3Q0EA

Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with product of s-allyl-l-cysteine sulfoxide
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
369
structure length
369
Chain Sequence
b'MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title Structural characterization of inhibitors with selectivity against members of a homologous enzyme family.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 123
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3q0eA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q0eA01
1JA9A 1ZNQO 4DUPA 4B3IA 1I36A 1GFSA 4Z3KA 5KVQA 1WDKA 1VL6A 4XD2A 4WCFA 1N1EA 1E1MA 1WXDA 3U4DA 1LQTA 3OM9A 1ZKMA 2TMDA 5FFFA 1EVIA 1X14A 3RVDA 4I5FA 4IQGA 4GLOA 2GRAA 1XA0A 1ULSA 5J9GA 1M67A 4O5OA 3E5MA 1VKOA 5FYDA 3GEGA 2Y99A 1NR1A 4RF3A 4OSPA 5BNTA 2B4RO 3PYMA 5JCJD 2C2YA 4AFNA 3ASUA 4B7UA 4H3VA 2HKIA 4BO0A 4IS2A 5JAIA 4EGFA 5IZCA 2PKQO 1ZK4A 2X5KO 5C7OO 1M75A 4XCVA 3T4EA 4BNWA 2P2SA 2RAFA 3D4NA 2PNFA 1VJ0A 4E6PA 1Y5RA 4UVHA 5DCWA 4MP8A 3V5NA 4ND2A 1Q0QA 4H7PA 4PN3A 2ZK7A 4C4OA 2WD8A 2NU8A 3DZBA 1B3BA 1GY8A 2H5LA 2EG9A 5EL0A 1I3MA 1NTOA 4A7PA 4CM1A 5IAAA 1BXKA 4P38A 2IRWA 4PG6A 1Y8RB 3GRPA 1E7YA 3GNQA 2OXIA 3GEMA 2Y1CA 1E7RA 3ROQA 1DLJA 3EZLA 3I9MA 2CF5A 5CDSA 1I30A 2Z95A 1NBOA 1AGNA 4WUVA 4ZQBA 4D42A 2GN4A 4D79A 4DMMA 3RSHA 4XGIA 4GX5A 4R1NA 1K89A 1SZJG 1JKFA 4IDDA 1BTOA 4XX0A 1E3JA 1FK8A 1GV1A 1PU2A 3GQVA 3TOXA 1ZK0A 2CY0A 4A03A 1CQIA 3W1VA 4WCDA 3GG9A 2D1YA 4W4TA 1E7QA 2FR8A 2EGHA 4GKBA 1DJQA 4P4NA 2WDZA 4GMGA 1HDYA 2VWHA 2LDXA 4W99A 4A27A 5HRUA 3ASVA 5KNLA 2J5RA 3QW2A 2IEDA 4B8WA 3WOHA 4ALJA 3EAGA 3DZGA 1PGNA 1HYGA 3DFUA 1I3LA 3C1OA 4WASA 5DBFA 5H83A 4NBVA 4UUMA 4DLLA 4UEKA 4UVGA 4FR5A 4O59O 2Y0EA 4BKOA 4BNMA 3FPCA 4WLEA 3QE3A 5EESA 2AEMA 5DP2A 4L9RA 3IKVA 1OBFO 3WGZA 5EINA 1SPXA 4YDRA 2Q4EA 3IJPA 1NFQA 1P9LA 1LTHR 2EV9A 2EW2A 1TB4A 4DC0A 3Q6IA 3LF2A 3EK2A 4IDGA 4OHUA 4TRNA 4XJSA 2E48A 1LSOA 3HWRA 1SAYA 4MVJA 3W4JA 3FD8A 1E5LA 2OORA 3DTTA 4OMUA 4TWRA 4E3ZA 4I5DA 1DHTA 2D59A 3RU9A 2YQ4A 5KCZA 2H63A 3G1TA 3F4LA 2ZCVA 3MJEA 2Y68A 4M86A 1V3TA 2PR2A 5JSFA 2Q22A 1PGJA 4QUKA 1LDMA 3RC9A 3RU7A 1YDWA 2VT3A 3PQDA 4LK3A 4IPTA 2PGJA 2EP5A 2D5CA 4A73A 1B8VA 1PJSA 3M6IA 2GDZA 5HTOA 2BMAA 3Q9NA 1MLDA 1G6KA 4CM9D 4DQUA 3PI7A 1IHYA 8ADHA 5ICMA 4MKRA 4PRKA 3WGQA 4BNUA 4HX5A 1XQ1A 3EVNA 2Q46A 3AI3A 5TGDA 3UICA 4J91A 4ND5A 3RUDA 1H6CA 4CM8B 1ADBA 4NBUA 1N2SA 3RC7A 1ARZA 3JYPA 3FRJA 2Y93A 2HU2A 4PG8A 4XQ9A 1C1XA 2JCVA 4EEZA 2ZJ0A 4IIVA 3WIEA 1OZAA 1BG6A 3GZ4A 4YAEA 5COQA 2O3SA 3DBRB 3QWHA 3DONA 4TZKA 2G76A 4CMIA 2JFHA 5AQ1A 3A28A 4R69A 4DYVA 4FFLA 1K6JA 1BVUA 4N7RA 4BVAA 4PGFA 4ALNA 5TJ9A 1QKIA 2O4CA 3JD3A 2G1UA 1EEHA 4PLFA 5IDWA 1PQPA 1LNQA 5KWEA 2OMEA 1HYEA 4A0SA 4G81A 2JJYA 4K26A 3ZNOA 5LDHA 4ALIA 3I9OA 2HMWA 4IGEA 3ITDA 1Z73A 2O23A 4FN4A 1RKXA 4BQRA 1WZIA 1LLDA 1T26A 3FTPA 3CE6A 2YV1A 2CFCA 1V6AA 4MINA 3PEFA 4J7XA 4M55A 1DRWA 4AJJA 2R00A 3HHPA 4AJ2A 2Q1TA 3HN7A 1FDTA 3ZGYA 3OEYA 4KTTE 1D3AA 4PG4A 4AJ1A 3P5SA 1JKJA 5LDGA 3TFOA 1WMBA 5U4QA 1HDZA 1UAYA 3HE3A 2UV8A 2RBEA 4J49A 1PS8A 3WDSA 4PLHA 2FR1A 2JL1A 5C37A 1XWFA 3AUUA 4PZCA 1PR9A 4ZRNA 2E4AA 3MTGA 2OP1A 2YDYA 4BIIA 4W6ZA 4O63O 1QG6A 3SX2A 2CDBA 2VOEA 1DHRA 2GO1A 3JQ6A 4XRRA 3ZWOA 3HJAA 1P31A 1ZH8A 1E1NA 1HDGO 4XA8A 1GUYA 1R4MB 1SO8A 4GL4A 3K8ZA 3FF4A 1LU9A 1GADO 1CRWG 2PTGA 4F6LA 4R1TA 5BSGA 3D1LA 1H2BA 3K2BA 3S2GA 2H9IA 3JQAB 1W6UA 4RLSA 3VPXA 4BKPA 2FSSA 4ZQHA 1B8UA 4EI2A 3AOEC 3CSDA 3NT2A 2GSDA 5JCJA 5BNFA 3V1UA 3LC1O 3W4IA 5G4KA 4EUFA 2VUSA 2A4KA 3VHRA 1E5QA 4DGSA 2GZ2A 4R3WA 3TFQA 1A9YA 4LCJA 1ID1A 5TQVA 3TN7A 3JYOA 5JMPA 4O1MA 3JQFC 4EDFA 2C7VA 3OMLA 3D4PA 4OIMA 1HE5A 3NEPX 5EERA 3IP3A 4AJOA 5KJ6A 1T2FA 1A4IA 3RJ5A 4J16A 4FJ2A 4Z9FA 3R0IA 3N74A 3RD5A 1PWZA 1YVEI 1EQUA 3AU9A 2VZ8A 5COAA 1EVJA 3DAPA 4AJPA 3G3EA 1SBYA 1ZJYA 4RZHA 2GNAA 2JHGA 4IGFA 3CEAA 2JAHA 4FFOA 3VH1A 4JN6B 3H7AA 3QSGA 3WSWA 2YY7A 3WTCA 3ORFA 4LSWA 5I8WA 1GQ2A 1LDNA 4NU5A 1IB6A 3H3JA 5JYAA 4AG3A 1UP6A 3B1FA 4WLFA 4KWHA 4BMSA 2IXBA 3H2ZA 1DIRA 5HS6A 5CDGA 3BMCB 3IOYA 1H5QA 3DHYA 1P1RA 1DB3A 1HDXA 5CEJA 1NR7A 3WLFA 2IZZA 1MP0A 2IXAA 2YUTA 1BGVA 5A02A 5JW6A 2V6FA 2PKQP 1NWHA 3L4SO 1AE1A 5I9NA 3EW7A 5K0ZA 3UGKA 4GBJA 5GY7A 4AJKA 1PL8A 1ZXBA 4HXYA 4DA9A 3NTRA 4CM3A 3F5SA 2DC1A 3HN2A 2ZQYA 3LC7O 4L76A 1XG5A 1Z75A 3RBVA 5T8KC 5IXYA 3NT4A 2DU8A 2X6TA 3O8QB 1DIBA 2BFAA 1YKFA 3DBLB 2EJWA 4J9UE 2Q49A 5CEFA 3IS3A 4NK4A 5IDQA 3H5NA 4XYLA 4HADA 2GF2A 3SJUA 5IDXA 3LVFO 1DDOA 5CP8A 4CM7A 3CXRA 1I01A 1NPDA 3N7UA 1A71A 4FFMA 4D3DA 1PWXA 3ENNA 4TKMA 4R4JA 2PD4A 3A06A 2G82A 4W82A 3QVTA 4CMCA 1GYPA 1YOVB 4PRLA 4CL8A 3I5MA 4PLVA 4CM9A 3H2SA 4YQYA 4GPD1 2PGDA 1PL7A 1YGYA 4XQEA 2VT2A 1HZJA 2NVUA 2UAGA 1UJMA 4ILKA 1WP4A 3PPIA 3RQSA 3ZN2A 5JO9A 3ZWNA 4CMAA 5IJZA 3UXYA 5CDUA 4I08A 1E6UA 3GFBA 1YQDA 2ZJ1A 1LDYA 5G2OA 4CLRB 2GASA 3BTUA 1C0LA 3DMTA 3FR7A 1GUFA 2AE2A 3RC2A 5ILGA 1NYTA 1MFPA 3FCOA 3B1KA 4WEQA 2P4HX 4RPHA 3H9QA 1KVSA 1N7GA 1QYCA 4D7AA 3GDOA 1ADCA 5T57A 4NNJA 1P1IA 3OQ1A 5U9CA 2WE8A 4GKVA 