3Q07A

Ctx-m-9 s70g in complex with piperacillin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title CTX-M-9 S70G mutant in complex with piperacillin
rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 94
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q07A00
3IWQA 3GTCA 3ZHHA 1W8QA 3ZG9B 3OPHA 1PWGA 4NETA 5GLBA 2P9VA 3FZCA 3S1YA 4UA6A 3PBNA 2HP9A 3UE0A 1SCWA 1HTZA 3OPLA 2Y4AA 4JF4A 4PM6A 1HD8A 4GN2A 4KZ5A 1SDNA 4R4SA 5U47A 5FAQA 2ZQCA 2EFUA 3TG9A 1BLCA 4X6TA 1KE4A 3ZVWA 1ERQA 2XD1A 4WELA 5EVIB 4R23A 5TGFA 5A92A 5JYOA 4E6WA 5I94A 3Q7VB 2ZC6B 2CC1A 1ZG4A 3E2LA 4HESA 1K57C 3ITAA 3CZDA 1I2SA 2ZQ8A 5FI6A 1W7FA 5HFOA 4DE1A 1IKGA 4KG2A 2J9OA 3BECA 2R9XA 3GVBA 4DE2A 3IXBA 4P0MA 2XGNA 1XXMA 3FWLA 4GKUA 3WS5A 2ZC7A 5E2GA 3N4IA 2V1ZA 3V39A 5CHJA 1XPBA 2X71A 3IH9A 2Y2QA 1YLPA 2PU2A 4ZJ3A 4B4XA 3MZFA 4Y0TA 1FQGA 3Q1FA 5GLAA 4HBUA 1PWCA 5GHYA 3BFGA 4GD8A 4RX2A 3G2ZA 4GDBA 4GOGA 2RL3A 1SHVA 3OZHA 4S2NC 1W5DA 5A90A 4KZ7A 1JTDA 1ZG6A 3BRMA 3FYZA 1Q2QA 1XP4A 2Y2GA 3UDFA 4JF6A 4DE0A 4E6XA 1RGYA 3C5AA 2J7VA 2UWXA 3MFDA 2WAFA 3LY3A 4FD8A 4KG5A 2BG1A 2WGIA 4DDSA 3BM6A 3P98A 2HDQA 1RCJA 2HP6A 2ZC3B 1MWRA 2WKIA 4JXWA 2X02A 4YINA 3UDXA 1KVLA 2EX6A 1IKIA 4N92A 3UPOA 1YT4A 4BL3A 3MKFA 2ZM8A 4C3QA 1YQSA 3SOIA 2Q9NA 3M2JA 4H8RA 5DF8A 4OOMA 4E3NA 1ONGA 4E3IA 2EXAA 3WS1A 4S2KA 1MWTA 3TSGA 4KENB 2JBFA 4FH2A 4C6YA 2X01A 1K55A 2G2WA 2I72A 4BD0A 3SH9A 1IYOA 3IXHA 4GDNA 3SS3A 1XX2A 2WADA 4EBLA 5DVAA 3LCEA 2XEPA 2Y59A 3EQUA 3WS4A 1GA0A 1NZOA 3HUNA 4ZJ2A 3G2YA 3V5MA 1K25A 2C6WB 3FKVA 1M40A 5CHUA 2XFTA 3D4FA 5E43A 4B88A 2XH9A 3IXGA 1ESIA 1EI5A 1H8ZA 4WZ5A 1G68A 5HX9A 4R3BA 3ZNTA 1O7EA 1TEMA 3MZDA 1Y54A 4LV1A 4LV3A 4UAAA 1L2SA 4GB7A 5GLDA 1CK3A 1MPLA 3PBOA 5A93A 3ZGAB 1IEMA 2Q9MA 1K56D 2XQZA 2WKEA 2HDSA 4S2OA 5L2FA 2H10A 4MEZA 4OPZA 1HZOA 1VM1A 4IVIA 4WM9A 3E2KA 3FV7A 3WS2A 1XGJA 2Y2OA 3RJUA 1ESUA 4JKTA 4OPRA 4OLGA 2XD5A 3IF6B 5AQBA 3G34A 3VP2A 3ZFZA 4Q8IA 1I5QA 2Y55A 4LV0A 3W8KA 2Y2IA 5M19A 3M6HA 1K6RA 4OVDA 2ZM2A 1YMSA 4XXRA 1JWZA 3AGDA 3IHBA 1NZUA 4U3TA 5EVIC 3ZNYA 3HLWA 3ZVTA 3W4QA 3W4PA 2WGVA 3G4PA 3UE1A 2GDNA 4MLLA 1FSWA 4JLFA 3UE3A 4KZ9A 5CGWA 4PMAA 2P9VB 4KG6A 4WEKA 3UO9A 4OONA 5J8XA 2ZLYA 4KZ3A 3VFHA 5EVID 5AQAA 3S4XA 3IQAA 1KGEA 2EXBA 2R9WA 2XK1A 3HUOA 1YLJA 4UA7A 5CRFA 5F83A 3NIAA 4X56A 1L0GA 1BT5A 1XA1A 2ZD8A 2WZXA 2XLNA 4JBFA 4OKPA 1IYSA 5D3OA 2A49A 4BLMA 4WMCD 3ZCZA 3B3XA 3DWKA 2FFYA 4DRTA 2WKHA 1MXOA 4RVAA 5CHMA 2ZJ9A 4N1HA 3EQVA 5FSRA 3W4OA 2Z2LB 2JE5A 2IWBA 5BOHA 1RP5A 1MWSA 4KZBA 5CEDA 4WEJA 5JYPA 1PI5A 2HPBA 3V50A 3WWXA 1SKFA 5GLCA 3G35A 3PBTA 4Y0OA 4N1XA 4CJNA 4DDYA 3SS5A 4S2IA 1YLTA 1BLPA 1J9MA 1WE4A 3BFCA 1ERMA 3A3IA 3WRZA 5FQMA 1TVFA 3RXXA 1AXBA 3M6BA 1ONHA 3JYIA 1ES3A 2V2FF 4OQIA 1YLZA 1U60A 5EVLA 3GR2A 4B4ZA 4Y7PA 2QPNA 1GHPA 1QMEA 4MNRA 5DTKA 3Q82A 4JPMA 4UHUA 2WUQA 4ZAMA 4X68A 5CGSA 5FQIA 1H5XA 1L0DA 3CJMA 4LV2A 3CG5A 3OPRA 2OV5A 4IEDA 4K91A 5KZHA 1MBLA 4JXVA 1S6RA 4OOYA 2IWDA 4E3MA 2XDMA 2VGJA 4R4RA 4XUXA 2G2UA 2WGWA 5GHZA 3HLBA 1GHIA 3RXWA 3IT9A 5CTNA 5M18A 3IF5A 1K57A 3QNBA 4QJGA 1K54C 2H0YA 1CEFA 1IELA 4P87A 3Q7ZA 3UDIA 2EX9A 4EWFA 1JTGA 4Y0UA 3A3JA 4X53A 5HARA 4A5RA 1WYBA 4EV4A 2XF3A 5EPHA 1N4OA 5HAQA 5FI2A 2A3UA 1PZPA 1NRFA 3MZEA 1YLYA 4FH4A 1E3UD 1PWDA 4X55A 5E2HA 5E2FA 4WZ4A 4S2LA 5FI7A 1C3BA 4OP8A 5EUAA 1QMFA 4BD1A 3DWZA 3IH8A 3ZG7B 2Y2LA 4U0XA 5F82A 1XKZA 4QHCA 1Q2PA 4F94A 3VP4A 3HLGA 3QNCA 1O07A 3C7VA 3HLFA 4PM8A 4X69A 4ZBEA 2ZQ7A 4DXBA 1E25A 1JWPA 3VOYA 1FR1A 1I2WA 3SH7A 4KZ6A 5M1AA 4EBPA 4S2NA 2ZMAA 3NC8A 2IWCA 4N9LA 4PM5A 3N6IA 2EX2A 4RYEA 5CXWA 3GV9A 1BSGA 4BENA 1PI4A 2WZZA 1ZC2A 3VOZA 1YMXA 5GL9A 2DNSA 4UA9A 3SH8A 1K4FA 1W8YA 3IF6C 3G32A 4FSFA 5KMWA 1TDLA 2V20A 1ES4A 2B5RA 3ZDJA 4OH0A 4YFMA 1LI0A 1KDSA 2OLUA 4PPRA 5EOEA 5AQ7A 2ZC5B 4P85A 5E2EA 3PBQA 2HP5A 4KQQA 1BZAA 4MBFA 2PBYA 1E4DA 1ES5A 1FOFA 3VP0A 1GCEA 3A3FA 1KGGA 1DJCA 4L0LA 3CMZA 2VGKA 1K4EA 3LO7A 2FFFB 4MBKA 4N9KA 1Z6FA 5HL1A 3BYDA 3HREA 1EROA 1FSYA 2EFXA 2XR0A 1MKIA 5EOOA 4DE3A 4WYYA 5FA7A 1HVBA 4JXGA 2ZQ9A 4QY6A 2Y2HA 2PU4A 3HVFA 3DTMA 4ZJ1A 3HL9A 3HLDA 2JC7A 1H8YA 1BLHA 4OPQA 1GA9A 3AGEA 4D2OA 4HBTA 2ZC4B 3BEBA 1NYMA 3HUMA 5CEBA 1ALQA 1NY0A 3P09A 4OOLA 3BLMA 4RA7A 5DF7A 3NI9A 2WYXA 4BQMA 3MXRA 3M2KA 1LI9A 5FASA 2Y2NA 1VQQA 1MWUA 3O3VA 1KGFA 2J8YA 5FAOA 1PYYA 4XUZA 1G6AA 1KVMA 2WK0A 2Y2PA 5GHXA 3BFFA 3HLEA 3ZG8B 4DKIA 1M6KA 1JWVA 2QMIA 5CECA 5DF9A 4BJPA 4ZTKA 3NBLA 1CI9A 3UNWA 3OPPA 4Z9QA 3V3RA 1LLBA 5KSHA 5EVIA 3FKWA 2EX8A 4CPKA 1FCOA 2JCHA 4C75A 3Q7VA 3PAGA 3S22A 3DW0A 3IWIA 4IBRA 2HDRA 5F1FA 3ISGA 4M3KA 5HW3A 2XFSA 3MKEA 5FQQA 4IBXA 4WMCA 5CGXA 5AQ9A 4LCLA 3V3SA 1FR6A 4EBNA 4GD6A 1EWZA 3UPNA 5FQ9A 1NJ4A 1W79A 1CEGA 4NK3A 2WAEA 4S2MA 4E3JA 3GRJA 3PBRA 3OCLA 3VSKA 4DXCA 1L0FA 2WGWB 4ID4A 5DTTA 3N8RA 5FQJA 2C5WB 4PM9A 4E3OA 3G31A 3C4OA 1PW1A 5A91A 4HEFA 4LCMA 2RCXA 1DJBA 1KE3A 1L0EA 1LL5A 1N9BA 4O7DA 4QU3A 4OQHA 2ZM0A 5HAIA 3BLSA 4DF6A 3ZG5A 1K6SA 2DCFA 4U0TA 1K55C 4LENA 3MBZA 5CTMA 3VP3A 4K0WA 4FCFA 1FCMA 2Y2KA 4JF5A 3NDEA 3O86A 4RX3A 4BL2A 4JXSA 4S2JA 2J9PA 5DTSA 1PZOA 2ZQDA 1IYPA 4KZ4A 5HAPA 3UN7A 1RGZA 3NY4A 5EECA 3TOIA 4WZ5C 3Q81A 3C7UA 1IYQA 2H0TA 5TFQA 2Y91A 4QD4A 3VMAA 2H5SA 3O88A 3IHAA 1CI8A 2Y2JA 4R1GA 5FAPA 4GNUA 3VP1A 1ES2A 3BFEA 3GMWA 4EUZA 2E8IA 3GQZA 4E3KA 3LY4A 1BUEA 3VFFA 5IHVA 4QB8A 3HBRA 5EE8A 5KSCA 2P74A 2Y2MA 4ZDXA 3A3EA 1E3UA 3IWOA 5FDHA 1ZKJA 3A3DA 1K54A 4S2PA 1YM1A 4PM7A 2Z2MB 3IXDA 1XA7A 3LEZA 4QY5A 3UPPA 3SS4A 3ZG0A 1YLWA 5CERA 1JVJA 3NDGA 4R3JA 3UY6A 3GSGA 1KE0A 4IVKA 3OCNA 2HDUA 1NYYA 5FQKA 4KQOA 1FCNA 1OMEA 4K0XA 3AGFA 3I7JA 4E3LA 3WRTA 5F1GA 3NCKA 5TR7A 2OLVA 4KZAA 3PTEA 3N8SA 3BFDA 3C4PA 4KQRA 3N7WA 1LHYA 4KZ8A 4OLDA 4OQGA 4R0QA 5FATA 3OC2A 1TDGA 4OQ0A 1PW8A 1BTLA 1SDEA 1BULA 3MXSA 3Q07A 3VSLA 1K56A 4P6BA 1LL9A 1DJAA 3HLCA 5G18A 3IF6A 4EQIA 1S0WA 2BLSA 3O87A 2ZQAA 3WS0A 3PAEA 4OP5A 4WBGA 4GZBA 4OPYA 4MBHA 1PIOA 1DY6A 1WYCA 1GHMA 3QHYA 1BLSA 2DRWA 2OSUA 1XGIA 2QZ6A 3ITBA 3PBSA 1MY8A 3G30A 1KDWA 3N8LA 1K38A 1NXYA
chains in the Genus database with same CATH superfamily
