3Q0EA

Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with product of s-allyl-l-cysteine sulfoxide
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
369
structure length
369
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title Structural characterization of inhibitors with selectivity against members of a homologous enzyme family.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 123
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3q0eA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q0eA01
1T1SA 5G0SA 3OJ0A 4DGSA 2I67A 1Z75A 4RV9A 3HG7A 3PK0A 2PH5A 4ZHSA 4DPMA 1ULUA 3JD1A 4U0JA 3NKLA 4G81A 2XXBA 2PH3A 4XRGA 2W90A 1TLTA 1BDMA 1Y9EA 1LQTA 2Q1SA 3U9LA 3RKRA 1PJ3A 5AXCA 4CMIB 1IULA 2JCVA 2GNAA 3WQRA 5TIIA 1YBAA 2RH8A 3TL2A 1L7EA 1W4ZA 3PHGA 3M2PA 3EUWA 3HZZA 4QQRA 3H4VA 3M6IA 3WLFA 3ABIA 3QWBA 5H82A 3GZNB 3W8DA 4TWRA 3JD4A 2Y1FA 4J4TA 5G0UA 3DMTC 1VM6A 1IB6A 3OM9A 3COSA 5KWEA 4RDHA 3H65A 2BFPA 2X5KO 4RCVA 3E1KA 4M89A 1ZZEA 4WJZA 2Y1DA 3STHA 1EEHA 1P44A 1K6JA 3HUDA 3F4LA 1MB4A 4LCJA 4LW8A 4TZTA 1ULSA 3JQ9A 4GLOA 4GVLA 4R9SA 2VQ3A 3DZFA 2IEBA 4NFSA 4CR8A 2Q22A 4LK3A 4ND3A 2HRZA 4FBGA 4LN1A 2OBYA 3ZGYA 3IP1A 4WLVA 2NSDA 3PDJA 3OHSX 1RJWA 4WECA 1BXGB 4BNVA 4PZEA 3NYWA 4E13A 1AN9A 3CMMA 1Z7EA 1HSZA 1R4NB 1R37A 4DYDA 1GCUA 5ES3A 1E77A 1HKUA 4JQCA 3IAHA 4H7PA 2HU2A 4HY3A 2B4TO 3S2IA 3WGGA 1WAMA 5EQDA 1PQUA 4S3MA 2R00C 3WYEA 1JQBA 4FCCA 1T1RA 4XGIA 1I3MA 5L4LA 2Q1TA 1GTMA 3OJLA 4KDFA 2WE8A 4W6ZA 2O4CA 4BO7A 1Q0QA 3FNFA 3GGPA 4P4NA 4E6PA 3DXFA 2AQ8A 3L6OO 4ZRMA 4CM8B 2DQ4A 5CDGA 4XRRA 1NXQA 1I2ZA 1WPQA 4J0FA 1I24A 3FCOA 4U8GA 2X58A 1PL6A 2GPTA 3TZCA 3LQFA 1H6BA 3SLKA 3INTA 1YO6A 1BWSA 3KLMX 3RBVA 3U4DA 3JQAA 3CUKA 1YBVA 3F46A 3Q9NA 2NVWA 2JL1A 4RVUA 1HWYA 3SBOA 4GX2A 