5H82A 1EK5A 1L1FA 1HL3A 1WNTA 3EC7A 3JYLA 3ZHZA 3AY3A 3DWFA 3E03A 4RPJA 1CF2O 5F3RA 3ZWPA 3JD2A 4BNNA 2I99A 5CPFA 4YAKA 1EVYA 4PG5A 3PK0A 4CUKA 8LDHA 1W4ZA 4INAA 1PSDA 4JBGA 1H2HA 1VL0A 5THQA 5K9ZA 4L8VA 2RCYA 1N5DA 1GCOA 1KEUA 5AXAA 3VPGA 2HO5A 1LC3A 4PVCA 2VNSA 1XKQA 1SEVA 1ISMA 4ZVVA 3EGOA 1IY8A 2FP4A 5IXSA 4Y8VA 2DUWA 2DBQA 5A5EA 1X15A 1Q7GA 4FJ1A 4BO7A 4YBZA 4BO8A 1CYDA 1KVQA 5GZ3A 2HDHA 4TMFA 3GVCA 3ON5A 4KOAA 3ETEA 5HBRA 3ZH2A 5MGBA 2AEJA 3K6JA 1LDEA 1JAXA 2OBYA 1EZ4A 3NT5A 2NU7A 1T4BA 4PLWA 1P0CA 3CH6A 5HM8A 4BB5A 1ISGA 5DNAA 1WZEA 2DLDA 3ANNA 1BDMA 3RUIA 4D43A 1UH5A 2PH5A 4RVGA 5BSFA 1DFIA 4BO5A 5A3VA 4YWJA 2FPIA 4G5HA 1U2DA 2Y1EA 2V6BA 4WKGA 4RVUA 1JN0A 2YV3A 3B6ZA 3OFSA 4EZBA 4FOSA 4YJFA 3ST7A 5JS6A 4RGBA 3GPDG 2BFPA 3DAGA 1Z6ZA 4AVYA 1UP7A 2G0TA 5F21A 4BO4A 4TVBA 3L6DA 1HDRA 1Q1NA 3WWZA 4B4WA 4NDNE 1C1XB 4WOKA 2VRCD 3DC2A 3IIEA 4UREA 3OSUA 3VZSA 2HK9A 4NHEA 3W8DA 3TRIA 2D5AA 1DFGA 2QZZA 4AJHA 4HFJA 5IFLA 2JFFA 2ZATA 4IJKA 3BMNA 3W8EA 3D0OA 2GR9A 4S3MA 3LLSA 3VKUA 1BVRA 1S7CA 4YT5A 4F3YA 2A35A 5TIIA 2XPCA 1EMDA 3I9KA 3OECA 3SC4A 3KSDO 1ISHA 3GAZA 3ZWWA 1DOHA 3D5TA 4WLVA 1QV7A 3ZNQA 3NDJA 1MG5A 2DUUA 3JQ8B 2GERA 3F46A 2DM6A 1PEDA 3VDQA 2RHRA 4GQAA 4PIVA 3U5TA 1ORRA 2E6UX 2Y1OA 2X9VA 4YJHA 1I0ZA 1UR5A 4CM4B 4CLOA 2ET6A 1UDAA 3EYWA 4J0FA 3BTVA 4JGBA 3PYXA 2BGLA 3GOHA 3CPSA 3JQDA 3UHAA 3OQBA 1AXEA 1DRVA 1RPNA 3FTNA 3Q1LA 5JPIA 1Z82A 1MUUA 4N18A 5EJ2A 5DN9A 4GVXA 4ID9A 3FN4A 3PJEA 5KIAA 3OJOA 3HFSA 1XCBA 2ZYGA 5KJ1A 3PTZA 4TZTA 1TA4A 3ZW9A 1EE9A 4YAGA 4MIOA 3F4BA 2I66A 4RVFA 5I7SA 4KWIA 1IYZA 1U28A 1VJ1A 3WB9A 3ZHBA 9LDTA 4AJIA 5FI3A 4BNGA 1NVTA 1NX6A 4RF5A 4TKLA 5DULA 4ZD6A 2I5PO 1E3WA 1YL5A 4MVJM 1ZK2A 5KKAA 2ZIZA 3P19A 3GDFA 2C0CA 5L4SA 1U4SA 3AFNA 4DLAA 4WOJA 1V35A 4FIZA 4Z6KA 1Y8QB 2R2GA 2Q50A 4QECA 2PLAA 1R0SA 3OIGA 2IZ1A 3GUCA 4CQLA 1QP8A 1X1TA 3MZ0A 2O48X 2B5WA 3NUGA 1H6DA 3KUXA 1YB5A 3FPLA 1I8TA 2NM0A 4BO6A 2C82A 1ENPA 3QY9A 3L6OO 4MP3A 4BKQA 3ZHXA 1QYWA 3HDQA 2C2XA 2J5QA 1HYHA 3M1AA 4RORA 3VZQA 3MJSA 2DTDA 1AUPA 3RKUA 4FQ8A 2GZ1A 5GZ6A 4IDCA 4NIMA 4JJIA 3IL2A 4XGKA 5ENDA 3ZHYA 3PWSA 1TEHA 1ENOA 3DEYX 3DOOA 3G17A 1NASA 3JQ7A 4J9VA 2F1KA 3ONDA 3ZI0A 3RJ9A 3P2OA 1ISFA 3VDRA 3C8MA 5F1OA 1SC6A 1U2GA 1UXGA 1WPQA 2D0IA 1PZEA 3WR5A 3HB4X 1E3IA 4U5QA 5K6AA 3GHHA 3MWEB 1H6BA 2BH9A 2D3TA 2FZEA 4NJMB 2X58A 2WEKA 4J90A 2A94A 3ICCA 5BNIA 1GDHA 2WM3A 4CMEA 2X22A 4CV1A 3JQ9A 1HETA 3C7AA 3FWZA 1V8BA 3PYLA 1YDEA 3WFIA 4XIJA 4Y9DA 5CPBA 5I7FA 2J3IA 3OETA 1P1FA 2C29D 4R54A 2CD9A 3E9MA 4BS9A 4E21A 2BGKA 2X5OA 1ZJZA 4UULA 2A9FA 1GD1O 3DBVO 1LBEA 4IMRA 5ADHA 5DOZA 5AXDA 5THKA 3GMDA 3KHUA 2FPGA 4IJVA 4GWKA 3MCVA 1L7EA 2OFPA 4GAEA 1B16A 5I7VA 3UN1A 3GVPA 1OOEA 3MJVA 3OJEA 1GTMA 5TT1A 3QWAA 4B7CA 5KJEA 2NACA 3IMFA 3L4BA 2FPPA 2FSVA 1X7HA 3AJRA 5BSHA 3QVOA 4YQZA 2VZ9A 1UAGA 3VZPA 5ICSA 4GMFA 1B0AA 1GV0A 4E5NA 1GUZA 1UDBA 1VKNA 3WQQA 1H9BA 5B4VA 3NX4A 4RLHA 1E1LA 4MVJP 3GGGA 2ZTLA 3VTFA 3NYWA 2H6EA 4LRSB 3DZJA 5BT9A 4WK6A 2PV7A 4UEOA 4ZN6A 4Z9XA 3H9EO 2C59A 4ROSA 1DXYA 2DT5A 3WGIA 4YR9A 5CDTA 2C5EA 3SC6A 3KYDB 1I2ZA 1NAIA 3GVIA 1DLIA 1PTJA 4NFSA 5T6BA 2X0RA 4OKNA 1AHIA 2B36A 4WNIA 1N9GA 1GPJA 4JNKA 5ES3A 2B5VA 5JMWA 2VCYA 5EPOA 4R5HA 5IN5A 2AG8A 4R01A 4EEXA 1XEAA 4PLTA 3TWOA 4XR4A 2HLPA 1SB9A 4OO3A 1ONPA 1U9JA 2X1HA 1FDWA 3GG2A 4GSLA 2JKVA 2NU9A 3BTSA 4BNKA 2JD2A 4M8SA 4Y6PA 1H9AA 3C7DB 3PGJA 4HFRA 2P91A 2Z5LA 3WGYA 1N1GA 1K5HA 4TVOA 1IPEA 3OQ6A 3JQCA 2FR0A 2ZYAA 3K96A 3PDUA 2CVZA 4IM7A 5L4NA 3IQDB 2VRCA 1H0KA 2W2KB 4CMJA 1EFLA 4JBIA 1LLQA 4B8ZA 3GNTA 3PQEA 3UAGA 1RM3A 1WWKA 4E2YA 2I67A 3WX0A 5C3MA 2BRUA 5J23A 5TS3A 2WD7B 4DPLA 3ZV6A 1G0OA 1NPTO 2AQKA 4BGUA 3AUSA 4R16A 5L9AA 4EJ0A 3WMWA 4BGIA 3U0BA 3V1TC 3BMQA 3CMCO 4CQMB 4DLBA 2R00C 1U7HA 3RAJA 1E6EA 1AXGA 2B83A 2HSDA 5JDCA 4QFCA 2P5YA 2NUAA 2YYYA 1R6DA 5DCUA 4ZGWA 3I83A 3G0OA 5U1PA 4AJ4A 1C0IA 2DAPA 1E0DA 2OL4A 2ZTUA 3RUEA 5L53A 1NQAO 2NLOA 2CZCA 4JBHA 5EMHA 3QV1A 3E9NA 1ZW1A 4FFRA 1EBFA 2EKPA 4MP6A 3QIVA 1ISJA 3GZNA 4RF2A 3VTZA 4IZIA 2YFHA 3LDHA 3WJ7A 5JYFA 1HTBA 3V2HA 1V9LA 4RPLA 1YL7A 2WYVA 1KVUA 3IP1A 3GR6A 5A9SB 5JXWA 2X9GA 4TRRA 2JHFA 2O3TA 3MJCA 4D41A 4YRDA 3FHLA 3DBHB 2P9EA 4NU6A 1HXHA 3S2EA 1WDLA 4JK3A 3WICA 2XOXA 4J4TA 3AM5A 3WFJA 4Q3AA 1HRDA 3SLGA 2B4QA 2IEBA 3FNGA 4NBTA 3OJLA 4UAGA 3TZQA 4CV3A 2Y0CA 1UXJA 3DO5A 1H93A 2W90A 3I9JA 4OM8A 4ALMA 4B4VA 4KP7A 1LLCA 3PZRA 1XQ6A 2C7GA 4P4GA 3PP8A 1E6WA 2BKAA 4XYMA 1U3WA 3U9LA 3C85A 1RYDA 3EUWA 3AW9A 3PJFA 1Y6JA 4KDEA 2C54A 2O3RA 4BNTA 2CDCA 4BKRA 2I3GA 4A5OA 5JBIA 1DIGA 3QP9A 3D3WB 1J0XO 4ALLA 1ZMOA 2EHDA 4HNHA 1QRRA 2C07A 4DBVO 2YW9A 4U7WA 4L75A 1PJLA 1MXFA 3WQSB 3NDIA 5JYEA 4J6FA 2BGMA 3I6IA 4BV8A 1P33A 4HP8A 4AJEA 3NGLA 1BW9B 4BHTA 3OJFA 3SVTA 4I9UA 4DL9A 4HWKA 3MWDB 2HCTA 2AW5A 1VM6A 1UZLA 5CHEA 3DZIA 3D7LA 4E13A 1Z45A 3KV3O 1T2AA 1UDCA 3U3XA 4NJOA 2J3JA 4D45A 1IHXA 5KKCA 3EDMA 2BF7A 1NQTA 2X5JO 3I4FA 1R4NA 4G65A 3GVHA 1RYEA 1C1DB 4XZ3A 1KC1A 2BFMA 4U0JA 4CV0A 2C5AA 5G0VA 1GL3A 3RFXA 3Q11A 4YXFA 2NVBA 1PJQA 3E48A 4GX2A 4UVIA 