;  5EOO A;  5GHX A;  2EXB A;  3BFD A;  2HDU A;  5MC7 A;  5TJJ A;  4PHT A;  3IXB A;  4EXO A;  3MQ0 A;  1YLT A;  4X55 A;  3TSG A;  4OLG A;  2J9P A;  3HRE A;  1BLS A;  1S67 L;  2PT7 A;  3PBO A;  4DJ2 A;  4E04 A;  3LEZ A;  3A3I A;  5GLD A;  3SS5 A;  3ZG9 B;  1F98 A;  1LSV A;  4LV1 A;  2PYP A;  3OPH A;  2H0T A;  3OPP A;  1S0W A;  4UA7 A;  4BBU A;  4DKI A;  2H5S A;  4O01 A;  3HLE A;  3O5Y A;  1LI0 A;  4HIA A;  1RP5 A;  2XK1 A;  1V9Z A;  3UDI A;  2FH5 A;  3H7W B;  5DJT A;  3HLB A;  4M3K A;  1TEM A;  2ZBB A;  4BJP A;  3LID A;  4IBX A;  1OME A;  2L4R A;  2DMW A;  3V67 A;  1IEL A;  3JPU A;  5A92 A;  4HY8 A;  4N9L A;  4Q0I A;  1XXM A;  1K0K A;  5FEG A;  1XGJ A;  3Q7V A;  3EQU A;  4KQR A;  2PDR A;  4XUX A;  5CGS A;  5GHY A;  3S22 A;  4FCF A;  3UE6 A;  3VOY A;  4R6L A;  4ZJ3 A;  1EWZ A;  2PD7 A;  3IWI A;  3UB9 A;  5EVI B;  1S4S A;  3T12 B;  2G2W A;  1ERO A;  1JTD A;  1XKZ A;  3NHQ A;  4OP5 A;  3TJZ C;  5AVF A;  4FOF A;  2WGW B;  3VP3 A;  1XJ6 A;  4E3K A;  1MBL A;  1T18 A;  4MBK A;  4Q0H A;  3UPP A;  2UV0 E;  3VOZ A;  2KX6 A;  3M6H A;  1FOF A;  5BOH A;  3C4P A;  5HD5 A;  4NET A;  3NOP C;  4G3W A;  2VV8 A;  2ZQC A;  3T1X A;  3BWL A;  2QJ7 A;  1IEM A;  3A0R A;  2EX2 A;  1WE4 A;  4H8R A;  1I2S A;  2W27 A;  3C7U A;  1ESU A;  4KZA A;  3RH8 B;  1SKO B;  4DE0 A;  5HAQ A;  3Q1F A;  5CED A;  3T4K A;  5DJU A;  1PWC A;  3F1P B;  2PBD P;  2ZQ8 A;  3DBA A;  2V1B A;  1G6O A;  3BQA A;  3Q82 A;  4GJ4 A;  1Z6F A;  2EFX A;  5CRF A;  2W3E A;  4CLC C;  4P87 A;  3G2Y A;  4JF6 A;  4X25 A;  1NY0 A;  5FA7 A;  3H7W A;  4FTX A;  4S2P A;  3QP4 A;  3EQV A;  2ZC3 B;  3L9K A;  4A5R A;  2VK3 A;  4P6Z S;  3CMZ A;  3KSG A;  3E0Y A;  5HPF A;  1TDL A;  4GOG A;  3IXG A;  1ACF A;  3P09 A;  2RL3 A;  3LIC A;  2CMN A;  2KLI A;  3HBR A;  3IF5 A;  3VFF A;  2XA7 S;  3TE8 A;  2FFF B;  5AVE A;  4FH4 A;  2J3T C;  3OPR A;  3UE1 A;  3N8L A;  4X6T A;  4BD1 A;  3NDE A;  3P7N A;  3PTE A;  4JF4 A;  1YM1 A;  1D06 A;  5EVI A;  5HDD A;  4Y0T A;  4ZJ1 A;  1IYS A;  3V3R A;  3EEH A;  3N7W A;  4C3Q A;  3BEC A;  3G4P A;  2E8I A;  3V39 A;  1S6R A;  4MCW A;  5KZH A;  1VET A;  2P74 A;  1LHY A;  1E25 A;  3NCK A;  3ZVW A;  5EVI D;  4K08 A;  3IXD A;  4LFU A;  1TVF A;  3NOT C;  5L2F A;  2W3G A;  1MPL A;  2GDN A;  1NXY A;  3UMD A;  1H3Q A;  1YT4 A;  4OOY A;  1H8Y A;  4HI4 A;  2INW A;  4JXV A;  3F1P A;  1VHM A;  4JXG A;  2GX5 A;  2ZM2 A;  2Q9M A;  3UB8 A;  1ZG4 A;  3ZG5 A;  3MF0 A;  5EUA A;  4GZB A;  3GDI