3L6EA 4NNJA 4YTEA 3EMKA 1NPTO 1XIVA 4FN4A 1J0XO 3OQ1A 1WP4A 1U28A 3T4EA 4CMGA 3A14A 1ONNA 3WGYA 4GX1A 4A5OA 4WEOA 4Y8VA 4J1QA 3ZU4A 4CPDA 3TFOA 3ITKA 3ZV4A 1LDMA 2P68A 4DIOA 4JP3A 4PCVA 2C2YA 3UICA 2YV1A 2C7GA 5C5IA 5JO0A 3PLRA 4J9UE 3INRA 2AG8A 1C14A 1XDWA 1SEPA 3PJDA 5T67A 3AW9A 1MUUA 4GKVA 4WCFB 1O8CA 4Q3NA 3WWZA 2OL4A 4YJDA 4YAJA 1PL7A 4XWYA 5F1OA 3DZKA 4EEZA 4U0KA 1MP0A 4QFCA 4FC7A 4WLNA 2QYSA 3PQFA 5COAA 3SLGA 5BNFA 3K2BA 2B35A 2DBZA 2JJYA 4CR6A 5DN9A 3LVFO 4MIOA 1LRJA 4I5FA 5BNIA 1E92A 4CODB 3E82A 2C54A 2P91A 5A9RA 4HFMA 4ZRNA 1BG6A 4YJFA 2UUPA 3JQ7A 2VNSA 1X14A 2CDAA 1NASA 3UFXA 2VOJA 1JW9B 3OBBA 1XELA 2C59A 3TPCA 4E32A 4E5MA 5IJZA 3BMCA 3GMDA 3H9UA 1OI7A 5TF4A 2A35A 3VHRA 4CQMB 5DNAA 4J2OA 4KZPA 3H8VA 3HE3A 1KY4A 3AFNA 3CTMA 3O38A 1E7YA 3ROQA 4BKPA 3IL2A 1NPYA 2J3HA 1P1IA 2OBNA 4RZHA 5L51A 2BLLA 2FPIA 4YJHB 1C0KA 3WGQA 3OP4A 4AJJA 4YAKA 4E2YA 4M54A 4AJLA 3DZIA 3PGJA 1C1XB 4UVDA 5EQFA 5A5FA 4BNFA 4B7XA 1B14A 4HXYA 2EW8A 4BHTA 4C4OA 4YT4A 1FDSA 2IYOA 3F5SA 3VH4A 3ZWCA 4ZQFA 4E30A 1PGJA 1HLDA 2AE1A 1J49A 3FBGA 1H5QA 4NIMA 2D0IA 4YACA 1W6UA 2BGKA 3FD8A 5T5QA 5EN4A 4RQUA 2NADA 3DTTA 1JU9A 4I5EA 2PKQP 3U09A 5A3VA 1GDHA 5TX7A 3RUIA 2V65A 3JQCA 2B4QA 4MOWA 1U9JA 5EESA 1T25A 4NU5A 1P1HA 1NR1A 1HL3A 1WZEA 2G5CA 2WYWA 3D3WB 3M2TA 1NNUA 2FMUA 5B37A 1T2DA 4KWHA 3RJ5A 1AHHA 3SEFA 5DBGA 2BF7A 4QXMA 4CLEA 2TMDA 3WTCA 1RM0A 3HDQA 4EYEA 4YWJA 4L4XA 4WK6A 2C29D 3DZGA 5C37A 1LLDA 4TRMA 5AXDA 1YS4A 3D1LA 3GAFA 4MVJF 2QQ5A 5TQVA 1UZNA 4E33A 1R15A 1E5QA 3A1NA 1Y8RB 3P7MA 4TQGA 1U3UA 2AEMA 2JFFA 3FPCA 5ITVA 1LDNA 1G6KA 4CMCA 2A94A 1K3TA 4IDDA 1U4OA 2GF2A 1FDVA 4JJGA 4WPGA 3DAPA 1H93A 2G0TA 3DZBA 2NQ8A 4UVEA 1A5ZA 3U4IA 5JY1A 1FDWA 3ROKA 1QMGA 1N9GA 5JW6A 3MEQA 3R0IA 4WLUA 3DZHA 2W2KA 4Q3DA 