3Q07A

Ctx-m-9 s70g in complex with piperacillin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title CTX-M-9 S70G mutant in complex with piperacillin
rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 94
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q07A00
3VP3A 1KVMA 3OCNA 4KZ7A 3IXHA 1GCEA 1ONHA 1S0WA 2BLSA 4FD8A 2EX8A 2ZJ9A 4IVKA 1XPBA 3BFFA 5E2HA 5F82A 4DRTA 4OPRA 3IT9A 4HEFA 1IKIA 4LCMA 4Q8IA 3NC8A 1DY6A 2DNSA 2Y91A 1QMEA 3UPNA 1ES3A 3FWLA 5EOEA 4OQHA 3VP2A 1JWZA 4Y7PA 3HUMA 1FSWA 3Q1FA 3ISGA 4KENB 5F83A 4S2PA 1BLSA 3PBSA 3V3RA 4HESA 3IWOA 3MBZA 4IBRA 3GQZA 3HUNA 3O86A 2QZ6A 3LY4A 3TOIA 1H8YA 3JYIA 2XQZA 3MZFA 3BFCA 5GLBA 2EXAA 4OONA 4OLGA 4KZAA 1TEMA 1MXOA 3Q07A 1L0DA 3LY3A 4JF6A 5M1AA 5AQBA 3UDXA 3ZG8B 1VQQA 1IYQA 1DJAA 4UA6A 1YQSA 2WGWB 2ZQ9A 1IELA 2I72A 2WKHA 3GVBA 2Y2NA 1JWVA 3V39A 4PM8A 2H10A 3G35A 4JXSA 5BOHA 4FCFA 3WS4A 5G18A 3E2KA 4E3MA 5EECA 5FQQA 5L2FA 3OPPA 4X55A 3VFFA 3BRMA 1K55A 4DKIA 4D2OA 4K0XA 5GLAA 2BG1A 4BL2A 1M6KA 4RX2A 3UY6A 4WM9A 3MXRA 1SDEA 4DE0A 4H8RA 5EOOA 4JXWA 2R9XA 4X69A 5KMWA 1J9MA 3WRZA 4XUZA 5DTKA 3ZDJA 4S2JA 3GRJA 3S22A 1LHYA 4S2KA 3QNBA 3UDFA 2P74A 1I2WA 2G2UA 3PTEA 5CGSA 1XA1A 3CG5A 2IWCA 3IF5A 1JTGA 3ZVWA 3G2ZA 2XFTA 2WAEA 2JE5A 4WZ4A 3O3VA 4WZ5C 2Y2HA 4R3BA 1ES5A 2X71A 4JLFA 4P0MA 1E25A 5CHJA 1XGIA 2WZXA 1JTDA 1K6SA 1OMEA 4S2OA 5E2FA 3PBQA 5DF7A 1PW8A 3G31A 5CHUA 3B3XA 2WKEA 5CERA 3VP1A 2HDSA 3M6HA 1IYOA 1W5DA 2Y2QA 1GHIA 4Z9QA 4B4XA 4E3LA 3OCLA 1XA7A 4OPZA 1RGZA 2J7VA 2EXBA 2H0TA 3GSGA 4EV4A 1SCWA 2HP6A 3BFGA 4DDYA 4LV3A 2Y2KA 1K57C 4GKUA 4ZJ3A 4KZ5A 3OPLA 1BT5A 4GN2A 1XX2A 2GDNA 3G4PA 4JXVA 4QB8A 5HW3A 5A91A 1JVJA 3HLBA 1TDLA 4OOLA 3SH9A 2P9VB 1YLWA 3ZVTA 1IEMA 1SKFA 3VOYA 3LCEA 3HLFA 1CI9A 1K56D 3A3EA 4JBFA 4E3KA 3NBLA 3WS2A 4GDBA 3HLCA 5JYOA 3GTCA 2UWXA 4S2NA 4O7DA 5F1GA 1E3UD 4XUXA 3Q7VB 5A92A 2OSUA 5HFOA 1I2SA 3UO9A 1ZKJA 3EQVA 1ZG6A 1GHMA 4OLDA 5TR7A 4X53A 1O07A 1G68A 1ESUA 2ZC5B 1MPLA 4L0LA 5HAIA 3WS0A 3FZCA 1YLYA 4S2IA 4X6TA 3SS5A 4E3NA 1L0EA 4LV1A 4GNUA 4QY5A 5FA7A 3IF6B 3HLDA 1PWDA 1RCJA 3MZEA 5CRFA 2X02A 2B5RA 3VMAA 3N6IA 3AGFA 2E8IA 5E2GA 5EVIA 2VGJA 2PU2A 4HBUA 4RYEA 4BD1A 3UPOA 1KGFA 5D3OA 4R4RA 5FQKA 2ZQ7A 3WS5A 4KQRA 4E6XA 1MWRA 1PZOA 3G32A 5GLDA 3AGEA 4WEKA 2ZQAA 4WELA 3HVFA 1LI9A 4WMCD 1SDNA 5M18A 5DVAA 4ZAMA 2XK1A 3HL9A 1NJ4A 4GDNA 4MBFA 4FSFA 3QHYA 3ITBA 4KZ4A 5FAPA 1BULA 2HDRA 3ZCZA 2XLNA 4RX3A 2WYXA 3BM6A 3MXSA 3N8LA 3OZHA 4EBNA 3W4OA 3HREA 3LO7A 2XD1A 4ZBEA 4PM6A 1EWZA 1ALQA 1XXMA 3PBRA 5FQ9A 1SHVA 3FKVA 1KE3A 4QD4A 2J9PA 2RL3A 2Y2GA 4R3JA 5CTNA 1RP5A 4PPRA 3BFEA 3V5MA 4BD0A 2HDQA 4R23A 1PWGA 1W8YA 4FH4A 3A3IA 1ES2A 4QJGA 1ERMA 4YINA 3W4QA 4E3OA 2ZD8A 1VM1A 4GD6A 4U0TA 1L0GA 2IWDA 5KSCA 5AQ7A 3FKWA 3N4IA 2ZM2A 4OKPA 2ZM0A 4KZ9A 4DXCA 1AXBA 2JC7A 4EQIA 2XD5A 5CTMA 5CHMA 2Y2PA 1CEFA 1K4EA 5DF9A 4N92A 1W7FA 4UHUA 2EX2A 3E2LA 2V2FF 4K0WA 5FI2A 3TSGA 4K91A 1PW1A 2H5SA 1K54C 4OQ0A 2DCFA 4OP5A 5EE8A 2J9OA 5CEBA 5M19A 2ZC3B 3NDGA 2ZQCA 1ONGA 4PM9A 1PWCA 1K38A 4JKTA 4XXRA 3PBTA 2EX6A 2WAFA 4C3QA 1NZUA 2OLVA 2PU4A 5KSHA 3VSKA 1NZOA 2V20A 3ITAA 1K57A 3IWIA 3MZDA 4DF6A 2EFXA 2Z2MB 2Y2IA 4R0QA 5GHZA 4E6WA 5E2EA 3OPRA 4WYYA 4IEDA 4QU3A 4KZ3A 1NYYA 4S2MA 1JWPA 5TGFA 1KE0A 3ZG9B 5J8XA 1YMXA 4MLLA 2CC1A 4ZTKA 1BLHA 2Z2LB 4PM5A 3LEZA 4EUZA 3MFDA 4KQQA 4KZ6A 3UPPA 3NCKA 4DDSA 2XDMA 3C4PA 1NXYA 5FASA 1BLPA 4EWFA 3G30A 3SS4A 5A90A 4BL3A 1YLJA 3FV7A 3OPHA 1FCNA 4ZDXA 1E4DA 2Y4AA 3C7VA 3N8SA 3UNWA 5JYPA 4OVDA 4KZ8A 3SH8A 1ES4A 3W8KA 4UAAA 1L2SA 5FQJA 4EBPA 4R1GA 2HPBA 3S1YA 2ZM8A 1CI8A 5TFQA 1PIOA 1FCMA 3D4FA 3O87A 2Q9NA 4GOGA 3UE0A 3WRTA 1HZOA 4UA7A 2ZLYA 1BTLA 4JPMA 5AQAA 5FAOA 2ZQ8A 1MWUA 1QMFA 3SOIA 3NDEA 2C6WB 5FI6A 4KQOA 3QNCA 1Q2QA 4CJNA 3RXXA 1ESIA 1YLTA 3IF6C 1BLCA 3ZG7B 1XP4A 1S6RA 2Y2JA 5GLCA 2H0YA 4LENA 5A93A 3MKEA 5I94A 4MBKA 1H8ZA 2JBFA 4JXGA 2WGWA 4BLMA 5E43A 2V1ZA 4R4SA 3IXBA 5KZHA 1L0FA 1N9BA 2HP5A 3V50A 3BECA 1H5XA 3SH7A 3N8RA 3FYZA 3C7UA 5EVLA 1KVLA 2WK0A 2X01A 5FATA 3UN7A 3VOZA 4N1HA 4QY6A 2WZZA 2ZMAA 4F94A 2XGNA 1NYMA 1YLZA 3DWKA 3SS3A 1KGEA 3EQUA 4IVIA 4OP8A 3ZGAB 4JF5A 5CXWA 4E3JA 3W4PA 4N1XA 1GA9A 1PI5A 2XEPA 3Q82A 2J8YA 3CZDA 1KGGA 4A5RA 3C4OA 3BYDA 4X68A 3BFDA 1PZPA 2FFFB 4NK3A 2WUQA 4S2NC 3PAGA 1XGJA 4P6BA 4OPQA 4BQMA 5F1FA 3IHBA 3UDIA 4NETA 3VSLA 5CECA 1ZG4A 3MKFA 4Y0OA 1DJBA 3VFHA 3DWZA 3WS1A 4Y0UA 1N4OA 3P09A 1BSGA 3NI9A 4MEZA 3ZG5A 1K56A 4Y0TA 1LL9A 3NIAA 5HX9A 1FR1A 4KG6A 1Y54A 3WWXA 3ZG0A 3GR2A 4HBTA 1CK3A 3A3JA 3AGDA 4EBLA 3S4XA 2PBYA 1WE4A 4OOYA 5FDHA 1K54A 2G2WA 1Q2PA 2OLUA 1E3UA 4B88A 1EI5A 5IHVA 3CMZA 3DW0A 5FI7A 1FQGA 4C6YA 3VP4A 2XF3A 4WZ5A 5EVIC 1GHPA 3OC2A 4M3KA 5DTSA 1U60A 5U47A 3ZNYA 4KG5A 3BLSA 1TVFA 1LI0A 1MKIA 3HBRA 5GL9A 1EROA 2WGVA 4E3IA 5HL1A 4N9KA 3UE1A 5EVIB 2OV5A 3IXDA 4LCLA 2WGIA 2WADA 4QHCA 1K4FA 1Z6FA 1K6RA 1YMSA 2C5WB 3I7JA 3HLGA 2XR0A 3M2JA 5DTTA 4OH0A 4BENA 2VGKA 4MNRA 2IWBA 4BJPA 1XKZA 1ZC2A 4OOMA 2QMIA 1FSYA 4B4ZA 1KE4A 3IHAA 2JCHA 1W8QA 4LV2A 4P85A 1NRFA 2P9VA 3ZFZA 3GV9A 4C75A 3VP0A 1IYPA 3Q81A 4WMCA 5HAQA 3BEBA 3PBOA 1C3BA 1TDGA 2Y2MA 3G34A 3IXGA 3A3FA 3V3SA 4PMAA 3M2KA 4S2LA 1K55C 4JF4A 4RA7A 2XH9A 5EPHA 1LL5A 5HARA 1KDWA 3IQAA 3IH9A 1HD8A 1I5QA 3Q7VA 5AQ9A 4ID4A 2HDUA 1IYSA 4ZJ1A 3TG9A 4PM7A 4OQIA 4OQGA 4RVAA 2Y2OA 3CJMA 4FH2A 1MWSA 1RGYA 4ZJ2A 1FR6A 3UE3A 4CPKA 1PYYA 1MBLA 1O7EA 2DRWA 5FAQA 5GHXA 4YFMA 1K25A 1PI4A 2Y55A 2ZC4B 3IF6A 5CGWA 3DTMA 4KG2A 5EVID 1LLBA 3RXWA 3G2YA 1MWTA 3ZHHA 5HAPA 1FCOA 1W79A 4U3TA 4DE3A 1BUEA 3M6BA 3IH8A 4MBHA 1YLPA 1YM1A 3BLMA 2EFUA 1ERQA 3HLWA 2FFYA 4LV0A 5FSRA 3RJUA 3O88A 4P87A 4DXBA 2EX9A 4UA9A 3Q7ZA 2Q9MA 2R9WA 3P98A 1G6AA 5CEDA 4DE2A 1WYBA 2HP9A 5EUAA 1WYCA 4X56A 2A49A 1GA0A 2ZQDA 2ZC6B 1KDSA 1NY0A 3PAEA 2Y59A 1HTZA 4OPYA 4WEJA 1FOFA 4IBXA 3ZNTA 1BZAA 1HVBA 5CGXA 1CEGA 2XFSA 5DF8A 3A3DA 4GZBA 4U0XA 1M40A 3HLEA 4WBGA 4DE1A 1IKGA 1YT4A 2RCXA 2A3UA 2Y2LA 3GMWA 4KZBA 4N9LA 2QPNA 3PBNA 5FQIA 4GB7A 1DJCA 2ZC7A 4GD8A 3NY4A 3HUOA 2WKIA 3C5AA 5GHYA 3N7WA 5FQMA 3IWQA 1MY8A
chains in the Genus database with same CATH superfamily