A;  5EM0 A;  1X0O A;  4GS9 A;  4JGR A;  1F9I A;  2B18 A;  3KYQ A;  2ZMF A;  2P04 A;  4OPY A;  4DE3 A;  4CQH A;  1K55 C;  1KGF A;  3CPT B;  3HJK A;  1NRJ A;  3G30 A;  4D2O A;  2EXA A;  5KSC A;  2X01 A;  2ZC7 A;  2O9B A;  1M40 A;  1FCM A;  2EWW A;  3ZDJ A;  1SKF A;  2JKT M;  2NUP C;  1HD8 A;  3VE4 A;  1FSW A;  4S2N A;  4JPM A;  3I7J A;  3A3E A;  4CJN A;  5F1G A;  2ZOH A;  4WEL A;  3HLW A;  3EGX C;  2BG1 A;  5FQK A;  5E2H A;  1N9B A;  2ZC4 B;  4HHD A;  4ME4 A;  4FUW A;  4N9K A;  1ERQ A;  1IYQ A;  4OQH A;  2Y4A A;  5CTM A;  4MN6 A;  3W2Z A;  4MEZ A;  1NYM A;  2HJE A;  5IT5 A;  3SH8 A;  1ESI A;  2V0W A;  4E3N A;  4BL3 A;  3O3V A;  3LIF A;  4E3M A;  3T1R A;  2RCX A;  4WLA A;  5I94 A;  3W4P A;  2XA7 M;  5L09 A;  5F83 A;  5HSQ A;  1UGU A;  4WF0 A;  1DY6 A;  4KZ9 A;  1KE0 A;  4MMN A;  1GA0 A;  3FV7 A;  4EW7 A;  1XJ2 A;  4DRT A;  1WYC A;  3C7V A;  4KUK A;  1P97 A;  3S7P A;  3T1S A;  4HEF A;  3BFC A;  3H82 B;  4DDS A;  1L0D A;  3KX0 X;  3HLG A;  1VQQ A;  5EPH A;  3T4O A;  4LCL A;  3U2A A;  4FSF A;  4HES A;  1ZKJ A;  5CGW A;  1HLU P;  3HCY A;  4GN2 A;  2EX8 A;  2XFS A;  2HDQ A;  1DP9 A;  3MS6 A;  5A90 A;  2ZC5 B;  4LCM A;  5D3O A;  1LL5 A;  3IX3 A;  3IS2 B;  4ZTK A;  3M6B A;  5HW3 A;  5CEB A;  1IKG A;  2HZ5 A;  2FZ0 A;  2XRO A;  2J8Y A;  5FDH A;  4ZDX A;  1J3W A;  4HBU A;  5IU1 A;  1VM1 A;  2WZZ A;  4NXG A;  2XQZ A;  1MWS A;  1SCW A;  3IH9 A;  2ZMV A;  1CI9 A;  5E2E A;  4OPZ A;  4RX3 A;  4EQI A;  4N1H A;  1OTE A;  2Y2O A;  3T1Q B;  1OTI A;  1TS6 A;  3E98 A;  2V2F F;  3Q81 A;  1FIL A;  3L7H A;  4DMZ A;  3IWO A;  3VOL A;  3HUM A;  2WKI A;  2V0U A;  3LCE A;  4HJ6 A;  2GZA A;  3QP1 A;  2IA2 A;  2A24 A;  3GEC A;  1PIO A;  4ZJ2 A;  5F68 A;  4F94 A;  4QPR A;  5L07 A;  4Q0J A;  1JNU A;  2QWS A;  2LB5 A;  3R7W B;  1RCJ A;  2G2U A;  3D9Y A;  1UWN X;  3WWX A;  1CJF A;  3BY8 A;  5GLA A;  1FCO A;  4I5S A;  2ZLY A;  4ARZ B;  5L10 A;  4M4X A;  2JKR M;  3MZE A;  1IYO A;  3Q7Z A;  2LB9 A;  4RVA A;  5CXW A;  3C2W A;  4WZ4 A;  1JTG A;  3S4X A;  4GDB A;  3S7O A;  2W1T B;  1W7F A;  2HDS A;  5FI6 A;  1FSY A;  2EA9 A;  1Q2P A;  5E2G A;  4LV0 A;  3FZC A;  5IHV A;  2D01 A;  3C5A A;  1PW8 A;  3A0S A;  2QJ5 A;  1OT6 A;  3BEB A;  4P6B A;  3SOI A;  4P6Z M;  5GHZ A;  1BSG A;  1K56 A;  3QP6 A;  4OQI A;  1BLP A;  2O9A A;  3MXS A;  1G6A A;  5DKL A;  3D4F A;  2P9V B;  4IVI A;  3S7N A;  1GSX A;  5HWT A;  1CEF A;  3LY3 A;  5AQA A;  1PZP A;  5TBM A;  4Y0U A;  4OP8 A;  2IWD