1FMCA 1EDZA 4D0RA 2EIHA 3JQBA 4FJ0A 2BI8A 4JJFA 2QG4A 5DBIA 1TT5B 3HDJA 4Q3CA 3GUYA 4Z0HO 4QO8A 4YJGB 3GRKA 2HJSA 3KSZO 1KC3A 1K6IA 1IULA 3ONEA 5TX7A 4DC1A 4IZHA 3ADOA 4OSOA 1YWGO 1DJNA 1NM5A 3W4KA 1FDVA 1ZEJA 3ZCXA 2G5CA 3F47A 2P9CA 5AXCA 1V3VA 1X13A 2AEFA 5AXBA 3SBOA 3KVOA 4II3A 1M2WA 5HA5A 3JSAA 3NTOA 2XXJA 4JQCA 3KYCA 2DPGA 4FFNA 2P5UA 1YQXA 4PZEA 1BXGA 1NWCA 4DPMA 4P4LA 4IQ8A 1MA0A 1UXHA 3ZU2A 4FCCA 5TNXA 4GVLA 1NHWA 3GGPA 4IBOA 5JDIA 3PLRA 4BMVA 2DQ4A 3OICA 3RIHA 3WYEA 1HLPA 4I5GA 5L7YA 1I10A 1E7WA 1A7AA 3ADPA 3PWZA 3VH3A 1D4FA 2UDPA 3PIDA 2HMUA 1KERA 4OXKA 1LA2A 4YTEA 3F9IA 3L0DA 4UUPA 3R1IA 3WWYA 1KY4A 4LMRA 1ISIA 1XGKA 3TQHA 4JX8A 4RQTA 4E31A 1H6AA 4AICA 3I9LA 4L4RA 4FDAA 3V8BA 1GU7A 3OIDA 1HE2A 4KUHA 3M2TA 4L0QA 4WPGA 4XYGA 2O7QA 5JAMA 1KS9A 3IC5A 1MFZA 2A92A 4FB5A 5DBGA 5ENVA 4QT0A 4B7XA 1WW8A 3AUAA 4JP3A 4A26A 1W0CA 2QHXA 1B15A 1SOVA 3D3EA 1FF9A 3ETDA 3OEWA 3DTYA 1MXHA 3L9WA 3LC2O 1J6UA 1ZO8A 1GPDG 5H81A 4R1UA 1R37A 4FD3A 3HG7A 3WIDA 1R16A 5A06A 3VH2A 4AJLA 3KZVA 1C0KA 4WCFB 3O26A 3E5RA 1PJTA 4EUHA 3WXBA 2NU6A 5IDYA 1WAMA 4M1QA 3GHYA 2VN8A 1PR3A 2FWMX 3E82A 3ROKA 3TNLA 1QLHA 5F1PA 5JC1A 2Q2VA 4KQWA 3JQAD 4Z0PA 3TL3A 1ZCJA 1BXZA 4E5KA 3H9UA 3KETA 3TOZA 3GDGA 4E2ZA 4W9NC 2V7PA 5ER9A 4BO1A 3HNPA 5B12A 1HE3A 3WJAA 1OAAA 1Q7BA 4YEDA 4FSHA 2B37A 3CZMA 4OL9A 1EUZA 4Z0TA 5I9LA 1KEVA 4ZU3A 4IIUA 4MKXA 2E37A 4YACA 1PL6A 4CM5A 2O4UX 4CM6A 7MDHA 1GQYA 1AHHA 1D1SA 4NBWA 4R9RA 3QHAA 2GCGA 1E7MA 3JQGA 3C1AA 3WSVA 3RASA 1V0JA 5GZ1A 5TLSA 1JKIA 1T25A 4NPCA 1QMGA 4HKTA 3FBTA 2C20A 1UXIA 1O6ZA 2VNAA 1P44A 2XAAA 3QJ5A 3RUHA 1Y8RA 1I3NA 2DBZA 2O50A 1U4OA 2EKLA 2WE7A 1P77A 2RH4A 4B4UA 3INGA 4IMPA 2VQ3A 3Q2IA 4RPGA 3R3SA 1YXMA 4M54A 3BYZA 4PFJA 3UF0A 3Q0EA 1KEPA 3GAFA 5L45A 2AHRA 2UUPA 1N9GB 1U7TA 4W7IA 1KVRA 3NV9A 4XKJA 1BDBA 4DQVA 4CV2A 4ZA2A 4IDEA 1K3TA 3PJGA 1B14A 4JP2A 1ZXLA 3OA2A 3PIIA 2EERA 3C24A 1SMKA 3GGOA 1CETA 4IQ0A 2BI7A 4X54A 1IE3A 4L73A 2PA3A 4BNFA 1VL8A 1EVZA 2Z1MA 4JIGA 5A03A 1J4AA 3E9QA 1QYXA 2PD6A 4B3HA 2P9GA 5IF3A 3MOGA 4B3JA 3O03A 3DHEA 1DPGA 4HFNA 1CEQA 4U0KA 1B3RA 3ZWAA 4BNVA 4JROA 3OBBA 2QIOA 3Q2KA 1RM4A 2PZMA 4R9SA 4EYEA 5IZ4A 4CMBA 2VYND 1C0PA 3UCXA 4B79A 2Y67A 2BHLA 2QX7A 2HMTA 5JCXA 1F8FA 1QLJA 2ZYDA 2AG5A 5JYDA 5KVCA 3JD1A 4B4OA 4LMPA 4ZQGA 4PLGA 1O5IA 4JXKA 1DC3A 4IINA 3ZU5A 1UP4A 1YBAA 3I4CA 3ITKA 4E33A 2ZB3A 3GT0A 2V6GA 3DFZA 4WLUA 3HDHA 4Q3NA 2ZB4A 3D4OA 4BO3A 5T8KA 1IOLA 3W6UA 1J49A 5CFZA 2BD0A 4U6SA 3OF2A 3G49A 1J5PA 1YE3A 3Q9UA 1HF3A 4K28A 1IZ0A 2QRJA 3WYBA 1CDOA 3F1KA 2WYUA 4Q3BA 4EW6A 3JQEA 1E3LA 4L4XA 4QEDA 5A5FA 2JAPA 1SB8A 2Y66A 4AJNA 1IPFA 3H3FA 1JW9B 4RZIA 3KXDA 4YA6A 3KEOA 3A9WA 3ROMA 2J6IA 5DDIP 1QV6A 4CM8A 3OP4A 4PLCA 2GN8A 3H6KA 3HQ4O 3CINA 1LDGA 4Y6SA 4ZJUA 3VPHA 5L95A 4OH1A 3PHGA 1F8GA 3JYQA 5CDYA 3ZWXA 3A4VA 4HFMA 3LT2A 1RM0A 1UXKA 2O3UA 7ADHA 1MC5A 3JCZA 4OOEA 1T4DA 4QX6A 2X7HA 1JWBB 2ZCUA 4GGOA 3OA0A 4XWYA 3ANLA 3DBRA 1HDCA 4FC7A 4NG5A 4CMIB 3KRTA 2WYWA 4PG7A 1CWUA 2IYOA 4IS3A 2GUGA 3WYCA 3C1TA 3FSRA 4XQGA 5JLAA 1Y7TA 4Q3EA 3KYBA 4ZRMA 4U8GA 1HKUA 4Z9YA 1P1KA 2PY6A 4DBZA 3UOGA 4HNGA 1OFGA 4FW8A 3T7CA 1UUFA 2TMGA 2YHUA 1CJCA 1QORA 3W6ZA 4GLLA 3ONFA 2VWQA 2I9PA 3UFXA 3GF4A 5EQFA 4J43A 2O3JA 4CR8A 2UUOA 5JO0A 1Z7BA 3K2EA 4J1NA 1E1KA 5A4DA 3STHA 3K73O 3GH3A 4CR6A 5CG2A 1ONNA 1GYQA 4J1TA 4TQGA 5L7WA 3JD0A 2PD3A 4WCFC 1Z74A 2F00A 3JQ9C 2HQ1A 5BSEA 1EDOA 5JFOA 4RL6A 3B20A 2Y0DA 3FWNA 1SOWA 3TZCA 4MVJE 1LRLA 1Y1PA 4J7UA 4QQRA 3A1NA 1HSZA 1JVBA 1MV8A 4LVUA 1A7KA 4CMHA 2Y1GA 3WBBA 2UVDA 1AN9A 1KIFA 3ENKA 3PFWO 1T2EA 1DC5A 3CUKA 1R4MA 1SNYA 2J3KA 2OHXA 4IDFA 2I65A 2RH8A 3HUDA 1ZK3A 5IZCC 4KQXA 3HFGA 1F0YA 3L4BC 3JD4A 3BZUA 1N8KA 2IDZA 3JQAA 2POQX 4Q3DA 2FHSA 5G0TA 2YHIA 1PX0A 4OKIA 1WMAA 4CR7A 3D64A 3KTDA 2RIRA 4RF4A 3UH1A 3JYNA 5G4KB 3NJ4A 3EHEA 2YV2A 1DEHA 1PGOA 2H1SA 4NK5A 3SJ7A 4R41A 2I6TA 1V3UA 4ITUA 2EP7A 4WEOA 4J4BA 1Q2XA 2X8LA 3ETGA 4J4HA 4PZDA 4BQPA 4FGWA 4K6CA 4XIYA 2VUTA 3UKOA 4F46A 1DSSG 4KDFA 3DOCA 3ZWMA 4R51A 4TSKA 3U4CA 3PZBA 4QO7A 3VH4A 1YBVA 5JY6A 1M66A 3CIFA 1I5RA 4NFYA 1P45A 2YQ5A 3NJ8A 1H94A 2Q99A 1U8XX 4NQZA 2ZB8A 1JVSA 3LSYA 3ULKA 4E2WA 5B1YA 4WGGA 5TF4A 3RUAA 2WSBA 4DMLA 4CODB 1O94A 1ULUA 3TZ6A 1MG0A 4DIOA 2CNBA 2VTDA 3ZU3A 2VRBA 3PHIA 4ND1A 3PRJA 4GWGA 1I3KA 5C5IA 4QSMA 4BO9A 5DF1A 3ZW8A 3P2YA 3OJ0A 4D3SA 1PJ4A 2EWMA 1A4UA 1JAYA 1D8AA 4MVJG 2O2SA 2V65A 3BMOA 1DAOA 3ZV5A 4F6CA 3LF1A 1YONA 3V2UA 1A5ZA 1DFHA 4EBFA 3ZDFA 1NQOA 2ZB7A 4KUEA 3BA1A 4EJ6A 3BHIA 3L77A 1YB4A 1X7DA 2Z1NA 4GI2A 4TRJA 4Y67A 5FI5A 4BV9A 1PQWA 4YAJA 1FDSA 5F5NA 5G4LA 4BUCA 4URFA 2G17A 4BNYA 1EQ2A 3WG9A 1TI7A 1NFFA 4E5PA 1P74A 4H16A 4I8XA 4QTZA 5JDCC 1NXQA 2VYNA 2WTBA 1WVGA 1A27A 3O8QA 4E5YA 3FNFA 4RDHA 3RUCA 4E32A 4DXHA 5A9RA 5COBA 3U62A 2Y1DA 3QQPA 3DBLA 4PLPA 4L4SA 3ZV4A 1NFRA 5KVSA 1XDWA 3EMKA 5TC4A 4LSMA 3C7CB 5TSDA 1M76A 5T64A 5TT0A 5ILOA 3ZU4A 1U1IA 4K1LA 1I2CA 4BGEA 3RUFA 5C7IO 3UCEA 2I76A 4NFHA 4N5MA 4D44A 5G0UA 2YJZA 4YB8A 2ILTA 3CZRA 4M89A 4YRBA 2OGUA 1QYVA 3E6AA 3LT4A 3FR8A 5A9TA 3JQGB 5DOVA 