3Q0BX

Crystal structure of suvh5 sra- fully methylated cg dna complex in space group p42212
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
163
structure length
148
Chain Sequence
b'QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVGEPPKDQQLVTGNLALKNSINKKNPVRVIRGIKKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPELPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title A dual flip-out mechanism for 5mC recognition by the Arabidopsis SUVH5 SRA domain and its impact on DNA methylation and H3K9 dimethylation in vivo.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase/dna
total genus 35
structure length 148
sequence length 163
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.30 Mainly Beta Roll PUA domain-like PUA domain-like 3q0bX00
3Q0CA 4YGIA 3Q0FA 3Q0BX 3Q0DA
chains in the Genus database with same CATH superfamily
3F8IA 3Q0FA 4PW7A 3Q0DA 4OC8A 2ZKGA 2ZO2B 3OLNA 2ZKEA 4PW5A 4RZLA 3BI7A 2PB7A 2ZO0B 3Q0BX 3DWHA 4F0PA 4PW6A 4F0QA 3Q0CA 4R28A 3F8JB 3CLZA 4NJ5A 4YGIA 2ZKFA 3FDEA 2ZKDA 2ZO1B
chains in the Genus database with same CATH topology
3Q0CA 4OC8A 4R28A 4YGIA 3Q0FA 3Q0BX 3Q0DA 4F0PA 4RZLA 4F0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0C A;  4YGI A;  3Q0F A;  3Q0B X;  3Q0D A; 
#chains in the Genus database with same CATH topology
 3F8I A;  3Q0F A;  4PW7 A;  3Q0D A;  4OC8 A;  2ZKG A;  2ZO2 B;  3OLN A;  2ZKE A;  4PW5 A;  4RZL A;  3BI7 A;  2PB7 A;  2ZO0 B;  3Q0B X;  3DWH A;  4F0P A;  4PW6 A;  4F0Q A;  3Q0C A;  4R28 A;  3F8J B;  3CLZ A;  4NJ5 A;  4YGI A;  2ZKF A;  3FDE A;  2ZKD A;  2ZO1 B; 
#chains in the Genus database with same CATH homology
 3Q0C A;  4OC8 A;  4R28 A;  4YGI A;  3Q0F A;  3Q0B X;  3Q0D A;  4F0P A;  4RZL A;  4F0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...