3GTCA 4NETA 5GLBA 3FZCA 2PAVP 3RH8B 3BY9A 4R4SA 3GDIA 2EFUA 1BLCA 4X6TA 1KE4A 2GZAA 2XD1A 4WELA 5JYOA 5I94A 2ZC6B 2CC1A 3E2LA 4HESA 1K57C 5TBMA 3CZDA 2ZQ8A 2PYRA 5FI6A 1PNEA 2CMNA 3PYPA 2XGNA 4X1MA 3FWLA 1H0MA 3D3OA 1A0KA 5CHJA 2XROA 4B4XA 2NUTC 3T1QB 1GSWA 3Q1FA 3BFGA 4LPZA 4RX2A 1OTIA 3G2ZA 4GOGA 3VV4A 1W5DA 5MC7A 1ZG6A 3FYZA 4I5SA 2Y2GA 4JF6A 4E6XA 2BG1A 2WGIA 3T4TA 1DP9A 2HP6A 4JXWA 4Y15A 2EX6A 1IKIA 4N92A 1YT4A 4H8RA 5DF8A 3MQQA 1XJ3A 2EXAA 3TSGA 4KENB 1Z09A 2JKRI 3HJKA 2KDKA 2X01A 1K55A 4II7A 2DMWA 2WADA 3F1PA 4EBLA 5DVAA 4HP9A 2QKPA 2Y59A 5IS1A 3G2YA 3FKVA 1M40A 4G3VA 4B88A 1H8ZA 4R3BA 3FPWA 1TEMA 2VV8A 4LV1A 1L2SA 3NECA 1CK3A 1SKOB 2Y79A 2Q9MA 1S1YA 2INWA 1W63M 4EESA 3E4OA 1ESUA 4OLGA 2XD5A 3IF6B 3BQ8A 5M19A 1K6RA 2ZM2A 4XXRA 3ZVTA 3LIEA 4Q0IA 2GDNA 1YAXA 5EFWA 4JLFA 3UE3A 2P9VB 3UO9A 3UB8A 3VOLA 2W3HA 5EVID 2R9WA 2J80A 3NIAA 1L0GA 1GSXA 1FILA 2WZXA 2V9AA 3MXQA 3LIBA 4HQAA 2ZJ9A 3EQVA 2Z2LB 5BOHA 3DTKA 4HP4A 4WEJA 4BBTA 5GLCA 5FEFA 4DDYA 1N9LA 5FQMA 3RXXA 3K3CA 1Y28A 1AXBA 1ES3A 2W1TB 1YLZA 1U60A 5EVLA 3GR2A 5F1GA 2QPNA 4MNRA 5DTKA 4JPMA 4UHUA 3CJMA 4K91A 3CITA 4JXVA 4E3MA 1VETA 2G2UA 2BASA 2WGWA 3RXWA 5CTNA 2VX8A 4UQIS 4QJGA 4B93A 3F1NA 1CEFA 4P87A 4EWFA 4QPRA 4Y0UA 4A5RA 4EV4A 4WF0A 5EPHA 1N4OA 1YLYA 3CI6A 4BD1A 1C3BA 5EUAA 4Y3IA 3IH8A 4U0XA 4QHCA 2VZWA 4ZBEA 1O07A 3HLFA 1JWPA 3SH7A 1I2WA 5F69A 4PM5A 3N6IA 1PI4A 1UWNX 3VOZA 3IF6C 4FSFA 5KMWA 5G4YA 5HPFA 1LI0A 1F9IA 5EOEA 5AQ7A 3KSGA 5E2EA 3DTEA 2O9CA 4KQQA 4NXBA 3FC7A 2HGVA 5AJGA 4L0LA 2FFFB 3D9YA 4IJGA 3BYDA 1FSYA 4DE3A 3EGXC 4QY6A 2Y2HA 4ZJ1A 3HL9A 1BLHA 1VB6A 1GA9A 5LBRA 1NYMA 4UQIM 2ZMVA 1P0ZA 3QP2A 3NI9A 2WYXA 3MXRA 4YNRA 5FAOA 1KGFA 2J8YA 4MMNA 2VK3A 1KVMA 2WK0A 3CLOA 3UE6A 5DF9A 1CI9A 3LIFA 1OT9A 1LLBA 2JCHA 4C75A 2VLGA 3PAGA 3DW0A 4HY8A 1ODVA 5AQ9A 1EWZA 2XRNA 4F3LA 3LR4A 1UWPX 1J3WA 5HDSA 3GRJA 3PBRA 3BY8A 1L0FA 4PM9A 3C4OA 2W1TA 4QU3A 4LCMA 1DJBA 1KE3A 1L0EA 1LL5A 5GHYA 4DF6A 3BLSA 3NJAA 4EEPA 3DTIA 2M7VA 1FIKA 3NDEA 4RX3A 2J9PA 2PYPA 1PZOA 4KZ4A 5HAPA 3NY4A 3Q81A 3VMAA 4L9GA 2Y2JA 4GNUA 3MQOA 2ZMFA 3LY4A 3VFFA 5IHVA 2P74A 4ZDXA 3A3EA 2B95A 1K54A 3IBJA 1XFNA 4HIAA 3LEZA 3T4OA 2I9VA 1JNUA 1SZVA 1JVJA 1AWIA 1KE0A 4IVKA 2XA7S 4Y13A 1OMEA 3LIAA 4WN5A 3AGFA 1F2KA 2HV1A 3S7NA 3N8SA 3VE3A 5FATA 2OAP1 4OQ0A 3HLCA 2BLSA 5HDCA 1DY6A 1GHMA 1MY8A 1K38A 1W8QA 3OPHA 3PBNA 3UE0A 4IUKA 4GN2A 2QWSA 1SDNA 4KZ5A 5U47A 4LFUA 1ERQA 3T4LA 5TGFA 4R23A 2PHYA 3LI9A 5EM0A 2NUPC 3HCYA 4GCZA 4JGRA 2J9OA 2WKRA 5DJTA 2R9XA 3GVBA 4DE2A 3CUEA 3IXBA 1XXMA 4GKUA 3WS5A 2ZC7A 2X71A 3IH9A 1YLPA 4ZJ3A 2XA7M 2VGLS 4EUVA 1PWCA 3EOIA 4IHQA 4GDBA 4RQ9A 1W63Q 1Q2QA 2ZBBA 1XP4A 3UDFA 4DE0A 2HJEA 1YSPA 2J7VA 4KG5A 3BM6A 2HDQA 2A2LA 4YINA 2PR5A 1MKMA 2OWHA 4ME4A 4BL3A 3MKFA 2ZM8A 3SOIA 3M2JA 4E3NA 1ONGA 3TW8A 4E3IA 3S7QA 3PHYA 2VKSA 4C6YA 4IUHA 2G2WA 2I72A 4BD0A 4GDNA 2M7UA 3SS3A 3UMDA 3LI8A 3WS4A 1GA0A 1NZOA 3HUNA 4YOFA 4MN5A 5CHUA 3L7HA 1EI5A 4G3WA 1O7EA 1Y54A 4UAAA 1OTAA 1MPLA 5A93A 1PRQA 1IEMA 4AFIA 4FUWA 4H6JB 4MEZA 3P01A 2VEAA 3WS2A 2W0NA 1XGJA 4JKTA 3ZFZA 3SW1A 2VGLM 5F5YA 1I5QA 2HZ5A 4NXEA 4LV0A 3MFXA 1YMSA 5EV0A 1NRJA 3AGDA 1NZUA 4U3TA 3ZNYA 3G4PA 2R78A 3KO6A 1FSWA 2EA9A 4KZ9A 5HWVA 4WEKA 4GW9A 2W3FA 2EXBA 5CRFA 5CX7A 2ZD8A 4DRTA 2WKHA 5CHMA 4N1HA 5FSRA 1DRMA 3MR0A 1RP5A 2HJ9C 4PKYG 5TJJA 2LB5A 3JVVA 3KYQA 1S1ZA 4KZBA 4PAUA 1PI5A 3RFBA 4CJNA 4N1XA 3SS5A 1NLZA 5EVEA 3BFCA 3A3IA 1TVFA 3V67A 1ONHA 1V9ZA 3KX0X 3MSHA 1TD5A 3FG8A 5FQIA 4ZAMA 2V8CA 2OV5A 1S6RA 2IWDA 3KSFA 2VGJA 5GHZA 3HLBA 1NLYA 1K57A 1TS7A 3QNBA 1G5UA 5IT5A 2EX9A 2O9AA 4NXFA 4MN6A 3F1OB 3MZEA 4S2LA 4WLAA 1QMFA 2A24A 2Y2LA 1XKZA 3VP4A 3QNCA 4X69A 1FR1A 4EBPA 1VEUA 3NC8A 1TS8A 2EX2A 5HSQA 3GV9A 1ZC2A 1YMXA 2DNSA 4UA9A 3DAVA 2P08A 5DFXA 1W8YA 3G32A 3ZDJA 4Q0HA 4YFMA 2ZC5B 4L9FA 4ETZA 2D02A 3PBQA 3H82A 1E4DA 4GHIA 1ES5A 1GCEA 1XJ6A 1K4EA 4MBKA 1S4SA 3LEQA 3C38A 5HL1A 2EFXA 1F98A 1MKIA 2G7UA 5FA7A 1HLUP 2AVXA 3MF0A 2JC7A 4H6JA 3AGEA 5CEBA 5DF7A 4BQMA 5F68A 2D01A 3O3VA 3D72A 4BWIA 5GHXA 3LUQA 2VV6A 4I38A 2XSSA 2QYBA 5L07A 5HZHA 3UNWA 2YKFA 3FKWA 2Z6CA 3B47A 1FCOA 3GECA 1TS6A 4IBRA 3IWIA 2XFSA 3BWLA 4WMCA 5AVEA 4LCLA 3OLOA 4GD6A 2JKRM 2K2NA 1NJ4A 3U4LP 1CEGA 3EEAA 3U2AA 4I39A 4E3JA 3KSHA 5EM1A 2L0WA 4DXCA 1KOUA 3N8RA 2C5WB 4DN0A 2JKTI 3G31A 4O7DA 4ZRRA 2JN7A 3ZG5A 2DCFA 2ZL1B 4LENA 3B42A 5CTMA 2W3GA 4K0WA 3T4SA 1MC0A 4JF5A 3O86A 4MDZA 4JXSA 3MS6A 2V1BA 1T1BA 2Z6DA 1OTDA 1H3QA 1RGZA 4WZ5C 2H0TA 5TFQA 1XJ4A 4QD4A 5DKLA 3O88A 5FAPA 3NOTC 3F1OA 2PDRA 1ES2A 2KLIA 3E4PA 3GQZA 4E3KA 3HBRA 5EE8A 5KSCA 3IWOA 1E3UA 3IS2B 1ZKJA 3OOVA 2J3WA 4DMZA 3UPPA 2O99A 3ZG0A 1YLWA 5DKKA 2HDUA 2PD8A 4KQOA 3KYZA 3S7PA 4CLCE 5TR7A 1SKOA 2OLVA 3C4PA 3KSIA 4KQRA 3N7WA 1LHYA 3KYEA 1SDEA 4CLCC 1BULA 3MXSA 3Q07A 3VSLA 4P6BA 1DJAA 5FEGA 3L9KA 3IF6A 3O87A 3IX3A 3BQAA 4DJ2A 2OAQ1 2DRWA 2QZ6A 3N8LA 3IWQA 1G28A 3S1YA 2P9VA 3LR0A 2Y4AA 2PT7A 4JF4A 1HD8A 2JKFA 3TG9A 3ZVWA 5EVIB 5A92A 3CHWP 3A0VA 3Q7VB 1UGUA 3QP5A 4HHDA 3EGDC 1ZG4A 3UB9A 2E8JA 3ITAA 4EETB 1W7FA 5HFOA 1IKGA 3S7OA 1DP8A 1LL8A 3N4IA 4ESPA 4CQHA 1XPBA 3T4JA 3QP6A 4Y0TA 2B18A 1N9OA 3OBFA 4S2NC 2Q0OA 3B33A 4BBVA 4KZ7A 1JTDA 2GJ3A 5HPIA 1RGYA 3E0YA 2UWXA 3MFDA 5C5KA 1D1JA 1XFQA 4DDSA 3IX4A 3P98A 3P7NA 1RCJA 2ZC3B 2WKIA 2KOIA 4KUOA 5DJUA 3UPOA 1S4RA 4C3QA 2Q9NA 1T19A 2W3DA 1P9RA 5HDDA 1IYOA 4K08A 3UB6A 3LR5A 3V5MA 3T1SA 1K25A 2C6WB 2XFTA 2HF6A 5E43A 2XH9A 3IXGA 1ESIA 5HX9A 1G68A 3ZNTA 4KUKA 3MZDA 4LV3A 2ZOIA 4GB7A 4UEYA 3PBOA 4NKPA 1K56D 2XQZA 1CF0A 2HDSA 4S2OA 2H10A 4OPZA 5L09A 4WM9A 2Y2OA 4LLOB 4OPRA 2Y55A 2VV7A 2Y2IA 1CJFA 3IHBA 3C30A 5EVIC 4HOIA 3HLWA 2WGVA 1PFLA 3HJIA 4MLLA 4PMAA 5FL3A 5J8XA 3JPUA 3T1RA 5F83A 4UA7A 1YLJA 4ARZB 4GS9B 1L3LA 1BT5A 4GJ4A 2XLNA 4OKPA 2KX6A 2ZOHA 2A49A 4BLMA 4WMCD 2FFYA 1MXOA 4RVAA 3W4OA 2JE5A 2YKHA 1DP6A 2M1CA 1MWSA 2GNXA 4YWZA 3V50A 3WWXA 3G35A 3PBTA 1J9MA 3O5YA 1ERMA 3WRZA 1VHMA 2V2FF 4OQIA 2K7SA 4B4ZA 4PHTA 2ACGA 1GHPA 1QMEA 3Q82A 2WUQA 5CGSA 5F6AA 4IEDA 1MBLA 5J3WA 3TE8A 4OOYA 4Y2FA 4R4RA 1GHIA 5M18A 3IT9A 3LR3A 4EQ1A 4EU0A 1LT0A 1JTGA 4X53A 3RTYA 5HAQA 5FI2A 5IU1A 1PZPA 1NRFA 4FH4A 4HH2A 1E3UD 4X55A 2P04A 5E2HA 4WZ4A 4OP8A 3CAXA 3UB5P 1IFQA 5F82A 2LB9A 5J4EA 1S67L 4F94A 2EWVA 4Q8IA 3C7VA 2ZQ7A 4DXBA 1F5MA 2FH5A 4KZ6A 2ZMAA 2IWCA 4RYEA 5CXWA 1BSGA 3F1PB 3NOPC 3SH8A 1K4FA 4HNBA 1ACFA 4LGWA 1TDLA 2B02A 2B5RA 4OH0A 2OLUA 4PPRA 4P85A 1BZAA 2PBYA 3A3FA 1KGGA 1DJCA 2VGKA 5K5BA 4FOFA 1Z6FA 3IX8A 3HREA 4WYYA 1HVBA 1OPXA 4EW7A 4D60A 4O0PA 1V9YA 3DTMA 1H8YA 3VE4A 4M4XA 4OPQA 4L9EA 4Y17A 2FZ0A 3BEBA 3QP4A 4OOLA 4RA7A 1H8MA 1OTBA 2Y2NA 4ETXA 4HH3A 1MWUA 2OOLA 3ICYA 4XUZA 1G6AA 3ZG8B 4DKIA 1M6KA 1JWVA 2QMIA 5CECA 4B9OA 3ULFA 4ARZA 4GS9A 3E98A 3T1XA 2EX8A 4HI4A 4CPKA 2K31A 5F1FA 2HDRA 3ISGA 4M3KA 5HW3A 1EW0A 3MKEA 1FR6A 3LIDA 1MZUA 5HWTA 3EEHA 2JHEA 4NK3A 2WAEA 5J7EA 3TJZC 4MN7A 1VETB 3OCLA 3VSKA 2WGWB 4ID4A 5DTTA 5FDSA 5FQJA 4E3OA 3F1NB 2RCXA 4Q0JA 4OQHA 5HAIA 1K6SA 1K55C 4I3AA 5HD5A 2Y2KA 1GSVA 2ZQDA 5AVFA 3UN7A 5EECA 4O01A 3IHAA 1CI8A 3UMEA 4R1GA 2BTFP 3BFEA 4NXGA 3GMWA 3K3DA 5FDHA 4PKYA 4S2PA 1YM1A 2Z2MB 3IXDA 1XA7A 4R6LA 5A8BA 2JKGA 4WL9A 4XT2B 4MCWA 1TF1A 3H9WA 4K0XA 2Y8HA 3I7JA 1NWZA 3A0SA 3E4QA 3OC2A 1PW8A 1BTLA 1IOUA 1K56A 1LL9A 1YKDA 4O8GA 4E04A 1P9WA 2ZQAA 2PD7A 3WS0A 4WBGA 4GZBA 5G4ZA 4MBHA 1WYCA 3QHYA 2UV0E 3ITBA 3PBSA 3G30A 3MJQA 5AQAA 1NXYA 3ZHHA 4G3KA 3ZG9B 1PWGA 4CLCB 1T1CA 4UA6A 2HP9A 2QJ7A 1SCWA 1HTZA 3OPLA 2W1RA 4PM6A 1OTEA 3SZTA 5FAQA 