4UUNA 1YOVA 4D3FA 1LSUA 4MIYA 1R0KA 3U4IA 3SEFA 4XJTA 1F14A 1X1EA 4YT4A 3ZV3A 1DRUA 4P22A 3AU8A 1Q7CA 3AOGA 2NVUB 2VHZA 4OXNA 1VRWA 4NMHA 3DXFA 2Q1UA 4LCEA 4LVCA 3IUSA 3CKYA 2DTEA 2PZJA 4CLRA 2FOIA 2IYPA 1YL6A 1I32A 3LT0A 4XYBA 3GEDA 4GH5A 3F6YA 3QLJA 2FMUA 3L6EA 4GX0A 2GLXA 3DZFA 1N92A 3G1UA 4RVSA 5KVVA 1P1JA 1R66A 1G1AA 1MB4A 1CERA 4D0SA 3H9GA 3R3JA 1X7GA 2AQIA 2IZ0A 2GN6A 3AUTA 3R6DA 1U5AA 2AA3A 2NWQA 2NTNA 4IDBA 3AFMA 2RHCA 3PHLA 4E5MA 4ALKA 1EK6A 4E4YA 3QRWA 4M87A 2VWGA 5L3ZA 1E92A 4CMGA 4II2A 2Q2QA 1QXSA 2HK7A 2PZLA 3NDRA 1WLYA 1HDOA 4EJMA 4IUYA 3RC1A 3AY7A 4RPKA 3T7EA 3E8XA 1YH3A 2W98A 2VHWA 4R3NA 4IXTA 3RWBA 1KEWA 5A1TA 2AXQA 3HB5X 1BMDA 3FNHA 1ZVMA 3GC6A 1ADFA 2AQ8A 3LYLA 3ABIA 5MDHA 1Z7EA 3PDJA 4Y98A 3NAQA 3OIFA 1LC0A 5B37A 3JQBC 1DAPA 1XR3A 4U6QA 1NQ5A 1ENZA 2EGGA 5JC8A 1UZMA 2NTJA 4ZHSA 1ZBQA 2BELA 4PLYA 2ZTVA 3MTJA 3S2FA 2EF1A 4ND4A 4AL4A 1F17A 5KTKA 1VSUA 2GD1O 3WNVA 2DPHA 4EUEA 3PVZA 3ZNPA 2OZPA 3DZKA 3DQPA 1PJCA 2ZTMA 5JY1A 4WLOA 1ZUD1 2AMFA 1B8PA 2GYYA 3GN1A 1B2LA 3PHJA 4XDZA 5T67A 5I9MA 1EBUA 1NP3A 1Y9AA 3HDYA 1NHGA 3ZWCA 5FWNA 4DIFA 2Q45A 4YJFB 1QYDA 4J0EA 1KETA 1GYRA 3U4HA 1S6YA 4O6VA 2DFDA 1JDJA 3VVBA 5F5LA 5JDIC 4BNZA 4DIBA 5BR7A 1OC2A 4FC6A 2PZKA 1SEPA 3DHNA 1VI2A 5T5QA 1FXSA 1X0XA 3AM4A 1HSOA 2DBRA 1KBZA 4TROA 3GVXA 5L51A 3BXXA 1D7OA 2VTEA 2YFQA 3B1JA 2GPTA 4H15A 3LK7A 6ADHA 2EJVA 3BMNB 3TDKA 2JFGA 3BAZA 4I9NA 4CQMD 3PWKA 2DTXA 2HRBA 3WMXA 3GLQA 3F5QA 4XQCA 3JQ8A 4BNLA 4RO0A 2VHXA 4YCAA 1GEGA 4K6FA 3O4RA 1A72A 1VE9A 4MDHA 3FBGA 1YJQA 3GNSA 1MX3A 1I33A 1I24A 3RFTA 4ESOA 4FFPA 1OI7A 3NKLA 1RJWA 1XU7A 2OOSA 4CM4A 3WS7A 1O9BA 4YJHB 1TT7A 2JCXA 2WMDA 3H9JA 4UEJA 4CLOB 2NV6A 1XYGA 2Q4BA 1VSVA 4YPOA 3X2FA 2HK8A 5I7EA 4GX1A 2QRKA 1R15A 1FDUA 1ONOA 2VHYA 4BNIA 3TSCA 5EQDA 2X4GA 3DAFA 4OGWA 4LRTB 4WJZA 5LCXA 2B4TO 4LN1A 4J2HA 4ND3A 2CMDA 4BO2A 3BTOA 1K2WA 2CF6A 1E77A 3LZ6A 1M6WA 3N58A 3RBZA 5L7TA 3O9ZA 3HSKA 4RV9A 2B0JA 1E3SA 2X86A 1JWAB 6LDHA 3IDSA 3DL2A 5FEUA 2WWRA 4KTVE 3AWDA 1P3DA 3PFFA 2BFOA 1U3TA 2HMVA 1HT0A 1T1SA 1BRMA 1E3EA 3Q3CA 4C7KA 4CMKA 2UYYA 3GPIA 1VJTA 3CMMA 3KLPX 2QYSA 5DCYA 1E3WB 2X9NA 1IZ9A 3QWBA 5GMOA 1K0UA 3VPSA 2NQTA 5EIOA 3BHMA 4Q39A 2DBVO 1Y8QA 2R6JA 1MGOA 2YHIB 4D46A 2CDAA 1ZSNA 4CUZA 3VZRA 1F06A 4ZICA 3VPFA 3WLEA 2LDBA 4OJNA 1TXGA 1LEHA 4CQLB 1T2DA 3UCFA 1O89A 1GR0A 1QSGA 2VZ0A 1PJ2A 3GMSA 3WBFA 3AM3A 2OP0A 1O0SA 5B4UA 2VYVD 1TLTA 4EITA 3U49A 3CTMA 2NVWA 5BQFA 4DWVA 2HJRA 3TF5A 3BIOA 3JQ7B 1C14A 4XB2A 2Q3EA 4RQUA 3KOUA 1PIWA 3K31A 1YB1A 3LT1A 4J1QA 3ZNNA 5ITVA 5L4LA 3GA0A 5DP1A 5KJFA 1GAEO 3DMTC 5I8ZA 1UZNA 4DRYA 2Q2WA 2D8AA 1SCUA 2JD1A 1HE4A 2WJPA 3A14A 4BB6A 3MOIA 2OUIA 4PCVA 4RDIA 4WLNA 3S2IA 4NZ9A 4BNJA 3JV7A 3LQFA 4IJUA 1DBVO 4JCOA 1R12A 3M2PA 4HY3A 4CLDA 3HZZA 3KM0A 5JAQA 4NJMA 4CLHA 5A05A 4M49A 3RI3A 5A04A 4ZQFA 4XRGA 3GY0A 2ZQZA 4F45A 1HZZA 2I3AA 2YDXA 3H5RA 5TRTA 2P68A 3NGXA 4NI5A 5G0WA 2OO5A 3BMOB 4BNXA 4RJTA 3S8MA 1Q0LA 1W73A 3SLKA 1YQGA 2FZWA 4MOWA 1HEUA 1XSEA 4MO2A 4FGSA 4KZPA 1PS9A 5JNLA 2NADA 1LQUA 5IN4A 3PHHA 5IG2A 5F1KA 2HUNA 3K30A 5G0SA 1ZK1A 2D4AA 1ZIDA 2O2YA 2Q1WA 2Y05A 3S55A 3I9NA 1OC4A 3KBOA 4UVEA 1ZSVA 3DB2A 1JU9A 1PS0A 3AOEA 3D5QA 3OHSX 4NH4A 4XEHA 5DZSA 4RVDA 1IL0A 3PQFA 4KMSA 1P1HA 4XR9A 1XHLA 1PJBA 4MPDA 1JTVA 5LC1A 3T4XA 2X0NA 1LJ8A 2YZ7A 4IY1A 1F12A 4A10A 2CUKA 3PGXA 3KYDA 2CVQA 4Z3DA 3JQFA 1EE2A 3WGTA 4UUOA 4GSKA 3GK3A 1KVTA 2B35A 3K5PA 1NVMB 5T73A 4WE3A 4KUGA 3DDNA 3TJRA 1JQBA 1PQUA 1WDMA 2W2LD 3JTMA 4YRAA 5CAEA 4Y6RA 1NNUA 5CEEA 3H5AA 3IJRA 3PJDA 1Y81A 2PKRA 2VWPA 2EEZA 3NTQA 1M6HA 4W7HA 3C3XA 3WGHA 4E30A 3ZZNA 2GGSA 1DC6A 1ZFNA 1GQQA 4ZQEA 1K6XA 4R68A 4BNHA 1VLLA 3E18A 3I52A 5HWSA 5EN4A 1IUKA 4N54A 1PZGA 1I2BA 3O38A 1ENYA 1T1RA 4BGVA 2E49A 4YJDA 2W2KA 4BL5A 1U8FO 4O0LA 2NQ8A 1O8CA 2D2IA 3BHJA 5KOIA 4RCVA 3W8FA 5ER6A 3ZWVA 1N7HA 3AK4A 4CJXA 4E12A 4WNCA 1T2CA 2B69A 1DIAA 3L9XA 5HS4A 3GFGA 3K92A 2WD7A 3M1LA 1O95A 1U3UA 4PVDA 3UW3A 9LDBA 1NAHA 4K9DA 1R0LA 3EZYA 3MJTA 4CQMA 1LRJA 2XF8A 3BMQB 3MEQA 1LI4A 2V6MA 1VPDA 3FI9A 1LX6A 3DMYA 1PGPA 2PFGA 3UVEA 1GEEA 4IXWA 1GZ4A 4UVDA 4N5NA 4J3FA 1U5CA 4I1IA 4C7JA 2AQHA 3WGGA 2QZ9A 3I23A 2IE0A 1YRLA 2NTVA 4YT8A 5M6DA 4FPXA 2PH3A 2P4QA 4GGPA 2FY8A 2VOJA 2DFVA 2O7SA 4YAIA 1NVGA 2SCUA 1E7SA 2EW8A 4W9NA 4MVJH 4G2NA 4P8RA 3KB6A 3RBXA 1XLTA 3GZNB 3IUPA 4CPDA 2QRLA 4I5EA 2NNLD 5A9SA 4ONEA 3IAHA 3WNQA 3DBHA 1LRKA 3GN2A 4DREA 1DC4A 3E1KA 3WGOA 3TZHA 1EFKA 2O3QA 2X0IA 3S1LA 3TL2A 4LISA 4HV4A 1PGQA 4OOFA 4DYDA 1ML3A 1LUAA 3WQRA 3NRCA 3VAZA 3PLNA 1MC4A 4BOYA 3INRA 1XELA 4DQXA 3ICPA 3INTA 1YS4A 4MKZA 4FS3A 2X0JA 1YJ8A 3FNEA 1PJ3A 3RFVA 1HLDA 1TVEA 2J3HA 2GN9A 3KLMX 3D3WA 1KOLA 2GZ3A 1GCUA 1DIHA 1A9ZA 4L74A 4N5LA 4XB1A 3F3SA 3KSUA 1CQJA 3KO8A 2DVMA 3K9QO 1C3VA 4R1SA 1L7DA 4BMNA 3I6QA 2XXBA 3P7MA 2PK3A 4JJGA 5AYVA 1PZHA 2VYVA 1BW9A 1BHSA 1XU9A 3TZKA 1X0VA 4PLZA 2OBNA 2W4QA 3VC7A 2QW8A 3QA9A 3AI2A 4DVJA 4I9HA 1B26A 3ZWBA 1RWBA 5K6AC 1LSJA 1LDBA 4MVJD 5JAZA 2Y1FA 4QXMA 1ADGA 1LLUA 2ZKLA 2J5KA 3H8VA 1GZ3A 1B7GO 2NSDA 4A2CA 4DTIA 