A;  5A91 A;  2HJ9 C;  3KYE A;  1Y28 A;  4QU3 A;  3LO7 A;  3CG5 A;  5FAS A;  1IOU A;  4S2M A;  1ERM A;  2QMI A;  2BAS A;  2ZJ9 A;  3QP2 A;  3D3O A;  1H5X A;  2W0N A;  4IVK A;  3JVV A;  2WZX A;  1D1J A;  4F3L A;  2PD8 A;  4KZ5 A;  2WKH A;  5EV0 A;  5KIZ A;  3B42 A;  3OPL A;  3ZNY A;  3BFG A;  2Y55 A;  3WRT A;  1GSV A;  5DTT A;  2VGK A;  2PHY A;  1H8M A;  1W63 M;  5FAQ A;  5CGX A;  1DP8 A;  1XX2 A;  1KVM A;  4KG2 A;  1W5D A;  1BTL A;  2OAQ 1;  2P08 A;  2DNS A;  3A3F A;  3ICY A;  1W79 A;  2Y2N A;  3DWZ A;  1G28 A;  3T4S A;  5K5B A;  1K4F A;  1NZU A;  2ZC6 B;  3ZYT A;  3FKV A;  3IBJ A;  1NYY A;  3ISG A;  4FH2 A;  3OOV A;  3K2N A;  4L9G A;  4PM7 A;  2Y79 A;  2XD5 A;  4LGW A;  3OLO A;  1PI5 A;  1L2S A;  4Y15 A;  3UY6 A;  4I3I A;  4R1G A;  3MKF A;  1TD5 A;  3NDG A;  4CLC B;  1TS7 A;  2M7V A;  2M7U A;  4GKU A;  4C6Y A;  4YIN A;  1KOU A;  1MKI A;  2PYR A;  2WAF A;  4EUV A;  4NEE D;  4BWI A;  5U47 A;  4ID4 A;  4Y3I A;  2QHK A;  1O7E A;  1ZG6 A;  4BEN A;  3OCL A;  4KG6 A;  5HDS A;  2OWH A;  4KQO A;  3T50 A;  1QME A;  5HAP A;  5DVA A;  3CLO A;  2CC1 A;  2P9V A;  4L9E A;  3UNW A;  3PBN A;  4EEU A;  1RGY A;  3UB5 P;  2VLG A;  3GVB A;  3DTK A;  5G4Z A;  3FWL A;  1LSW A;  3VFH A;  4E3L A;  3OZH A;  4O0P A;  1H8Z A;  4RQ9 A;  2K7S A;  2Z6C A;  3GRJ A;  4RYE A;  4GNU A;  1HVB A;  1DP6 A;  4X68 A;  1K56 D;  3PBQ A;  4H6J A;  3MFD A;  5M18 A;  3HUO A;  4HP4 A;  4NK3 A;  1E4D A;  4Y7P A;  5L8M A;  4JXS A;  1S66 L;  2DCF A;  2Y2J A;  2X71 A;  3KO6 A;  3WS2 A;  2XRN A;  3M2K A;  4QD4 A;  4HJ3 A;  2IWB A;  4E6X A;  4HP9 A;  2GNX A;  3UN7 A;  2Y2K A;  2B95 A;  2PU4 A;  2JBF A;  4EET B;  1YLW A;  2W3D A;  2P7J A;  1XFQ A;  5HL1 A;  5EEC A;  2A49 A;  3FYZ A;  2BTF P;  2L1M A;  5IS1 A;  5C5K A;  2V1A A;  2X02 A;  3ZFZ A;  3NY4 A;  1MWR A;  1L0F A;  1MWU A;  1ZTU A;  4DDY A;  3MJQ A;  3RFB A;  1XGI A;  2V1Z A;  2VGL M;  4GHI A;  1F2K A;  4NKP A;  3KSH A;  1YPR A;  2J7V A;  3TW8 A;  4B88 A;  4WUJ A;  1KVL A;  4LRZ E;  1RGZ A;  3NBL A;  2ZL1 A;  4KQD A;  1O07 A;  1A0K A;  4NXE A;  5EFW A;  1T1A A;  4GS9 B;  4EBP A;  3GQZ A;  4WN5 A;  4IHQ A;  3UE3 A;  3PBR A;  2WGV A;  3RTY A;  1K6S A;  5HAR A;  2Q0O A;  1NZO A;  3QHY A;  4L9F A;  4HH2 A;  5A8B A;  5J4E A;  1W8Q A;  2O99 A;  4WL9 A;  4OPQ A;  5CHJ A;  4Y0O A;  4UA9 A;  5DFX A;  3Q07 A;  1YMX A;  1HZO A;  4S2O A;  4UA6 A;  1DJB A;  2K2N A;  3CJM A;  2VA0 A;  4G3K A;  4EES A;  2WKP A;  1OTD A;  2D02 A;  1MKM