4HJ3A 2ZQCA 3QP8A 1Y4OA 2J3TC 4E6WA 3LICA 1D7EA 1I2SA 4DE1A 1D06A 4KG2A 3BECA 3CWFA 4LRXC 3PXPA 4P0MA 3R7WB 3ZQ5A 5E2GA 4F3LB 3TRCA 2V1ZA 3V39A 2Y2QA 2PU2A 4JGOA 5I5LA 3MZFA 1FQGA 5GLAA 3C2WA 4HBUA 1N9NA 4GD8A 2RL3A 4DJ3A 1SHVA 3OZHA 4LRYC 5A90A 3CPTB 3BRMA 4NG2A 3C5AA 2W27A 2WAFA 3LY3A 4FD8A 3MQ0A 1MWRA 4EEUA 2X02A 3UDXA 1KVLA 1OT6A 4EXOA 3MMHA 1YQSA 3BJNA 4OOMA 3WS1A 4S2KA 1MWTA 2GX5A 3T4QA 2JBFA 4FH2A 2H28A 3PR6A 4R38A 3SH9A 3IXHA 3G6OA 4Z1WA 1XX2A 3LCEA 3NOUC 2XEPA 3EQUA 4ZJ2A 3D4FA 4WZ5A 1OJ5A 2V0UA 5GLDA 2PBDP 3ZGAB 4X25A 2WKEA 3T12B 4XT2A 5L2FA 5L8MA 4X1LA 1HZOA 1VM1A 4IVIA 4WUJA 3E2KA 3FV7A 3RJUA 5FASA 3VP2A 5AQBA 3G34A 3W2ZA 1P97A 3W8KA 2PRFA 3M6HA 4FTXA 4OVDA 5L10A 1JWZA 3W4QA 3W4PA 3UE1A 5CGWA 4KG6A 4OONA 2JKTM 2ZLYA 4KZ3A 3VFHA 3S4XA 3IQAA 1KGEA 2XK1A 3HUOA 4KQDA 4X56A 1XA1A 2W3EA 4JBFA 1IYSA 5D3OA 2O9BA 3NULA 3ZCZA 3B3XA 3DWKA 4CLCA 3H7WB 2L1MA 2IWBA 5CEDA 5JYPA 2HPBA 5HL6A 1SKFA 4Y0OA 4S2IA 1YLTA 1BLPA 4HJ6A 3R4KA 1WE4A 2WKQA 1YSQA 2PR6A 3M6BA 3JYIA 4Y7PA 3T4KA 4BMWA 4X68A 1H5XA 1L0DA 4LV2A 3R7WA 3CG5A 3OPRA 5KZHA 3NHQA 2VA0A 2XDMA 4XUXA 1OJGA 3IF5A 1K54C 2H0YA 1IELA 1XJ2A 3Q7ZA 3UDIA 2ZL1A 3A3JA 2O0YA 5HARA 1WYBA 2XF3A 1T1AA 2A3UA 3CPTA 1PWDA 4NEED 5E2FA 5FI7A 3DWZA 4I3IA 3ZG7B 1Q2PA 3HLGA 4PM8A 2IA2A 1E25A 3VOYA 3LYXA 5M1AA 4S2NA 4N9LA 2L4RA 4BENA 2WZZA 5GL9A 3IS2A 3QP1A 1K0KA 1T18A 2V20A 1ES4A 1KDSA 5DFYA 2HP5A 4MBFA 1FOFA 1ZTUA 3VP0A 3CMZA 3LO7A 2QHKA 4N9KA 5HD3A 2P7JA 4R3AA 2EWWA 1EROA 3EWKA 5EOOA 2XR0A 2QJ5A 4JXGA 2ZQ9A 2PU4A 3ZYTA 1YPRA 3HVFA 3HLDA 1STZA 1WA9A 2OWJA 4D2OA 2V8FA 4HBTA 2ZC4B 3HUMA 1ALQA 1NY0A 3P09A 3C8CA 3BLMA 5HWWA 3M2KA 1LI9A 3CUEC 1VQQA 3BW6A 4JGQA 3LFVA 1PYYA 4JGPA 2Y2PA 3BFFA 3HLEA 5TBMB 5KIZA 2VJWA 1S66L 3UB7A 1LSXA 4BJPA 4ZTKA 3NBLA 1G6OA 3OPPA 4Z9QA 3V3RA 5KSHA 5EVIA 1CQAA 3Q7VA 3S22A 3H7WA 5FQQA 4IBXA 1ZHHB 2J3TD 5CGXA 3V3SA 4R70A 4EBNA 3UPNA 5FQ9A 1W79A 4LRZE 4S2MA 4I3JA 4QWOA 1PW1A 5A91A 4P6ZS 4HEFA 2MJ6A 1N9BA 2ZM0A 4U0TA 3MBZA 3VP3A 4FCFA 1FCMA 4BL2A 4S2JA 4Y5FA 2A24B 5DTSA 1IYPA 3TOIA 2V1AA 3C7UA 1IYQA 2Y91A 2H5SA 1VEUB 3VP1A 4EUZA 2E8IA 1BUEA 4QB8A 2Y2MA 3A3DA 4GLQA 1X0OA 3A0RA 4PM7A 3FPVA 3JVUA 1TS0A 4QY5A 1LSVA 1LSWA 3SS4A 5CERA 3NDGA 3UY6A 3H82B 4R3JA 4GHIB 3GSGA 3OCNA 1NYYA 5FQKA 1FCNA 4E3LA 3WRTA 3NCKA 3DBAA 4KZAA 3PTEA 3BFDA 3IBRA 4KZ8A 4OLDA 4OQGA 4R0QA 4EERA 1TDGA 2V0WA 5G18A 4EQIA 1S0WA 4HJ4A 3PAEA 4OP5A 4P6ZM 2WKPA 3K2NA 4OPYA 4BBUA 1PIOA 3T50A 4CLCD 1BYWA 1BLSA 2OSUA 1XGIA 3LGOA 1KDWA
chains in the Genus database with same CATH topology
3IWQA 3GTCA 3ZHHA 1W8QA 3ZG9B 3OPHA 1PWGA 4NETA 5GLBA 2P9VA 3FZCA 3S1YA 4UA6A 3PBNA 2HP9A 3UE0A 1SCWA 1HTZA 3OPLA 2Y4AA 4JF4A 4PM6A 1HD8A 4GN2A 4KZ5A 1SDNA 4R4SA 5U47A 5FAQA 2ZQCA 2EFUA 3TG9A 1BLCA 4X6TA 1KE4A 3ZVWA 1ERQA 2XD1A 4WELA 5EVIB 4R23A 5TGFA 5A92A 5JYOA 4E6WA 5I94A 3Q7VB 2ZC6B 2CC1A 1ZG4A 3E2LA 4HESA 1K57C 3ITAA 3CZDA 1I2SA 2ZQ8A 5FI6A 1W7FA 5HFOA 4DE1A 1IKGA 4KG2A 2J9OA 3BECA 2R9XA 3GVBA 4DE2A 3IXBA 4P0MA 2XGNA 1XXMA 3FWLA 4GKUA 3WS5A 2ZC7A 5E2GA 3N4IA 2V1ZA 3V39A 5CHJA 1XPBA 2X71A 3IH9A 2Y2QA 1YLPA 2PU2A 4ZJ3A 4B4XA 3MZFA 4Y0TA 1FQGA 3Q1FA 5GLAA 4HBUA 1PWCA 5GHYA 3BFGA 4GD8A 4RX2A 3G2ZA 4GDBA 4GOGA 2RL3A 1SHVA 3OZHA 4S2NC 1W5DA 5A90A 4KZ7A 1JTDA 1ZG6A 3BRMA 3FYZA 1Q2QA 1XP4A 2Y2GA 3UDFA 4JF6A 4DE0A 4E6XA 1RGYA 3C5AA 2J7VA 2UWXA 3MFDA 2WAFA 3LY3A 4FD8A 4KG5A 2BG1A 2WGIA 4DDSA 3BM6A 3P98A 2HDQA 1RCJA 2HP6A 2ZC3B 1MWRA 2WKIA 4JXWA 2X02A 4YINA 3UDXA 1KVLA 2EX6A 1IKIA 4N92A 3UPOA 1YT4A 4BL3A 3MKFA 2ZM8A 4C3QA 1YQSA 3SOIA 2Q9NA 3M2JA 4H8RA 5DF8A 4OOMA 4E3NA 1ONGA 4E3IA 2EXAA 3WS1A 4S2KA 1MWTA 3TSGA 4KENB 2JBFA 4FH2A 4C6YA 2X01A 1K55A 2G2WA 2I72A 4BD0A 3SH9A 1IYOA 3IXHA 4GDNA 3SS3A 1XX2A 2WADA 4EBLA 5DVAA 3LCEA 2XEPA 2Y59A 3EQUA 3WS4A 1GA0A 1NZOA 3HUNA 4ZJ2A 3G2YA 3V5MA 1K25A 2C6WB 3FKVA 1M40A 5CHUA 2XFTA 3D4FA 5E43A 4B88A 2XH9A 3IXGA 1ESIA 1EI5A 1H8ZA 4WZ5A 1G68A 5HX9A 4R3BA 3ZNTA 1O7EA 1TEMA 3MZDA 1Y54A 4LV1A 4LV3A 4UAAA 1L2SA 4GB7A 5GLDA 1CK3A 1MPLA 3PBOA 5A93A 3ZGAB 1IEMA 2Q9MA 1K56D 2XQZA 2WKEA 2HDSA 4S2OA 5L2FA 2H10A 4MEZA 4OPZA 1HZOA 1VM1A 4IVIA 4WM9A 3E2KA 3FV7A 3WS2A 1XGJA 2Y2OA 3RJUA 1ESUA 4JKTA 4OPRA 4OLGA 2XD5A 3IF6B 5AQBA 3G34A 3VP2A 3ZFZA 4Q8IA 1I5QA 2Y55A 4LV0A 3W8KA 2Y2IA 5M19A 3M6HA 1K6RA 4OVDA 2ZM2A 1YMSA 4XXRA 1JWZA 3AGDA 3IHBA 1NZUA 4U3TA 5EVIC 3ZNYA 3HLWA 3ZVTA 3W4QA 3W4PA 2WGVA 3G4PA 3UE1A 2GDNA 4MLLA 1FSWA 4JLFA 3UE3A 4KZ9A 5CGWA 4PMAA 2P9VB 4KG6A 4WEKA 3UO9A 4OONA 5J8XA 2ZLYA 4KZ3A 3VFHA 5EVID 5AQAA 3S4XA 3IQAA 1KGEA 2EXBA 2R9WA 2XK1A 3HUOA 1YLJA 4UA7A 5CRFA 5F83A 3NIAA 4X56A 1L0GA 1BT5A 1XA1A 2ZD8A 2WZXA 2XLNA 4JBFA 4OKPA 1IYSA 5D3OA 2A49A 4BLMA 4WMCD 3ZCZA 3B3XA 3DWKA 2FFYA 4DRTA 2WKHA 1MXOA 4RVAA 5CHMA 2ZJ9A 4N1HA 3EQVA 5FSRA 3W4OA 2Z2LB 2JE5A 2IWBA 5BOHA 1RP5A 1MWSA 4KZBA 5CEDA 4WEJA 5JYPA 1PI5A 2HPBA 3V50A 3WWXA 1SKFA 5GLCA 3G35A 3PBTA 4Y0OA 4N1XA 4CJNA 4DDYA 3SS5A 4S2IA 1YLTA 1BLPA 1J9MA 1WE4A 3BFCA 1ERMA 3A3IA 3WRZA 5FQMA 1TVFA 3RXXA 1AXBA 3M6BA 1ONHA 3JYIA 1ES3A 2V2FF 4OQIA 1YLZA 1U60A 5EVLA 3GR2A 4B4ZA 4Y7PA 2QPNA 1GHPA 1QMEA 4MNRA 5DTKA 3Q82A 4JPMA 4UHUA 2WUQA 4ZAMA 4X68A 5CGSA 5FQIA 1H5XA 1L0DA 3CJMA 4LV2A 3CG5A 3OPRA 2OV5A 4IEDA 4K91A 5KZHA 1MBLA 4JXVA 1S6RA 4OOYA 2IWDA 4E3MA 2XDMA 2VGJA 4R4RA 4XUXA 2G2UA 2WGWA 5GHZA 3HLBA 1GHIA 3RXWA 3IT9A 5CTNA 5M18A 3IF5A 1K57A 3QNBA 4QJGA 1K54C 2H0YA 1CEFA 1IELA 4P87A 3Q7ZA 3UDIA 2EX9A 4EWFA 1JTGA 4Y0UA 3A3JA 4X53A 5HARA 4A5RA 1WYBA 4EV4A 2XF3A 5EPHA 1N4OA 5HAQA 5FI2A 2A3UA 1PZPA 1NRFA 3MZEA 1YLYA 4FH4A 1E3UD 1PWDA 4X55A 5E2HA 5E2FA 4WZ4A 4S2LA 5FI7A 1C3BA 4OP8A 5EUAA 1QMFA 4BD1A 3DWZA 3IH8A 3ZG7B 2Y2LA 4U0XA 5F82A 1XKZA 4QHCA 1Q2PA 4F94A 3VP4A 3HLGA 3QNCA 1O07A 3C7VA 3HLFA 4PM8A 4X69A 4ZBEA 2ZQ7A 4DXBA 1E25A 1JWPA 3VOYA 1FR1A 1I2WA 3SH7A 4KZ6A 5M1AA 4EBPA 4S2NA 2ZMAA 3NC8A 2IWCA 4N9LA 4PM5A 3N6IA 2EX2A 4RYEA 5CXWA 3GV9A 1BSGA 4BENA 1PI4A 2WZZA 1ZC2A 3VOZA 1YMXA 5GL9A 2DNSA 4UA9A 3SH8A 1K4FA 1W8YA 3IF6C 3G32A 4FSFA 5KMWA 1TDLA 2V20A 1ES4A 2B5RA 3ZDJA 4OH0A 4YFMA 1LI0A 1KDSA 2OLUA 4PPRA 5EOEA 5AQ7A 2ZC5B 4P85A 5E2EA 3PBQA 2HP5A 4KQQA 1BZAA 4MBFA 2PBYA 1E4DA 1ES5A 1FOFA 3VP0A 1GCEA 3A3FA 1KGGA 1DJCA 4L0LA 3CMZA 2VGKA 1K4EA 3LO7A 2FFFB 4MBKA 4N9KA 1Z6FA 5HL1A 3BYDA 3HREA 1EROA 1FSYA 2EFXA 2XR0A 1MKIA 5EOOA 4DE3A 4WYYA 5FA7A 1HVBA 4JXGA 2ZQ9A 4QY6A 2Y2HA 2PU4A 3HVFA 3DTMA 4ZJ1A 3HL9A 3HLDA 2JC7A 1H8YA 1BLHA 4OPQA 1GA9A 3AGEA 4D2OA 4HBTA 2ZC4B 3BEBA 1NYMA 3HUMA 5CEBA 1ALQA 1NY0A 3P09A 4OOLA 3BLMA 4RA7A 5DF7A 3NI9A 2WYXA 4BQMA 3MXRA 3M2KA 1LI9A 5FASA 2Y2NA 1VQQA 1MWUA 3O3VA 1KGFA 2J8YA 5FAOA 1PYYA 4XUZA 1G6AA 1KVMA 2WK0A 2Y2PA 5GHXA 3BFFA 3HLEA 3ZG8B 4DKIA 1M6KA 1JWVA 2QMIA 5CECA 5DF9A 4BJPA 4ZTKA 3NBLA 1CI9A 3UNWA 3OPPA 4Z9QA 3V3RA 1LLBA 5KSHA 5EVIA 3FKWA 2EX8A 4CPKA 