1C1DA 4CMEC 5CG1A 1R4NB 1HWYA 2CVOA 4OAQA 1CIVA 3QVWA 4MIEA 1FJHA 1P0FA 4J7CA 3WTBA 4CL3A 1LSSA 2Q1SA 1DO8A 1KYQA 3AI1A 3V1YA 3LLVA 4S1VA 3QVXA 1ZSYA 1TT5A 4YVFA 3RKRA 4YJGA 3LU1A 4XGNA 5FF9A 2HRZA 3VVCA 3AY6A 3H65A 3QVSA 2PGLA 3EVTA 4J1SA 2W8ZA 3ROPA 3V2GA 1BSVA 1Q0HA 1NPYA 3QWIA 3QWFA 4Q9NA 2CSUA 4BKUA 2JCYA 3B70A 4OYRA 1KY5A 2J8ZA 1QR6A 2EKQA 3KEQA 4WECA 5B4TA 5KJCA 2QQ5A 3DZHA 5A3JA 2E82A 4NR0A 5TJHA 3X2EA 1VC2A 1JLLA 3KYCB 5DT9A 3HADA 1RM5A 4E0BA 2JD0A 1OMOA 5AVOA 3SXPA 1BXGB 3IKTA 4HUJA 2VHVA 4YT2A 2QYTA 1PZFA 3UUWA 4YYZA 1T24A 3H4VA 3DOJA 4LGVA 1LXCA 4OXYA 1EUDA 4J2OA 3ZWYA 2PWZA 4CUJA 4OQZA 4MVJF 4RVHA 1ZEMA 5ITWA 3RROA 3L07A 2BLLA 2IODA 4LW8A 5AOVA 4JLWA 5JE8A 3VKVA 3I1JA 3COSA 2X23A 1ZMTA 2FN7A 4CLXA 2HAEA 2HMSA 5L40A 2VUUA 4MVJI 4FOOA 1Y5MA 1G0NA 1Y9EA 4TRMA 4E2XA 3OH8A 3I3OA 1EUCA 4QFDA 4XDYA 4IDAA 3DR3A 3MJ4A 4XYEA 3TPCA 3ANMA 2W2LA 4OQYA 3U09A 1YBMA 2DKNA 4NBRA 4HBGA 3PXXA 2FRDA 5C7LO 4DPKA 4MJLA 1ZZEA 2AE1A 3EY4A 4FBGA 2EXXA 4IJWA 1XIVA 3G79A 1BWSA 1W8DA 3BMCA 4CLEA 1D1TA 3RCBA 1GZ6A 1YO6A 1U3VA 3F1LA 3VOSA 4R5MA
chains in the Genus database with same CATH superfamily
4DUPA 2OG2A 4B3IA 1I36A 5TPZD 4XLLA 2C9DA 4AZ3A 4DV2B 4A6XA 1U3GA 1U0NA 3LLUA 4GI3A 4BQEA 1BS9A 1SZCA 3GJ5A 3U4DA 4GKKB 4M0PA 1X9IA 5JT1A 2BFEA 4YAOA 5I5EA 2TMDA 3H1PA 3LKDA 1X14A 5JWOA 1VSBA 4I5FA 4IQGA 1WM1A 4ECAA 2DSNA 4WACA 2F43B 3HGTA 3I64A 3OTOB 1YDGA 3NYIA 5P21A 3LTNC 4JZYA 2KPOA 4LSGA 5J58A 2ACEA 1JB1A 4O5OA 1VKOA 2GM5A 3QUQA 3TM5A 2AR7A 3CUWA 2IUYA 1NR1A 3L05A 2UU9B 4RF3A 1Q5PA 1YACA 4J0CA 10MHA 2D0DA 3UK6A 4YMTA 1KOFA 3H0EA 1E9BA 4JJ4A 3PYMA 4X00A 2C2YA 4AFNA 4I1RA 1ZM4A 5IKXA 4IS2A 5JAIA 2H2AA 4OVKA 3C97A 5CFLA 5KPDA 1NI4A 1XLUA 2FX3A 4BUJA 1E1RD 1XQVA 1SG9A 4Q93A 2V1XA 2ZPUA 4D82A 1ETHA 1UQTA 3ZHQA 3WYFA 2X5KO 4XCVA 1M75A 4XB6B 2AH5A 1YR3A 2A9QA 3ANYB 1YCGA 2XUKA 3K1ZA 4IFIA 1Y8AA 4XLZA 5ISMA 3D4NA 2Y0BA 4K87A 3EY9A 4UVHA 5K2MA 4EMUA 3N0TA 2YQZA 1H23A 3UXMA 3V5NA 4EH1A 5JUWA 1Q0QA 3ZCPA 3KU1A 4PN3A 3EEFA 2ZK7A 2QI9C 1EXDA 2WD8A 3L49A 3UPTA 1BD4A 4R0MA 3DLHA 1B3BA 1GY8A 1YBHA 2OV1A 2OFOA 4HH0A 4L6IA 3RVPA 2EG9A 3ZVRA 4CE6A 1CZHA 2Z2XA 4CM1A 2G6TA 1BXKA 3COZA 4P4SB 2JAUA 3L0SA 1RQNA 5C81A 1Y8RB 2A0WA 2QMHA 3GRPA 4EA6A 1SXPA 3GEMA 2C61A 4IZ6A 4F1WA 3NIWA 2Q5EA 4P53A 2JGLA 5REQB 3ZYCA 1ZBDA 4ZQBA 4D79A 1V9SA 4UMEA 5SZHB 2QL7A 4XGIA 4A4DA 3GEPA 4KQ6A 4R1NA 2O8DA 1UIMA 4UNSA 3VAAA 5JNSA 3L0BA 5GVRA 2E4XA 2Q9UA 4XX0A 4DCUA 1J2RA 2HBYA 5CAEB 1AXRA 1UXOA 2CY0A 2UUCB 2BHSA 1I0IA 1KBQA 4WCDA 3IJ5A 2C9CA 2V0CA 4WHMA 1ZCZA 5FORA 1BGWA 2W0SA 4S0ZA 4D8YA 2CV0A 3U61B 4WERA 3IP5A 4JWTA 3GDWA 4IF4A 2FR8A 2EGHA 3O73A 1L5KA 5FO1A 3RS4A 1YVRA 1RACA 3AESA 1DJQA 2ZE5A 4NENB 4P4NA 4GMGA 2VWHA 2RFLA 1FFCA 3IEKA 2AG6A 4NKRA 1IJBA 3OZDA 3OFJA 1E1CB 1DEAA 3RFFA 5KNLA 2CL7X 1KJZA 1GLGA 1NQXA 4X9XA 3WOHA 5CA0F 2ZRFA 1PGNA 4WASA 1CZNA 1I3LA 1Z5GA 1EWVA 2DZDA 3EZ2A 3FPGA 3G88A 3LA8A 4GSYA 4KVAA 5H83A 3WJ2A 4DLLA 3GT7A 4FR5A 4ASUD 4BNMA 1XZIA 1JDPA 4RD3A 1QGZA 1TM5E 2RHMA 2ZT8A 1YFKA 4GP6A 1QHGA 3KQNA 2BEVB 4L9RA 3ILYA 2BGIA 1SZPA 3WGZA 3EH2A 4I1UA 2BCEA 5EINA 1Q83A 2HM7A 3IJPA 5GJVC 2XF2A 1P9LA 1KZ6A 1LTHR 2G4LA 2WB4A 3QOWA 5C31A 4B31A 2GM4A 3LF2A 3EK2A 3I2IA 1IWBB 2E48A 5I51A 4LXHA 2GF9A 3HWRA 4XXHA 4YI5A 5B53A 3HB7A 5MFZA 2RSLA 4MVJA 5FHRA 1U7ZA 1AHPA 3W4JA 5CIQA 3VSEA 1DHTA 3RU9A 4H17A 3ZGVA 2H63A 5HCUA 3F4LA 3OFNA 2ZCVA 5F2EA 1XMJA 1TADA 4XD7A 2Y68A 5HIKA 1WCIB 5BOSA 3CZ9A 2QVBA 4NV0A 5JSFA 1PGJA 3I42A 5C4GB 1JA1A 2AZ4A 3SC2B 3RC9A 2XQGA 1SXJE 4EIWA 1RWOA 3VPBA 3PQDA 2K87A 3PF8A 2PGJA 2D5CA 2D54A 1GTL1 1SULA 2Y71A 2ZETA 1PJSA 3KSRA 3M6IA 3DEJA 4KNVA 4C6SA 4L9WA 3N8HA 4X3OA 4OP1A 3Q9NA 1DNPA 3T1YB 1J21A 1MLDA 1G6KA 1QWOA 2FMIA 3O4JA 3PI7A 1CU1A 1WHSA 2A9KA 4CM9D 5ICMA 1PV4A 3FYSA 4O2AA 3GJ6A 5HPYB 1G3RA 4Q4HA 3L7AA 4BNUA 4HX5A 2JRLA 3B2NA 4YCSA 3N2YA 2AKAB 3R2JA 4DSAA 9GPBA 4QXPA 2PRZA 2YW2A 1ADBA 2COUA 4NBUA 1EWQA 3W0LB 1PZMA 3FWYA 3FUCA 3KZOA 4IDPA 2WTAA 3RIYA 1W7AA 3RRZA 1GZSA 1ZMBA 1ARZA 3STVA 5FTLA 2Y93A 4PG8A 3IODA 4QYIB 1IFXA 2DT8A 3LXRA 1A96A 5JSYA 1USKA 3CVUA 4IIVA 2ZWOA 2QD5A 3Q85A 3GZ4A 3BWMA 3AILA 3M82A 4GOJA 4LMAA 1DWPA 3DONA 5ALWA 3UQZA 4MHSA 2XWPA 3TDNA 2H59A 4P7FA 4CMIA 3AFIA 5K8IA 2RGRA 4YCCA 4FFLA 1K6JA 1ZP6A 4JKOA 2FWRA 5K0JA 2YJ5A 2CUTA 4M0DA 3HCFA 2O4CA 3U31A 5HG0A 3R0XA 4TM8A 3D6FA 4QGFA 3A4TA 4U4AA 2ANBA 1YK0A 4G81A 4AX8A 5JBNA 4P5EA 3KV1A 3T3MB 2KWIA 3ZNOA 3I9OA 4OREX 4IGEA 3ITDA 2O23A 1YJ5A 3UAXA 1MABB 1KMMA 1LZKA 1RAFA 1WSDA 4QU0A 1GNQA 1YI1A 1LLDA 4Z0NA 2XCOA 1T26A 1E69A 1XI2A 2FA9A 4X91A 2E5LB 4A36A 1KMHA 1P81A 3IUJA 2PUWA 3OLQA 4AZTA 4JI2B 5FADA 1V6AA 5FJJA 3G59A 4MINA 2ZBEA 3RJMA 3BA6A 1AGXA 4HCJA 2Z3VA 1AA6A 3AR3A 1JEEA 1TGVA 1CUIA 4AJ2A 3M9LA 4F21A 3OEYA 2IYSA 1E2QA 5EAIA 5LMUB 2IIPA 4KTTE 4URVR 3PNKA 5K3DA 4DA8A 3LUAA 3C4VA 2Q6IA 4IKPA 2VSNA 4FW9A 1ECCA 4HH3C 1X7YB 3CJTA 5LDGA 5FH9A 1JSRA 1Y82A 5B1SA 2YJ6A 1RT9A 4P35A 2H1CA 1HDZA 1KYWA 1UAYA 1A0OA 4MO9A 4ZVSA 4O29A 4D80A 2UV8A 3T4UA 2PX5A 2ZEJA 3X0DA 1DAFA 5LQKA 4AMUA 2FR1A 5EP2A 