1YOVA 3L0DA 3GVCA 5TGDA 2VHYA 4DQXA 1ISMA 2E49A 1GPJA 4MIYA 3TOXA 3NRCA 3ZN2A 1PTJA 4IMRA 1CJCA 3SJUA 4EI2A 1I3NA 3A9WA 2Y0EA 1XQ1A 3WLEA 3G49A 1NPDA 1DC3A 1YGYA 4WCDA 3DOOA 1ZXBA 2B83A 4IGEA 3I83A 1N92A 1X1TA 4Z0TA 1UR5A 4RVSA 3SX2A 1LLUA 1UDBA 3CXRA 4RL6A 3WXBA 5COQA 4YA6A 5KKCA 5KJEA 1EDZA 3GGOA 2X1HA 4BNUA 1B8PA 4ROSA 3ZV3A 3Q6IA 5ILGA 3W4JA 1YONA 1EUDA 3BHMA 4NG5A 1B0AA 4UREA 2I6TA 1YJQA 4K26A 1TA4A 3GEMA 1F8FA 2JAPA 3NGLA 3DBRA 4O6VA 3BIOA 4FD3A 2CUKA 2E82A 4IY1A 3F1KA 1GYPA 4RQTA 3JD0A 4CLXA 5L3ZA 4BVAA 4CM4A 2ET6A 2VCYA 3WGIA 4RVFA 3ANMA 3OQ6A 5CEJA 5FEUA 2VUSA 3DONA 5EERA 3W6UA 5JSFA 3NAQA 3RROA 5KJCA 4I8XA 3JQ9C 2Z1MA 1TB4A 2IXAA 4A03A 3G79A 2ZTVA 5JYEA 4YB8A 5JMPA 4W82A 1ISIA 2BGLA 2NVUB 3T7CA 3LLSA 1IYZA 4M1QA 3ETDA 3FN4A 1H0KA 4YRBA 2JD0A 1NFFA 4RVHA 1HYEA 3ZNOA 4MIEA 2VZ9A 5KVVA 3NEPX 4Q3EA 3OIFA 3H3JA 3D4NA 3C1TA 2GDZA 3VAZA 4I9HA 2BD0A 4XJSA 1UXGA 3V2GA 1PR3A 1QR6A 3T7EA 3RC9A 3GC6A 1D3AA 2GR9A 2C5AA 4CLHA 1VL0A 1X7GA 5L40A 2RAFA 1H6DA 4BNNA 1R12A 3VZRA 2EERA 3C7CB 4IQGA 2C5EA 1B3BA 1N7HA 4OGWA 4WLEA 1KEUA 1DAPA 4Z9FA 1NTOA 5TT0A 4EJMA 2X23A 3NTRA 2IEDA 1ZKMA 4CMBA 5EPOA 1ADCA 4CR7A 2J6IA 4WEQA 1Q2XA 1G0OA 2UYYA 4PLZA 4AJPA 3F6YA 4DC0A 2FR8A 3ETEA 4OSPA 4A2CA 1AGNA 1MV8A 4D3FA 2UUOA 1KEVA 2VHVA 1ADGA 5KIAA 4NJMB 5GZ1A 1NVGA 4R1TA 5ADHA 4LCEA 2X0IA 4M87A 1ZVMA 3NDIA 5T57A 3ROMA 3G3EA 2YHIB 1WDMA 2XAAA 1LC3A 2LDBA 2GD1O 2EP7A 1U1IA 3Q2KA 1E3WB 4EUHA 2D3TA 3IDSA 1DXYA 3VVCA 3IKTA 5A4DA 1UP4A 4TROA 3CEAA 1G1AA 1KOLA 2EXXA 3DC2A 1NFQA 1UJMA 4NU6A 2DUUA 1A9ZA 2WM3A 1X1EA 4JIGA 4QECA 3ZCXA 1NQAO 1YDWA 5AVOA 4J9VA 4MVJA 1LDEA 1HETA 2GN9A 4RLHA 4J4BA 1D4FA 4BGUA 1ZO8A 3ASVA 1H6AA 3OA2A 3LZ6A 4ALNA 3AWDA 3KTDA 1HT0A 4PGFA 2JKVA 3NUGA 4KWIA 4BV9A 4NBWA 3F9IA 1S6YA 1E1MA 1E1KA 