1FCOA 2JCHA 4C75A 3Q7VA 3PAGA 3S22A 3DW0A 3IWIA 4IBRA 2HDRA 5F1FA 3ISGA 4M3KA 5HW3A 2XFSA 3MKEA 5FQQA 4IBXA 4WMCA 5CGXA 5AQ9A 4LCLA 3V3SA 1FR6A 4EBNA 4GD6A 1EWZA 3UPNA 5FQ9A 1NJ4A 1W79A 1CEGA 4NK3A 2WAEA 4S2MA 4E3JA 3GRJA 3PBRA 3OCLA 3VSKA 4DXCA 1L0FA 2WGWB 4ID4A 5DTTA 3N8RA 5FQJA 2C5WB 4PM9A 4E3OA 3G31A 3C4OA 1PW1A 5A91A 4HEFA 4LCMA 2RCXA 1DJBA 1KE3A 1L0EA 1LL5A 1N9BA 4O7DA 4QU3A 4OQHA 2ZM0A 5HAIA 3BLSA 4DF6A 3ZG5A 1K6SA 2DCFA 4U0TA 1K55C 4LENA 3MBZA 5CTMA 3VP3A 4K0WA 4FCFA 1FCMA 2Y2KA 4JF5A 3NDEA 3O86A 4RX3A 4BL2A 4JXSA 4S2JA 2J9PA 5DTSA 1PZOA 2ZQDA 1IYPA 4KZ4A 5HAPA 3UN7A 1RGZA 3NY4A 5EECA 3TOIA 4WZ5C 3Q81A 3C7UA 1IYQA 2H0TA 5TFQA 2Y91A 4QD4A 3VMAA 2H5SA 3O88A 3IHAA 1CI8A 2Y2JA 4R1GA 5FAPA 4GNUA 3VP1A 1ES2A 3BFEA 3GMWA 4EUZA 2E8IA 3GQZA 4E3KA 3LY4A 1BUEA 3VFFA 5IHVA 4QB8A 3HBRA 5EE8A 5KSCA 2P74A 2Y2MA 4ZDXA 3A3EA 1E3UA 3IWOA 5FDHA 1ZKJA 3A3DA 1K54A 4S2PA 1YM1A 4PM7A 2Z2MB 3IXDA 1XA7A 3LEZA 4QY5A 3UPPA 3SS4A 3ZG0A 1YLWA 5CERA 1JVJA 3NDGA 4R3JA 3UY6A 3GSGA 1KE0A 4IVKA 3OCNA 2HDUA 1NYYA 5FQKA 4KQOA 1FCNA 1OMEA 4K0XA 3AGFA 3I7JA 4E3LA 3WRTA 5F1GA 3NCKA 5TR7A 2OLVA 4KZAA 3PTEA 3N8SA 3BFDA 3C4PA 4KQRA 3N7WA 1LHYA 4KZ8A 4OLDA 4OQGA 4R0QA 5FATA 3OC2A 1TDGA 4OQ0A 1PW8A 1BTLA 1SDEA 1BULA 3MXSA 3Q07A 3VSLA 1K56A 4P6BA 1LL9A 1DJAA 3HLCA 5G18A 3IF6A 4EQIA 1S0WA 2BLSA 3O87A 2ZQAA 3WS0A 3PAEA 4OP5A 4WBGA 4GZBA 4OPYA 4MBHA 1PIOA 1DY6A 1WYCA 1GHMA 3QHYA 1BLSA 2DRWA 2OSUA 1XGIA 2QZ6A 3ITBA 3PBSA 1MY8A 3G30A 1KDWA 3N8LA 1K38A 1NXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWQ A;  3GTC A;  3ZHH A;  1W8Q A;  3ZG9 B;  3OPH A;  1PWG A;  4NET A;  5GLB A;  2P9V A;  3FZC A;  3S1Y A;  4UA6 A;  3PBN A;  2HP9 A;  3UE0 A;  1SCW A;  1HTZ A;  3OPL A;  2Y4A A;  4JF4 A;  4PM6 A;  1HD8 A;  4GN2 A;  4KZ5 A;  1SDN A;  4R4S A;  5U47 A;  5FAQ A;  2ZQC A;  2EFU A;  3TG9 A;  1BLC A;  4X6T A;  1KE4 A;  3ZVW A;  1ERQ A;  2XD1 A;  4WEL A;  5EVI B;  4R23 A;  5TGF A;  5A92 A;  5JYO A;  4E6W A;  5I94 A;  3Q7V B;  2ZC6 B;  2CC1 A;  1ZG4 A;  3E2L A;  4HES A;  1K57 C;  3ITA A;  3CZD A;  1I2S A;  2ZQ8 A;  5FI6 A;  1W7F A;  5HFO A;  4DE1 A;  1IKG A;  4KG2 A;  2J9O A;  3BEC A;  2R9X A;  3GVB A;  4DE2 A;  3IXB A;  4P0M A;  2XGN A;  1XXM A;  3FWL A;  4GKU A;  3WS5 A;  2ZC7 A;  5E2G A;  3N4I A;  2V1Z A;  3V39 A;  5CHJ A;  1XPB A;  2X71 A;  3IH9 A;  2Y2Q A;  1YLP A;  2PU2 A;  4ZJ3 A;  4B4X A;  3MZF A;  4Y0T A;  1FQG A;  3Q1F A;  5GLA A;  4HBU A;  1PWC A;  5GHY A;  3BFG A;  4GD8 A;  4RX2 A;  3G2Z A;  4GDB A;  4GOG A;  2RL3 A;  1SHV A;  3OZH A;  4S2N C;  1W5D A;  5A90 A;  4KZ7 A;  1JTD A;  1ZG6 A;  3BRM A;  3FYZ A;  1Q2Q A;  1XP4 A;  2Y2G A;  3UDF A;  4JF6 A;  4DE0 A;  4E6X A;  1RGY A;  3C5A A;  2J7V A;  2UWX A;  3MFD A;  2WAF A;  3LY3 A;  4FD8 A;  4KG5 A;  2BG1 A;  2WGI A;  4DDS A;  3BM6 A;  3P98 A;  2HDQ A;  1RCJ A;  2HP6 A;  2ZC3 B;  1MWR A;  2WKI A;  4JXW A;  2X02 A;  4YIN A;  3UDX A;  1KVL A;  2EX6 A;  1IKI A;  4N92 A;  3UPO A;  1YT4 A;  4BL3 A;  3MKF A;  2ZM8 A;  4C3Q A;  1YQS A;  3SOI A;  2Q9N A;  3M2J A;  4H8R A;  5DF8 A;  4OOM A;  4E3N A;  1ONG A;  4E3I A;  2EXA A;  3WS1 A;  4S2K A;  1MWT A;  3TSG A;  4KEN B;  2JBF A;  4FH2 A;  4C6Y A;  2X01 A;  1K55 A;  2G2W A;  2I72 A;  4BD0 A;  3SH9 A;  1IYO A;  3IXH A;  4GDN A;  3SS3 A;  1XX2 A;  2WAD A;  4EBL A;  5DVA A;  3LCE A;  2XEP A;  2Y59 A;  3EQU A;  3WS4 A;  1GA0 A;  1NZO A;  3HUN A;  4ZJ2 A;  3G2Y A;  3V5M A;  1K25 A;  2C6W B;  3FKV A;  1M40 A;  5CHU A;  2XFT A;  3D4F A;  5E43 A;  4B88 A;  2XH9 A;  3IXG A;  1ESI A;  1EI5 A;  1H8Z A;  4WZ5 A;  1G68 A;  5HX9 A;  4R3B A;  3ZNT A;  1O7E A;  1TEM A;  3MZD A;  1Y54 A;  4LV1 A;  4LV3 A;  4UAA A;  1L2S A;  4GB7 A;  5GLD A;  1CK3 A;  1MPL A;  3PBO A;  5A93 A;  3ZGA B;  1IEM A;  2Q9M A;  1K56 D;  2XQZ A;  2WKE A;  2HDS A;  4S2O A;  5L2F A;  2H10 A;  4MEZ A;  4OPZ A;  1HZO A;  1VM1 A;  4IVI A;  4WM9 A;  3E2K A;  3FV7 A;  3WS2 A;  1XGJ A;  2Y2O A;  3RJU A;  1ESU A;  4JKT A;  4OPR A;  4OLG A;  2XD5 A;  3IF6 B;  5AQB A;  3G34 A;  3VP2 A;  3ZFZ A;  4Q8I A;  1I5Q A;  2Y55 A;  4LV0 A;  3W8K A;  2Y2I A;  5M19 A;  3M6H A;  1K6R A;  4OVD A;  2ZM2 A;  1YMS A;  4XXR A;  1JWZ A;  3AGD A;  3IHB A;  1NZU A;  4U3T A;  5EVI C;  3ZNY A;  3HLW A;  3ZVT A;  3W4Q A;  3W4P A;  2WGV A;  3G4P A;  3UE1 A;  2GDN A;  4MLL A;  1FSW A;  4JLF A;  3UE3 A;  4KZ9 A;  5CGW A;  4PMA A;  2P9V B;  4KG6 A;  4WEK A;  3UO9 A;  4OON A;  5J8X A;  2ZLY A;  4KZ3 A;  3VFH A;  5EVI D;  5AQA A;  3S4X A;  3IQA A;  1KGE A;  2EXB A;  2R9W A;  2XK1 A;  3HUO A;  1YLJ A;  4UA7 A;  5CRF A;  5F83 A;  3NIA A;  4X56 A;  1L0G A;  1BT5 A;  1XA1 A;  2ZD8 A;  2WZX A;  2XLN A;  4JBF A;  4OKP A;  1IYS A;  5D3O A;  2A49 A;  4BLM A;  4WMC D;  3ZCZ A;  3B3X A;  3DWK A;  2FFY A;  4DRT A;  2WKH A;  1MXO A;  4RVA A;  5CHM A;  2ZJ9 A;  4N1H A;  3EQV A;  5FSR A;  3W4O A;  2Z2L B;  2JE5 A;  2IWB A;  5BOH A;  1RP5 A;  1MWS A;  4KZB A;  5CED A;  4WEJ A;  5JYP A;  1PI5 A;  2HPB A;  3V50 A;  3WWX A;  1SKF A;  5GLC A;  3G35 A;  3PBT A;  4Y0O A;  4N1X A;  4CJN A;  4DDY A;  3SS5 A;  4S2I A;  1YLT A;  1BLP A;  1J9M A;  1WE4 A;  3BFC A;  1ERM A;  3A3I A;  3WRZ A;  5FQM A;  1TVF A;  3RXX A;  1AXB A;  3M6B A;  1ONH A;  3JYI A;  1ES3 A;  2V2F F;  4OQI A;  1YLZ A;  1U60 A;  5EVL A;  3GR2 A;  4B4Z A;  4Y7P A;  2QPN A;  1GHP A;  1QME A;  4MNR A;  5DTK A;  3Q82 A;  4JPM A;  4UHU A;  2WUQ A;  4ZAM A;  4X68 A;  5CGS A;  5FQI A;  1H5X A;  1L0D A;  3CJM A;  4LV2 A;  3CG5 A;  3OPR A;  2OV5 A;  4IED A;  4K91 A;  5KZH A;  1MBL A;  4JXV A;  1S6R A;  4OOY A;  2IWD A;  4E3M A;  2XDM A;  2VGJ A;  4R4R A;  4XUX A;  2G2U A;  2WGW A;  5GHZ A;  3HLB A;  1GHI A;  3RXW A;  3IT9 A;  5CTN A;  5M18 A;  3IF5 A;  1K57 A;  3QNB A;  4QJG A;  1K54 C;  2H0Y A;  1CEF A;  1IEL A;  4P87 A;  3Q7Z A;  3UDI A;  2EX9 A;  4EWF A;  1JTG A;  4Y0U A;  3A3J A;  4X53 A;  5HAR A;  4A5R A;  1WYB A;  4EV4 A;  2XF3 A;  5EPH A;  1N4O A;  5HAQ A;  5FI2 A;  2A3U A;  1PZP A;  1NRF A;  3MZE A;  1YLY A;  4FH4 A;  1E3U D;  1PWD A;  4X55 A;  5E2H A;  5E2F A;  4WZ4 A;  4S2L A;  5FI7 A;  1C3B A;  4OP8 A;  5EUA A;  1QMF A;  4BD1 A;  3DWZ A;  3IH8 A;  3ZG7 B;  2Y2L A;  4U0X A;  5F82 A;  1XKZ A;  4QHC A;  1Q2P A;  4F94 A;  3VP4 A;  3HLG A;  3QNC A;  1O07 A;  3C7V A;  3HLF A;  4PM8 A;  4X69 A;  4ZBE A;  2ZQ7 A;  4DXB A;  1E25 A;  1JWP A;  3VOY A;  1FR1 A;  1I2W A;  3SH7 A;  4KZ6 A;  5M1A A;  4EBP A;  4S2N A;  2ZMA A;  3NC8 A;  2IWC A;  4N9L A;  4PM5 A;  3N6I A;  2EX2 A;  4RYE A;  5CXW A;  3GV9 A;  1BSG A;  4BEN A;  1PI4 A;  2WZZ A;  1ZC2 A;  3VOZ A;  1YMX A;  5GL9 A;  2DNS A;  4UA9 A;  3SH8 A;  1K4F A;  1W8Y A;  3IF6 C;  3G32 A;  4FSF A;  5KMW A;  1TDL A;  2V20 A;  1ES4 A;  2B5R A;  3ZDJ A;  4OH0 A;  4YFM A;  1LI0 A;  1KDS A;  