1KVMA 3OCNA 3BFFA 1IKIA 4LCMA 1OJ5A 1IFQA 3H82A 1QMEA 5TBMA 3F1OA 4CLCC 3HUMA 4EW7A 3Q1FA 5F83A 1BLSA 4PHTA 1H8YA 2V8FA 2XQZA 3BFCA 2Y79A 4KZAA 5DJUA 2VK3A 1MXOA 1L0DA 4JF6A 4PKYG 1YQSA 1IELA 3GVBA 1JWVA 3V39A 1T19A 4FCFA 4HJ6A 1UWPX 5EECA 4Y15A 2J3WA 1K55A 4DKIA 4D2OA 5HSQA 3UB5P 4DE0A 5EOOA 4HP9A 1S4SA 1SZVA 2R9XA 5K5BA 3K2NA 3TRCA 4S2JA 4HI4A 3PHYA 2Z6CA 4LRXC 2ZL1B 3PTEA 4X1MA 5CGSA 2IWCA 3L7HA 2WAEA 3S7PA 4WZ5C 1E25A 1XGIA 2WZXA 3FPVA 2L0WA 4S2OA 5FL3A 3T1XA 3G31A 2WKEA 5MC7A 2HDSA 3FC7A 4EEUA 3M6HA 1W5DA 3UMDA 4B4XA 1F5MA 5HWTA 2J7VA 3GSGA 4DMZA 4DDYA 4LV3A 1YAXA 4ZJ3A 4KZ5A 4Q0HA 5L8MA 4GN2A 2GDNA 4R6LA 3T50A 1JVJA 5L10A 2P9VB 1YLWA 1SKFA 1FILA 4JBFA 4GW9A 3HLCA 4JGOA 4O7DA 1E3UD 5HFOA 3EQVA 1ZG6A 1GHMA 3KSGA 3MQOA 3ZYTA 3C30A 1L0EA 3H7WB 1DP8A 5FA7A 3IF6B 3HLDA 1S66L 3VMAA 3N6IA 3T1RA 2HZ5A 2E8IA 4CQHA 4BBUA 1OPXA 2EWVA 5F68A 2PU2A 5HZHA 3UPOA 4II7A 2ZQ7A 2QJ7A 1PZOA 3G32A 5GLDA 3HVFA 1SDNA 5DVAA 4ZAMA 2XK1A 4HP4A 5L09A 1NJ4A 4FSFA 3A0VA 1N9NA 4KUKA 2HDRA 3ZCZA 2VKSA 4RX3A 2WYXA 4Q0JA 3F1PB 4EBNA 2XD1A 2Y2GA 1OTEA 2XA7M 3F1NA 4PPRA 3V5MA 2HDQA 1W8YA 3W4QA 4P6ZM 2IWDA 3QP2A 4OKPA 2ZM0A 4DXCA 5CTMA 1NRJA 3CPTA 2M7VA 5DF9A 3LIBA 1VEUA 3TSGA 5M19A 2ZC3B 3NOUC 4D60A 1Y4OA 1LL8A 1NZUA 2BTFP 3MR0A 4DF6A 2JKRM 5GHZA 3DBAA 1KE0A 3ZG9B 5C5KA 2PYPA 2W1TA 4F3LB 4EUZA 4KZ6A 3B33A 2BASA 5HD3A 3C4PA 4LRYC 1BLPA 4EWFA 3G30A 1XJ6A 3SS4A 5A90A 1YLJA 2P08A 4NKPA 1FCNA 3C7VA 3UNWA 2PR5A 4JGQA 4DN0A 4UAAA 1L2SA 3KYZA 3S1YA 1PIOA 1K0KA 3LI8A 5FI6A 1XP4A 2Y2JA 5GLCA 2H0YA 4NXGA 4HJ4A 5KZHA 3V50A 1DP9A 3BECA 4YWZA 1XFNA 3SS3A 1A0KA 2V0WA 3EQUA 4IVIA 4NXEA 4OP8A 2JKTI 5CXWA 1OJGA 2XEPA 2PBDP 3T4LA 1MKMA 1MZUA 1NWZA 1DP6A 1XGJA 2K31A 1ZG4A 3CUEA 3JVUA 4CLCB 3ZG5A 4Y0TA 1LL9A 3NIAA 1FR1A 3ZG0A 5EVEA 3AGDA 3S4XA 2PBYA 2V1AA 4EU0A 1WE4A 4O8GA 5IHVA 3DW0A 4C6YA 4Y3IA 3OC2A 5U47A 1U60A 2W27A 4KG5A 1LI0A 2W3DA 4E3IA 1XFQA 2GZAA 3HLGA 4BENA 4UQIS 3VE3A 2VV7A 3TE8A 1FSYA 2A2LA 2UV0E 2LB9A 4LV2A 3JPUA 2QYBA 2OAQ1 4FTXA 4C75A 1IYPA 3CI6A 3G34A 5IU1A 2PR6A 4RA7A 5HARA 3IQAA 2M7UA 4ID4A 4Y5FA 4RVAA 2Y2OA 2AVXA 4ZJ2A 3UE3A 1OTBA 2ZC4B 2Y55A 5CGWA 3ZHHA 5EVID 1FCOA 4U3TA 3M6BA 3IH8A 4MBHA 4MMNA 4LV0A 5DKKA 4UA9A 2Q9MA 3CWFA 1WYBA 2HP9A 1WYCA 3B42A 1GSWA 2ZQDA 4WLAA 2ZC6B 1KDSA 1NY0A 3PAEA 4OPYA 4IBXA 2YKHA 3HJIA 5CGXA 2J3TD 4KZBA 2W0NA 3PBNA 5DFXA 4GB7A 4ETZA 2WKPA 3NY4A 2WKRA 3NOTC 3N7WA 4HQAA 3IWQA 5AVFA 1YSQA 3VP3A 2HGVA 1GCEA 4FD8A 5E2HA 1XPBA 4DRTA 4ESPA 1LSXA 3NC8A 3KO6A 3UPNA 5EOEA 2PRFA 4E04A 3UMEA 1JWZA 4Y7PA 1FSWA 3UB6A 3ISGA 1CQAA 3P01A 4S2PA 3PBSA 4GHIA 4YOFA 2W3GA 4PAUA 3IWOA 3UE6A 4IBRA 3EWKA 3LY4A 3QP8A 1UWNX 3MZFA 5GLBA 2EXAA 4OLGA 3C2WA 4B93A 2J80A 2PDRA 5AQBA 1DRMA 1IYQA 5L07A 1YSPA 3LICA 2H10A 3G35A 4XT2A 5BOHA 4QWOA 1UGUA 4R38A 2VV8A 4E3MA 4X55A 2QWSA 3BRMA 3C38A 2BG1A 4RX2A 3MXRA 1SDEA 4H8RA 4JXWA 2NUTC 2QJ5A 2J3TC 2OWHA 1S67L 3S22A 1LHYA 2B95A 2P74A 1I2WA 3MS6A 1TD5A 1XA1A 3CG5A 3IF5A 1JTGA 2XFTA 2Q0OA 4P0MA 5EM1A 5CHJA 1JTDA 1OMEA 2P04A 3LIAA 5DF7A 5CERA 3VP1A 1IYOA 4Y13A 2Y2QA 4EERA 1OT6A 1GHIA 3ULFA 3BJNA 3E0YA 1SKOA 4G3VA 4GKUA 1BT5A 1XX2A 5HD5A 1ODVA 3HLBA 4OOLA 1TDLA 3SH9A 3ZVTA 3R4KA 3LCEA 3HLFA 2E8JA 1K56D 3A3EA 2VA0A 3T4SA 3S7QA 4HIAA 5JYOA 1D06A 3Q7VB 2Y8HA 3UO9A 1VETB 1O07A 1G68A 5HDDA 1ESUA 2ZC5B 3WS0A 4GS9A 4S2IA 4E3NA 2D02A 5F6AA 3QP5A 5G4ZA 1RCJA 2EA9A 3MZEA 2B5RA 1H8MA 5E2GA 4ARZB 2VGJA 4HBUA 1P9WA 1AWIA 3IS2A 4R4RA 5FQKA 3WS5A 3O5YA 2VEAA 1OTAA 4WEKA 3GECA 1LI9A 5M18A 3HL9A 4MBFA 3ITBA 1WA9A 3BM6A 3N8LA 3OZHA 4IJGA 3HREA 3LO7A 3PYPA 4ZBEA 1EWZA 1XXMA 3PBRA 5FQ9A 2GNXA 1KE3A 4QD4A 1RP5A 3A3IA 1ES2A 4QJGA 5KSCA 1XJ2A 4KZ9A 3BWLA 1CEFA 1K4EA 5LBRA 3RFBA 1ZTUA 2V2FF 3KSFA 5CEBA 3GDIA 1PWCA 2G7UA 4JKTA 4XXRA 1X0OA 4C3QA 5KSHA 4BMWA 1NZOA 1K57A 2Z2MB 2B18A 4GCZA 3OPRA 4WYYA 1NYYA 1JWPA 5J8XA 2L4RA 4EESA 3NECA 3LEZA 3VV4A 1TS6A 3UPPA 2KX6A 2V9AA 3FV7A 3OPHA 2Y4AA 3N8SA 2VLGA 3T4KA 3SH8A 5J7EA 3W8KA 2R78A 5IT5A 2KDKA 2ZOHA 1H3QA 1FCMA 3D4FA 4UA7A 5FAOA 2ZLYA 4JPMA 2PAVP 4MDZA 3KX0X 5DFYA 1N9LA 3SOIA 2C6WB 1P97A 1ESIA 1YLTA 3ZG7B 2HJ9C 5FEGA 3MKEA 5I94A 5E43A 2QHKA 2V1ZA 2HP5A 2A24B 2VZWA 2X01A 1KVLA 2VJWA 2WK0A 4IHQA 3VOZA 4Z1WA 2XGNA 1NYMA 2GX5A 1KGEA 4JF5A 3LEQA 1PI5A 3CZDA 1KGGA 3C4OA 3EEAA 3BYDA 4X68A 4NK3A 5F1FA 3PAGA 2JKGA 5CECA 3MKFA 4Y0OA 1DJBA 3VFHA 4Y0UA 1BSGA 3C8CA 2ZL1A 3NI9A 3JVVA 2XRNA 3GR2A 4HBTA 4EBLA 4OOYA 1K54A 1T18A 1EI5A 4NXBA 5FI7A 1GHPA 3BLSA 3MQQA 1TVFA 1EROA 3UE1A 5EVIB 3IXDA 1PNEA 4LCLA 5IS1A 2WADA 1K4FA 2C5WB 3I7JA 2O99A 3M2JA 2ZMVA 2VGKA 4MNRA 2IWBA 4L9GA 2VGLS 3UB7A 1XKZA 2QMIA 4B4ZA 1W8QA 4P85A 1NRFA 3HJKA 2P9VA 3PXPA 4WMCA 5HAQA 2O9CA 3MQ0A 3BEBA 3QP6A 1C3BA 2Y2MA 3A3FA 3T4TA 3M2KA 1K55C 4JF4A 5EPHA 1LL5A 4ZJ1A 2VGLM 1MBLA 1O7EA 5FAQA 4G3KA 3H7WA 3IF6A 3DTMA 1LLBA 2W1RA 3G2YA 1MWTA 4WN5A 1PRQA 1W79A 5A8BA 3QP4A 1YLPA 3BLMA 1ERQA 3O88A 4WF0A 4DXBA 4NG2A 3P98A 2R9WA 4FUWA 1BZAA 2HF6A 4ZRRA 2ZBBA 3A3DA 2V1BA 4GZBA 3HLEA 4DE1A 2RCXA 3GMWA 2A3UA 2Y2LA 4N9LA 4AFIA 3F1PA 3KYQA 1G6OA 1W63Q 5FQMA 2P7JA 5HPIA 5CX7A 3IXHA 1HLUP 1ONHA 5F82A 5F69A 3EGXC 4HEFA 4Q8IA 1G5UA 1DY6A 2Y91A 1ES3A 3FWLA 1T1CA 3MBZA 3LI9A 3S7OA 3GQZA 3HUNA 3CHWP 4ETXA 1YKDA 2QZ6A 4BBVA 1TS8A 5M1AA 3UDXA 3E4QA 5KIZA 1DJAA 4UA6A 2WGWB 2ZQ9A 4GJ4A 2WKHA 3EEHA 2Y2NA 3P7NA 1GSXA 3E98A 5HDCA 5FQQA 3OPPA 4F3LA 4K0XA 4BL2A 2HJEA 1M6KA 2PD7A 3L9KA 4Y17A 4YNRA 4CLCE 2WKQA 3E4OA 1J9MA 4XUZA 3GRJA 3MMHA 4S2KA 4NXFA 3QNBA 4LPZA 3ZVWA 3O3VA 3A0RA 2Y2HA 4R3BA 1ES5A 2X71A 4JLFA 1OTDA 4UQIM 5E2FA 3PBQA 3B3XA 4EQ1A 1D7EA 4JGPA 4KQDA 3OCLA 1XA7A 2KOIA 4OPZA 2EXBA 4EV4A 1SCWA 3BFGA 2Y2KA 4I3JA 4EXOA 3OPLA 4X25A 3V67A 4QB8A 4UEYA 3VOYA 3R7WB 2PYRA 1TS7A 3KYEA 4E3KA 3WS2A 1JNUA 3GTCA 2UWXA 4CLCA 4S2NA 4IUHA 5A92A 4RQ9A 1ZKJA 3LR5A 3FZCA 4H6JB 4O01A 4X6TA 3SS5A 3W2ZA 2JKFA 4I3AA 5CRFA 2X02A 3D72A 3AGFA 3QP1A 5DKLA 4RYEA 1PFLA 4KQRA 4E6XA 4HH2A 2ZQAA 4WELA 1LSVA 2CMNA 4GDNA 3LR4A 1NLZA 2XLNA 5AJGA 4EUVA 3MXSA 5EV0A 2FH5A 1ALQA 4WL9A 3FKVA 2M1CA 4R3JA 4BD0A 1PWGA 1ZHHB 4FH4A 3S7NA 1ERMA 4E3OA 2ZD8A 1VM1A 4GD6A 4GS9B 4U0TA 1L0GA 4ME4A 3PR6A 3N4IA 3CUEC 3SW1A 2VV6A 3H82B 5TBMB 3F1OB 1AXBA 1S4RA 2Y2PA 4IUKA 4N92A 3FPWA 4UHUA 2EX2A 3IX4A 4K91A 1PW1A 2H5SA 2DCFA 4OP5A 2J9OA 2ZQCA 3DTEA 1K38A 3D9YA 1OTIA 2EX6A 2PU4A 3BQ8A 3VSKA 3MZDA 2EFXA 1LSWA 2OWJA 3T4QA 4Y2FA 5TGFA 1YMXA 3BQAA 4MLLA 1GSVA 4ZTKA 1BLHA 1G28A 2Z2LB 4HOIA 4KQQA 2JN7A 3NCKA 4DDSA 2LB5A 3ZQ5A 4LRZE 2ZMFA 3LFVA 4BL3A 3LIDA 3T1SA 1E4DA 4MN5A 3OOVA 5FQJA 4EBPA 2ZM8A 3O87A 3WRTA 2ZQ8A 1MWUA 1D1JA 4I3IA 3RXXA 1S6RA 3DTIA 1V9ZA 3U2AA 4MCWA 4LENA 3BY8A 3HCYA 4MBKA 2JBFA 2XSSA 4Q0IA 4BLMA 3VOLA 4R4SA 1N9BA 3SH7A 3N8RA 3FYZA 3C7UA 5EVLA 3TJZC 4QY6A 3BW6A 2WZZA 3DWKA 1YLZA 3OBFA 5AVEA 3ZGAB 1P0ZA 1GA9A 2GJ3A 4N1XA 3Q82A 2J8YA 2JHEA 4S2NC 4P6BA 4OPQA 3IHBA 4NETA 3VSLA 2DMWA 3WS1A 3DWZA 3D3OA 2FZ0A 1N9OA 3WWXA 3MXQA 3VE4A 5FDHA 2G2WA 1Q2PA 2OOLA 1E3UA 3CAXA 3CMZA 3LR3A 1FQGA 5DJTA 2XF3A 4M3KA 3ZNYA 5GL9A 1BYWA 2WGVA 2OV5A 2WGIA 1YMSA 4OH0A 4BJPA 1S1ZA 5FEFA 2IA2A 2K7SA 3MJQA 3T1QB 3IHAA 2JCHA 3ZFZA 3GV9A 3VP0A 3Q81A 1TDGA 3IXGA 4PMAA 4S2LA 1KDWA 3F1NB 3IH9A 1HD8A 1I5QA 3Q7VA 4LGWA 5AQ9A 1YPRA 1IYSA 3TG9A 4OQIA 4OQGA 3CJMA 1VETA 1RGYA 1FR6A 1PYYA 4HHDA 2DRWA 3RH8B 1XJ4A 1PI4A 2I9VA 4KG2A 3T4JA 5HAPA 3CPTB 1LT0A 1VEUB 3CITA 1BUEA 4DE3A 1YM1A 2FFYA 1T1BA 4P87A 2V8CA 4ARZA 3Q7ZA 1G6AA 4LLOB 4DE2A 5EUAA 1GA0A 5EFWA 3IBRA 2Y59A 1FOFA 3ZNTA 2O0YA 5DF8A 1V9YA 5HL6A 1IKGA 1YT4A 5FQIA 