A;  3LUQ A;  1F5M A;  5HWW A;  1IFQ A;  2XR0 A;  3P98 A;  1K55 A;  4HBT A;  3PBS A;  1XFN A;  5FI7 A;  2NUT C;  2EFU A;  1P9R A;  3PYP A;  3MMH A;  4Y5F A;  1MXO A;  5G4Y A;  4R4S A;  3OC2 A;  1OPX A;  5DFY A;  3MXR A;  1PZO A;  3AGF A;  4S2N C;  2IWC A;  5FQM A;  1K38 A;  4XXR A;  3LIB A;  2HF6 A;  4ZBE A;  3RXX A;  2Y2H A;  1K6R A;  4PKY G;  3BFE A;  2WUQ A;  3MR0 A;  3LFV A;  4EQ1 A;  3D72 A;  4GHI B;  4CLC D;  3TG9 A;  3SZT A;  1W63 Q;  1E3U A;  5DTK A;  2H28 A;  2V20 A;  2PRF A;  3IX4 A;  4EEP A;  4U0T A;  4ZRR A;  3UME A;  1NWZ A;  3GTC A;  3CWF A;  2JKF A;  3WRZ A;  1JWZ A;  2Y59 A;  3UPO A;  3G6O A;  1ONG A;  1VEU B;  1OTA A;  1K25 A;  5GLB A;  1ZC2 A;  1FR1 A;  2WAE A;  1ONH A;  4KUO A;  3HVF A;  1S4R A;  5FL3 A;  1S1Z A;  2PAV P;  3VP2 A;  3TOI A;  1YSP A;  4QJG A;  2DRW A;  2Y91 A;  3CUE A;  4WBG A;  4IJG A;  4CLC E;  3ZGA B;  4B93 A;  3WS1 A;  1ES3 A;  1JWV A;  2PR5 A;  4ETX A;  4IUK A;  1PWD A;  3FC7 A;  3ZG7 B;  1LT0 A;  3UPN A;  4LPZ A;  3UDX A;  4DXC A;  2VJW A;  3DWK A;  4Y2F A;  3IH8 A;  2QKP A;  3HJI A;  2HP6 A;  1SDE A;  3N8S A;  2O9C A;  1KDW A;  3S1Y A;  1FIK A;  2PU2 A;  4PM9 A;  3IF6 B;  3NUL A;  1ES2 A;  1SZV A;  1T1B A;  1CF0 A;  3C4O A;  1CEG A;  5FQI A;  2EWV A;  3GMW A;  2EX9 A;  2XF3 A;  4E3I A;  2J80 A;  1YLJ A;  1YAX A;  3DTI A;  4O7D A;  1GA9 A;  1FR6 A;  3LIA A;  1P0Z A;  1KDS A;  4I3A A;  4X1L A;  4PM5 A;  4QWO A;  4WM9 A;  3E2L A;  3CIT A;  2ZD8 A;  1L0E A;  2R9X A;  2GJ3 A;  2Y8H A;  4KZ3 A;  5TR7 A;  3GV9 A;  3F1O A;  3NOU C;  2V9A A;  3FPV A;  1Y4O A;  5J3W A;  1SDN A;  5FQJ A;  2WKQ A;  5FAT A;  4IUH A;  3C38 A;  2Y2P A;  4UQI S;  5CX7 A;  4PPR A;  1YQS A;  3BY9 A;  2JC7 A;  2Y2Q A;  3IHA A;  5FEF A;  5HL6 A;  1K4E A;  1M6K A;  2OLV A;  1T19 A;  3LI9 A;  4E3O A;  2OOL A;  1UWP X;  1PRQ A;  2QZ6 A;  1P9W A;  5A93 A;  1YMS A;  4KZ7 A;  2H0Y A;  2A3U A;  4B4Z A;  5CTN A;  3R7W A;  5F6A A;  3F1N A;  3EOI A;  4DE1 A;  3W4Q A;  3FKW A;  4R4R A;  4HQA A;  2JHE A;  1YKD A;  5TFQ A;  1XA1 A;  3SH9 A;  2XFT A;  1GCE A;  3FPW A;  3FG8 A;  1EI5 A;  1PWG A;  4LRY C;  1TS0 A;  2ZQA A;  3HLD A;  4B9O A;  4R3J A;  4YFM A;  1TDG A;  4D60 A;  4JKT A;  2Y2I A;  3EWK A;  4MBF A;  3PAG A;  2W1T A;  5EVL A;  1KGG A;  4YOF A;  4C75 A;  3LGO A;  4HNB A;  4AFI A;  1YLZ A;  4OQ0 A;  2K31 A;  5J7E A;  1YLP A;  5KSH A;  4U0X A;  2KOI A;  4QY5 A;  3EGD C;  1MZU A;  5DF7 A;  5AQ7 A;  3ZCZ A;  4MDZ A;  4LEN A;  2C5W