2OLU A;  4PPR A;  5EOE A;  5AQ7 A;  2ZC5 B;  4P85 A;  5E2E A;  3PBQ A;  2HP5 A;  4KQQ A;  1BZA A;  4MBF A;  2PBY A;  1E4D A;  1ES5 A;  1FOF A;  3VP0 A;  1GCE A;  3A3F A;  1KGG A;  1DJC A;  4L0L A;  3CMZ A;  2VGK A;  1K4E A;  3LO7 A;  2FFF B;  4MBK A;  4N9K A;  1Z6F A;  5HL1 A;  3BYD A;  3HRE A;  1ERO A;  1FSY A;  2EFX A;  2XR0 A;  1MKI A;  5EOO A;  4DE3 A;  4WYY A;  5FA7 A;  1HVB A;  4JXG A;  2ZQ9 A;  4QY6 A;  2Y2H A;  2PU4 A;  3HVF A;  3DTM A;  4ZJ1 A;  3HL9 A;  3HLD A;  2JC7 A;  1H8Y A;  1BLH A;  4OPQ A;  1GA9 A;  3AGE A;  4D2O A;  4HBT A;  2ZC4 B;  3BEB A;  1NYM A;  3HUM A;  5CEB A;  1ALQ A;  1NY0 A;  3P09 A;  4OOL A;  3BLM A;  4RA7 A;  5DF7 A;  3NI9 A;  2WYX A;  4BQM A;  3MXR A;  3M2K A;  1LI9 A;  5FAS A;  2Y2N A;  1VQQ A;  1MWU A;  3O3V A;  1KGF A;  2J8Y A;  5FAO A;  1PYY A;  4XUZ A;  1G6A A;  1KVM A;  2WK0 A;  2Y2P A;  5GHX A;  3BFF A;  3HLE A;  3ZG8 B;  4DKI A;  1M6K A;  1JWV A;  2QMI A;  5CEC A;  5DF9 A;  4BJP A;  4ZTK A;  3NBL A;  1CI9 A;  3UNW A;  3OPP A;  4Z9Q A;  3V3R A;  1LLB A;  5KSH A;  5EVI A;  3FKW A;  2EX8 A;  4CPK A;  1FCO A;  2JCH A;  4C75 A;  3Q7V A;  3PAG A;  3S22 A;  3DW0 A;  3IWI A;  4IBR A;  2HDR A;  5F1F A;  3ISG A;  4M3K A;  5HW3 A;  2XFS A;  3MKE A;  5FQQ A;  4IBX A;  4WMC A;  5CGX A;  5AQ9 A;  4LCL A;  3V3S A;  1FR6 A;  4EBN A;  4GD6 A;  1EWZ A;  3UPN A;  5FQ9 A;  1NJ4 A;  1W79 A;  1CEG A;  4NK3 A;  2WAE A;  4S2M A;  4E3J A;  3GRJ A;  3PBR A;  3OCL A;  3VSK A;  4DXC A;  1L0F A;  2WGW B;  4ID4 A;  5DTT A;  3N8R A;  5FQJ A;  2C5W B;  4PM9 A;  4E3O A;  3G31 A;  3C4O A;  1PW1 A;  5A91 A;  4HEF A;  4LCM A;  2RCX A;  1DJB A;  1KE3 A;  1L0E A;  1LL5 A;  1N9B A;  4O7D A;  4QU3 A;  4OQH A;  2ZM0 A;  5HAI A;  3BLS A;  4DF6 A;  3ZG5 A;  1K6S A;  2DCF A;  4U0T A;  1K55 C;  4LEN A;  3MBZ A;  5CTM A;  3VP3 A;  4K0W A;  4FCF A;  1FCM A;  2Y2K A;  4JF5 A;  3NDE A;  3O86 A;  4RX3 A;  4BL2 A;  4JXS A;  4S2J A;  2J9P A;  5DTS A;  1PZO A;  2ZQD A;  1IYP A;  4KZ4 A;  5HAP A;  3UN7 A;  1RGZ A;  3NY4 A;  5EEC A;  3TOI A;  4WZ5 C;  3Q81 A;  3C7U A;  1IYQ A;  2H0T A;  5TFQ A;  2Y91 A;  4QD4 A;  3VMA A;  2H5S A;  3O88 A;  3IHA A;  1CI8 A;  2Y2J A;  4R1G A;  5FAP A;  4GNU A;  3VP1 A;  1ES2 A;  3BFE A;  3GMW A;  4EUZ A;  2E8I A;  3GQZ A;  4E3K A;  3LY4 A;  1BUE A;  3VFF A;  5IHV A;  4QB8 A;  3HBR A;  5EE8 A;  5KSC A;  2P74 A;  2Y2M A;  4ZDX A;  3A3E A;  1E3U A;  3IWO A;  5FDH A;  1ZKJ A;  3A3D A;  1K54 A;  4S2P A;  1YM1 A;  4PM7 A;  2Z2M B;  3IXD A;  1XA7 A;  3LEZ A;  4QY5 A;  3UPP A;  3SS4 A;  3ZG0 A;  1YLW A;  5CER A;  1JVJ A;  3NDG A;  4R3J A;  3UY6 A;  3GSG A;  1KE0 A;  4IVK A;  3OCN A;  2HDU A;  1NYY A;  5FQK A;  4KQO A;  1FCN A;  1OME A;  4K0X A;  3AGF A;  3I7J A;  4E3L A;  3WRT A;  5F1G A;  3NCK A;  5TR7 A;  2OLV A;  4KZA A;  3PTE A;  3N8S A;  3BFD A;  3C4P A;  4KQR A;  3N7W A;  1LHY A;  4KZ8 A;  4OLD A;  4OQG A;  4R0Q A;  5FAT A;  3OC2 A;  1TDG A;  4OQ0 A;  1PW8 A;  1BTL A;  1SDE A;  1BUL A;  3MXS A;  3Q07 A;  3VSL A;  1K56 A;  4P6B A;  1LL9 A;  1DJA A;  3HLC A;  5G18 A;  3IF6 A;  4EQI A;  1S0W A;  2BLS A;  3O87 A;  2ZQA A;  3WS0 A;  3PAE A;  4OP5 A;  4WBG A;  4GZB A;  4OPY A;  4MBH A;  1PIO A;  1DY6 A;  1WYC A;  1GHM A;  3QHY A;  1BLS A;  2DRW A;  2OSU A;  1XGI A;  2QZ6 A;  3ITB A;  3PBS A;  1MY8 A;  3G30 A;  1KDW A;  3N8L A;  1K38 A;  1NXY A; 
#chains in the Genus database with same CATH topology
 3GTC A;  4NET A;  5GLB A;  3FZC A;  2PAV P;  3RH8 B;  3BY9 A;  4R4S A;  3GDI A;  2EFU A;  1BLC A;  4X6T A;  1KE4 A;  2GZA A;  2XD1 A;  4WEL A;  5JYO A;  5I94 A;  2ZC6 B;  2CC1 A;  3E2L A;  4HES A;  1K57 C;  5TBM A;  3CZD A;  2ZQ8 A;  2PYR A;  5FI6 A;  1PNE A;  2CMN A;  3PYP A;  2XGN A;  4X1M A;  3FWL A;  1H0M A;  3D3O A;  1A0K A;  5CHJ A;  2XRO A;  4B4X A;  2NUT C;  3T1Q B;  1GSW A;  3Q1F A;  3BFG A;  4LPZ A;  4RX2 A;  1OTI A;  3G2Z A;  4GOG A;  3VV4 A;  1W5D A;  5MC7 A;  1ZG6 A;  3FYZ A;  4I5S A;  2Y2G A;  4JF6 A;  4E6X A;  2BG1 A;  2WGI A;  3T4T A;  1DP9 A;  2HP6 A;  4JXW A;  4Y15 A;  2EX6 A;  1IKI A;  4N92 A;  1YT4 A;  4H8R A;  5DF8 A;  3MQQ A;  1XJ3 A;  2EXA A;  3TSG A;  4KEN B;  1Z09 A;  2JKR I;  3HJK A;  2KDK A;  2X01 A;  1K55 A;  4II7 A;  2DMW A;  2WAD A;  3F1P A;  4EBL A;  5DVA A;  4HP9 A;  2QKP A;  2Y59 A;  5IS1 A;  3G2Y A;  3FKV A;  1M40 A;  4G3V A;  4B88 A;  1H8Z A;  4R3B A;  3FPW A;  1TEM A;  2VV8 A;  4LV1 A;  1L2S A;  3NEC A;  1CK3 A;  1SKO B;  2Y79 A;  2Q9M A;  1S1Y A;  2INW A;  1W63 M;  4EES A;  3E4O A;  1ESU A;  4OLG A;  2XD5 A;  3IF6 B;  3BQ8 A;  5M19 A;  1K6R A;  2ZM2 A;  4XXR A;  3ZVT A;  3LIE A;  4Q0I A;  2GDN A;  1YAX A;  5EFW A;  4JLF A;  3UE3 A;  2P9V B;  3UO9 A;  3UB8 A;  3VOL A;  2W3H A;  5EVI D;  2R9W A;  2J80 A;  3NIA A;  1L0G A;  1GSX A;  1FIL A;  2WZX A;  2V9A A;  3MXQ A;  3LIB A;  4HQA A;  2ZJ9 A;  3EQV A;  2Z2L B;  5BOH A;  3DTK A;  4HP4 A;  4WEJ A;  4BBT A;  5GLC A;  5FEF A;  4DDY A;  1N9L A;  5FQM A;  3RXX A;  3K3C A;  1Y28 A;  1AXB A;  1ES3 A;  2W1T B;  1YLZ A;  1U60 A;  5EVL A;  3GR2 A;  5F1G A;  2QPN A;  4MNR A;  5DTK A;  4JPM A;  4UHU A;  3CJM A;  4K91 A;  3CIT A;  4JXV A;  4E3M A;  1VET A;  2G2U A;  2BAS A;  2WGW A;  3RXW A;  5CTN A;  2VX8 A;  4UQI S;  4QJG A;  4B93 A;  3F1N A;  1CEF A;  4P87 A;  4EWF A;  4QPR A;  4Y0U A;  4A5R A;  4EV4 A;  4WF0 A;  5EPH A;  1N4O A;  1YLY A;  3CI6 A;  4BD1 A;  1C3B A;  5EUA A;  4Y3I A;  3IH8 A;  4U0X A;  4QHC A;  2VZW A;  4ZBE A;  1O07 A;  3HLF A;  1JWP A;  3SH7 A;  1I2W A;  5F69 A;  4PM5 A;  3N6I A;  1PI4 A;  1UWN X;  3VOZ A;  3IF6 C;  4FSF A;  5KMW A;  5G4Y A;  5HPF A;  1LI0 A;  1F9I A;  5EOE A;  5AQ7 A;  3KSG A;  5E2E A;  3DTE A;  2O9C A;  4KQQ A;  4NXB A;  3FC7 A;  2HGV A;  5AJG A;  4L0L A;  2FFF B;  3D9Y A;  4IJG A;  3BYD A;  1FSY A;  4DE3 A;  3EGX C;  4QY6 A;  2Y2H A;  4ZJ1 A;  3HL9 A;  1BLH A;  1VB6 A;  1GA9 A;  5LBR A;  1NYM A;  4UQI M;  2ZMV A;  1P0Z A;  3QP2 A;  3NI9 A;  2WYX A;  3MXR A;  4YNR A;  5FAO A;  1KGF A;  2J8Y A;  4MMN A;  2VK3 A;  1KVM A;  2WK0 A;  3CLO A;  3UE6 A;  5DF9 A;  1CI9 A;  3LIF A;  1OT9 A;  1LLB A;  2JCH A;  4C75 A;  2VLG A;  3PAG A;  3DW0 A;  4HY8 A;  1ODV A;  5AQ9 A;  1EWZ A;  2XRN A;  4F3L A;  3LR4 A;  1UWP X;  1J3W A;  5HDS A;  3GRJ A;  3PBR A;  3BY8 A;  1L0F A;  4PM9 A;  3C4O A;  2W1T A;  4QU3 A;  4LCM A;  1DJB A;  1KE3 A;  1L0E A;  1LL5 A;  5GHY A;  4DF6 A;  3BLS A;  3NJA A;  4EEP A;  3DTI A;  2M7V A;  1FIK A;  3NDE A;  4RX3 A;  2J9P A;  2PYP A;  1PZO A;  4KZ4 A;  5HAP A;  3NY4 A;  3Q81 A;  3VMA A;  4L9G A;  2Y2J A;  4GNU A;  3MQO A;  2ZMF A;  3LY4 A;  3VFF A;  5IHV A;  2P74 A;  4ZDX A;  3A3E A;  2B95 A;  1K54 A;  3IBJ A;  1XFN A;  4HIA A;  3LEZ A;  3T4O A;  2I9V A;  1JNU A;  1SZV A;  1JVJ A;  1AWI A;  1KE0 A;  4IVK A;  