4FOFA 1DJCA 2ZC7A 4GD8A 2WKIA 4NEED 5GHYA 2W1TB 1FIKA 4KZ7A 4BD1A 1S0WA 4IVKA 2BLSA 2EX8A 2ZJ9A 4G3WA 4OPRA 2W3FA 3IT9A 2ZOIA 2DNSA 5EM0A 4OQHA 3VP2A 4I5SA 4EETB 4MN7A 4KENB 3V3RA 3K3DA 4HESA 2XA7S 4I38A 3O86A 3B47A 3TOIA 4DJ2A 3JYIA 4P6ZS 4OONA 1TEMA 4LFUA 3Q07A 3LY3A 4BWIA 3ZG8B 1VQQA 1F2KA 2I72A 3DAVA 4PM8A 4L9EA 5FDSA 4JXSA 3WS4A 5G18A 3E2KA 5L2FA 3OLOA 3DTKA 3VFFA 5GLAA 3LIEA 3SZTA 5HDSA 3UY6A 4WM9A 4MN6A 3KSIA 4X69A 5KMWA 3WRZA 2W3EA 5DTKA 2JKRI 3ZDJA 4R70A 3UDFA 2W3HA 2G2UA 3G2ZA 2JE5A 4WZ4A 3RTYA 3G6OA 1CJFA 1K6SA 3LR0A 1PW8A 5CHUA 1NLYA 4WUJA 1S1YA 1TF1A 4Z9QA 4E3LA 2MJ6A 1TS0A 1J3WA 2A24A 3ICYA 1RGZA 2H0TA 2HP6A 1K57C 1VB6A 3UB9A 4R3AA 3G4PA 4JXVA 2HV1A 5HW3A 5A91A 1IEMA 4HNBA 1CI9A 3KSHA 1IOUA 3NBLA 4GDBA 5F1GA 3IX8A 1Y28A 4XUXA 2OSUA 1I2SA 4OLDA 5TR7A 4X53A 3TW8A 4L0LA 1MPLA 5HAIA 1YLYA 4LV1A 4GNUA 4QY5A 1PWDA 3IX3A 4I39A 1STZA 5EVIA 1KOUA 3U4LP 1L3LA 1KGFA 5D3OA 1MWRA 2JKTM 3AGEA 4JGRA 3E4PA 3LGOA 4WMCD 2H28A 3QHYA 4KZ4A 5FAPA 1BULA 2EWWA 3T12B 3W4OA 4PM6A 1SHVA 5I5LA 2J9PA 2RL3A 3EOIA 5CTNA 3BFEA 3LYXA 1CF0A 4R23A 1F9IA 4YINA 2O9AA 1Z09A 2INWA 5AQ7A 3FKWA 2ZM2A 4EQIA 2JC7A 2XD5A 5CHMA 3EGDC 3NOPC 1W7FA 3E2LA 4K0WA 4GHIB 5FI2A 1K54C 4OQ0A 3CLOA 5HPFA 5F5YA 5EE8A 3NDGA 3UB8A 2K2NA 1ONGA 2V0UA 4PM9A 4L9FA 3PBTA 2WAFA 2OLVA 2O9BA 3MF0A 2V20A 3ITAA 3IWIA 2Y2IA 4R0QA 4E6WA 5E2EA 4IEDA 4QU3A 4KZ3A 4S2MA 4XT2B 2L1MA 4KUOA 3A0SA 2CC1A 2ACGA 4O0PA 4PM5A 3MFDA 2XDMA 1NXYA 5FASA 4ZDXA 3NJAA 5JYPA 4OVDA 4KZ8A 1ES4A 3MFXA 2Z6DA 4R1GA 2HPBA 2YKFA 4HH3A 1CI8A 5TFQA 4GOGA 2Q9NA 2VX8A 3UE0A 1HZOA 1BTLA 5AQAA 5J4EA 1QMFA 2PT7A 3NDEA 1XJ3A 4KQOA 3QNCA 1Q2QA 4CJNA 4HJ3A 4B9OA 3IF6C 1BLCA 5A93A 1H0MA 4EEPA 4PKYA 2OAP1 1H8ZA 4JXGA 2WGWA 2D01A 3IXBA 4QPRA 1L0FA 1H5XA 2QKPA 1SKOB 5FATA 1T1AA 3UN7A 4N1HA 2ZMAA 4F94A 3NHQA 3K3CA 5HWVA 4E3JA 3W4PA 4A5RA 3FG8A 1EW0A 3BFDA 1PZPA 2FFFB 2WUQA 1VHMA 4BQMA 3UDIA 1N4OA 3P09A 4MEZA 1K56A 5HX9A 4KG6A 1Y54A 1CK3A 3A3JA 3LUQA 4DJ3A 4BBTA 2OLUA 4B88A 2XROA 3VP4A 4WZ5A 5EVIC 5DTSA 1MKIA 3HBRA 5HL1A 5TJJA 4N9KA 4QHCA 3MSHA 1Z6FA 1K6RA 5DTTA 2XR0A 1ACFA 3IS2B 1P9RA 1ZC2A 4OOMA 1KE4A 5HWWA 3IBJA 3R7WA 3H9WA 2KLIA 3NULA 3PBOA 4X1LA 4CLCD 3V3SA 4GLQA 2XH9A 3LIFA 2HDUA 4PM7A 4K08A 4FH2A 1MWSA 4CPKA 4H6JA 5GHXA 4YFMA 1K25A 1OT9A 3RXWA 4HY8A 2B02A 1F98A 5G4YA 2PHYA 2EFUA 3HLWA 5FSRA 3RJUA 2NUPC 2EX9A 3T4OA 5CEDA 2PD8A 4X56A 2A49A 5J3WA 1MC0A 4M4XA 1HTZA 4WEJA 1HVBA 3BY9A 1CEGA 2XFSA 4U0XA 1M40A 4WBGA 2QPNA 1W63M 3HUOA 3C5AA 1MY8A
chains in the Genus database with same CATH topology
3VP3A 1KVMA 3OCNA 4KZ7A 3IXHA 1GCEA 1ONHA 1S0WA 2BLSA 4FD8A 2EX8A 2ZJ9A 4IVKA 1XPBA 3BFFA 5E2HA 5F82A 4DRTA 4OPRA 3IT9A 4HEFA 1IKIA 4LCMA 4Q8IA 3NC8A 1DY6A 2DNSA 2Y91A 1QMEA 3UPNA 1ES3A 3FWLA 5EOEA 4OQHA 3VP2A 1JWZA 4Y7PA 3HUMA 1FSWA 3Q1FA 3ISGA 4KENB 5F83A 4S2PA 1BLSA 3PBSA 3V3RA 4HESA 3IWOA 3MBZA 4IBRA 3GQZA 3HUNA 3O86A 2QZ6A 3LY4A 3TOIA 1H8YA 3JYIA 2XQZA 3MZFA 3BFCA 5GLBA 2EXAA 4OONA 4OLGA 4KZAA 1TEMA 1MXOA 3Q07A 1L0DA 3LY3A 4JF6A 5M1AA 5AQBA 3UDXA 3ZG8B 1VQQA 1IYQA 1DJAA 4UA6A 1YQSA 2WGWB 2ZQ9A 1IELA 2I72A 2WKHA 3GVBA 2Y2NA 1JWVA 3V39A 4PM8A 2H10A 3G35A 4JXSA 5BOHA 4FCFA 3WS4A 5G18A 3E2KA 4E3MA 5EECA 5FQQA 5L2FA 3OPPA 4X55A 3VFFA 3BRMA 1K55A 4DKIA 4D2OA 4K0XA 5GLAA 2BG1A 4BL2A 1M6KA 4RX2A 3UY6A 4WM9A 3MXRA 1SDEA 4DE0A 4H8RA 5EOOA 4JXWA 2R9XA 4X69A 5KMWA 1J9MA 3WRZA 4XUZA 5DTKA 3ZDJA 4S2JA 3GRJA 3S22A 1LHYA 4S2KA 3QNBA 3UDFA 2P74A 1I2WA 2G2UA 3PTEA 5CGSA 1XA1A 3CG5A 2IWCA 3IF5A 1JTGA 3ZVWA 3G2ZA 2XFTA 2WAEA 2JE5A 4WZ4A 3O3VA 4WZ5C 2Y2HA 4R3BA 1ES5A 2X71A 4JLFA 4P0MA 1E25A 5CHJA 1XGIA 2WZXA 1JTDA 1K6SA 1OMEA 4S2OA 5E2FA 3PBQA 5DF7A 1PW8A 3G31A 5CHUA 3B3XA 2WKEA 5CERA 3VP1A 2HDSA 3M6HA 1IYOA 1W5DA 2Y2QA 1GHIA 4Z9QA 4B4XA 4E3LA 3OCLA 1XA7A 4OPZA 1RGZA 2J7VA 2EXBA 2H0TA 3GSGA 4EV4A 1SCWA 2HP6A 3BFGA 4DDYA 4LV3A 2Y2KA 1K57C 4GKUA 4ZJ3A 4KZ5A 3OPLA 1BT5A 4GN2A 1XX2A 2GDNA 3G4PA 4JXVA 4QB8A 5HW3A 5A91A 1JVJA 3HLBA 1TDLA 4OOLA 3SH9A 2P9VB 1YLWA 3ZVTA 1IEMA 1SKFA 3VOYA 3LCEA 3HLFA 1CI9A 1K56D 3A3EA 4JBFA 4E3KA 3NBLA 3WS2A 4GDBA 3HLCA 5JYOA 3GTCA 2UWXA 4S2NA 4O7DA 5F1GA 1E3UD 4XUXA 3Q7VB 5A92A 2OSUA 5HFOA 1I2SA 3UO9A 1ZKJA 3EQVA 1ZG6A 1GHMA 4OLDA 5TR7A 4X53A 1O07A 1G68A 1ESUA 2ZC5B 1MPLA 4L0LA 5HAIA 3WS0A 3FZCA 1YLYA 4S2IA 4X6TA 3SS5A 4E3NA 1L0EA 4LV1A 4GNUA 4QY5A 5FA7A 3IF6B 3HLDA 1PWDA 1RCJA 3MZEA 5CRFA 2X02A 2B5RA 3VMAA 3N6IA 3AGFA 2E8IA 5E2GA 5EVIA 2VGJA 2PU2A 4HBUA 4RYEA 4BD1A 3UPOA 1KGFA 5D3OA 4R4RA 5FQKA 2ZQ7A 3WS5A 4KQRA 4E6XA 1MWRA 1PZOA 3G32A 5GLDA 3AGEA 4WEKA 2ZQAA 4WELA 3HVFA 1LI9A 4WMCD 1SDNA 5M18A 5DVAA 4ZAMA 2XK1A 3HL9A 1NJ4A 4GDNA 4MBFA 4FSFA 3QHYA 3ITBA 4KZ4A 5FAPA 1BULA 2HDRA 3ZCZA 2XLNA 4RX3A 2WYXA 3BM6A 3MXSA 3N8LA 3OZHA 4EBNA 3W4OA 3HREA 3LO7A 2XD1A 4ZBEA 4PM6A 1EWZA 1ALQA 1XXMA 3PBRA 5FQ9A 1SHVA 3FKVA 1KE3A 4QD4A 2J9PA 2RL3A 2Y2GA 4R3JA 5CTNA 1RP5A 4PPRA 3BFEA 3V5MA 4BD0A 2HDQA 4R23A 1PWGA 1W8YA 4FH4A 3A3IA 1ES2A 4QJGA 1ERMA 4YINA 3W4QA 4E3OA 2ZD8A 1VM1A 4GD6A 4U0TA 1L0GA 2IWDA 5KSCA 5AQ7A 3FKWA 3N4IA 2ZM2A 4OKPA 2ZM0A 4KZ9A 4DXCA 1AXBA 2JC7A 4EQIA 2XD5A 5CTMA 5CHMA 2Y2PA 1CEFA 1K4EA 5DF9A 4N92A 1W7FA 4UHUA 2EX2A 3E2LA 2V2FF 4K0WA 5FI2A 3TSGA 4K91A 1PW1A 2H5SA 1K54C 4OQ0A 2DCFA 4OP5A 5EE8A 2J9OA 5CEBA 5M19A 2ZC3B 3NDGA 2ZQCA 1ONGA 4PM9A 1PWCA 1K38A 4JKTA 4XXRA 3PBTA 2EX6A 2WAFA 4C3QA 1NZUA 2OLVA 2PU4A 5KSHA 3VSKA 1NZOA 2V20A 3ITAA 1K57A 3IWIA 3MZDA 4DF6A 2EFXA 2Z2MB 2Y2IA 4R0QA 5GHZA 4E6WA 5E2EA 3OPRA 4WYYA 4IEDA 4QU3A 4KZ3A 1NYYA 4S2MA 1JWPA 5TGFA 1KE0A 3ZG9B 5J8XA 1YMXA 4MLLA 2CC1A 4ZTKA 1BLHA 2Z2LB 4PM5A 3LEZA 4EUZA 3MFDA 4KQQA 4KZ6A 3UPPA 3NCKA 4DDSA 2XDMA 3C4PA 1NXYA 5FASA 1BLPA 4EWFA 3G30A 3SS4A 5A90A 4BL3A 1YLJA 3FV7A 3OPHA 1FCNA 4ZDXA 1E4DA 2Y4AA 3C7VA 3N8SA 3UNWA 5JYPA 4OVDA 4KZ8A 3SH8A 1ES4A 3W8KA 4UAAA 1L2SA 5FQJA 4EBPA 4R1GA 2HPBA 3S1YA 2ZM8A 1CI8A 5TFQA 1PIOA 1FCMA 3D4FA 3O87A 2Q9NA 4GOGA 3UE0A 3WRTA 1HZOA 4UA7A 2ZLYA 1BTLA 4JPMA 5AQAA 5FAOA 2ZQ8A 1MWUA 1QMFA 3SOIA 3NDEA 2C6WB 5FI6A 4KQOA 3QNCA 1Q2QA 4CJNA 3RXXA 1ESIA 1YLTA 3IF6C 1BLCA 3ZG7B 1XP4A 1S6RA 2Y2JA 5GLCA 2H0YA 4LENA 5A93A 3MKEA 5I94A 4MBKA 1H8ZA 2JBFA 4JXGA 2WGWA 4BLMA 5E43A 2V1ZA 4R4SA 3IXBA 5KZHA 1L0FA 1N9BA 2HP5A 3V50A 3BECA 1H5XA 3SH7A 3N8RA 3FYZA 3C7UA 5EVLA 1KVLA 2WK0A 2X01A 5FATA 3UN7A 3VOZA 4N1HA 4QY6A 2WZZA 2ZMAA 4F94A 2XGNA 1NYMA 1YLZA 3DWKA 3SS3A 1KGEA 3EQUA 4IVIA 4OP8A 3ZGAB 4JF5A 5CXWA 4E3JA 3W4PA 4N1XA 1GA9A 1PI5A 2XEPA 3Q82A 2J8YA 3CZDA 1KGGA 4A5RA 3C4OA 3BYDA 4X68A 3BFDA 1PZPA 2FFFB 4NK3A 2WUQA 4S2NC 3PAGA 1XGJA 4P6BA 4OPQA 4BQMA 5F1FA 3IHBA 3UDIA 4NETA 3VSLA 5CECA 1ZG4A 3MKFA 4Y0OA 1DJBA 3VFHA 3DWZA 3WS1A 4Y0UA 1N4OA 3P09A 1BSGA 3NI9A 4MEZA 3ZG5A 1K56A 4Y0TA 1LL9A 3NIAA 5HX9A 1FR1A 4KG6A 1Y54A 3WWXA 3ZG0A 3GR2A 4HBTA 1CK3A 3A3JA 3AGDA 