2C07A 2W2LA 1ID1A 2VYVA 2VRCA 1DIAA 5BNTA 3U62A 1OFGA 3D7LA 3LT0A 4A7PA 1EBFA 3BMNA 4P4GA 4PVCA 4JROA 1ZBQA 3PJGA 3NGXA 2NVBA 1KS9A 1V6AA 2O4UX 1WLYA 4CUZA 4OXNA 2RHCA 2VTEA 4IIVA 4IDCA 4QTZA 4IPTA 3EC7A 4LISA 1AXEA 2EJWA 1U3WA 5JAQA 1P1JA 1UP6A 1QYWA 2VT2A 1CQJA 2VWQA 4L74A 3VTZA 3H5AA 3S2FA 4XIJA 1TT5A 2C2XA 4R51A 3WIDA 3L4BA 2YW9A 1I2CA 4KDEA 3Q3CA 3AM4A 4GGOA 1H9AA 1QSGA 4BO6A 5CG1A 5FWNA 3GHYA 3DR3A 3G0OA 4WLOA 2PTGA 1PWXA 5B4UA 5L4NA 1R4MB 3LT4A 4D7AA 5A9SB 4BNIA 4A0SA 1Y9AA 1YQGA 4BMSA 3GPDG 3S2EA 2J5KA 2P5UA 3EDMA 2VYND 1CERA 1YL5A 1ZCJA 1EUCA 3AJRA 3GG9A 3EGOA 4J3FA 4PIVA 4URFA 2FN7A 2Z1NA 2ZIZA 1A7AA 3KUXA 3BMOA 3GDGA 4OSOA 4RF2A 1OMOA 1I33A 2NLOA 4UULA 4FJ0A 1IZ0A 3KYDB 3WR5A 1VKOA 4BKQA 1RWBA 1PJLA 5IG2A 2QIOA 1KYQA 3GVIA 2HUNA 4BNGA 5U9CA 3I4FA 2JFHA 3I9MA 2O3RA 5BR7A 4YRAA 5L95A 1PJ4A 1Q0LA 3EAGA 2X7HA 3HSKA 2SCUA 1ZJZA 3GAZA 2PLAA 2ZYGA 2CF5A 1XA0A 3D64A 2PZLA 5HRUA 3AFMA 4OQYA 3WICA 4YBZA 3H9JA 4O5OA 4IINA 4JK3A 1B15A 3K2EA 4XZ3A 3TNLA 1P74A 3ZWOA 3QJ5A 3RD5A 5F5LA 5K6AA 1EE2A 2YQ5A 3P5SA 3RBZA 2Q1WA 3UXYA 1FXSA 3K8ZA 2QYTA 2G17A 2E48A 1BHSA 3IS3A 4WKGA 3PJEA 1B7GO 1C1DA 2OHXA 3I6QA 5I8ZA 4H15A 3IJPA 4WOKA 1P31A 3WGOA 1ZEJA 5BQFA 5JDIA 1P77A 3GZNA 2H6EA 2EJVA 2PD6A 4AL4A 2CD9A 2EF1A 3GG2A 4LVCA 4JJFA 1E6UA 3LLVA 3OF2A 4XQCA 5TSDA 3BTVA 1KVTA 2Y1GA 1G0NA 1FF9A 4ND4A 1LA2A 1C0LA 5TNXA 3W8EA 4RVGA 3FRJA 1UXIA 1R66A 2VTDA 2B5VA 4JJIA 3ICPA 1B8VA 4LGVA 1KC3A 1A4IA 2Y0CA 2DUWA 4LMRA 1I3KA 3BMQB 3ADPA 1Q7BA 1Y5RA 5ICMA 2VWGA 2HO5A 4ITUA 1BXGA 4LSWA 5ER9A 4BL5A 2B36A 4L9RA 1LSSA 3WB9A 2XF8A 1R4NA 2FSSA 4RPKA 4YJGB 1ZJYA 3KETA 3S2GA 1DLIA 4EW6A 2R2GA 1PS9A 1DFHA 3FBTA 1HYHA 4ZQBA 5BSFA 1UZLA 5KOIA 4UVHA 1PR9A 4DUPA 4B4OA 1DC5A 1O5IA 4PLCA 2ZK7A 4B3JA 4ND5A 4HFRA 4XJTA 4B7CA 