2XA7 S;  4Y13 A;  1OME A;  3LIA A;  4WN5 A;  3AGF A;  1F2K A;  2HV1 A;  3S7N A;  3N8S A;  3VE3 A;  5FAT A;  2OAP 1;  4OQ0 A;  3HLC A;  2BLS A;  5HDC A;  1DY6 A;  1GHM A;  1MY8 A;  1K38 A;  1W8Q A;  3OPH A;  3PBN A;  3UE0 A;  4IUK A;  4GN2 A;  2QWS A;  1SDN A;  4KZ5 A;  5U47 A;  4LFU A;  1ERQ A;  3T4L A;  5TGF A;  4R23 A;  2PHY A;  3LI9 A;  5EM0 A;  2NUP C;  3HCY A;  4GCZ A;  4JGR A;  2J9O A;  2WKR A;  5DJT A;  2R9X A;  3GVB A;  4DE2 A;  3CUE A;  3IXB A;  1XXM A;  4GKU A;  3WS5 A;  2ZC7 A;  2X71 A;  3IH9 A;  1YLP A;  4ZJ3 A;  2XA7 M;  2VGL S;  4EUV A;  1PWC A;  3EOI A;  4IHQ A;  4GDB A;  4RQ9 A;  1W63 Q;  1Q2Q A;  2ZBB A;  1XP4 A;  3UDF A;  4DE0 A;  2HJE A;  1YSP A;  2J7V A;  4KG5 A;  3BM6 A;  2HDQ A;  2A2L A;  4YIN A;  2PR5 A;  1MKM A;  2OWH A;  4ME4 A;  4BL3 A;  3MKF A;  2ZM8 A;  3SOI A;  3M2J A;  4E3N A;  1ONG A;  3TW8 A;  4E3I A;  3S7Q A;  3PHY A;  2VKS A;  4C6Y A;  4IUH A;  2G2W A;  2I72 A;  4BD0 A;  4GDN A;  2M7U A;  3SS3 A;  3UMD A;  3LI8 A;  3WS4 A;  1GA0 A;  1NZO A;  3HUN A;  4YOF A;  4MN5 A;  5CHU A;  3L7H A;  1EI5 A;  4G3W A;  1O7E A;  1Y54 A;  4UAA A;  1OTA A;  1MPL A;  5A93 A;  1PRQ A;  1IEM A;  4AFI A;  4FUW A;  4H6J B;  4MEZ A;  3P01 A;  2VEA A;  3WS2 A;  2W0N A;  1XGJ A;  4JKT A;  3ZFZ A;  3SW1 A;  2VGL M;  5F5Y A;  1I5Q A;  2HZ5 A;  4NXE A;  4LV0 A;  3MFX A;  1YMS A;  5EV0 A;  1NRJ A;  3AGD A;  1NZU A;  4U3T A;  3ZNY A;  3G4P A;  2R78 A;  3KO6 A;  1FSW A;  2EA9 A;  4KZ9 A;  5HWV A;  4WEK A;  4GW9 A;  2W3F A;  2EXB A;  5CRF A;  5CX7 A;  2ZD8 A;  4DRT A;  2WKH A;  5CHM A;  4N1H A;  5FSR A;  1DRM A;  3MR0 A;  1RP5 A;  2HJ9 C;  4PKY G;  5TJJ A;  2LB5 A;  3JVV A;  3KYQ A;  1S1Z A;  4KZB A;  4PAU A;  1PI5 A;  3RFB A;  4CJN A;  4N1X A;  3SS5 A;  1NLZ A;  5EVE A;  3BFC A;  3A3I A;  1TVF A;  3V67 A;  1ONH A;  1V9Z A;  3KX0 X;  3MSH A;  1TD5 A;  3FG8 A;  5FQI A;  4ZAM A;  2V8C A;  2OV5 A;  1S6R A;  2IWD A;  3KSF A;  2VGJ A;  5GHZ A;  3HLB A;  1NLY A;  1K57 A;  1TS7 A;  3QNB A;  1G5U A;  5IT5 A;  2EX9 A;  2O9A A;  4NXF A;  4MN6 A;  3F1O B;  3MZE A;  4S2L A;  4WLA A;  1QMF A;  2A24 A;  2Y2L A;  1XKZ A;  3VP4 A;  3QNC A;  4X69 A;  1FR1 A;  4EBP A;  1VEU A;  3NC8 A;  1TS8 A;  2EX2 A;  5HSQ A;  3GV9 A;  1ZC2 A;  1YMX A;  2DNS A;  4UA9 A;  3DAV A;  2P08 A;  5DFX A;  1W8Y A;  3G32 A;  3ZDJ A;  4Q0H A;  4YFM A;  2ZC5 B;  4L9F A;  4ETZ A;  2D02 A;  3PBQ A;  3H82 A;  1E4D A;  4GHI A;  1ES5 A;  1GCE A;  1XJ6 A;  1K4E A;  4MBK A;  1S4S A;  3LEQ A;  3C38 A;  5HL1 A;  2EFX A;  1F98 A;  1MKI A;  2G7U A;  5FA7 A;  1HLU P;  2AVX A;  3MF0 A;  2JC7 A;  4H6J A;  3AGE A;  5CEB A;  5DF7 A;  4BQM A;  5F68 A;  2D01 A;  3O3V A;  3D72 A;  4BWI A;  5GHX A;  3LUQ A;  2VV6 A;  4I38 A;  2XSS A;  2QYB A;  5L07 A;  5HZH A;  3UNW A;  2YKF A;  3FKW A;  2Z6C A;  3B47 A;  1FCO A;  3GEC A;  1TS6 A;  4IBR A;  3IWI A;  2XFS A;  3BWL A;  4WMC A;  5AVE A;  4LCL A;  3OLO A;  4GD6 A;  2JKR M;  2K2N A;  1NJ4 A;  3U4L P;  1CEG A;  3EEA A;  3U2A A;  4I39 A;  4E3J A;  3KSH A;  5EM1 A;  2L0W A;  4DXC A;  1KOU A;  3N8R A;  2C5W B;  4DN0 A;  2JKT I;  3G31 A;  4O7D A;  4ZRR A;  2JN7 A;  3ZG5 A;  2DCF A;  2ZL1 B;  4LEN A;  3B42 A;  5CTM A;  2W3G A;  4K0W A;  3T4S A;  1MC0 A;  4JF5 A;  3O86 A;  4MDZ A;  4JXS A;  3MS6 A;  2V1B A;  1T1B A;  2Z6D A;  1OTD A;  1H3Q A;  1RGZ A;  4WZ5 C;  2H0T A;  5TFQ A;  1XJ4 A;  4QD4 A;  5DKL A;  3O88 A;  5FAP A;  3NOT C;  3F1O A;  2PDR A;  1ES2 A;  2KLI A;  3E4P A;  3GQZ A;  4E3K A;  3HBR A;  5EE8 A;  5KSC A;  3IWO A;  1E3U A;  3IS2 B;  1ZKJ A;  3OOV A;  2J3W A;  4DMZ A;  3UPP A;  2O99 A;  3ZG0 A;  1YLW A;  5DKK A;  2HDU A;  2PD8 A;  4KQO A;  3KYZ A;  3S7P A;  4CLC E;  5TR7 A;  1SKO A;  2OLV A;  3C4P A;  3KSI A;  4KQR A;  3N7W A;  1LHY A;  3KYE A;  1SDE A;  4CLC C;  1BUL A;  3MXS A;  3Q07 A;  3VSL A;  4P6B A;  1DJA A;  5FEG A;  3L9K A;  3IF6 A;  3O87 A;  3IX3 A;  3BQA A;  4DJ2 A;  2OAQ 1;  2DRW A;  2QZ6 A;  3N8L A;  3IWQ A;  1G28 A;  3S1Y A;  2P9V A;  3LR0 A;  2Y4A A;  2PT7 A;  4JF4 A;  1HD8 A;  2JKF A;  3TG9 A;  3ZVW A;  5EVI B;  5A92 A;  3CHW P;  3A0V A;  3Q7V B;  1UGU A;  3QP5 A;  4HHD A;  3EGD C;  1ZG4 A;  3UB9 A;  2E8J A;  3ITA A;  4EET B;  1W7F A;  5HFO A;  1IKG A;  3S7O A;  1DP8 A;  1LL8 A;  3N4I A;  4ESP A;  4CQH A;  1XPB A;  3T4J A;  3QP6 A;  4Y0T A;  2B18 A;  1N9O A;  3OBF A;  4S2N C;  2Q0O A;  3B33 A;  4BBV A;  4KZ7 A;  1JTD A;  2GJ3 A;  5HPI A;  1RGY A;  3E0Y A;  2UWX A;  3MFD A;  5C5K A;  1D1J A;  1XFQ A;  4DDS A;  3IX4 A;  3P98 A;  3P7N A;  1RCJ A;  2ZC3 B;  2WKI A;  2KOI A;  4KUO A;  5DJU A;  3UPO A;  1S4R A;  4C3Q A;  2Q9N A;  1T19 A;  2W3D A;  1P9R A;  5HDD A;  1IYO A;  4K08 A;  3UB6 A;  3LR5 A;  3V5M A;  3T1S A;  1K25 A;  2C6W B;  2XFT A;  2HF6 A;  5E43 A;  2XH9 A;  3IXG A;  1ESI A;  5HX9 A;  1G68 A;  3ZNT A;  4KUK A;  3MZD A;  4LV3 A;  2ZOI A;  4GB7 A;  4UEY A;  3PBO A;  4NKP A;  1K56 D;  2XQZ A;  1CF0 A;  2HDS A;  4S2O A;  2H10 A;  4OPZ A;  5L09 A;  4WM9 A;  2Y2O A;  4LLO B;  4OPR A;  2Y55 A;  2VV7 A;  2Y2I A;  1CJF A;  3IHB A;  3C30 A;  5EVI C;  4HOI A;  3HLW A;  2WGV A;  1PFL A;  3HJI A;  4MLL A;  4PMA A;  5FL3 A;  5J8X A;  3JPU A;  3T1R A;  5F83 A;  4UA7 A;  1YLJ A;  4ARZ B;  4GS9 B;  1L3L A;  1BT5 A;  4GJ4 A;  2XLN A;  4OKP A;  2KX6 A;  2ZOH A;  2A49 A;  4BLM A;  4WMC D;  2FFY A;  1MXO A;  4RVA A;  3W4O A;  2JE5 A;  2YKH A;  1DP6 A;  2M1C A;  1MWS A;  2GNX A;  4YWZ A;  3V50 A;  3WWX A;  3G35 A;  3PBT A;  1J9M A;  3O5Y A;  1ERM A;  3WRZ A;  1VHM A;  2V2F F;  4OQI A;  2K7S A;  4B4Z A;  4PHT A;  2ACG A;  1GHP A;  1QME A;  3Q82 A;  2WUQ A;  5CGS A;  5F6A A;  4IED A;  1MBL A;  5J3W A;  3TE8 A;  4OOY A;  4Y2F A;  4R4R A;  1GHI A;  5M18 A;  3IT9 A;  3LR3 A;  4EQ1 A;  4EU0 A;  1LT0 A;  1JTG A;  4X53 A;  3RTY A;  5HAQ A;  5FI2 A;  5IU1 A;  1PZP A;  1NRF A;  4FH4 A;  4HH2 A;  1E3U D;  4X55 A;  2P04 A;  5E2H A;  4WZ4 A;  4OP8 A;  3CAX A;  3UB5 P;  1IFQ A;  5F82 A;  2LB9 A;  5J4E A;  1S67 L;  4F94 A;  2EWV A;  4Q8I A;  3C7V A;  2ZQ7 A;  4DXB A;  1F5M A;  2FH5 A;  4KZ6 A;  2ZMA A;  2IWC A;  4RYE A;  5CXW A;  1BSG A;  3F1P B;  3NOP C;  3SH8 A;  1K4F A;  4HNB A;  1ACF A;  4LGW A;  1TDL A;  2B02 A;  2B5R A;  4OH0 A;  2OLU A;  4PPR A;  4P85 A;  1BZA A;  2PBY A;  3A3F A;  1KGG A;  1DJC A;  2VGK A;  5K5B A;  4FOF A;  1Z6F A;  3IX8 A;  3HRE A;  4WYY A;  1HVB A;  1OPX A;  4EW7 A;  4D60 A;  4O0P A;  1V9Y A;  3DTM A;  1H8Y A;  3VE4 A;  4M4X A;  4OPQ A;  4L9E A;  4Y17 A;  2FZ0 A;  3BEB A;  3QP4 A;  4OOL A;  4RA7 A;  1H8M A;  1OTB A;  2Y2N A;  4ETX A;  4HH3 A;  1MWU A;  2OOL A;  3ICY A;  4XUZ A;  1G6A A;  3ZG8 B;  4DKI A;  1M6K A;  1JWV A;  2QMI A;  5CEC A;  4B9O A;  3ULF A;  4ARZ A;  4GS9 A;  3E98 A;  3T1X A;  2EX8 A;  4HI4 A;  4CPK A;  2K31 A;  5F1F