4EBLA 3S4XA 2PBYA 1WE4A 4OOYA 5FDHA 1K54A 2G2WA 1Q2PA 2OLUA 1E3UA 4B88A 1EI5A 5IHVA 3CMZA 3DW0A 5FI7A 1FQGA 4C6YA 3VP4A 2XF3A 4WZ5A 5EVIC 1GHPA 3OC2A 4M3KA 5DTSA 1U60A 5U47A 3ZNYA 4KG5A 3BLSA 1TVFA 1LI0A 1MKIA 3HBRA 5GL9A 1EROA 2WGVA 4E3IA 5HL1A 4N9KA 3UE1A 5EVIB 2OV5A 3IXDA 4LCLA 2WGIA 2WADA 4QHCA 1K4FA 1Z6FA 1K6RA 1YMSA 2C5WB 3I7JA 3HLGA 2XR0A 3M2JA 5DTTA 4OH0A 4BENA 2VGKA 4MNRA 2IWBA 4BJPA 1XKZA 1ZC2A 4OOMA 2QMIA 1FSYA 4B4ZA 1KE4A 3IHAA 2JCHA 1W8QA 4LV2A 4P85A 1NRFA 2P9VA 3ZFZA 3GV9A 4C75A 3VP0A 1IYPA 3Q81A 4WMCA 5HAQA 3BEBA 3PBOA 1C3BA 1TDGA 2Y2MA 3G34A 3IXGA 3A3FA 3V3SA 4PMAA 3M2KA 4S2LA 1K55C 4JF4A 4RA7A 2XH9A 5EPHA 1LL5A 5HARA 1KDWA 3IQAA 3IH9A 1HD8A 1I5QA 3Q7VA 5AQ9A 4ID4A 2HDUA 1IYSA 4ZJ1A 3TG9A 4PM7A 4OQIA 4OQGA 4RVAA 2Y2OA 3CJMA 4FH2A 1MWSA 1RGYA 4ZJ2A 1FR6A 3UE3A 4CPKA 1PYYA 1MBLA 1O7EA 2DRWA 5FAQA 5GHXA 4YFMA 1K25A 1PI4A 2Y55A 2ZC4B 3IF6A 5CGWA 3DTMA 4KG2A 5EVID 1LLBA 3RXWA 3G2YA 1MWTA 3ZHHA 5HAPA 1FCOA 1W79A 4U3TA 4DE3A 1BUEA 3M6BA 3IH8A 4MBHA 1YLPA 1YM1A 3BLMA 2EFUA 1ERQA 3HLWA 2FFYA 4LV0A 5FSRA 3RJUA 3O88A 4P87A 4DXBA 2EX9A 4UA9A 3Q7ZA 2Q9MA 2R9WA 3P98A 1G6AA 5CEDA 4DE2A 1WYBA 2HP9A 5EUAA 1WYCA 4X56A 2A49A 1GA0A 2ZQDA 2ZC6B 1KDSA 1NY0A 3PAEA 2Y59A 1HTZA 4OPYA 4WEJA 1FOFA 4IBXA 3ZNTA 1BZAA 1HVBA 5CGXA 1CEGA 2XFSA 5DF8A 3A3DA 4GZBA 4U0XA 1M40A 3HLEA 4WBGA 4DE1A 1IKGA 1YT4A 2RCXA 2A3UA 2Y2LA 3GMWA 4KZBA 4N9LA 2QPNA 3PBNA 5FQIA 4GB7A 1DJCA 2ZC7A 4GD8A 3NY4A 3HUOA 2WKIA 3C5AA 5GHYA 3N7WA 5FQMA 3IWQA 1MY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP3 A;  1KVM A;  3OCN A;  4KZ7 A;  3IXH A;  1GCE A;  1ONH A;  1S0W A;  2BLS A;  4FD8 A;  2EX8 A;  2ZJ9 A;  4IVK A;  1XPB A;  3BFF A;  5E2H A;  5F82 A;  4DRT A;  4OPR A;  3IT9 A;  4HEF A;  1IKI A;  4LCM A;  4Q8I A;  3NC8 A;  1DY6 A;  2DNS A;  2Y91 A;  1QME A;  3UPN A;  1ES3 A;  3FWL A;  5EOE A;  4OQH A;  3VP2 A;  1JWZ A;  4Y7P A;  3HUM A;  1FSW A;  3Q1F A;  3ISG A;  4KEN B;  5F83 A;  4S2P A;  1BLS A;  3PBS A;  3V3R A;  4HES A;  3IWO A;  3MBZ A;  4IBR A;  3GQZ A;  3HUN A;  3O86 A;  2QZ6 A;  3LY4 A;  3TOI A;  1H8Y A;  3JYI A;  2XQZ A;  3MZF A;  3BFC A;  5GLB A;  2EXA A;  4OON A;  4OLG A;  4KZA A;  1TEM A;  1MXO A;  3Q07 A;  1L0D A;  3LY3 A;  4JF6 A;  5M1A A;  5AQB A;  3UDX A;  3ZG8 B;  1VQQ A;  1IYQ A;  1DJA A;  4UA6 A;  1YQS A;  2WGW B;  2ZQ9 A;  1IEL A;  2I72 A;  2WKH A;  3GVB A;  2Y2N A;  1JWV A;  3V39 A;  4PM8 A;  2H10 A;  3G35 A;  4JXS A;  5BOH A;  4FCF A;  3WS4 A;  5G18 A;  3E2K A;  4E3M A;  5EEC A;  5FQQ A;  5L2F A;  3OPP A;  4X55 A;  3VFF A;  3BRM A;  1K55 A;  4DKI A;  4D2O A;  4K0X A;  5GLA A;  2BG1 A;  4BL2 A;  1M6K A;  4RX2 A;  3UY6 A;  4WM9 A;  3MXR A;  1SDE A;  4DE0 A;  4H8R A;  5EOO A;  4JXW A;  2R9X A;  4X69 A;  5KMW A;  1J9M A;  3WRZ A;  4XUZ A;  5DTK A;  3ZDJ A;  4S2J A;  3GRJ A;  3S22 A;  1LHY A;  4S2K A;  3QNB A;  3UDF A;  2P74 A;  1I2W A;  2G2U A;  3PTE A;  5CGS A;  1XA1 A;  3CG5 A;  2IWC A;  3IF5 A;  1JTG A;  3ZVW A;  3G2Z A;  2XFT A;  2WAE A;  2JE5 A;  4WZ4 A;  3O3V A;  4WZ5 C;  2Y2H A;  4R3B A;  1ES5 A;  2X71 A;  4JLF A;  4P0M A;  1E25 A;  5CHJ A;  1XGI A;  2WZX A;  1JTD A;  1K6S A;  1OME A;  4S2O A;  5E2F A;  3PBQ A;  5DF7 A;  1PW8 A;  3G31 A;  5CHU A;  3B3X A;  2WKE A;  5CER A;  3VP1 A;  2HDS A;  3M6H A;  1IYO A;  1W5D A;  2Y2Q A;  1GHI A;  4Z9Q A;  4B4X A;  4E3L A;  3OCL A;  1XA7 A;  4OPZ A;  1RGZ A;  2J7V A;  2EXB A;  2H0T A;  3GSG A;  4EV4 A;  1SCW A;  2HP6 A;  3BFG A;  4DDY A;  4LV3 A;  2Y2K A;  1K57 C;  4GKU A;  4ZJ3 A;  4KZ5 A;  3OPL A;  1BT5 A;  4GN2 A;  1XX2 A;  2GDN A;  3G4P A;  4JXV A;  4QB8 A;  5HW3 A;  5A91 A;  1JVJ A;  3HLB A;  1TDL A;  4OOL A;  3SH9 A;  2P9V B;  1YLW A;  3ZVT A;  1IEM A;  1SKF A;  3VOY A;  3LCE A;  3HLF A;  1CI9 A;  1K56 D;  3A3E A;  4JBF A;  4E3K A;  3NBL A;  3WS2 A;  4GDB A;  3HLC A;  5JYO A;  3GTC A;  2UWX A;  4S2N A;  4O7D A;  5F1G A;  1E3U D;  4XUX A;  3Q7V B;  5A92 A;  2OSU A;  5HFO A;  1I2S A;  3UO9 A;  1ZKJ A;  3EQV A;  1ZG6 A;  1GHM A;  4OLD A;  5TR7 A;  4X53 A;  1O07 A;  1G68 A;  1ESU A;  2ZC5 B;  1MPL A;  4L0L A;  5HAI A;  3WS0 A;  3FZC A;  1YLY A;  4S2I A;  4X6T A;  3SS5 A;  4E3N A;  1L0E A;  4LV1 A;  4GNU A;  4QY5 A;  5FA7 A;  3IF6 B;  3HLD A;  1PWD A;  1RCJ A;  3MZE A;  5CRF A;  2X02 A;  2B5R A;  3VMA A;  3N6I A;  3AGF A;  2E8I A;  5E2G A;  5EVI A;  2VGJ A;  2PU2 A;  4HBU A;  4RYE A;  4BD1 A;  3UPO A;  1KGF A;  5D3O A;  4R4R A;  5FQK A;  2ZQ7 A;  3WS5 A;  4KQR A;  4E6X A;  1MWR A;  1PZO A;  3G32 A;  5GLD A;  3AGE A;  4WEK A;  2ZQA A;  4WEL A;  3HVF A;  1LI9 A;  4WMC D;  1SDN A;  5M18 A;  5DVA A;  4ZAM A;  2XK1 A;  3HL9 A;  1NJ4 A;  4GDN A;  4MBF A;  4FSF A;  3QHY A;  3ITB A;  4KZ4 A;  5FAP A;  1BUL A;  2HDR A;  3ZCZ A;  2XLN A;  4RX3 A;  2WYX A;  3BM6 A;  3MXS A;  3N8L A;  3OZH A;  4EBN A;  3W4O A;  3HRE A;  3LO7 A;  2XD1 A;  4ZBE A;  4PM6 A;  1EWZ A;  1ALQ A;  1XXM A;  3PBR A;  5FQ9 A;  1SHV A;  3FKV A;  1KE3 A;  4QD4 A;  2J9P A;  2RL3 A;  2Y2G A;  4R3J A;  5CTN A;  1RP5 A;  4PPR A;  3BFE A;  3V5M A;  4BD0 A;  2HDQ A;  4R23 A;  1PWG A;  1W8Y A;  4FH4 A;  3A3I A;  1ES2 A;  4QJG A;  1ERM A;  4YIN A;  3W4Q A;  4E3O A;  2ZD8 A;  1VM1 A;  4GD6 A;  4U0T A;  1L0G A;  2IWD A;  5KSC A;  5AQ7 A;  3FKW A;  3N4I A;  2ZM2 A;  4OKP A;  2ZM0 A;  4KZ9 A;  4DXC A;  1AXB A;  2JC7 A;  4EQI A;  2XD5 A;  5CTM A;  5CHM A;  2Y2P A;  1CEF A;  1K4E A;  5DF9 A;  4N92 A;  1W7F A;  4UHU A;  2EX2 A;  3E2L A;  2V2F F;  4K0W A;  5FI2 A;  3TSG A;  4K91 A;  1PW1 A;  2H5S A;  1K54 C;  4OQ0 A;  2DCF A;  4OP5 A;  5EE8 A;  2J9O A;  5CEB A;  5M19 A;  2ZC3 B;  3NDG A;  2ZQC A;  1ONG A;  4PM9 A;  1PWC A;  1K38 A;  4JKT A;  4XXR A;  3PBT A;  2EX6 A;  2WAF A;  4C3Q A;  1NZU A;  2OLV A;  2PU4 A;  5KSH A;  3VSK A;  1NZO A;  2V20 A;  3ITA A;  1K57 A;  3IWI A;  3MZD A;  4DF6 A;  2EFX A;  2Z2M B;  2Y2I A;  4R0Q A;  5GHZ A;  4E6W A;  5E2E A;  3OPR A;  4WYY A;  4IED A;  4QU3 A;  4KZ3 A;  1NYY A;  4S2M A;  1JWP A;  5TGF A;  1KE0 A;  3ZG9 B;  5J8X A;  1YMX A;  4MLL A;  2CC1 A;  4ZTK A;  1BLH A;  2Z2L B;  4PM5 A;  3LEZ A;  4EUZ A;  3MFD A;  4KQQ A;  4KZ6 A;  3UPP A;  3NCK A;  4DDS A;  2XDM A;  3C4P A;  1NXY A;  5FAS A;  1BLP A;  4EWF A;  3G30 A;  3SS4 A;  5A90 A;  4BL3 A;  1YLJ A;  3FV7 A;  3OPH A;  1FCN A;  4ZDX A;  1E4D A;  2Y4A A;  3C7V A;  3N8S A;  3UNW A;  5JYP A;  4OVD A;  4KZ8 A;  3SH8 A;  1ES4 A;  3W8K A;  4UAA A;  1L2S A;  5FQJ A;  4EBP A;  4R1G A;  2HPB A;  3S1Y A;  2ZM8 A;  1CI8 A;  5TFQ A;  1PIO A;  1FCM A;  3D4F A;  3O87 A;  2Q9N A;  4GOG A;  3UE0 A;  3WRT A;  1HZO A;  4UA7 A;  2ZLY A;  1BTL A;  4JPM A;  5AQA A;  5FAO A;  2ZQ8 A;  1MWU A;  1QMF A;  3SOI A;  3NDE A;  2C6W B;  5FI6 A;  4KQO A;  3QNC A;  1Q2Q A;  4CJN A;  3RXX A;  1ESI A;  1YLT A;  