B;  3CAX A;  1HTZ A;  4F3L B;  4WMC A;  1JWP A;  1JVJ A;  3BLM A;  3G34 A;  4R23 A;  2JCH A;  3W8K A;  3HUN A;  4Z9Q A;  3NI9 A;  3RXW A;  3G35 A;  5M1A A;  5HDC A;  1LL8 A;  2HV1 A;  5DKK A;  3LI8 A;  5E2F A;  3N4I A;  3PAE A;  2R78 A;  3MZD A;  5GL9 A;  2OAP 1;  1NJ4 A;  4Q8I A;  3LR0 A;  4NXF A;  5TGF A;  4R0Q A;  3LR3 A;  5EE8 A;  3LR5 A;  4WYY A;  2A2L A;  3OBF A;  1YLY A;  4OOM A;  1BUL A;  4BL2 A;  3NJA A;  3CZD A;  4PKY A;  2HGV A;  1KE4 A;  2JN7 A;  1ODV A;  3K3D A;  3UE0 A;  4P85 A;  4XT2 B;  1AXB A;  4CLC A;  4RA7 A;  3F1N B;  3QP5 A;  5DTS A;  4I3J A;  4P0M A;  2V8F A;  4E6W A;  2ZMA A;  4IBR A;  5F82 A;  1DJA A;  1H0M A;  1MWT A;  5F1F A;  1VET B;  4IED A;  5FAO A;  3TRC A;  1PI4 A;  3SH7 A;  3BQ8 A;  3E2K A;  2EX6 A;  2Y2M A;  4OVD A;  4BMW A;  3CUE C;  3G2Z A;  4EU0 A;  5HD3 A;  4GDN A;  3VSL A;  2VV6 A;  1WA9 A;  5G18 A;  4XUZ A;  1DJC A;  2MJ6 A;  2Q9N A;  3MQQ A;  1ZHH B;  3O87 A;  4KZ4 A;  1Z09 A;  3T4T A;  4O8G A;  3N6I A;  3E4Q A;  1G5U A;  4RX2 A;  2VV7 A;  3E4O A;  1YSQ A;  4BQM A;  5HX9 A;  1CI8 A;  5CER A;  2R9W A;  1PW1 A;  1IKI A;  2OWJ A;  1CK3 A;  5LBR A;  3GSG A;  3A3D A;  4L0L A;  4DN0 A;  2UWX A;  3UB6 A;  3G31 A;  2JKG A;  3ZG0 A; 
#chains in the Genus database with same CATH homology
 3JYI A;  3Q07 A;  4DRT A;  1YMX A;  5FAP A;  1HZO A;  4S2O A;  4UA6 A;  1WYC A;  2WKE A;  3C7V A;  1DJB A;  4KZ8 A;  1PYY A;  4X56 A;  2QPN A;  5FSR A;  1L0G A;  3CJM A;  4KZB A;  3QNB A;  3IT9 A;  5CHM A;  3VMA A;  1C3B A;  4HEF A;  3BFC A;  4OON A;  1FCN A;  2I72 A;  4PMA A;  5FI2 A;  1L0D A;  4DDS A;  5GLC A;  1XA7 A;  3QNC A;  4DXB A;  3HLG A;  1VQQ A;  3N8R A;  5EPH A;  2XR0 A;  3P98 A;  4S2K A;  1K55 A;  5FQQ A;  4HBT A;  3PBS A;  5FI7 A;  1GHI A;  4LCL A;  4JF5 A;  2WGI A;  4K0W A;  2EFU A;  4FSF A;  4HES A;  1ZKJ A;  2Z2M B;  5CGW A;  5KMW A;  4S2J A;  4GN2 A;  1MXO A;  2WGW A;  3Q7V B;  4R4S A;  1K57 C;  3IXH A;  3ITA A;  2EX8 A;  3OC2 A;  2XFS A;  1E3U D;  5EOO A;  5GHX A;  2EXB A;  3HLC A;  3M2J A;  3UDF A;  2HDQ A;  5A90 A;  3BFD A;  4PM6 A;  2ZC5 B;  2HDU A;  3PBT A;  4LCM A;  1LL5 A;  5D3O A;  3MXR A;  1PZO A;  3AGF A;  3IXB A;  2IWC A;  4S2N C;  4ZTK A;  5FQM A;  1K38 A;  2H10 A;  3M6B A;  5HW3 A;  1YLT A;  5CEB A;  1IKG A;  1IYP A;  1I2W A;  4XXR A;  4X55 A;  3VP1 A;  2J8Y A;  5FDH A;  3PBO A;  2HP5 A;  2J9P A;  1BLS A;  3HRE A;  4HBU A;  4OLG A;  3TSG A;  4ZDX A;  3LEZ A;  4ZBE A;  3RXX A;  