A;  2HDR A;  3ISG A;  4M3K A;  5HW3 A;  1EW0 A;  3MKE A;  1FR6 A;  3LID A;  1MZU A;  5HWT A;  3EEH A;  2JHE A;  4NK3 A;  2WAE A;  5J7E A;  3TJZ C;  4MN7 A;  1VET B;  3OCL A;  3VSK A;  2WGW B;  4ID4 A;  5DTT A;  5FDS A;  5FQJ A;  4E3O A;  3F1N B;  2RCX A;  4Q0J A;  4OQH A;  5HAI A;  1K6S A;  1K55 C;  4I3A A;  5HD5 A;  2Y2K A;  1GSV A;  2ZQD A;  5AVF A;  3UN7 A;  5EEC A;  4O01 A;  3IHA A;  1CI8 A;  3UME A;  4R1G A;  2BTF P;  3BFE A;  4NXG A;  3GMW A;  3K3D A;  5FDH A;  4PKY A;  4S2P A;  1YM1 A;  2Z2M B;  3IXD A;  1XA7 A;  4R6L A;  5A8B A;  2JKG A;  4WL9 A;  4XT2 B;  4MCW A;  1TF1 A;  3H9W A;  4K0X A;  2Y8H A;  3I7J A;  1NWZ A;  3A0S A;  3E4Q A;  3OC2 A;  1PW8 A;  1BTL A;  1IOU A;  1K56 A;  1LL9 A;  1YKD A;  4O8G A;  4E04 A;  1P9W A;  2ZQA A;  2PD7 A;  3WS0 A;  4WBG A;  4GZB A;  5G4Z A;  4MBH A;  1WYC A;  3QHY A;  2UV0 E;  3ITB A;  3PBS A;  3G30 A;  3MJQ A;  5AQA A;  1NXY A;  3ZHH A;  4G3K A;  3ZG9 B;  1PWG A;  4CLC B;  1T1C A;  4UA6 A;  2HP9 A;  2QJ7 A;  1SCW A;  1HTZ A;  3OPL A;  2W1R A;  4PM6 A;  1OTE A;  3SZT A;  5FAQ A;  4HJ3 A;  2ZQC A;  3QP8 A;  1Y4O A;  2J3T C;  4E6W A;  3LIC A;  1D7E A;  1I2S A;  4DE1 A;  1D06 A;  4KG2 A;  3BEC A;  3CWF A;  4LRX C;  3PXP A;  4P0M A;  3R7W B;  3ZQ5 A;  5E2G A;  4F3L B;  3TRC A;  2V1Z A;  3V39 A;  2Y2Q A;  2PU2 A;  4JGO A;  5I5L A;  3MZF A;  1FQG A;  5GLA A;  3C2W A;  4HBU A;  1N9N A;  4GD8 A;  2RL3 A;  4DJ3 A;  1SHV A;  3OZH A;  4LRY C;  5A90 A;  3CPT B;  3BRM A;  4NG2 A;  3C5A A;  2W27 A;  2WAF A;  3LY3 A;  4FD8 A;  3MQ0 A;  1MWR A;  4EEU A;  2X02 A;  3UDX A;  1KVL A;  1OT6 A;  4EXO A;  3MMH A;  1YQS A;  3BJN A;  4OOM A;  3WS1 A;  4S2K A;  1MWT A;  2GX5 A;  3T4Q A;  2JBF A;  4FH2 A;  2H28 A;  3PR6 A;  4R38 A;  3SH9 A;  3IXH A;  3G6O A;  4Z1W A;  1XX2 A;  3LCE A;  3NOU C;  2XEP A;  3EQU A;  4ZJ2 A;  3D4F A;  4WZ5 A;  1OJ5 A;  2V0U A;  5GLD A;  2PBD P;  3ZGA B;  4X25 A;  2WKE A;  3T12 B;  4XT2 A;  5L2F A;  5L8M A;  4X1L A;  1HZO A;  1VM1 A;  4IVI A;  4WUJ A;  3E2K A;  3FV7 A;  3RJU A;  5FAS A;  3VP2 A;  5AQB A;  3G34 A;  3W2Z A;  1P97 A;  3W8K A;  2PRF A;  3M6H A;  4FTX A;  4OVD A;  5L10 A;  1JWZ A;  3W4Q A;  3W4P A;  3UE1 A;  5CGW A;  4KG6 A;  4OON A;  2JKT M;  2ZLY A;  4KZ3 A;  3VFH A;  3S4X A;  3IQA A;  1KGE A;  2XK1 A;  3HUO A;  4KQD A;  4X56 A;  1XA1 A;  2W3E A;  4JBF A;  1IYS A;  5D3O A;  2O9B A;  3NUL A;  3ZCZ A;  3B3X A;  3DWK A;  4CLC A;  3H7W B;  2L1M A;  2IWB A;  5CED A;  5JYP A;  2HPB A;  5HL6 A;  1SKF A;  4Y0O A;  4S2I A;  1YLT A;  1BLP A;  4HJ6 A;  3R4K A;  1WE4 A;  2WKQ A;  1YSQ A;  2PR6 A;  3M6B A;  3JYI A;  4Y7P A;  3T4K A;  4BMW A;  4X68 A;  1H5X A;  1L0D A;  4LV2 A;  3R7W A;  3CG5 A;  3OPR A;  5KZH A;  3NHQ A;  2VA0 A;  2XDM A;  4XUX A;  1OJG A;  3IF5 A;  1K54 C;  2H0Y A;  1IEL A;  1XJ2 A;  3Q7Z A;  3UDI A;  2ZL1 A;  3A3J A;  2O0Y A;  5HAR A;  1WYB A;  2XF3 A;  1T1A A;  2A3U A;  3CPT A;  1PWD A;  4NEE D;  5E2F A;  5FI7 A;  3DWZ A;  4I3I A;  3ZG7 B;  1Q2P A;  3HLG A;  4PM8 A;  2IA2 A;  1E25 A;  3VOY A;  3LYX A;  5M1A A;  4S2N A;  4N9L A;  2L4R A;  4BEN A;  2WZZ A;  5GL9 A;  3IS2 A;  3QP1 A;  1K0K A;  1T18 A;  2V20 A;  1ES4 A;  1KDS A;  5DFY A;  2HP5 A;  4MBF A;  1FOF A;  1ZTU A;  3VP0 A;  3CMZ A;  3LO7 A;  2QHK A;  4N9K A;  5HD3 A;  2P7J A;  4R3A A;  2EWW A;  1ERO A;  3EWK A;  5EOO A;  2XR0 A;  2QJ5 A;  4JXG A;  2ZQ9 A;  2PU4 A;  3ZYT A;  1YPR A;  3HVF A;  3HLD A;  1STZ A;  1WA9 A;  2OWJ A;  4D2O A;  2V8F A;  4HBT A;  2ZC4 B;  3HUM A;  1ALQ A;  1NY0 A;  3P09 A;  3C8C A;  3BLM A;  5HWW A;  3M2K A;  1LI9 A;  3CUE C;  1VQQ A;  3BW6 A;  4JGQ A;  3LFV A;  1PYY A;  4JGP A;  2Y2P A;  3BFF A;  3HLE A;  5TBM B;  5KIZ A;  2VJW A;  1S66 L;  3UB7 A;  1LSX A;  4BJP A;  4ZTK A;  3NBL A;  1G6O A;  3OPP A;  4Z9Q A;  3V3R A;  5KSH A;  5EVI A;  1CQA A;  3Q7V A;  3S22 A;  3H7W A;  5FQQ A;  4IBX A;  1ZHH B;  2J3T D;  5CGX A;  3V3S A;  4R70 A;  4EBN A;  3UPN A;  5FQ9 A;  1W79 A;  4LRZ E;  4S2M A;  4I3J A;  4QWO A;  1PW1 A;  5A91 A;  4P6Z S;  4HEF A;  2MJ6 A;  1N9B A;  2ZM0 A;  4U0T A;  3MBZ A;  3VP3 A;  4FCF A;  1FCM A;  4BL2 A;  4S2J A;  4Y5F A;  2A24 B;  5DTS A;  1IYP A;  3TOI A;  2V1A A;  3C7U A;  1IYQ A;  2Y91 A;  2H5S A;  1VEU B;  3VP1 A;  4EUZ A;  2E8I A;  1BUE A;  4QB8 A;  2Y2M A;  3A3D A;  4GLQ A;  1X0O A;  3A0R A;  4PM7 A;  3FPV A;  3JVU A;  1TS0 A;  4QY5 A;  1LSV A;  1LSW A;  3SS4 A;  5CER A;  3NDG A;  3UY6 A;  3H82 B;  4R3J A;  4GHI B;  3GSG A;  3OCN A;  1NYY A;  5FQK A;  1FCN A;  4E3L A;  3WRT A;  3NCK A;  3DBA A;  4KZA A;  3PTE A;  3BFD A;  3IBR A;  4KZ8 A;  4OLD A;  4OQG A;  4R0Q A;  4EER A;  1TDG A;  2V0W A;  5G18 A;  4EQI A;  1S0W A;  4HJ4 A;  3PAE A;  4OP5 A;  4P6Z M;  2WKP A;  3K2N A;  4OPY A;  4BBU A;  1PIO A;  3T50 A;  4CLC D;  1BYW A;  1BLS A;  2OSU A;  1XGI A;  3LGO A;  1KDW A; 
#chains in the Genus database with same CATH homology
 3IWQ A;  3GTC A;  3ZHH A;  1W8Q A;  3ZG9 B;  3OPH A;  1PWG A;  4NET A;  5GLB A;  2P9V A;  3FZC A;  3S1Y A;  4UA6 A;  3PBN A;  2HP9 A;  3UE0 A;  1SCW A;  1HTZ A;  3OPL A;  2Y4A A;  4JF4 A;  4PM6 A;  1HD8 A;  4GN2 A;  4KZ5 A;  1SDN A;  4R4S A;  5U47 A;  5FAQ A;  2ZQC A;  2EFU A;  3TG9 A;  1BLC A;  4X6T A;  1KE4 A;  3ZVW A;  1ERQ A;  2XD1 A;  4WEL A;  5EVI B;  4R23 A;  5TGF A;  5A92 A;  5JYO A;  4E6W A;  5I94 A;  3Q7V B;  2ZC6 B;  2CC1 A;  1ZG4 A;  3E2L A;  4HES A;  1K57 C;  3ITA A;  3CZD A;  1I2S A;  2ZQ8 A;  5FI6 A;  1W7F A;  5HFO A;  4DE1 A;  1IKG A;  4KG2 A;  2J9O A;  3BEC A;  2R9X A;  3GVB A;  4DE2 A;  3IXB A;  4P0M A;  2XGN A;  1XXM A;  3FWL A;  4GKU A;  3WS5 A;  2ZC7 A;  5E2G A;  3N4I A;  2V1Z A;  3V39 A;  5CHJ A;  1XPB A;  2X71 A;  3IH9 A;  2Y2Q A;  1YLP A;  2PU2 A;  4ZJ3 A;  4B4X A;  3MZF A;  4Y0T A;  1FQG A;  3Q1F A;  5GLA A;  4HBU A;  1PWC A;  5GHY A;  3BFG A;  4GD8 A;  4RX2 A;  3G2Z A;  4GDB A;  4GOG A;  2RL3 A;  1SHV A;  3OZH A;  4S2N C;  1W5D A;  5A90 A;  4KZ7 A;  1JTD A;  1ZG6 A;  3BRM A;  3FYZ A;  1Q2Q A;  1XP4 A;  2Y2G A;  3UDF A;  4JF6 A;  4DE0 A;  4E6X A;  1RGY A;  3C5A A;  2J7V A;  2UWX A;  3MFD A;  2WAF A;  3LY3 A;  4FD8 A;  4KG5 A;  2BG1 A;  2WGI A;  4DDS A;  3BM6 A;  3P98 A;  2HDQ A;  1RCJ A;  2HP6 A;  2ZC3 B;  1MWR A;  2WKI A;  4JXW A;  2X02 A;  4YIN A;  3UDX A;  1KVL A;  2EX6 A;  1IKI A;  4N92 A;  3UPO A;  1YT4 A;  4BL3 A;  3MKF A;  2ZM8 A;  4C3Q A;  1YQS A;  3SOI A;  2Q9N A;  3M2J A;  4H8R A;  5DF8 A;  4OOM A;  4E3N A;  1ONG A;  4E3I A;  2EXA A;  3WS1 A;  4S2K A;  1MWT A;  3TSG A;  4KEN B;  2JBF A;  4FH2 A;  4C6Y A;  2X01 A;  1K55 A;  2G2W A;  2I72 A;  4BD0 A;  3SH9 A;  1IYO A;  3IXH A;  4GDN A;  3SS3 A;  1XX2 A;  2WAD A;  4EBL A;  5DVA A;  3LCE A;  2XEP A;  2Y59 A;  3EQU A;  3WS4 A;  1GA0 A;  1NZO A;  3HUN A;  4ZJ2 A;  3G2Y