3IF6 C;  1BLC A;  3ZG7 B;  1XP4 A;  1S6R A;  2Y2J A;  5GLC A;  2H0Y A;  4LEN A;  5A93 A;  3MKE A;  5I94 A;  4MBK A;  1H8Z A;  2JBF A;  4JXG A;  2WGW A;  4BLM A;  5E43 A;  2V1Z A;  4R4S A;  3IXB A;  5KZH A;  1L0F A;  1N9B A;  2HP5 A;  3V50 A;  3BEC A;  1H5X A;  3SH7 A;  3N8R A;  3FYZ A;  3C7U A;  5EVL A;  1KVL A;  2WK0 A;  2X01 A;  5FAT A;  3UN7 A;  3VOZ A;  4N1H A;  4QY6 A;  2WZZ A;  2ZMA A;  4F94 A;  2XGN A;  1NYM A;  1YLZ A;  3DWK A;  3SS3 A;  1KGE A;  3EQU A;  4IVI A;  4OP8 A;  3ZGA B;  4JF5 A;  5CXW A;  4E3J A;  3W4P A;  4N1X A;  1GA9 A;  1PI5 A;  2XEP A;  3Q82 A;  2J8Y A;  3CZD A;  1KGG A;  4A5R A;  3C4O A;  3BYD A;  4X68 A;  3BFD A;  1PZP A;  2FFF B;  4NK3 A;  2WUQ A;  4S2N C;  3PAG A;  1XGJ A;  4P6B A;  4OPQ A;  4BQM A;  5F1F A;  3IHB A;  3UDI A;  4NET A;  3VSL A;  5CEC A;  1ZG4 A;  3MKF A;  4Y0O A;  1DJB A;  3VFH A;  3DWZ A;  3WS1 A;  4Y0U A;  1N4O A;  3P09 A;  1BSG A;  3NI9 A;  4MEZ A;  3ZG5 A;  1K56 A;  4Y0T A;  1LL9 A;  3NIA A;  5HX9 A;  1FR1 A;  4KG6 A;  1Y54 A;  3WWX A;  3ZG0 A;  3GR2 A;  4HBT A;  1CK3 A;  3A3J A;  3AGD A;  4EBL A;  3S4X A;  2PBY A;  1WE4 A;  4OOY A;  5FDH A;  1K54 A;  2G2W A;  1Q2P A;  2OLU A;  1E3U A;  4B88 A;  1EI5 A;  5IHV A;  3CMZ A;  3DW0 A;  5FI7 A;  1FQG A;  4C6Y A;  3VP4 A;  2XF3 A;  4WZ5 A;  5EVI C;  1GHP A;  3OC2 A;  4M3K A;  5DTS A;  1U60 A;  5U47 A;  3ZNY A;  4KG5 A;  3BLS A;  1TVF A;  1LI0 A;  1MKI A;  3HBR A;  5GL9 A;  1ERO A;  2WGV A;  4E3I A;  5HL1 A;  4N9K A;  3UE1 A;  5EVI B;  2OV5 A;  3IXD A;  4LCL A;  2WGI A;  2WAD A;  4QHC A;  1K4F A;  1Z6F A;  1K6R A;  1YMS A;  2C5W B;  3I7J A;  3HLG A;  2XR0 A;  3M2J A;  5DTT A;  4OH0 A;  4BEN A;  2VGK A;  4MNR A;  2IWB A;  4BJP A;  1XKZ A;  1ZC2 A;  4OOM A;  2QMI A;  1FSY A;  4B4Z A;  1KE4 A;  3IHA A;  2JCH A;  1W8Q A;  4LV2 A;  4P85 A;  1NRF A;  2P9V A;  3ZFZ A;  3GV9 A;  4C75 A;  3VP0 A;  1IYP A;  3Q81 A;  4WMC A;  5HAQ A;  3BEB A;  3PBO A;  1C3B A;  1TDG A;  2Y2M A;  3G34 A;  3IXG A;  3A3F A;  3V3S A;  4PMA A;  3M2K A;  4S2L A;  1K55 C;  4JF4 A;  4RA7 A;  2XH9 A;  5EPH A;  1LL5 A;  5HAR A;  1KDW A;  3IQA A;  3IH9 A;  1HD8 A;  1I5Q A;  3Q7V A;  5AQ9 A;  4ID4 A;  2HDU A;  1IYS A;  4ZJ1 A;  3TG9 A;  4PM7 A;  4OQI A;  4OQG A;  4RVA A;  2Y2O A;  3CJM A;  4FH2 A;  1MWS A;  1RGY A;  4ZJ2 A;  1FR6 A;  3UE3 A;  4CPK A;  1PYY A;  1MBL A;  1O7E A;  2DRW A;  5FAQ A;  5GHX A;  4YFM A;  1K25 A;  1PI4 A;  2Y55 A;  2ZC4 B;  3IF6 A;  5CGW A;  3DTM A;  4KG2 A;  5EVI D;  1LLB A;  3RXW A;  3G2Y A;  1MWT A;  3ZHH A;  5HAP A;  1FCO A;  1W79 A;  4U3T A;  4DE3 A;  1BUE A;  3M6B A;  3IH8 A;  4MBH A;  1YLP A;  1YM1 A;  3BLM A;  2EFU A;  1ERQ A;  3HLW A;  2FFY A;  4LV0 A;  5FSR A;  3RJU A;  3O88 A;  4P87 A;  4DXB A;  2EX9 A;  4UA9 A;  3Q7Z A;  2Q9M A;  2R9W A;  3P98 A;  1G6A A;  5CED A;  4DE2 A;  1WYB A;  2HP9 A;  5EUA A;  1WYC A;  4X56 A;  2A49 A;  1GA0 A;  2ZQD A;  2ZC6 B;  1KDS A;  1NY0 A;  3PAE A;  2Y59 A;  1HTZ A;  4OPY A;  4WEJ A;  1FOF A;  4IBX A;  3ZNT A;  1BZA A;  1HVB A;  5CGX A;  1CEG A;  2XFS A;  5DF8 A;  3A3D A;  4GZB A;  4U0X A;  1M40 A;  3HLE A;  4WBG A;  4DE1 A;  1IKG A;  1YT4 A;  2RCX A;  2A3U A;  2Y2L A;  3GMW A;  4KZB A;  4N9L A;  2QPN A;  3PBN A;  5FQI A;  4GB7 A;  1DJC A;  2ZC7 A;  4GD8 A;  3NY4 A;  3HUO A;  2WKI A;  3C5A A;  5GHY A;  3N7W A;  5FQM A;  3IWQ A;  1MY8 A; 
#chains in the Genus database with same CATH topology
 1KVM A;  3OCN A;  3BFF A;  1IKI A;  4LCM A;  1OJ5 A;  1IFQ A;  3H82 A;  1QME A;  5TBM A;  3F1O A;  4CLC C;  3HUM A;  4EW7 A;  3Q1F A;  5F83 A;  1BLS A;  4PHT A;  1H8Y A;  2V8F A;  2XQZ A;  3BFC A;  2Y79 A;  4KZA A;  5DJU A;  2VK3 A;  1MXO A;  1L0D A;  4JF6 A;  4PKY G;  1YQS A;  1IEL A;  3GVB A;  1JWV A;  3V39 A;  1T19 A;  4FCF A;  4HJ6 A;  1UWP X;  5EEC A;  4Y15 A;  2J3W A;  1K55 A;  4DKI A;  4D2O A;  5HSQ A;  3UB5 P;  4DE0 A;  5EOO A;  4HP9 A;  1S4S A;  1SZV A;  2R9X A;  5K5B A;  3K2N A;  3TRC A;  4S2J A;  4HI4 A;  3PHY A;  2Z6C A;  4LRX C;  2ZL1 B;  3PTE A;  4X1M A;  5CGS A;  2IWC A;  3L7H A;  2WAE A;  3S7P A;  4WZ5 C;  1E25 A;  1XGI A;  2WZX A;  3FPV A;  2L0W A;  4S2O A;  5FL3 A;  3T1X A;  3G31 A;  2WKE A;  5MC7 A;  2HDS A;  3FC7 A;  4EEU A;  3M6H A;  1W5D A;  3UMD A;  4B4X A;  1F5M A;  5HWT A;  2J7V A;  3GSG A;  4DMZ A;  4DDY A;  4LV3 A;  1YAX A;  4ZJ3 A;  4KZ5 A;  4Q0H A;  5L8M A;  4GN2 A;  2GDN A;  4R6L A;  3T50 A;  1JVJ A;  5L10 A;  2P9V B;  1YLW A;  1SKF A;  1FIL A;  4JBF A;  4GW9 A;  3HLC A;  4JGO A;  4O7D A;  1E3U D;  5HFO A;  3EQV A;  1ZG6 A;  1GHM A;  3KSG A;  3MQO A;  3ZYT A;  3C30 A;  1L0E A;  3H7W B;  1DP8 A;  5FA7 A;  3IF6 B;  3HLD A;  1S66 L;  3VMA A;  3N6I A;  3T1R A;  2HZ5 A;  2E8I A;  4CQH A;  4BBU A;  1OPX A;  2EWV A;  5F68 A;  2PU2 A;  5HZH A;  3UPO A;  4II7 A;  2ZQ7 A;  2QJ7 A;  1PZO A;  3G32 A;  5GLD A;  3HVF A;  1SDN A;  5DVA A;  4ZAM A;  2XK1 A;  4HP4 A;  5L09 A;  1NJ4 A;  4FSF A;  3A0V A;  1N9N A;  4KUK A;  2HDR A;  3ZCZ A;  2VKS A;  4RX3 A;  2WYX A;  4Q0J A;  3F1P B;  4EBN A;  2XD1 A;  2Y2G A;  1OTE A;  2XA7 M;  3F1N A;  4PPR A;  3V5M A;  2HDQ A;  1W8Y A;  3W4Q A;  4P6Z M;  2IWD A;  3QP2 A;  4OKP A;  2ZM0 A;  4DXC A;  5CTM A;  1NRJ A;  3CPT A;  2M7V A;  5DF9 A;  3LIB A;  1VEU A;  3TSG A;  5M19 A;  2ZC3 B;  3NOU C;  4D60 A;  1Y4O A;  1LL8 A;  1NZU A;  2BTF P;  3MR0 A;  4DF6 A;  2JKR M;  5GHZ A;  3DBA A;  1KE0 A;  3ZG9 B;  5C5K A;  2PYP A;  2W1T A;  4F3L B;  4EUZ A;  4KZ6 A;  3B33 A;  2BAS A;  5HD3 A;  3C4P A;  4LRY C;  1BLP A;  4EWF A;  3G30 A;  1XJ6 A;  3SS4 A;  5A90 A;  1YLJ A;  2P08 A;  4NKP A;  1FCN A;  3C7V A;  3UNW A;  2PR5 A;  4JGQ A;  4DN0 A;  4UAA A;  1L2S A;  3KYZ A;  3S1Y A;  1PIO A;  1K0K A;  3LI8 A;  5FI6 A;  1XP4 A;  2Y2J A;  5GLC A;  2H0Y A;  4NXG A;  4HJ4 A;  5KZH A;  3V50 A;  1DP9 A;  3BEC A;  4YWZ A;  1XFN A;  3SS3 A;  1A0K A;  2V0W A;  3EQU A;  4IVI A;  4NXE A;  4OP8 A;  2JKT I;  5CXW A;  1OJG A;  2XEP A;  2PBD P;  3T4L A;  1MKM A;  1MZU A;  1NWZ A;  1DP6 A;  1XGJ A;  2K31 A;  1ZG4 A;  3CUE A;  3JVU A;  4CLC B;  3ZG5 A;  4Y0T A;  1LL9 A;  3NIA A;  1FR1 A;  3ZG0 A;  5EVE A;  3AGD A;  3S4X A;  2PBY A;  2V1A A;  4EU0 A;  1WE4 A;  4O8G A;  5IHV A;  3DW0 A;  4C6Y A;  4Y3I A;  3OC2 A;  5U47 A;  1U60 A;  2W27 A;  4KG5 A;  1LI0 A;  2W3D A;  4E3I A;  1XFQ A;  2GZA A;  3HLG A;  4BEN A;  4UQI S;  3VE3 A;  2VV7 A;  3TE8 A;  1FSY A;  2A2L A;  2UV0 E;  2LB9 A;  4LV2 A;  3JPU A;  2QYB A;  2OAQ 1;  4FTX A;  4C75 A;  1IYP A;  3CI6 A;  3G34 A;  5IU1 A;  2PR6 A;  4RA7 A;  5HAR A;  3IQA A;  2M7U A;  4ID4 A;  4Y5F A;  4RVA A;  2Y2O A;  2AVX A;  4ZJ2 A;  3UE3 A;  1OTB A;  2ZC4 B;  2Y55 A;  5CGW A;  3ZHH A;  5EVI D;  1FCO A;  4U3T A;  3M6B A;  3IH8 A;  4MBH A;  4MMN A;  4LV0 A;  5DKK A;  4UA9 A;  2Q9M A;  