5AM4A 5C4MA 4FE3A 5C37A 2ZRLA 4QJ4A 2VJLA 4JEIA 1GPUA 1K7YA 5EY5B 1G4AE 3QE4A 5EIBD 4GL2A 1F0NA 3QKIA 2WB2A 1U8UA 2CDBA 1FIUA 1YU9A 1DHRA 2GO1A 4XRRA 5TPZA 1KQ3A 3SEZA 2HSGA 1M33A 1P31A 4M0CA 2R97A 1L5FA 1U0OC 5C5CA 3IDQA 1ZIYA 5LUAA 1GZUA 1Z4PX 2ZR9A 1AKRA 5K4AA 2I3ZA 3WHKA 2W0MA 3FF4A 4K9PA 5BY2A 4TV8A 5JS1A 4LZJA 4JR2A 2PTGA 4F6LA 1NV9A 2OXFA 1P8AA 3K2BA 1QRDA 2QJOA 3D02A 4CGZA 1W6UA 1W6RA 1CRPA 3WK8A 2JCBA 4ZYYA 4C89A 3F7MA 1IXKA 1IUNA 1XCMA 4ZQHA 9MHTA 3AOEC 4D4HA 1PJZA 1SR8A 3GJ7A 4IJ5A 5IH7A 4BZXA 4L9AA 5AFSA 1JT2A 5C46F 5JQWA 2IYYA 3MRVA 1EGHA 1E1RA 3GJRA 2MJLA 2C3OA 3NUQA 3T0FA 3OI7A 2ONKA 3FWKA 5DHUA 2IUEA 4DAEA 4DGSA 1CG6A 1A9YA 1PSWA 1ID1A 3H2IA 4KBFA 5TQVA 3TFQA 3TN7A 1BQ4A 1UBKS 4AZSA 3JYOA 2D7JA 4O1MA 5C0OE 4EDFA 1DIOB 2Q3LA 2NUPB 3OMLA 4OIMA 3RGGA 4CEHA 4WINA 1GHTA 1LI5A 1SH7A 2PRIA 2XR1A 3NEPX 3CZAA 5K8TA 1P7YA 4AJOA 2RE8A 2V9ZA 3VRHA 3NMUF 1T5BA 2L18A 3FPJA 1T9ZA 2ZJ6A 4FJ2A 4Z9FA 5AHXA 3RD5A 4PONA 2GS9A 1YVEI 1E5TA 3AVOA 3KQSA 4NE9A 5COAA 3ZKAA 1IG3A 4GICA 4MGIR 4YY3B 1MO2A 1RADA 1YS6A 1SBYA 1UT6A 1ZJYA 2P65A 4MAFA 4QULA 4EB6B 1AK1A 2Q8NA 2CHGA 1T8YA 2BLNA 3P45A 3LWZA 4B74A 3ILHA 1GA6A 1Y6GA 3RJTA 3ZD7A 3BRCA 3CEAA 1MU0A 4R31A 3V7NA 1NW3A 3CLUC 5GOZA 2N42A 4Q47A 3SHTA 3QSGA 3SDBA 3G1WA 1XVUA 3M89A 1UC8A 4LSWA 3EA4A 3KB2A 4RKFA 4ZCSA 4PZZA 1NJ8A 1P2TA 4PW0A 2IITA 2P2NA 4LXGA 1UP6A 3W2IA 4WLFA 1JQEA 4NECA 1N9KA 4N3AA 4URHA 4BMSA 2IXBA 2P0YA 1Y4SA 1XD9A 5CDGA 3KCNA 2J0UB 3BMCB 3IOYA 4F4FA 2R8ZA 3A27A 3DHYA 1IN6A 4FBMA 2HWYA 5A4AA 1HDXA 1BEEA 1NR7A 3JPWA 4PX3A 1GPLA 1L3CA 1MP0A 3EF0A 2YUTA 5IC4A 2FZCA 1BGVA 5JW6A 4PZ9A 2ZBFA 1NWHA 3RIGA 4D9KA 2EU8A 3EOAI 3UGKA 1FZQA 4QNRA 1NVVR 4ASUA 3D43A 4AJKA 3W9UA 3ESQA 4HXYA 5CLIA 4G5OA 2DC1A 1HE1C 3FGNA 3IGFA 4L76A 3ZQUA 1Z75A 4QATA 5D3MA 3CYFA 2TMYA 1EFVA 1YAJA 5T8KC 3RF7A 2DU8A 3RTDA 2BFCA 2G0AA 4H60A 3TIGA 4KU4A 2OYRA 4CBVA 1Y0BA 2VL7A 3ET4A 3KPUA 2W5UA 3CONA 4CL2A 3PVSA 4O4HF 1F2UA 1V41E 4L8YA 5TVKA 3EMVA 1N2OA 3U3MA 3HABA 2QLBA 2B1JA 3IS3A 3RIEA 5FAXA 2B4KA 4ZJZA 5DHQA 2XXAA 4Q1VA 2MYUA 4YI3A 1DDOA 2A84A 2OENG 3Q0IA 1FJXA 5FNVA 2WI8A 3IWDB 4P3YA 3N86A 3CXRA 1KSGA 4O25A 2G9NA 1I01A 5DX0A 5CBPA 1NMSA 3C3WA 1J5EB 2JH9A 3IR5A 4RMHA 1A71A 3FETA 4FFMA 3GT3A 1PWXA 3ENNA 2VRNA 3CG0A 4L02A 4LHYA 4KJXA 3T0GA 4EJSA 5J2TF 4W82A 4P98A 1G8AA 1P6XA 4CXMA 3W3AD 4MRMB 1ECFA 1U0LA 3GRRA 3T94A 5JZOA 1GYPA 3NPMA 1K8RA 3RE1A 3VNBA 4PLVA 4CM9A 1V5EA 4N8EA 2JLYA 3D8RA 4QDXA 4PC7A 1JIUA 4EFDA 1WUYA 4FFBB 4IIFA 2UAGA 3FDXA 5IJXA 3K53A 3JSXA 4NJEA 4P3KA 4PINA 3RQSA 2CNWD 2OAP1 2HQBA 3ZN2A 4N0PA 4A0RA 4H18A 5IANA 4FMBB 4P58A 4I08A 4OI4A 2XTJA 4G5SA 3GRZA 1QG4A 5KEIA 3A3YA 3I12A 1SHKA 1SVSA 3UW1A 5KKNB 1Y4ZA 2ZIVB 4DCOA 5G2OA 3W34A 1XK7A 2CLSA 2Z9CA 3SCZA 1KP3A 1TU3A 4OEHA 2AE2A 3T6KA 5ILGA 4J3NA 5A4JA 3FCOA 2QD3A 3B1KA 2HPVA 1EFHA 2GD6A 3DSRA 5KYKA 1V3QE 1OVMA 3ONWA 4D7AA 2QTAA 4BWFB 2Y77A 5T57A 4RSHA 3WLKX 3H1GA 1QFJA 2B7CA 1LGYA 3GP5A 4GKVA 4Z4IA 5H82A 5KTNA 1S2LA 3R09A 5IMBA 4BVLA 3QFCA 2H8GA 4ZYTA 1HL3A 3EC7A 3JYLA 4EPTA 4KR7A 3ZHZA 2WWWA 4D26A 3CKMA 3JD2A 2I99A 5KNBH 1T0BA 5CB8A 1N5IA 5JSUA 4ZVUA 3TRJA 8LDHA 4KXLA 1PSDA 3P0IA 1H2HA 3HNOA 1VL0A 1IQPA 1J0CA 2FZGA 2QV0A 2RCYA 5AXAA 1GCOA 5FOSA 1S8OA 1E6CA 1VCIA 2VNSA 3QOFA 4N6OA 3TLMA 4EEKA 4CKWA 3A11A 4ZVVA 3UG6A 2WHPB 3BB3A 2XVAA 3ZDQA 1G2QA 1AKWA 3K1JA 2DUWA 1UBGA 2DBQA 3E84A 4UBIA 1STOA 1V2HE 2PSHA 4YBZA 4Z9AA 3UKJA 2ZRKA 1CYDA 2QLJA 2BZGA 3WA6A 1MH9A 4FMCF 3CLRC 4M1WA 2DWPA 5ARDA 1OAKA 1G5FA 2BP7B 2AEJA 3K6JA 4JX9A 5EZ5A 5T4BA 3Q9SA 2VQEB 1XRNA 2XNJA 4LOJA 3UENA 1I1OA 3SYMA 4EK9A 1EZ4A 2YIMA 3QJGA 3V1LA 4PLWA 2P35A 1P0CA 4EGJA 4X1YA 4V0NA 3E7FA 4DXAA 5HF8A 3C87A 1ISGA 1F9EA 2DLDA 3ETHA 5DHSA 1Z08A 4MYTA 2AD1A 2W6ID 4D43A 2IF2A 4S1TA 1QH0A 1GTG1 1NUQA 3GMIA 4JLJA 4MX8A 1RI2A 4G8BA 1U2DA 2P9YA 2CV2A 4Q7MB 1QC5A 3HR7A 4N9QA 5EMLA 5A62A 1YQTA 2JGFA 4MR7A 3ZLVA 3HKBB 1IY1A 2YV3A 2ZJAA 3Q3VA 4RVUA 1V25A 1RRVA 1O54A 1YJXA 3FVWA 3K9BA 3OZBA 4IHJF 4RGBA 2QJRA 3QVJA 4IQ4A 5JNRA 3DDWA 1WCV1 3MTEA 2PS0A 3GPDG 5AVJA 1G18A 5LP6C 2F64A 1A97A 4E2FA 4AVYA 3S2YA 3CZ5A 2G0TA 3LO5A 2R6AA 3U7QB 4TVBA 4BO4A 3L6DA 2PM8A 5CLLA 3ZW7A 4DJAA 5IT9A 3CS3A 3OPVA 4PZUA 4NDNE 1W52X 4MITA 5KNBD 3BFJA 3T1QA 1QDLB 1YHYA 2FEKA 4YRLA 3OSUA 2C00A 5KYXA 4EQ6B 1COZA 1E62A 2IPNA 4UHFA 3TRIA 1DFGA 2QZZA 3L46A 2AFHE 5DW0A 3GFTA 1WKBA 3BMNA 1WBBA 1BJKA 3BPSA 1ULHA 3P2JA 3W8EA 2PUAA 4KBYA 3LFUA 1BVRA 3SJBA 3WFZA 3NP7A 2VJPA 2O8CB 1Q16A 1XZPA 1SRRA 1UKAA 1DL5A 2RK6A 2XGGA 4L7VA 3D0QA 3OCCA 3LIIA 4XJXA 1JFVA 3AP1A 4WLVA 4BFCA 4COKA 3EISA 4Y2GA 1CJMA 3C39A 2GERA 4IX9A 4RHYA 4FCVA 1VA4A 1NURA 4MJ7A 1PEDA 1A9QA 1Y5IA 1KBOA 2JFBA 3FCAA 3CY6A 4GQAA 3M6LA 4MH0R 1OF1A 1AQNA 2VC2B 3KWLA 2ID4A 4C4YA 1BQEA 3BSFA 5TEVA 5F4BA 1N6LA 2E6UX 2X9VA 4GM1A 4C3ZA 4UD6A 4BMPB 5KX5A 4KVGA 4U2DA 1Z0KA 3PSAA 5HGJA 3EYWA 4XFDA 1Z06A 2GF0A 3BTVA 1N7IA 3TTSA 4U9IS 4R6XA 1L7VC 3PYXA 3DT6A 3MCUA 3JQDA 3OQBA 2ZM5A 4BX9A 1RWQA 1FLNA 2HY7A 4JUFA 2YC2C 1SVMA 1NXXA 4DLUA 3DP7A 3HK2A 3FUVA 3C8DA 5JH7A 2FFJA 