A;  3V5M A;  1K25 A;  2C6W B;  3FKV A;  1M40 A;  5CHU A;  2XFT A;  3D4F A;  5E43 A;  4B88 A;  2XH9 A;  3IXG A;  1ESI A;  1EI5 A;  1H8Z A;  4WZ5 A;  1G68 A;  5HX9 A;  4R3B A;  3ZNT A;  1O7E A;  1TEM A;  3MZD A;  1Y54 A;  4LV1 A;  4LV3 A;  4UAA A;  1L2S A;  4GB7 A;  5GLD A;  1CK3 A;  1MPL A;  3PBO A;  5A93 A;  3ZGA B;  1IEM A;  2Q9M A;  1K56 D;  2XQZ A;  2WKE A;  2HDS A;  4S2O A;  5L2F A;  2H10 A;  4MEZ A;  4OPZ A;  1HZO A;  1VM1 A;  4IVI A;  4WM9 A;  3E2K A;  3FV7 A;  3WS2 A;  1XGJ A;  2Y2O A;  3RJU A;  1ESU A;  4JKT A;  4OPR A;  4OLG A;  2XD5 A;  3IF6 B;  5AQB A;  3G34 A;  3VP2 A;  3ZFZ A;  4Q8I A;  1I5Q A;  2Y55 A;  4LV0 A;  3W8K A;  2Y2I A;  5M19 A;  3M6H A;  1K6R A;  4OVD A;  2ZM2 A;  1YMS A;  4XXR A;  1JWZ A;  3AGD A;  3IHB A;  1NZU A;  4U3T A;  5EVI C;  3ZNY A;  3HLW A;  3ZVT A;  3W4Q A;  3W4P A;  2WGV A;  3G4P A;  3UE1 A;  2GDN A;  4MLL A;  1FSW A;  4JLF A;  3UE3 A;  4KZ9 A;  5CGW A;  4PMA A;  2P9V B;  4KG6 A;  4WEK A;  3UO9 A;  4OON A;  5J8X A;  2ZLY A;  4KZ3 A;  3VFH A;  5EVI D;  5AQA A;  3S4X A;  3IQA A;  1KGE A;  2EXB A;  2R9W A;  2XK1 A;  3HUO A;  1YLJ A;  4UA7 A;  5CRF A;  5F83 A;  3NIA A;  4X56 A;  1L0G A;  1BT5 A;  1XA1 A;  2ZD8 A;  2WZX A;  2XLN A;  4JBF A;  4OKP A;  1IYS A;  5D3O A;  2A49 A;  4BLM A;  4WMC D;  3ZCZ A;  3B3X A;  3DWK A;  2FFY A;  4DRT A;  2WKH A;  1MXO A;  4RVA A;  5CHM A;  2ZJ9 A;  4N1H A;  3EQV A;  5FSR A;  3W4O A;  2Z2L B;  2JE5 A;  2IWB A;  5BOH A;  1RP5 A;  1MWS A;  4KZB A;  5CED A;  4WEJ A;  5JYP A;  1PI5 A;  2HPB A;  3V50 A;  3WWX A;  1SKF A;  5GLC A;  3G35 A;  3PBT A;  4Y0O A;  4N1X A;  4CJN A;  4DDY A;  3SS5 A;  4S2I A;  1YLT A;  1BLP A;  1J9M A;  1WE4 A;  3BFC A;  1ERM A;  3A3I A;  3WRZ A;  5FQM A;  1TVF A;  3RXX A;  1AXB A;  3M6B A;  1ONH A;  3JYI A;  1ES3 A;  2V2F F;  4OQI A;  1YLZ A;  1U60 A;  5EVL A;  3GR2 A;  4B4Z A;  4Y7P A;  2QPN A;  1GHP A;  1QME A;  4MNR A;  5DTK A;  3Q82 A;  4JPM A;  4UHU A;  2WUQ A;  4ZAM A;  4X68 A;  5CGS A;  5FQI A;  1H5X A;  1L0D A;  3CJM A;  4LV2 A;  3CG5 A;  3OPR A;  2OV5 A;  4IED A;  4K91 A;  5KZH A;  1MBL A;  4JXV A;  1S6R A;  4OOY A;  2IWD A;  4E3M A;  2XDM A;  2VGJ A;  4R4R A;  4XUX A;  2G2U A;  2WGW A;  5GHZ A;  3HLB A;  1GHI A;  3RXW A;  3IT9 A;  5CTN A;  5M18 A;  3IF5 A;  1K57 A;  3QNB A;  4QJG A;  1K54 C;  2H0Y A;  1CEF A;  1IEL A;  4P87 A;  3Q7Z A;  3UDI A;  2EX9 A;  4EWF A;  1JTG A;  4Y0U A;  3A3J A;  4X53 A;  5HAR A;  4A5R A;  1WYB A;  4EV4 A;  2XF3 A;  5EPH A;  1N4O A;  5HAQ A;  5FI2 A;  2A3U A;  1PZP A;  1NRF A;  3MZE A;  1YLY A;  4FH4 A;  1E3U D;  1PWD A;  4X55 A;  5E2H A;  5E2F A;  4WZ4 A;  4S2L A;  5FI7 A;  1C3B A;  4OP8 A;  5EUA A;  1QMF A;  4BD1 A;  3DWZ A;  3IH8 A;  3ZG7 B;  2Y2L A;  4U0X A;  5F82 A;  1XKZ A;  4QHC A;  1Q2P A;  4F94 A;  3VP4 A;  3HLG A;  3QNC A;  1O07 A;  3C7V A;  3HLF A;  4PM8 A;  4X69 A;  4ZBE A;  2ZQ7 A;  4DXB A;  1E25 A;  1JWP A;  3VOY A;  1FR1 A;  1I2W A;  3SH7 A;  4KZ6 A;  5M1A A;  4EBP A;  4S2N A;  2ZMA A;  3NC8 A;  2IWC A;  4N9L A;  4PM5 A;  3N6I A;  2EX2 A;  4RYE A;  5CXW A;  3GV9 A;  1BSG A;  4BEN A;  1PI4 A;  2WZZ A;  1ZC2 A;  3VOZ A;  1YMX A;  5GL9 A;  2DNS A;  4UA9 A;  3SH8 A;  1K4F A;  1W8Y A;  3IF6 C;  3G32 A;  4FSF A;  5KMW A;  1TDL A;  2V20 A;  1ES4 A;  2B5R A;  3ZDJ A;  4OH0 A;  4YFM A;  1LI0 A;  1KDS A;  2OLU A;  4PPR A;  5EOE A;  5AQ7 A;  2ZC5 B;  4P85 A;  5E2E A;  3PBQ A;  2HP5 A;  4KQQ A;  1BZA A;  4MBF A;  2PBY A;  1E4D A;  1ES5 A;  1FOF A;  3VP0 A;  1GCE A;  3A3F A;  1KGG A;  1DJC A;  4L0L A;  3CMZ A;  2VGK A;  1K4E A;  3LO7 A;  2FFF B;  4MBK A;  4N9K A;  1Z6F A;  5HL1 A;  3BYD A;  3HRE A;  1ERO A;  1FSY A;  2EFX A;  2XR0 A;  1MKI A;  5EOO A;  4DE3 A;  4WYY A;  5FA7 A;  1HVB A;  4JXG A;  2ZQ9 A;  4QY6 A;  2Y2H A;  2PU4 A;  3HVF A;  3DTM A;  4ZJ1 A;  3HL9 A;  3HLD A;  2JC7 A;  1H8Y A;  1BLH A;  4OPQ A;  1GA9 A;  3AGE A;  4D2O A;  4HBT A;  2ZC4 B;  3BEB A;  1NYM A;  3HUM A;  5CEB A;  1ALQ A;  1NY0 A;  3P09 A;  4OOL A;  3BLM A;  4RA7 A;  5DF7 A;  3NI9 A;  2WYX A;  4BQM A;  3MXR A;  3M2K A;  1LI9 A;  5FAS A;  2Y2N A;  1VQQ A;  1MWU A;  3O3V A;  1KGF A;  2J8Y A;  5FAO A;  1PYY A;  4XUZ A;  1G6A A;  1KVM A;  2WK0 A;  2Y2P A;  5GHX A;  3BFF A;  3HLE A;  3ZG8 B;  4DKI A;  1M6K A;  1JWV A;  2QMI A;  5CEC A;  5DF9 A;  4BJP A;  4ZTK A;  3NBL A;  1CI9 A;  3UNW A;  3OPP A;  4Z9Q A;  3V3R A;  1LLB A;  5KSH A;  5EVI A;  3FKW A;  2EX8 A;  4CPK A;  1FCO A;  2JCH A;  4C75 A;  3Q7V A;  3PAG A;  3S22 A;  3DW0 A;  3IWI A;  4IBR A;  2HDR A;  5F1F A;  3ISG A;  4M3K A;  5HW3 A;  2XFS A;  3MKE A;  5FQQ A;  4IBX A;  4WMC A;  5CGX A;  5AQ9 A;  4LCL A;  3V3S A;  1FR6 A;  4EBN A;  4GD6 A;  1EWZ A;  3UPN A;  5FQ9 A;  1NJ4 A;  1W79 A;  1CEG A;  4NK3 A;  2WAE A;  4S2M A;  4E3J A;  3GRJ A;  3PBR A;  3OCL A;  3VSK A;  4DXC A;  1L0F A;  2WGW B;  4ID4 A;  5DTT A;  3N8R A;  5FQJ A;  2C5W B;  4PM9 A;  4E3O A;  3G31 A;  3C4O A;  1PW1 A;  5A91 A;  4HEF A;  4LCM A;  2RCX A;  1DJB A;  1KE3 A;  1L0E A;  1LL5 A;  1N9B A;  4O7D A;  4QU3 A;  4OQH A;  2ZM0 A;  5HAI A;  3BLS A;  4DF6 A;  3ZG5 A;  1K6S A;  2DCF A;  4U0T A;  1K55 C;  4LEN A;  3MBZ A;  5CTM A;  3VP3 A;  4K0W A;  4FCF A;  1FCM A;  2Y2K A;  4JF5 A;  3NDE A;  3O86 A;  4RX3 A;  4BL2 A;  4JXS A;  4S2J A;  2J9P A;  5DTS A;  1PZO A;  2ZQD A;  1IYP A;  4KZ4 A;  5HAP A;  3UN7 A;  1RGZ A;  3NY4 A;  5EEC A;  3TOI A;  4WZ5 C;  3Q81 A;  3C7U A;  1IYQ A;  2H0T A;  5TFQ A;  2Y91 A;  4QD4 A;  3VMA A;  2H5S A;  3O88 A;  3IHA A;  1CI8 A;  2Y2J A;  4R1G A;  5FAP A;  4GNU A;  3VP1 A;  1ES2 A;  3BFE A;  3GMW A;  4EUZ A;  2E8I A;  3GQZ A;  4E3K A;  3LY4 A;  1BUE A;  3VFF A;  5IHV A;  4QB8 A;  3HBR A;  5EE8 A;  5KSC A;  2P74 A;  2Y2M A;  4ZDX A;  3A3E A;  1E3U A;  3IWO A;  5FDH A;  1ZKJ A;  3A3D A;  1K54 A;  4S2P A;  1YM1 A;  4PM7 A;  2Z2M B;  3IXD A;  1XA7 A;  3LEZ A;  4QY5 A;  3UPP A;  3SS4 A;  3ZG0 A;  1YLW A;  5CER A;  1JVJ A;  3NDG A;  4R3J A;  3UY6 A;  3GSG A;  1KE0 A;  4IVK A;  3OCN A;  2HDU A;  1NYY A;  5FQK A;  4KQO A;  1FCN A;  1OME A;  4K0X A;  3AGF A;  3I7J A;  4E3L A;  3WRT A;  5F1G A;  3NCK A;  5TR7 A;  2OLV A;  4KZA A;  3PTE A;  3N8S A;  3BFD A;  3C4P A;  4KQR A;  3N7W A;  1LHY A;  4KZ8 A;  4OLD A;  4OQG A;  4R0Q A;  5FAT A;  3OC2 A;  1TDG A;  4OQ0 A;  1PW8 A;  1BTL A;  1SDE A;  1BUL A;  3MXS A;  3Q07 A;  3VSL A;  1K56 A;  4P6B A;  1LL9 A;  1DJA A;  3HLC A;  5G18 A;  3IF6 A;  4EQI A;  1S0W A;  2BLS A;  3O87 A;  2ZQA A;  3WS0 A;  3PAE A;  4OP5 A;  4WBG A;  4GZB A;  4OPY A;  4MBH A;  1PIO A;  1DY6 A;  1WYC A;  1GHM A;  3QHY A;  1BLS A;  2DRW A;  2OSU A;  1XGI A;  2QZ6 A;  3ITB A;  3PBS A;  1MY8 A;  3G30 A;  1KDW A;  3N8L A;  1K38 A;  1NXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...