3CWF A;  1WYB A;  2HP9 A;  1WYC A;  3B42 A;  1GSW A;  2ZQD A;  4WLA A;  2ZC6 B;  1KDS A;  1NY0 A;  3PAE A;  4OPY A;  4IBX A;  2YKH A;  3HJI A;  5CGX A;  2J3T D;  4KZB A;  2W0N A;  3PBN A;  5DFX A;  4GB7 A;  4ETZ A;  2WKP A;  3NY4 A;  2WKR A;  3NOT C;  3N7W A;  4HQA A;  3IWQ A;  5AVF A;  1YSQ A;  3VP3 A;  2HGV A;  1GCE A;  4FD8 A;  5E2H A;  1XPB A;  4DRT A;  4ESP A;  1LSX A;  3NC8 A;  3KO6 A;  3UPN A;  5EOE A;  2PRF A;  4E04 A;  3UME A;  1JWZ A;  4Y7P A;  1FSW A;  3UB6 A;  3ISG A;  1CQA A;  3P01 A;  4S2P A;  3PBS A;  4GHI A;  4YOF A;  2W3G A;  4PAU A;  3IWO A;  3UE6 A;  4IBR A;  3EWK A;  3LY4 A;  3QP8 A;  1UWN X;  3MZF A;  5GLB A;  2EXA A;  4OLG A;  3C2W A;  4B93 A;  2J80 A;  2PDR A;  5AQB A;  1DRM A;  1IYQ A;  5L07 A;  1YSP A;  3LIC A;  2H10 A;  3G35 A;  4XT2 A;  5BOH A;  4QWO A;  1UGU A;  4R38 A;  2VV8 A;  4E3M A;  4X55 A;  2QWS A;  3BRM A;  3C38 A;  2BG1 A;  4RX2 A;  3MXR A;  1SDE A;  4H8R A;  4JXW A;  2NUT C;  2QJ5 A;  2J3T C;  2OWH A;  1S67 L;  3S22 A;  1LHY A;  2B95 A;  2P74 A;  1I2W A;  3MS6 A;  1TD5 A;  1XA1 A;  3CG5 A;  3IF5 A;  1JTG A;  2XFT A;  2Q0O A;  4P0M A;  5EM1 A;  5CHJ A;  1JTD A;  1OME A;  2P04 A;  3LIA A;  5DF7 A;  5CER A;  3VP1 A;  1IYO A;  4Y13 A;  2Y2Q A;  4EER A;  1OT6 A;  1GHI A;  3ULF A;  3BJN A;  3E0Y A;  1SKO A;  4G3V A;  4GKU A;  1BT5 A;  1XX2 A;  5HD5 A;  1ODV A;  3HLB A;  4OOL A;  1TDL A;  3SH9 A;  3ZVT A;  3R4K A;  3LCE A;  3HLF A;  2E8J A;  1K56 D;  3A3E A;  2VA0 A;  3T4S A;  3S7Q A;  4HIA A;  5JYO A;  1D06 A;  3Q7V B;  2Y8H A;  3UO9 A;  1VET B;  1O07 A;  1G68 A;  5HDD A;  1ESU A;  2ZC5 B;  3WS0 A;  4GS9 A;  4S2I A;  4E3N A;  2D02 A;  5F6A A;  3QP5 A;  5G4Z A;  1RCJ A;  2EA9 A;  3MZE A;  2B5R A;  1H8M A;  5E2G A;  4ARZ B;  2VGJ A;  4HBU A;  1P9W A;  1AWI A;  3IS2 A;  4R4R A;  5FQK A;  3WS5 A;  3O5Y A;  2VEA A;  1OTA A;  4WEK A;  3GEC A;  1LI9 A;  5M18 A;  3HL9 A;  4MBF A;  3ITB A;  1WA9 A;  3BM6 A;  3N8L A;  3OZH A;  4IJG A;  3HRE A;  3LO7 A;  3PYP A;  4ZBE A;  1EWZ A;  1XXM A;  3PBR A;  5FQ9 A;  2GNX A;  1KE3 A;  4QD4 A;  1RP5 A;  3A3I A;  1ES2 A;  4QJG A;  5KSC A;  1XJ2 A;  4KZ9 A;  3BWL A;  1CEF A;  1K4E A;  5LBR A;  3RFB A;  1ZTU A;  2V2F F;  3KSF A;  5CEB A;  3GDI A;  1PWC A;  2G7U A;  4JKT A;  4XXR A;  1X0O A;  4C3Q A;  5KSH A;  4BMW A;  1NZO A;  1K57 A;  2Z2M B;  2B18 A;  4GCZ A;  3OPR A;  4WYY A;  1NYY A;  1JWP A;  5J8X A;  2L4R A;  4EES A;  3NEC A;  3LEZ A;  3VV4 A;  1TS6 A;  3UPP A;  2KX6 A;  2V9A A;  3FV7 A;  3OPH A;  2Y4A A;  3N8S A;  2VLG A;  3T4K A;  3SH8 A;  5J7E A;  3W8K A;  2R78 A;  5IT5 A;  2KDK A;  2ZOH A;  1H3Q A;  1FCM A;  3D4F A;  4UA7 A;  5FAO A;  2ZLY A;  4JPM A;  2PAV P;  4MDZ A;  3KX0 X;  5DFY A;  1N9L A;  3SOI A;  2C6W B;  1P97 A;  1ESI A;  1YLT A;  3ZG7 B;  2HJ9 C;  5FEG A;  3MKE A;  5I94 A;  5E43 A;  2QHK A;  2V1Z A;  2HP5 A;  2A24 B;  2VZW A;  2X01 A;  1KVL A;  2VJW A;  2WK0 A;  4IHQ A;  3VOZ A;  4Z1W A;  2XGN A;  1NYM A;  2GX5 A;  1KGE A;  4JF5 A;  3LEQ A;  1PI5 A;  3CZD A;  1KGG A;  3C4O A;  3EEA A;  3BYD A;  4X68 A;  4NK3 A;  5F1F A;  3PAG A;  2JKG A;  5CEC A;  3MKF A;  4Y0O A;  1DJB A;  3VFH A;  4Y0U A;  1BSG A;  3C8C A;  2ZL1 A;  3NI9 A;  3JVV A;  2XRN A;  3GR2 A;  4HBT A;  4EBL A;  4OOY A;  1K54 A;  1T18 A;  1EI5 A;  4NXB A;  5FI7 A;  1GHP A;  3BLS A;  3MQQ A;  1TVF A;  1ERO A;  3UE1 A;  5EVI B;  3IXD A;  1PNE A;  4LCL A;  5IS1 A;  2WAD A;  1K4F A;  2C5W B;  3I7J A;  2O99 A;  3M2J A;  2ZMV A;  2VGK A;  4MNR A;  2IWB A;  4L9G A;  2VGL S;  3UB7 A;  1XKZ A;  2QMI A;  4B4Z A;  1W8Q A;  4P85 A;  1NRF A;  3HJK A;  2P9V A;  3PXP A;  4WMC A;  5HAQ A;  2O9C A;  3MQ0 A;  3BEB A;  3QP6 A;  1C3B A;  2Y2M A;  3A3F A;  3T4T A;  3M2K A;  1K55 C;  4JF4 A;  5EPH A;  1LL5 A;  4ZJ1 A;  2VGL M;  1MBL A;  1O7E A;  5FAQ A;  4G3K A;  3H7W A;  3IF6 A;  3DTM A;  1LLB A;  2W1R A;  3G2Y A;  1MWT A;  4WN5 A;  1PRQ A;  1W79 A;  5A8B A;  3QP4 A;  1YLP A;  3BLM A;  1ERQ A;  3O88 A;  4WF0 A;  4DXB A;  4NG2 A;  3P98 A;  2R9W A;  4FUW A;  1BZA A;  2HF6 A;  4ZRR A;  2ZBB A;  3A3D A;  2V1B A;  4GZB A;  3HLE A;  4DE1 A;  2RCX A;  3GMW A;  2A3U A;  2Y2L A;  4N9L A;  4AFI A;  3F1P A;  3KYQ A;  1G6O A;  1W63 Q;  5FQM A;  2P7J A;  5HPI A;  5CX7 A;  3IXH A;  1HLU P;  1ONH A;  5F82 A;  5F69 A;  3EGX C;  4HEF A;  4Q8I A;  1G5U A;  1DY6 A;  2Y91 A;  1ES3 A;  3FWL A;  1T1C A;  3MBZ A;  3LI9 A;  3S7O A;  3GQZ A;  3HUN A;  3CHW P;  4ETX A;  1YKD A;  2QZ6 A;  4BBV A;  1TS8 A;  5M1A A;  3UDX A;  3E4Q A;  5KIZ A;  1DJA A;  4UA6 A;  2WGW B;  2ZQ9 A;  4GJ4 A;  2WKH A;  3EEH A;  2Y2N A;  3P7N A;  1GSX A;  3E98 A;  5HDC A;  5FQQ A;  3OPP A;  4F3L A;  4K0X A;  4BL2 A;  2HJE A;  1M6K A;  2PD7 A;  3L9K A;  4Y17 A;  4YNR A;  4CLC E;  2WKQ A;  3E4O A;  1J9M A;  4XUZ A;  3GRJ A;  3MMH A;  4S2K A;  4NXF A;  3QNB A;  4LPZ A;  3ZVW A;  3O3V A;  3A0R A;  2Y2H A;  4R3B A;  1ES5 A;  2X71 A;  4JLF A;  1OTD A;  4UQI M;  5E2F A;  3PBQ A;  3B3X A;  4EQ1 A;  1D7E A;  4JGP A;  4KQD A;  3OCL A;  1XA7 A;  2KOI A;  4OPZ A;  2EXB A;  4EV4 A;  1SCW A;  3BFG A;  2Y2K A;  4I3J A;  4EXO A;  3OPL A;  4X25 A;  3V67 A;  4QB8 A;  4UEY A;  3VOY A;  3R7W B;  2PYR A;  1TS7 A;  3KYE A;  4E3K A;  3WS2 A;  1JNU A;  3GTC A;  2UWX A;  4CLC A;  4S2N A;  4IUH A;  5A92 A;  4RQ9 A;  1ZKJ A;  3LR5 A;  3FZC A;  4H6J B;  4O01 A;  4X6T A;  3SS5 A;  3W2Z A;  2JKF A;  4I3A A;  5CRF A;  2X02 A;  3D72 A;  3AGF A;  3QP1 A;  5DKL A;  4RYE A;  1PFL A;  4KQR A;  4E6X A;  4HH2 A;  2ZQA A;  4WEL A;  1LSV A;  2CMN A;  4GDN A;  3LR4 A;  1NLZ A;  2XLN A;  5AJG A;  4EUV A;  3MXS A;  5EV0 A;  2FH5 A;  1ALQ A;  4WL9 A;  3FKV A;  2M1C A;  4R3J A;  4BD0 A;  1PWG A;  1ZHH B;  4FH4 A;  3S7N A;  1ERM A;  4E3O A;  2ZD8 A;  1VM1 A;  4GD6 A;  4GS9 B;  4U0T A;  1L0G A;  4ME4 A;  3PR6 A;  3N4I A;  3CUE C;  3SW1 A;  2VV6 A;  3H82 B;  5TBM B;  3F1O B;  1AXB A;  1S4R A;  2Y2P A;  4IUK A;  4N92 A;  3FPW A;  4UHU A;  2EX2 A;  3IX4 A;  4K91 A;  1PW1 A;  2H5S A;  2DCF A;  4OP5 A;  2J9O A;  2ZQC A;  3DTE A;  1K38 A;  3D9Y A;  1OTI A;  2EX6 A;  2PU4 A;  3BQ8 A;  3VSK A;  3MZD A;  2EFX A;  1LSW A;  2OWJ A;  3T4Q A;  4Y2F A;  5TGF A;  1YMX A;  3BQA A;  4MLL A;  1GSV A;  4ZTK A;  1BLH A;  1G28 A;  2Z2L B;  4HOI A;  4KQQ A;  2JN7 A;  3NCK A;  4DDS A;  2LB5 A;  3ZQ5 A;  4LRZ E;  2ZMF A;  3LFV A;  4BL3 A;  3LID A;  3T1S A;  1E4D A;  4MN5 A;  3OOV A;  5FQJ A;  4EBP A;  2ZM8 A;  3O87 A;  3WRT A;  2ZQ8 A;  1MWU A;  1D1J A;  4I3I A;  3RXX A;  1S6R A;  3DTI A;  1V9Z A;  3U2A A;  4MCW A;  4LEN A;  3BY8 A;  3HCY A;  4MBK A;  2JBF A;  2XSS A;  4Q0I A;  4BLM A;  3VOL A;  4R4S A;  1N9B A;  3SH7 A;  3N8R A;  3FYZ A;  3C7U A;  5EVL A;  3TJZ C;  4QY6 A;  3BW6 A;  2WZZ A;  3DWK A;  1YLZ A;  3OBF A;  5AVE A;  3ZGA B;  1P0Z