1VM1 A;  2Y2H A;  2WZZ A;  3A3I A;  4OKP A;  1K6R A;  5GLD A;  2XQZ A;  1MWS A;  3SS5 A;  1SCW A;  3ZG9 B;  3BFE A;  2WUQ A;  3IH9 A;  4MBH A;  4EUZ A;  1CI9 A;  4LV1 A;  5E2E A;  3OPH A;  4OPZ A;  1MY8 A;  2H0T A;  4RX3 A;  3OPP A;  3WS0 A;  3TG9 A;  1S0W A;  4UA7 A;  4EQI A;  3WS5 A;  1E3U A;  4N1H A;  5DTK A;  2Y2O A;  1LI9 A;  4DKI A;  2H5S A;  2V20 A;  2XH9 A;  2V2F F;  3HLE A;  1LI0 A;  3Q81 A;  1RP5 A;  1WYB A;  2XK1 A;  4U0T A;  3UDI A;  2Y2G A;  3O88 A;  3IWO A;  3GTC A;  4S2L A;  3HUM A;  3B3X A;  2WKI A;  1KE3 A;  3HLB A;  3WRZ A;  2XGN A;  5DF8 A;  3LCE A;  1JWZ A;  2Y59 A;  3UPO A;  4M3K A;  1TEM A;  1ONG A;  4BJP A;  3NC8 A;  5EOE A;  1K25 A;  3AGE A;  3BFF A;  4IBX A;  5GLB A;  1ZC2 A;  1OME A;  1FR1 A;  2WAE A;  1PIO A;  4LV3 A;  4ZJ2 A;  1ONH A;  2WK0 A;  4F94 A;  3HVF A;  1IEL A;  4BD0 A;  5A92 A;  4N9L A;  3VP2 A;  3W4O A;  1XXM A;  3TOI A;  1XGJ A;  1RCJ A;  2G2U A;  4QJG A;  2DRW A;  2Y91 A;  3Q7V A;  4JBF A;  2OSU A;  2ZM8 A;  3EQU A;  4KQR A;  4WBG A;  4U3T A;  3WWX A;  3ZGA B;  1I5Q A;  3WS1 A;  1ES3 A;  1SHV A;  2PBY A;  4XUX A;  5CGS A;  5GHY A;  1LLB A;  1JWV A;  3RJU A;  2XLN A;  5GLA A;  1FCO A;  4ZAM A;  2ZLY A;  3S22 A;  4FCF A;  1PWD A;  3VOY A;  5AQB A;  3ZG7 B;  1BLC A;  3ZG8 B;  3UPN A;  3MZE A;  4ZJ3 A;  1EWZ A;  3UDX A;  2VGJ A;  3IWI A;  1IYO A;  3Q7Z A;  4MNR A;  4RVA A;  1K54 C;  4CPK A;  4DXC A;  3DWK A;  5CXW A;  5EVI B;  3IH8 A;  1BLH A;  4WZ4 A;  3VP4 A;  1JTG A;  4KEN B;  3S4X A;  2G2W A;  1ERO A;  4GDB A;  2HP6 A;  1SDE A;  1W7F A;  1JTD A;  5CHU A;  2HDS A;  3N8S A;  5FI6 A;  1FSY A;  1XKZ A;  1Q2P A;  4OLD A;  4K0X A;  1KDW A;  3S1Y A;  2PU2 A;  4OP5 A;  4PM9 A;  5E2G A;  3VP0 A;  4LV0 A;  3FZC A;  1NRF A;  3IF6 B;  2WGW B;  1ES2 A;  5IHV A;  2XDM A;  3C5A A;  3VP3 A;  4E3K A;  1MBL A;  3C4O A;  1PW8 A;  4MBK A;  3UPP A;  2WYX A;  3V3S A;  1CEG A;  5FQI A;  3BEB A;  3BM6 A;  3GMW A;  2EX9 A;  2XF3 A;  4E3I A;  3VOZ A;  1U60 A;  4P6B A;  3M6H A;  3SOI A;  1YLJ A;  1FOF A;  5BOH A;  1ALQ A;  3ITB A;  5HFO A;  4O7D A;  3C4P A;  5DF9 A;  4N92 A;  5GHZ A;  1GA9 A;  4NET A;  1FR6 A;  1BSG A;  1K56 A;  1KDS A;  2ZQC A;  4OQI A;  3LY4 A;  1G68 A;  1IEM A;  2EX2 A;  1BLP A;  1WE4 A;  4PM5 A;  4H8R A;  3MXS A;  1G6A A;  1I2S A;  3D4F A;  2HP9 A;  2P9V B;  3C7U A;  4IVI A;  4WM9 A;  1ESU A;  3E2L A;  3WS4 A;  4KZA A;  4EV4 A;  4OPR A;  1CEF A;  2ZD8 A;  1L0E A;  3LY3 A;  5E43 A;  5AQA A;  