3EXG1 1W35A 2H4HA 4FXPA 3FN4A 3PJEA 2GPYA 1P7PA 4V0ME 1C81A 2IT1A 4EUEA 1XCBA 3IO3A 2O8EB 2HF2A 2QTNA 4I36A 1TA4A 4V39A 1FFXB 2AW3A 2AZXA 4D9IA 3G9ZA 1EE9A 1U1EA 2CLIB 4MIOA 3OD5A 3PC8A 1TKCA 1IYZA 2R1UA 2V54A 4G9EA 1JFRA 3OQHA 4PSVA 3RS7A 4ARZB 3IEVA 2F1IA 3KCQA 4RJLA 3D8UA 4TKLA 3NW9A 4KO2S 4NY1A 2ZSEA 1L7MA 1GRQA 1ZQ1A 3MJHA 4BFSA 2I5PO 1UPFA 1E3WA 2XAUA 3E23A 3UGTA 3P19A 4Z99A 2QPOA 3GDFA 2HSZA 4N76A 4LBYA 3W5SA 1U4SA 2GI4A 4M98A 1AKTA 1KEEB 3IOCA 4WOJA 2R751 3TECE 1V35A 1X74A 4OB6A 4YP5A 1P7WA 5BR8B 2D5LA 2PLAA 5C1PA 1MB9A 3N05A 4DW8A 1LH0A 4LPSA 4EHIA 4G1MB 4CQLA 1X1TA 1GPMA 3UYLA 1FP4A 3NUGA 3B60A 3EJ6A 1YB5A 3D4IA 3ZY6A 4BO6A 4I5IA 3L6OO 3ZCUA 3A9SA 3HDQA 3IDFA 3ECAA 3Q8XB 1HYHA 3W78A 2V4MA 3MJSA 2DTDA 4J75A 1JR3D 3GLHA 2R9VA 3M6MD 5GZ6A 4GM4A 4JJIA 1TMYA 3NRBA 5LBTA 1JPUA 3FUWA 1NASA 3G17A 3BD7A 3VUEA 3DVRX 3W3AA 2NSLA 2KSQA 1R0WA 1EXVA 2FKNA 2AOUB 2RHWA 4LHSA 4EKDA 1H65A 4L78A 5AJXA 4LFAB 1XHFA 4MRVA 1FNMA 3QBTA 4DSNA 1NJ5A 1UXGA 1XT6A 4BMDA 1GSIA 1MO3A 1WLSA 2WSMA 3MJDA 4HGOA 3WR5A 1KDTA 3ETNA 2CNWA 3QG5A 1DOZA 2R11A 2WJ3A 3MWEB 2DEUA 4AKHA 4JC8A 4J6EA 3IXMA 3X1YA 3AETB 2NQ2C 2V55B 4QJBA 4NJMB 4UTXA 2QI9F 3F8TA 2CV1A 2NPFA 2RB4A 1MMFB 3ICCA 3A37A 2GEVA 3EGCA 3OTQA 4BQOA 3I5UA 4BQQA 4CMEA 2HQSA 4DS3A 2VJQA 4IDHA 1TQ4A 3FWZA 2Q5QA 2R8XA 3QEJA 2AFVA 1XTPA 3PYLA 5JPCA 3ZZ0A 3ICEA 1NDHA 2O2CA 4NBKA 4Y9DA 3BFKA 2J3IA 4QHYA 3KQTA 3B1ZA 2OHOA 4RZSA 2I4MA 1DDIA 4KH1A 3E9MA 2PT9A 3JR7A 2Q3MA 2BGKA 1ZJZA 4MW4A 3PHCA 5G02A 3AR9A 5ADHA 4DV7B 3ICWA 1X8XA 2R4QA 3T3DA 3GUUA 2WD9A 2ZT5A 2VJAA 2WJJA 3CH7A 1C4KA 2NVOA 2J87A 4GE3A 4GWKA 1UKEA 3MCVA 1L7EA 1X6VA 1VHQA 2OFPA 2PS9A 2Q5HA 3KWJA 4K6GA 5CX1B 4B71A 3D7KA 1N77A 3FRHA 2XUZA 1OOEA 3MJVA 4FMPA 1DEOA 5TT1A 3QWAA 5B7QA 1TQ6A 1JSZA 2QR3A 4OHMA 3FPBA 4AKSA 2EWVA 4B7CA 4BLRA 3L4BA 2Z83A 4INOA 2PUDA 4O4IB 2VK4A 2NUBA 1L7PA 3T5CA 4JJKA 1N3BA 3PUXA 4PYMA 5LOVA 2QMYA 3F6EX 3JWGA 5HUJA 4KO8A 4K9QA 3KKLA 1X19A 1QR2A 1BCRA 5C8YA 4RLHA 2OR3A 3USZA 2F3UA 2FJUA 1Z26A 4M8NE 2WOOA 5KYYA 3LRXA 3W7VA 2ZTLA 5DBHX 1BROA 1YSCA 2CSXA 1T0HB 4TMXA 3MBIA 3R5TA 3VNQA 421PA 4ZN6A 4Z4FA 2WKPA 2C59A 1Y1TA 3WGIA 2DT5A 3MCAA 5CDHA 3EA0A 1CYEA 3EQ7A 1KZ7B 5BYKA 2F4VB 4IH9A 1NAIA 4OB8A 1A5AB 2FWJA 1PTJA 5T6BA 2QT0A 3ELYA 3LBYA 2PNJA 2OCBA 3COJA 4YECA 4NATA 1G5HA 3RTCA 2Y4OA 4JNKA 3SSNA 2K4MA 2B5VA 3AR2A 2W6IA 3L8EA 2OMKA 4PEVA 1T9KA 3B9PA 3ZY4A 3L01A 5K7SA 1XZCA 1E8NA 1BU8A 2FETA 4Z4HA 5ALXA 3CVWA 4XR4A 3K1TA 4C4XA 1B0PA 2R1TA 1U9JA 1R8QA 3ZBPA 1OXUA 1F4VA 2Q7XA 2GK7A 2NU9A 3BTSA 5AVKA 4PR3A 3D8HA 2YWEA 3I8OA 4M8SA 3QOXA 4JUIA 4S1WA 4Y6PA 2JLRA 3PGJA 2P91A 1HYBA 2Z5LA 4F91B 5JJBA 4Z7OB 3AVQA 3BWCA 1JLSA 3HZHA 4M1KA 4YMWA 2QN2A 1OX4B 1T1GA 3JQCA 2JIQA 3OZRA 1GPKA 3K96A 2CNDA 3O91A 3QPUA 3UV3A 1XRSB 1EFDN 3SN6A 5KNBA 1H0KA 2ZVPX 3F6SA 4HRXA 3A1VA 1GA4A 2HU5A 3STXA 2VK1A 3K05A 1UOPA 1LLQA 2GLTA 1AMUA 1GZHB 1Q12A 1U65A 4HZUB 1KFJB 1WWKA 2A1IA 4PQEA 1SWVA 3WX0A 2BRUA 5C3MA 3B82A 3TTXA 3LCCA 4OPMA 5TS3A 2IDMA 2Q9BA 4QUAA 5AD1A 1G0OA 3A6HA 2GB4A 2PQMA 3V1MA 4R16A 5L9AA 4PAQA 3A4LA 5TVOB 1GT91 4ND7A 3MB8A 2A5FA 3V1TC 4DLBA 3SBDA 2R00C 1U7HA 2FG7C 3WY9A 5DFAA 2ZIWB 3T3EA 3WO1A 2ILVA 2AJTA 4GRAA 4LHZA 4FUQA 4QFCA 521PA 3FLMA 2KB0A 4D9HA 4M4SA 3CF4G 1H05A 4ZGWA 1PBTA 5H9VA 3U4QA 1EESA 1N6KA 5ADWA 3HJBA 5BV7A 4OHOA 3JVVA 2R1VB 5AW7A 1E0DA 2WF5A 1VDMA 1TF7A 4RJKA 3HL0A 1NQAO 1BN7A 2NLOA 2AG0A 2P5SA 3B36A 4KPUB 2ZI6A 3TVTA 2W9XA 1C3OA 4FFRA 5ALRA 1KYXA 4WKPA 2PX6A 3HMKA 4MP6A 3GPCA 3BF8A 3L7BA 4OHWA 1AZSC 2AN1A 3STWA 3LC0A 4BJ3A 5A7GA 1HC7A 3W7BA 1A9SA 3GZNA 3NQ41 5DISB 2XGOA 2OLJA 3PU6A 4XWGA 3H2BA 2WIAA 3VTZA 2JGDA 1F2DA 1T3ZA 5AKXA 4RPLA 1FFSA 3K0FB 4UDYX 3C45A 4M6WB 4PYNA 4RDCA 4JI5B 4D0GA 1NBEA 4G25A 2AXNA 1SY7A 1W85B 2BFBA 3DBHB 3H9CA 1HXHA 3R3UA 1WDLA 1BNCA 4YRDA 1CE8A 2O8NA 2I7DA 5HKLA 3WICA 4EX6A 5C4IA 3AZPA 2NU7B 3NNNA 4P36A 4J4TA 2DWOA 1XLWA 4X44A 1W9HA 1DKNA 2X4IA 5CX4A 2GWRA 4DILA 4C3VA 4UUQA 1PYOA 2B4QA 2OV2A 3SLGA 4MW9A 3WLQA 1BE1A 3R40A 1K27A 4AO8A 4IHAA 1J8FA 4EI9A 1UXJA 3TD6A 1TYCA 3I9JA 3CCCA 2QYOA 4OM8A 2UXBB 5EKXA 1XQ6A 1GDDA 1W88B 3UAOA 5KWIA 5ELXA 1DJMA 3AR7A 4XYMA 2WIJA 4F97A 1D6NA 1NW7A 2ZJ2A 2Z8YM 3HFJA 4LV6A 2JGMA 1ZGZA 2QVCA 3C85A 4C43A 4JFAA 3ZZUA 2SHKA 3MLEA 5JS2A 3VZDA 1Y6JA 2IP1A 4KDEA 4OU5A 3OZTA 4I50F 1KR5A 2O3RA 1DWOA 3E3OA 4RSMA 3SNKA 4DG5A 3WGUA 4NMWA 2I3GA 3GEEA 3VOTA 5JBIA 4RY2A 3H75A 1QFZA 4PAOA 4X1KA 2EHDA 3MAJA 4H7IA 3V4VB 1N0WA 4DBVO 4N7MA 4U00A 4GF5A 3FDJA 4U7WA 5FLKA 2RB5A 4EY8A 1PJLA 3WQSB 1HYQA 3NDIA 3W5IA 1G5RA 3IEIA 1V1RB 4G85A 4RFVA 3MTQA 5C8VA 2B82A 1QK3A 3QU5A 1H2AS 4B6PA 5CIYA 1P33A 1JYSA 4HP8A 5KREA 1X7WA 2X5NA 1BFDA 3NGLA 1BW9B 3T34A 3G8BA 4N5DA 5GOTA 1JR3A 3OJFA 3TMAA 4HYEA 1Q1QA 5H3CA 3RSGA 3MWDB 1ZONA 2AW5A 4I4TA 1FW8A 1VCMA 3R6GA 3D7LA 3M6VA 2LKDA 3IR7A 1FXWA 3H5IA 5FV4A 4H4DA 2IQIA 4I1OA 2GBCA 2YXDA 2J3JA 2I2BA 2KQUA 5J1SB 5KKCA 1NQTA 1UJBA 1NLUA 1R4NA 2H31A 3I4FA 4XZ3A 4IMJB 2AMYA 4U0JA 4DJFC 3LI2A 1QKKA 2QL6A 3PUJA 4N3GA 3EE6A 1EIZA 3Q11A 1FVHA 5GTDA 2F9MA 3LRTA 