A;  1GA9 A;  2GJ3 A;  4N1X A;  3Q82 A;  2J8Y A;  2JHE A;  4S2N C;  4P6B A;  4OPQ A;  3IHB A;  4NET A;  3VSL A;  2DMW A;  3WS1 A;  3DWZ A;  3D3O A;  2FZ0 A;  1N9O A;  3WWX A;  3MXQ A;  3VE4 A;  5FDH A;  2G2W A;  1Q2P A;  2OOL A;  1E3U A;  3CAX A;  3CMZ A;  3LR3 A;  1FQG A;  5DJT A;  2XF3 A;  4M3K A;  3ZNY A;  5GL9 A;  1BYW A;  2WGV A;  2OV5 A;  2WGI A;  1YMS A;  4OH0 A;  4BJP A;  1S1Z A;  5FEF A;  2IA2 A;  2K7S A;  3MJQ A;  3T1Q B;  3IHA A;  2JCH A;  3ZFZ A;  3GV9 A;  3VP0 A;  3Q81 A;  1TDG A;  3IXG A;  4PMA A;  4S2L A;  1KDW A;  3F1N B;  3IH9 A;  1HD8 A;  1I5Q A;  3Q7V A;  4LGW A;  5AQ9 A;  1YPR A;  1IYS A;  3TG9 A;  4OQI A;  4OQG A;  3CJM A;  1VET A;  1RGY A;  1FR6 A;  1PYY A;  4HHD A;  2DRW A;  3RH8 B;  1XJ4 A;  1PI4 A;  2I9V A;  4KG2 A;  3T4J A;  5HAP A;  3CPT B;  1LT0 A;  1VEU B;  3CIT A;  1BUE A;  4DE3 A;  1YM1 A;  2FFY A;  1T1B A;  4P87 A;  2V8C A;  4ARZ A;  3Q7Z A;  1G6A A;  4LLO B;  4DE2 A;  5EUA A;  1GA0 A;  5EFW A;  3IBR A;  2Y59 A;  1FOF A;  3ZNT A;  2O0Y A;  5DF8 A;  1V9Y A;  5HL6 A;  1IKG A;  1YT4 A;  5FQI A;  4FOF A;  1DJC A;  2ZC7 A;  4GD8 A;  2WKI A;  4NEE D;  5GHY A;  2W1T B;  1FIK A;  4KZ7 A;  4BD1 A;  1S0W A;  4IVK A;  2BLS A;  2EX8 A;  2ZJ9 A;  4G3W A;  4OPR A;  2W3F A;  3IT9 A;  2ZOI A;  2DNS A;  5EM0 A;  4OQH A;  3VP2 A;  4I5S A;  4EET B;  4MN7 A;  4KEN B;  3V3R A;  3K3D A;  4HES A;  2XA7 S;  4I38 A;  3O86 A;  3B47 A;  3TOI A;  4DJ2 A;  3JYI A;  4P6Z S;  4OON A;  1TEM A;  4LFU A;  3Q07 A;  3LY3 A;  4BWI A;  3ZG8 B;  1VQQ A;  1F2K A;  2I72 A;  3DAV A;  4PM8 A;  4L9E A;  5FDS A;  4JXS A;  3WS4 A;  5G18 A;  3E2K A;  5L2F A;  3OLO A;  3DTK A;  3VFF A;  5GLA A;  3LIE A;  3SZT A;  5HDS A;  3UY6 A;  4WM9 A;  4MN6 A;  3KSI A;  4X69 A;  5KMW A;  3WRZ A;  2W3E A;  5DTK A;  2JKR I;  3ZDJ A;  4R70 A;  3UDF A;  2W3H A;  2G2U A;  3G2Z A;  2JE5 A;  4WZ4 A;  3RTY A;  3G6O A;  1CJF A;  1K6S A;  3LR0 A;  1PW8 A;  5CHU A;  1NLY A;  4WUJ A;  1S1Y A;  1TF1 A;  4Z9Q A;  4E3L A;  2MJ6 A;  1TS0 A;  1J3W A;  2A24 A;  3ICY A;  1RGZ A;  2H0T A;  2HP6 A;  1K57 C;  1VB6 A;  3UB9 A;  4R3A A;  3G4P A;  4JXV A;  2HV1 A;  5HW3 A;  5A91 A;  1IEM A;  4HNB A;  1CI9 A;  3KSH A;  1IOU A;  3NBL A;  4GDB A;  5F1G A;  3IX8 A;  1Y28 A;  4XUX A;  2OSU A;  1I2S A;  4OLD A;  5TR7 A;  4X53 A;  3TW8 A;  4L0L A;  1MPL A;  5HAI A;  1YLY A;  4LV1 A;  4GNU A;  4QY5 A;  1PWD A;  3IX3 A;  4I39 A;  1STZ A;  5EVI A;  1KOU A;  3U4L P;  1L3L A;  1KGF A;  5D3O A;  1MWR A;  2JKT M;  3AGE A;  4JGR A;  3E4P A;  3LGO A;  4WMC D;  2H28 A;  3QHY A;  4KZ4 A;  5FAP A;  1BUL A;  2EWW A;  3T12 B;  3W4O A;  4PM6 A;  1SHV A;  5I5L A;  2J9P A;  2RL3 A;  3EOI A;  5CTN A;  3BFE A;  3LYX A;  1CF0 A;  4R23 A;  1F9I A;  4YIN A;  2O9A A;  1Z09 A;  2INW A;  5AQ7 A;  3FKW A;  2ZM2 A;  4EQI A;  2JC7 A;  2XD5 A;  5CHM A;  3EGD C;  3NOP C;  1W7F A;  3E2L A;  4K0W A;  4GHI B;  5FI2 A;  1K54 C;  4OQ0 A;  3CLO A;  5HPF A;  5F5Y A;  5EE8 A;  3NDG A;  3UB8 A;  2K2N A;  1ONG A;  2V0U A;  4PM9 A;  4L9F A;  3PBT A;  2WAF A;  2OLV A;  2O9B A;  3MF0 A;  2V20 A;  3ITA A;  3IWI A;  2Y2I A;  4R0Q A;  4E6W A;  5E2E A;  4IED A;  4QU3 A;  4KZ3 A;  4S2M A;  4XT2 B;  2L1M A;  4KUO A;  3A0S A;  2CC1 A;  2ACG A;  4O0P A;  4PM5 A;  3MFD A;  2XDM A;  1NXY A;  5FAS A;  4ZDX A;  3NJA A;  5JYP A;  4OVD A;  4KZ8 A;  1ES4 A;  3MFX A;  2Z6D A;  4R1G A;  2HPB A;  2YKF A;  4HH3 A;  1CI8 A;  5TFQ A;  4GOG A;  2Q9N A;  2VX8 A;  3UE0 A;  1HZO A;  1BTL A;  5AQA A;  5J4E A;  1QMF A;  2PT7 A;  3NDE A;  1XJ3 A;  4KQO A;  3QNC A;  1Q2Q A;  4CJN A;  4HJ3 A;  4B9O A;  3IF6 C;  1BLC A;  5A93 A;  1H0M A;  4EEP A;  4PKY A;  2OAP 1;  1H8Z A;  4JXG A;  2WGW A;  2D01 A;  3IXB A;  4QPR A;  1L0F A;  1H5X A;  2QKP A;  1SKO B;  5FAT A;  1T1A A;  3UN7 A;  4N1H A;  2ZMA A;  4F94 A;  3NHQ A;  3K3C A;  5HWV A;  4E3J A;  3W4P A;  4A5R A;  3FG8 A;  1EW0 A;  3BFD A;  1PZP A;  2FFF B;  2WUQ A;  1VHM A;  4BQM A;  3UDI A;  1N4O A;  3P09 A;  4MEZ A;  1K56 A;  5HX9 A;  4KG6 A;  1Y54 A;  1CK3 A;  3A3J A;  3LUQ A;  4DJ3 A;  4BBT A;  2OLU A;  4B88 A;  2XRO A;  3VP4 A;  4WZ5 A;  5EVI C;  5DTS A;  1MKI A;  3HBR A;  5HL1 A;  5TJJ A;  4N9K A;  4QHC A;  3MSH A;  1Z6F A;  1K6R A;  5DTT A;  2XR0 A;  1ACF A;  3IS2 B;  1P9R A;  1ZC2 A;  4OOM A;  1KE4 A;  5HWW A;  3IBJ A;  3R7W A;  3H9W A;  2KLI A;  3NUL A;  3PBO A;  4X1L A;  4CLC D;  3V3S A;  4GLQ A;  2XH9 A;  3LIF A;  2HDU A;  4PM7 A;  4K08 A;  4FH2 A;  1MWS A;  4CPK A;  4H6J A;  5GHX A;  4YFM A;  1K25 A;  1OT9 A;  3RXW A;  4HY8 A;  2B02 A;  1F98 A;  5G4Y A;  2PHY A;  2EFU A;  3HLW A;  5FSR A;  3RJU A;  2NUP C;  2EX9 A;  3T4O A;  5CED A;  2PD8 A;  4X56 A;  2A49 A;  5J3W A;  1MC0 A;  4M4X A;  1HTZ A;  4WEJ A;  1HVB A;  3BY9 A;  1CEG A;  2XFS A;  4U0X A;  1M40 A;  4WBG A;  2QPN A;  1W63 M;  3HUO A;  3C5A A;  1MY8 A; 
#chains in the Genus database with same CATH homology
 3VP3 A;  1KVM A;  3OCN A;  4KZ7 A;  3IXH A;  1GCE A;  1ONH A;  1S0W A;  2BLS A;  4FD8 A;  2EX8 A;  2ZJ9 A;  4IVK A;  1XPB A;  3BFF A;  5E2H A;  5F82 A;  4DRT A;  4OPR A;  3IT9 A;  4HEF A;  1IKI A;  4LCM A;  4Q8I A;  3NC8 A;  1DY6 A;  2DNS A;  2Y91 A;  1QME A;  3UPN A;  1ES3 A;  3FWL A;  5EOE A;  4OQH A;  3VP2 A;  1JWZ A;  4Y7P A;  3HUM A;  1FSW A;  3Q1F A;  3ISG A;  4KEN B;  5F83 A;  4S2P A;  1BLS A;  3PBS A;  3V3R A;  4HES A;  3IWO A;  3MBZ A;  4IBR A;  3GQZ A;  3HUN A;  3O86 A;  2QZ6 A;  3LY4 A;  3TOI A;  1H8Y A;  3JYI A;  2XQZ A;  3MZF A;  3BFC A;  5GLB A;  2EXA A;  4OON A;  4OLG A;  4KZA A;  1TEM A;  1MXO A;  3Q07 A;  1L0D A;  3LY3 A;  4JF6 A;  5M1A A;  5AQB A;  3UDX A;  3ZG8 B;  1VQQ A;  1IYQ A;  1DJA A;  4UA6 A;  1YQS A;  2WGW B;  2ZQ9 A;  1IEL A;  2I72 A;  2WKH A;  3GVB A;  2Y2N A;  1JWV A;  3V39 A;  4PM8 A;  2H10 A;  3G35 A;  4JXS A;  5BOH A;  4FCF A;  3WS4 A;  5G18 A;  3E2K A;  4E3M A;  5EEC A;  5FQQ A;  5L2F A;  3OPP A;  4X55 A;  3VFF A;  3BRM A;  1K55 A;  4DKI A;  4D2O A;  4K0X A;  5GLA A;  2BG1 A;  4BL2 A;  1M6K A;  4RX2 A;  3UY6 A;  4WM9 A;  3MXR A;  1SDE A;  4DE0 A;  4H8R A;  5EOO A;  4JXW A;  2R9X A;  4X69 A;  5KMW A;  1J9M A;  3WRZ A;  4XUZ A;  5DTK A;  3ZDJ A;  4S2J A;  3GRJ A;  3S22 A;  1LHY A;  4S2K A;  3QNB A;  3UDF A;  2P74 A;  1I2W A;  2G2U A;  3PTE A;  5CGS A;  1XA1 A;  3CG5 A;  2IWC A;  3IF5 A;  1JTG A;  3ZVW A;  3G2Z A;  2XFT A;  2WAE A;  2JE5 A;  4WZ4 A;  3O3V A;  4WZ5 C;  2Y2H A;  4R3B A;  1ES5 A;  2X71 A;  4JLF A;  4P0M A;  1E25 A;  5CHJ A;  1XGI A;  2WZX A;  1JTD A;  1K6S A;  1OME A;  4S2O A;  5E2F A;  3PBQ A;  5DF7 A;  1PW8 A;  3G31 A;  5CHU A;  3B3X A;  2WKE A;  5CER A;  3VP1 A;  2HDS A;  3M6H A;  1IYO A;  1W5D A;  2Y2Q A;  1GHI A;  4Z9Q A;  4B4X A;  4E3L A;  3OCL A;  1XA7 A;  4OPZ A;  1RGZ A;  2J7V A;  2EXB A;  2H0T