4OOL A;  4DE0 A;  1PZP A;  2R9X A;  5HAQ A;  4KZ3 A;  5TR7 A;  3IWQ A;  3Q1F A;  3HLF A;  4OP8 A;  2IWD A;  4Y0U A;  4JXW A;  5CED A;  3GV9 A;  5A91 A;  4QU3 A;  1ES5 A;  2FFY A;  1PWC A;  3CG5 A;  3LO7 A;  5FAS A;  1SDN A;  2Z2L B;  2ZQ8 A;  3G32 A;  4S2M A;  3Q82 A;  5FQJ A;  5FAT A;  1ERM A;  2XD1 A;  1Z6F A;  2EFX A;  5CRF A;  2QMI A;  2ZJ9 A;  2Y2P A;  4P87 A;  1XP4 A;  3G2Y A;  4JF6 A;  1NY0 A;  1H5X A;  4PPR A;  1XPB A;  1YQS A;  2JC7 A;  5FA7 A;  2Y2Q A;  3IHA A;  4S2P A;  4R3B A;  4WZ5 C;  3UO9 A;  4IVK A;  5AQ9 A;  3EQV A;  2ZC3 B;  2WZX A;  3AGD A;  4A5R A;  5FQ9 A;  1K4E A;  1M6K A;  4KZ5 A;  2WKH A;  2OLV A;  2Y2L A;  4E3O A;  2ZQ7 A;  3OPL A;  3CMZ A;  5JYO A;  2QZ6 A;  3ZNY A;  3BFG A;  2Y55 A;  3IF6 C;  3WRT A;  4DF6 A;  5A93 A;  5DTT A;  2VGK A;  1TDL A;  1YMS A;  4GOG A;  4KZ7 A;  2H0Y A;  3IXG A;  3P09 A;  2A3U A;  5FAQ A;  2RL3 A;  1XX2 A;  5CGX A;  4B4Z A;  1KVM A;  4KG2 A;  5CTN A;  3HBR A;  3IF5 A;  1W5D A;  1BTL A;  3SS4 A;  3VFF A;  4KQQ A;  4DE1 A;  3W4Q A;  3FKW A;  3A3F A;  2DNS A;  4R4R A;  2FFF B;  1W79 A;  2Y2N A;  3DWZ A;  4X53 A;  5TFQ A;  4FH4 A;  1XA1 A;  5M19 A;  3OPR A;  1W8Y A;  3SH9 A;  3UE1 A;  3N8L A;  4X6T A;  2XFT A;  4BD1 A;  1GCE A;  1K4F A;  1NZU A;  2ZC6 B;  3NDE A;  3FKV A;  3MKE A;  3NIA A;  4WMC D;  1EI5 A;  1PWG A;  1K57 A;  1NYY A;  2ZQA A;  3PTE A;  3HLD A;  3ISG A;  4FH2 A;  4JF4 A;  4R3J A;  4YFM A;  1BZA A;  1YM1 A;  3IQA A;  5EVI A;  1TDG A;  4JKT A;  4PM7 A;  4Y0T A;  2XD5 A;  4ZJ1 A;  1IYS A;  5HAI A;  2Y2I A;  4MBF A;  3PAG A;  4UAA A;  3V3R A;  5EVL A;  2J9O A;  1PI5 A;  1KGG A;  1L2S A;  4QB8 A;  4C75 A;  3UY6 A;  3N7W A;  4R1G A;  3MKF A;  1YLZ A;  4C3Q A;  3NDG A;  4OQ0 A;  1QMF A;  3BEC A;  4EWF A;  3G4P A;  3IF6 A;  1YLP A;  4GKU A;  5KSH A;  4C6Y A;  3ZVT A;  4YIN A;  4U0X A;  1MKI A;  2WAF A;  2E8I A;  2C6W B;  3V39 A;  4BLM A;  4QY5 A;  1S6R A;  5KZH A;  3O86 A;  4EBL A;  5U47 A;  5DF7 A;  2BLS A;  4GD8 A;  4ID4 A;  2P74 A;  1LHY A;  3HL9 A;  1O7E A;  5AQ7 A;  3ZCZ A;  1ZG6 A;  4BEN A;  1E25 A;  3OCL A;  3NCK A;  4KG6 A;  4LEN A;  3ZVW A;  2C5W B;  1ES4 A;  1HTZ A;  5EVI D;  1BUE A;  3IXD A;  1KGE A;  1TVF A;  4WMC A;  4KQO A;  1QME A;  1JWP A;  4DE2 A;  4B4X A;  5HAP A;  1JVJ A;  3BLM A;  3V5M A;  5DVA A;  2CC1 A;  2P9V A;  3G34 A;  4R23 A;  3VSK A;  5L2F A;  2JCH A;  3UNW A;  3PBN A;  3W8K A;  3ZNT A;  3HUN A;  1RGY A;  4Z9Q A;  1MPL A;  2GDN A;  3GVB A;  