4OX9B 4EHKA 2C98A 1UMDB 3JQBA 4RA9A 4Z1MD 1TYBE 5DBIA 3HXPA 4G4SO 4LX0A 4LXIA 2GJ9A 3PPWA 4QO8A 4U9HS 4YJGB 3GRKA 2HJSA 1KC3A 3I9FA 4PAMA 4BLWA 3QKTA 3JAMA 2PBFA 1IULA 3SQMA 3IAM6 4YV1A 3M9WA 3ADOA 3C70A 1DJNA 1TF5A 5FWYB 1FDVA 2D8MA 1ABFA 1UQUA 3KPVA 1P6UA 4HGQA 4UTNA 4G37A 1X86B 1U0FA 2IU3A 2OCKA 4FFWA 2H5EA 1U7WA 5EJMA 3CX6A 1CZKA 5J5CA 4HWRA 2JZOA 1G6Q1 2QTBA 1NW6A 3QLUA 3QXJA 3TAHA 2AEFA 5AXBA 3SBOA 3KVOA 3NTLA 4I55A 5CK5A 5JFTA 3LHFA 4RL4A 2IOHA 3MELA 1KRXA 3NTOA 2XVYA 2BV3A 3SXUB 1QCYA 4DEVA 1UEJA 5BUQA 1R0ZA 2DPXA 3DEIA 4B8YA 1YQXA 4N39A 1Q0SA 1X1DA 3T15A 2I03A 2C9ZA 4PZEA 2XKJE 4Q16A 3CNEA 4H1TA 5F73A 1W1WA 4DPMA 1OE0A 4PO8A 4KE8A 1M1YB 1PNOA 3MVEA 4JVLA 3ZU2A 2W37A 1TCBA 4GVLA 2W2OA 3I6MA 2W7TA 1LK5A 1QMPA 4TTIA 1BX1A 4MRSA 3ZQKA 1HLPA 1QQ5A 1O57A 2MCFA 3ADPA 3OM1A 3LBFA 3PWZA 4FHFA 4GZ5A 4WA8A 4WQMA 3L0YA 1QHHA 1EQAA 1YNSA 2DYKA 3HA5A 4QOIA 1G8GA 1KERA 1MNQA 4DANA 4OXKA 1PI3A 4H1UA 4YTEA 2ZULA 3F9IA 3K1AB 3R4CA 4UMVA 2XB2A 1T6ZA 3R1IA 3Q10A 3WWYA 3KOYA 4L8WB 3NIBA 4UUBA 1QHEA 3KSMA 4O08A 5HDBB 3NH6A 3TQHA 3Q2OA 3ZGNA 4RQTA 1FLDA 1M74A 5GWXA 5FEMA 1RAGA 1W4BA 1J2YA 3EP3B 3FG9A 4L4RA 4NBSA 4NULA 1EUCB 1G21B 3AYXB 3PRKE 3SLRA 2IXTA 3LL7A 1USWA 1R4AA 1XP5A 3NVMB 4L0QA 4UARA 5ED0A 5EJ5A 1NU8A 3EEQA 4K88A 4R84A 4FB5A 4G3XA 1PFQA 3A2MA 1IXYA 3GFVA 2C9BA 4IH4A 2WOJA 3IVCA 3L04A 4WVLA 1THGA 3TG8A 2HPAA 4NSNA 2QR2A 4A26A 4A1OA 1Q17A 2NAFA 2QHXA 1B15A 2LCIA 3L5KA 4I7EA 2KBEA 1TZKA 1FF9A 3D3EA 4DLZA 1FX0A 5JMTA 4WBNF 2JFXA 3ES9A 3L9WA 3PDHA 5LQAA 3LC2O 1C3LA 5CD9A 2XYPA 1L8LA 1R37A 4CW7A 1HNZB 4AF6A 1WO8A 3WIDA 1KSFX 4LFCB 1Y1KE 3VH2A 3FKSD 2FYTA 3E5RA 1PJTA 3OC0A 1YS7A 1BH2A 2FMFA 1DDGA 3C6ZA 1WV1A 3WXBA 2ZRIA 4BX3A 3MPUA 2O2DA 1EU1A 1WAMA 2F43A 4RA6B 3TZLA 3HVRA 4M1QA 3GHYA 3GGDA 4BECA 1M8GA 3LVRE 4QUHA 5JC1A 3TL3A 2P4SA 2W2VA 4K6OA 3VSAA 3ZI7A 2OPBA 3L41A 4RY8A 1BXZA 3IVRA 3JTEA 4GPAA 4FHZA 1K4MA 2FAXA 4LZWA 3E61A 1JHDA 2P41A 3GDGA 1C3JA 1UWCA 5HEKA 3MS7A 5B1IA 2V5VA 3KOOA 3KK0A 4N5IX 3I3SR 5B12A 3HNPA 1HE3A 1VP9A 1VL1A 4PXAA 4ZJYA 4HDSA 1WZNA 4JYBA 2XT9A 4FSHA 5DHTA 3AVWA 3CZMA 4RHUA 1R7RA 3KKMA 1TEVA 4U2BA 3ZLJA 4U2EA 1KEVA 4ND8B 1NVVQ 1Z7YA 4EY4A 3RC8A 1J25A 4CM5A 3I2HA 4CM6A 3QU9A 4X3PA 4KR6A 1CFJA 1R88A 3MS2A 4KLNA 4XVRA 3CUUA 3PJRA 2HF7A 3WSVA 1S2MA 5GZ1A 3T38A 1UJNA 1L7QA 1RCTE 4F92B 1JKIA 1TJPB 5LWHA 3NC1C 2FQXA 3JZFA 2JLWA 3KKOA 2NU8B 2C20A 1L4NA 2RGDA 4B46A 3H2YA 2VNAA 3COVA 4FDTA 4P4SA 2XAAA 3CO0S 2O0LA 3QJ5A 3N07A 4MS1B 1Y8RA 2WE7A 3RUHA 2H48A 2EKLA 1RD4A 4K6HA 5LB4A 5BWOA 1P77A 5EQTA 4B4UA 3M4JA 4X20B 3ZCRA 1U2EA 5REQA 3H4IA 5TMDA 1ZN9A 3B2EA 3ZQ6A 1ZNYA 4GYWA 1L5SA 5DV9A 4M54A 4YRCA 2D1RA 5KZMB 3E9EA 1DRJA 2GAJA 2XCUA 2D5BA 2E0IA 4RKQA 4XM2A 3KSBC 1TJYA 1N9GB 1E4OA 1VJDA 4W7IA 3NV9A 4DQVA 3DC7A 1JQAA 2BE7A 4JP2A 3EP6B 1P9RA 4AP5A 5K0BA 3IPAA 3U3ZA 1ZXLA 3KQPA 3Q98A 4YROA 5JZ9A 5D3QA 1SMKA 1RFLA 2BI7A 4UC0A 1JHUA 2X76A 4IHQA 4X54A 2JLUA 3BWDD 1IE3A 4L73A 4X3CA 1WF3A 2CLOB 2Z1MA 4DADA 1E1CA 2PH7A 3ZQJA 5FBKA 1KGDA 2ZYUX 3E9QA 1QYXA 2PD6A 3DDZX 4POAA 5TB5A 4UDOA 5IF3A 2HRRA 1MEJA 1HG0A 3IIJA 3DHEA 4HFNA 4KXFB 4U0KA 4FNMA 4JIMA 3A2NA 2C99A 4Y2SA 4OXQA 4BNVA 1E2BA 2JVKA 2VATA 3FNQA 5TS2A 4AURA 2WWIA 2QROA 2QIOA 3GFFA 2AI2A 4YCBA 2BEVA 1PJ8A 2E4ZA 2OECA 4TKUA 5CUQA 3D8NA 5JTTA 3NBKA 2VYND 1I3CA 1OTHA 2BDUA 4N49A 4MRAA 5AI8A 4D5EA 1CY2A 1NVEA 1J39A 1SBNE 2HMTA 5JCXA 5JYDA 2GD0A 5LP6F 2A5GA 2FSGA 1T1IA 4LMPA 3QNUA 4JXKA 3G2HA 2YXNA 3BXOA 3I2KA 4GC9A 1YBAA 1VHJA 3RRJA 1VIDA 2I71A 2OV8A 3H83A 3SNHA 3GT0A 3GYBA 3EEBA 4JMPA 2YOFA 4BO3A 3M1IA 4UKDA 1XJWA 2H1FA 5IBQA 2ZAIA 2NXWA 1SWWA 1WCIA 5I48A 5IAKA 4U6SA 3HV2A 1YE3A 3G9QA 4B87A 4KFCA 4LSZA 1XMVA 2JS7A 1IZ0A 5DGIA 3SBEA 4DLSA 4Y2UA 1MORA 3BERA 3UMGA 2O59A 2IHYA 1A8QA 2JVIA 3VNAA 4FX5A 3RARA 2WYUA 4Z1MA 4EW6A 3N7AA 4OQMA 2YVUA 4QEDA 2JFQA 1BHQ1 3IA2A 1TNDA 3RU3A 5F7ZA 3KL2A 3ND6A 2ZRAA 3RSFA 3I6ZA 1SB8A 4QQKA 3H3FA 4RZIA 1E99A 1G17A 1JW9B 1KP9A 2VH2A 4DNQA 2ZZMA 3EXFA 3KAPA 1EFPA 3BJEA 1G1MA 1B6TA 3GMTA 1RXSA 4MQEA 4WOPA 2B34A 2GN8A 2P75A 3H6KA 4P33A 3KG2A 5FBQB 1KJJA 3HWSA 1E9SA 5LXTF 5IXJA 1BFUA 1I3OA 4NPAA 1GZ5A 3VPHA 5L95A 4JLMA 4OGFA 2IP2A 3JYQA 4PBTA 1SIBE 3P9PA 1C9NA 3VTKA 1A9TA 4QYIA 2RK4A 2H1OA 1W96A 4L15A 4P3PA 2GZMA 1XNGA 1T4DA 4QX6A 3CF2A 4FZ5A 1QX4A 4WWHA 5FL7D 3T1OA 2ACKA 1P2SA 2RHTA 1KI2A 1E98A 4TXMA 4DQ0A 3L40A 2XMSA 5KS2A 5FIUA 4PG7A 1O4WA 3MMSA 4HXGA 1WR8A 3PQCA 3P94A 4HPWA 3RSOA 4BZZA 2GUGA 3DE0X 3LFTA 1FS6A 3KLOA 4YJ3B 5U4XA 2R5NA 3CVXA 1HPLA 3FSRA 2VK8A 2H0QA 5K20A 1XZDA 1NBHA 2QP3A 2QRZA 4BC0A 2PHZA 3KYBA 2EX4A 3AFHA 4MWTA 4FFVA 1HKUA 4ZRMA 4XWTA 1P1KA 2PMKA 3DO6A 3UAVA 1I80A 2QB5A 1II8B 3QELA 5F5XA 2Q7DA 3UOGA 4RZ2A 4D2IA 1QMIA 1XCPA 1MABA 3N87A 1JDUA 1UUFA 1YMVA 1IC6A 2XW6A 2VDRB 2YHUA 3DO8A 1UBSB 4JAVC 1T8TA 2HNKA 2J67A 1N5MA 1CIPA 2VWQA 3G2MA 3ONFA 2QN7A 4G4SP 5HP4A 4FYPA 4Z7JA 2C4MA 4AY2A 4QYWA 2R44A 5EQFA 3WDMA 2W4IA 4J43A 4RS4A 3LSTA 3JAKB 3GT4A 1Z7BA 1WP9A 3A6PC 1K86A 3K2EA 4W5WA 4Q9DA 3WQHA 1UDWA 4H9GA 1JAZA 1YFLA 4J1NA 3V4OA 2ZIXB 3GFSA