A;  3GSG A;  4EV4 A;  1SCW A;  2HP6 A;  3BFG A;  4DDY A;  4LV3 A;  2Y2K A;  1K57 C;  4GKU A;  4ZJ3 A;  4KZ5 A;  3OPL A;  1BT5 A;  4GN2 A;  1XX2 A;  2GDN A;  3G4P A;  4JXV A;  4QB8 A;  5HW3 A;  5A91 A;  1JVJ A;  3HLB A;  1TDL A;  4OOL A;  3SH9 A;  2P9V B;  1YLW A;  3ZVT A;  1IEM A;  1SKF A;  3VOY A;  3LCE A;  3HLF A;  1CI9 A;  1K56 D;  3A3E A;  4JBF A;  4E3K A;  3NBL A;  3WS2 A;  4GDB A;  3HLC A;  5JYO A;  3GTC A;  2UWX A;  4S2N A;  4O7D A;  5F1G A;  1E3U D;  4XUX A;  3Q7V B;  5A92 A;  2OSU A;  5HFO A;  1I2S A;  3UO9 A;  1ZKJ A;  3EQV A;  1ZG6 A;  1GHM A;  4OLD A;  5TR7 A;  4X53 A;  1O07 A;  1G68 A;  1ESU A;  2ZC5 B;  1MPL A;  4L0L A;  5HAI A;  3WS0 A;  3FZC A;  1YLY A;  4S2I A;  4X6T A;  3SS5 A;  4E3N A;  1L0E A;  4LV1 A;  4GNU A;  4QY5 A;  5FA7 A;  3IF6 B;  3HLD A;  1PWD A;  1RCJ A;  3MZE A;  5CRF A;  2X02 A;  2B5R A;  3VMA A;  3N6I A;  3AGF A;  2E8I A;  5E2G A;  5EVI A;  2VGJ A;  2PU2 A;  4HBU A;  4RYE A;  4BD1 A;  3UPO A;  1KGF A;  5D3O A;  4R4R A;  5FQK A;  2ZQ7 A;  3WS5 A;  4KQR A;  4E6X A;  1MWR A;  1PZO A;  3G32 A;  5GLD A;  3AGE A;  4WEK A;  2ZQA A;  4WEL A;  3HVF A;  1LI9 A;  4WMC D;  1SDN A;  5M18 A;  5DVA A;  4ZAM A;  2XK1 A;  3HL9 A;  1NJ4 A;  4GDN A;  4MBF A;  4FSF A;  3QHY A;  3ITB A;  4KZ4 A;  5FAP A;  1BUL A;  2HDR A;  3ZCZ A;  2XLN A;  4RX3 A;  2WYX A;  3BM6 A;  3MXS A;  3N8L A;  3OZH A;  4EBN A;  3W4O A;  3HRE A;  3LO7 A;  2XD1 A;  4ZBE A;  4PM6 A;  1EWZ A;  1ALQ A;  1XXM A;  3PBR A;  5FQ9 A;  1SHV A;  3FKV A;  1KE3 A;  4QD4 A;  2J9P A;  2RL3 A;  2Y2G A;  4R3J A;  5CTN A;  1RP5 A;  4PPR A;  3BFE A;  3V5M A;  4BD0 A;  2HDQ A;  4R23 A;  1PWG A;  1W8Y A;  4FH4 A;  3A3I A;  1ES2 A;  4QJG A;  1ERM A;  4YIN A;  3W4Q A;  4E3O A;  2ZD8 A;  1VM1 A;  4GD6 A;  4U0T A;  1L0G A;  2IWD A;  5KSC A;  5AQ7 A;  3FKW A;  3N4I A;  2ZM2 A;  4OKP A;  2ZM0 A;  4KZ9 A;  4DXC A;  1AXB A;  2JC7 A;  4EQI A;  2XD5 A;  5CTM A;  5CHM A;  2Y2P A;  1CEF A;  1K4E A;  5DF9 A;  4N92 A;  1W7F A;  4UHU A;  2EX2 A;  3E2L A;  2V2F F;  4K0W A;  5FI2 A;  3TSG A;  4K91 A;  1PW1 A;  2H5S A;  1K54 C;  4OQ0 A;  2DCF A;  4OP5 A;  5EE8 A;  2J9O A;  5CEB A;  5M19 A;  2ZC3 B;  3NDG A;  2ZQC A;  1ONG A;  4PM9 A;  1PWC A;  1K38 A;  4JKT A;  4XXR A;  3PBT A;  2EX6 A;  2WAF A;  4C3Q A;  1NZU A;  2OLV A;  2PU4 A;  5KSH A;  3VSK A;  1NZO A;  2V20 A;  3ITA A;  1K57 A;  3IWI A;  3MZD A;  4DF6 A;  2EFX A;  2Z2M B;  2Y2I A;  4R0Q A;  5GHZ A;  4E6W A;  5E2E A;  3OPR A;  4WYY A;  4IED A;  4QU3 A;  4KZ3 A;  1NYY A;  4S2M A;  1JWP A;  5TGF A;  1KE0 A;  3ZG9 B;  5J8X A;  1YMX A;  4MLL A;  2CC1 A;  4ZTK A;  1BLH A;  2Z2L B;  4PM5 A;  3LEZ A;  4EUZ A;  3MFD A;  4KQQ A;  4KZ6 A;  3UPP A;  3NCK A;  4DDS A;  2XDM A;  3C4P A;  1NXY A;  5FAS A;  1BLP A;  4EWF A;  3G30 A;  3SS4 A;  5A90 A;  4BL3 A;  1YLJ A;  3FV7 A;  3OPH A;  1FCN A;  4ZDX A;  1E4D A;  2Y4A A;  3C7V A;  3N8S A;  3UNW A;  5JYP A;  4OVD A;  4KZ8 A;  3SH8 A;  1ES4 A;  3W8K A;  4UAA A;  1L2S A;  5FQJ A;  4EBP A;  4R1G A;  2HPB A;  3S1Y A;  2ZM8 A;  1CI8 A;  5TFQ A;  1PIO A;  1FCM A;  3D4F A;  3O87 A;  2Q9N A;  4GOG A;  3UE0 A;  3WRT A;  1HZO A;  4UA7 A;  2ZLY A;  1BTL A;  4JPM A;  5AQA A;  5FAO A;  2ZQ8 A;  1MWU A;  1QMF A;  3SOI A;  3NDE A;  2C6W B;  5FI6 A;  4KQO A;  3QNC A;  1Q2Q A;  4CJN A;  3RXX A;  1ESI A;  1YLT A;  3IF6 C;  1BLC A;  3ZG7 B;  1XP4 A;  1S6R A;  2Y2J A;  5GLC A;  2H0Y A;  4LEN A;  5A93 A;  3MKE A;  5I94 A;  4MBK A;  1H8Z A;  2JBF A;  4JXG A;  2WGW A;  4BLM A;  5E43 A;  2V1Z A;  4R4S A;  3IXB A;  5KZH A;  1L0F A;  1N9B A;  2HP5 A;  3V50 A;  3BEC A;  1H5X A;  3SH7 A;  3N8R A;  3FYZ A;  3C7U A;  5EVL A;  1KVL A;  2WK0 A;  2X01 A;  5FAT A;  3UN7 A;  3VOZ A;  4N1H A;  4QY6 A;  2WZZ A;  2ZMA A;  4F94 A;  2XGN A;  1NYM A;  1YLZ A;  3DWK A;  3SS3 A;  1KGE A;  3EQU A;  4IVI A;  4OP8 A;  3ZGA B;  4JF5 A;  5CXW A;  4E3J A;  3W4P A;  4N1X A;  1GA9 A;  1PI5 A;  2XEP A;  3Q82 A;  2J8Y A;  3CZD A;  1KGG A;  4A5R A;  3C4O A;  3BYD A;  4X68 A;  3BFD A;  1PZP A;  2FFF B;  4NK3 A;  2WUQ A;  4S2N C;  3PAG A;  1XGJ A;  4P6B A;  4OPQ A;  4BQM A;  5F1F A;  3IHB A;  3UDI A;  4NET A;  3VSL A;  5CEC A;  1ZG4 A;  3MKF A;  4Y0O A;  1DJB A;  3VFH A;  3DWZ A;  3WS1 A;  4Y0U A;  1N4O A;  3P09 A;  1BSG A;  3NI9 A;  4MEZ A;  3ZG5 A;  1K56 A;  4Y0T A;  1LL9 A;  3NIA A;  5HX9 A;  1FR1 A;  4KG6 A;  1Y54 A;  3WWX A;  3ZG0 A;  3GR2 A;  4HBT A;  1CK3 A;  3A3J A;  3AGD A;  4EBL A;  3S4X A;  2PBY A;  1WE4 A;  4OOY A;  5FDH A;  1K54 A;  2G2W A;  1Q2P A;  2OLU A;  1E3U A;  4B88 A;  1EI5 A;  5IHV A;  3CMZ A;  3DW0 A;  5FI7 A;  1FQG A;  4C6Y A;  3VP4 A;  2XF3 A;  4WZ5 A;  5EVI C;  1GHP A;  3OC2 A;  4M3K A;  5DTS A;  1U60 A;  5U47 A;  3ZNY A;  4KG5 A;  3BLS A;  1TVF A;  1LI0 A;  1MKI A;  3HBR A;  5GL9 A;  1ERO A;  2WGV A;  4E3I A;  5HL1 A;  4N9K A;  3UE1 A;  5EVI B;  2OV5 A;  3IXD A;  4LCL A;  2WGI A;  2WAD A;  4QHC A;  1K4F A;  1Z6F A;  1K6R A;  1YMS A;  2C5W B;  3I7J A;  3HLG A;  2XR0 A;  3M2J A;  5DTT A;  4OH0 A;  4BEN A;  2VGK A;  4MNR A;  2IWB A;  4BJP A;  1XKZ A;  1ZC2 A;  4OOM A;  2QMI A;  1FSY A;  4B4Z A;  1KE4 A;  3IHA A;  2JCH A;  1W8Q A;  4LV2 A;  4P85 A;  1NRF A;  2P9V A;  3ZFZ A;  3GV9 A;  4C75 A;  3VP0 A;  1IYP A;  3Q81 A;  4WMC A;  5HAQ A;  3BEB A;  3PBO A;  1C3B A;  1TDG A;  2Y2M A;  3G34 A;  3IXG A;  3A3F A;  3V3S A;  4PMA A;  3M2K A;  4S2L A;  1K55 C;  4JF4 A;  4RA7 A;  2XH9 A;  5EPH A;  1LL5 A;  5HAR A;  1KDW A;  3IQA A;  3IH9 A;  1HD8 A;  1I5Q A;  3Q7V A;  5AQ9 A;  4ID4 A;  2HDU A;  1IYS A;  4ZJ1 A;  3TG9 A;  4PM7 A;  4OQI A;  4OQG A;  4RVA A;  2Y2O A;  3CJM A;  4FH2 A;  1MWS A;  1RGY A;  4ZJ2 A;  1FR6 A;  3UE3 A;  4CPK A;  1PYY A;  1MBL A;  1O7E A;  2DRW A;  5FAQ A;  5GHX A;  4YFM A;  1K25 A;  1PI4 A;  2Y55 A;  2ZC4 B;  3IF6 A;  5CGW A;  3DTM A;  4KG2 A;  5EVI D;  1LLB A;  3RXW A;  3G2Y A;  1MWT A;  3ZHH A;  5HAP A;  1FCO A;  1W79 A;  4U3T A;  4DE3 A;  1BUE A;  3M6B A;  3IH8 A;  4MBH A;  1YLP A;  1YM1 A;  3BLM A;  2EFU A;  1ERQ A;  3HLW A;  2FFY A;  4LV0 A;  5FSR A;  3RJU A;  3O88 A;  4P87 A;  4DXB A;  2EX9 A;  4UA9 A;  3Q7Z A;  2Q9M A;  2R9W A;  3P98 A;  1G6A A;  5CED A;  4DE2 A;  1WYB A;  2HP9 A;  5EUA A;  1WYC A;  4X56 A;  2A49 A;  1GA0 A;  2ZQD A;  2ZC6 B;  1KDS A;  1NY0 A;  3PAE A;  2Y59 A;  1HTZ A;  4OPY A;  4WEJ A;  1FOF A;  4IBX A;  3ZNT A;  1BZA A;  1HVB A;  5CGX A;  1CEG A;  2XFS A;  5DF8 A;  3A3D A;  4GZB A;  4U0X A;  1M40 A;  3HLE A;  4WBG A;  4DE1 A;  1IKG A;  1YT4 A;  2RCX A;  2A3U A;  2Y2L A;  3GMW A;  4KZB A;  4N9L A;  2QPN A;  3PBN A;  5FQI A;  4GB7 A;  1DJC A;  2ZC7 A;  4GD8 A;  3NY4 A;  3HUO A;  2WKI A;  3C5A A;  5GHY A;  3N7W A;  5FQM A;  3IWQ A;  1MY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...