3NI9 A;  3RXW A;  3BLS A;  3G35 A;  5M1A A;  1Y54 A;  2ZM0 A;  1NXY A;  1YT4 A;  4OOY A;  3FWL A;  1H8Y A;  5E2F A;  3VFH A;  4E3L A;  3N4I A;  3OZH A;  4JXV A;  3PAE A;  3IHB A;  4JXG A;  1BT5 A;  2ZM2 A;  3MZD A;  1H8Z A;  2B5R A;  5GL9 A;  3V50 A;  2HPB A;  2Q9M A;  1NJ4 A;  1ZG4 A;  3A3J A;  1GHP A;  3GRJ A;  4RYE A;  4Q8I A;  3BRM A;  3ZG5 A;  5TGF A;  3BYD A;  4GNU A;  5EVI C;  4R0Q A;  4GZB A;  5EUA A;  5EE8 A;  1HVB A;  4X68 A;  1K56 D;  4X69 A;  3ZHH A;  3PBQ A;  4GB7 A;  4WYY A;  3DTM A;  3MFD A;  3SS3 A;  5M18 A;  5J8X A;  3HUO A;  4OPY A;  4DE3 A;  1YLY A;  4MLL A;  4OOM A;  4NK3 A;  1E4D A;  4KG5 A;  1K55 C;  1KGF A;  1BUL A;  4QY6 A;  1FQG A;  4BL2 A;  4Y7P A;  4KZ6 A;  3CZD A;  4D2O A;  1KE4 A;  3G30 A;  4JXS A;  3UE0 A;  4P85 A;  2DCF A;  2Y2J A;  4K91 A;  2EXA A;  2X71 A;  2X01 A;  3WS2 A;  5KSC A;  3M2K A;  1AXB A;  4QD4 A;  4RA7 A;  2IWB A;  4E6X A;  5DTS A;  2ZC7 A;  3UN7 A;  4P0M A;  2OV5 A;  1M40 A;  1FCM A;  4E6W A;  2ZMA A;  4IBR A;  3ZDJ A;  1SKF A;  3MBZ A;  5F82 A;  2Y2K A;  1DJA A;  1MWT A;  4N1X A;  1HD8 A;  2PU4 A;  5F1F A;  2JBF A;  1J9M A;  1YLW A;  1N4O A;  4IED A;  1LL9 A;  1FSW A;  4S2N A;  4JPM A;  3GR2 A;  3A3E A;  3I7J A;  5FAO A;  4UHU A;  5HL1 A;  4WEJ A;  2WAD A;  4CJN A;  5EEC A;  1PI4 A;  2A49 A;  4EBN A;  3FYZ A;  5F1G A;  2HDR A;  4WEL A;  3HLW A;  3SH7 A;  2X02 A;  4OQG A;  3E2K A;  2EX6 A;  2Y2M A;  4OVD A;  2BG1 A;  3ZFZ A;  5CEC A;  3NY4 A;  1MWR A;  5FQK A;  3G2Z A;  5E2H A;  1L0F A;  1MWU A;  1N9B A;  2ZC4 B;  4DDY A;  2JE5 A;  4GDN A;  3VSL A;  1XGI A;  2V1Z A;  5G18 A;  3OCN A;  1DJC A;  4XUZ A;  2Q9N A;  4N9K A;  4FD8 A;  2ZQD A;  1ERQ A;  1IYQ A;  4OQH A;  2J7V A;  2Y4A A;  3MZF A;  5CTM A;  4B88 A;  4LV2 A;  4MEZ A;  1NYM A;  4E3J A;  1KVL A;  2OLU A;  1RGZ A;  3SH8 A;  3NBL A;  3O87 A;  4KZ4 A;  1ESI A;  1O07 A;  4GD6 A;  4OH0 A;  4E3N A;  3N6I A;  3O3V A;  4BL3 A;  4EBP A;  4E3M A;  3GQZ A;  4RX2 A;  4BQM A;  5HX9 A;  2ZQ9 A;  1K54 A;  4WZ5 A;  3UE3 A;  2RCX A;  3PBR A;  5I94 A;  5JYP A;  4S2I A;  3W4P A;  3DW0 A;  1CI8 A;  4WEK A;  2WGV A;  5F83 A;  5CER A;  2R9W A;  1GHM A;  1PW1 A;  4JLF A;  1IKI A;  1K6S A;  1CK3 A;  5HAR A;  1NZO A;  3QHY A;  3GSG A;  3A3D A;  4L0L A;  1W8Q A;  2UWX A;  1DY6 A;  4KZ9 A;  3G31 A;  4OPQ A;  1KE0 A;  4PM8 A;  4Y0O A;  1GA0 A;  4UA9 A;  1Q2Q A;  4QHC A;  5CHJ A;  3FV7 A;  3ZG0 A;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...