4TSKA 4BKOA 4H3VA 2IE0A 5A06A 4EUEA 3NDRA 4XYBA 3IOYA 1PQWA 2DTXA 4E2ZA 5B1YA 1K5HA 1R16A 3V1YA 3VPHA 1ZIDA 1MLDA 4NJOA 2YYYA 1ZSVA 4RGBA 2E6UX 4A26A 4CM8A 2VHWA 3H2ZA 4FDAA 5I9LA 4MVJM 2GN8A 1JDJA 1ML3A 3DDNA 1QP8A 4RORA 1Z73A 4RVDA 3IMFA 1LSOA 5GMOA 5T73A 2Q4BA 2D8AA 2X4GA 2IZ1A 1ENPA 1XHLA 1SNYA 1T4BA 3F47A 3TL3A 2B5WA 1U2GA 1WNTA 3RFTA 3RUEA 5DT9A 1HE3A 3BA1A 1O6ZA 1XU7A 3TF5A 3JQ8A 2HRBA 2NU9A 2Y1EA 3PHIA 4K28A 5C7LO 1LQUA 2GERA 1KEWA 3RI3A 4PRKA 4XB2A 3E5MA 4KUHA 2W8ZA 4XYEA 4BO2A 4CM9A 1UXKA 1FMCA 1NX6A 2HDHA 4XQEA 3CPSA 3LYLA 4BO5A 1PIWA 4IDEA 1PJQA 1NHGA 4F45A 5IDXA 2BKAA 1IHXA 2Q4EA 2QX7A 3Q9UA 1QKIA 4AJKA 1FDUA 1WZIA 2ZB4A 3JTMA 5JNLA 3TZ6A 4LRTB 3UCFA 3C3XA 3BXXA 3I4CA 4TKMA 2JCXA 4A27A 3TN7A 4JP2A 3AI3A 3VZSA 1EVJA 1VJ0A 4WCFA 5G4KB 1T2FA 3B20A 3E9MA 1YB5A 3MOGA 5EIOA 4AJ4A 4BO3A 3AUTA 4J16A 1LUAA 4MVJG 3FSRA 4DPLA 1EQ2A 3INGA 3CH6A 1PZHA 1I5RA 1K89A 1W73A 2OUIA 4PRLA 3MJSA 2V6MA 1E6EA 2I5PO 5ILOA 4BS9A 5J9GA 1IY8A 1HF3A 5GY7A 1ZUD1 2P9EA 3DTYA 1GUFA 4GVXA 1N1EA 4QO8A 3JYQA 2NACA 4S1VA 1P0FA 1PGOA 1TVEA 3ZWWA 4EUFA 3FPLA 4IXTA 2UVDA 5F1PA 3SXPA 5JAMA 2PR2A 4BNHA 5JC1A 1LC0A 3MJEA 4GKBA 4ALJA 4P38A 5C7IO 1JVSA 1ISFA 3QWAA 4R68A 4CUJA 2YDYA 4EGFA 3UVEA 1K0UA 2NTNA 4MKXA 4RDIA 2I65A 4CQMA 1N2SA 4CV1A 1PJ2A 2J5RA 2NV6A 1U5CA 1QRRA 2UDPA 5F1KA 1Q7CA 4U7WA 1X15A 3ULKA 1OZAA 1GU7A 1Y5MA 2WDZA 1PJTA 4FSHA 3U5TA 4Z0PA 2HQ1A 2QHXA 4WASA 4YJHA 5KVQA 5ER6A 3ZNNA 1K2WA 3NDJA 2DTDA 2VWHA 3CKYA 5A5EA 5L45A 1PEDA 3I9NA 4FFRA 3AUSA 3VTFA 3WBFA 3FR8A 3UHAA 2BMAA 3AK4A 4OL9A 3GY0A 3PPIA 1DPGA 2B4RO 4L4RA 3QWFA 3C1AA 1SBYA 3WMXA 4BNKA 2AQHA 4ZQHA 3K31A 5CDYA 1EZ4A 1CRWG 2P9GA 3GRKA 4CLRB 2FP4A 2QRLA 4GGPA 4OM8A 3DAGA 5DP2A 4YAIA 2GO1A 2Y1CA 3A4VA 1JWAB 2Q1UA 3PWKA 1HSOA 2Y99A 2EP5A 3PHLA 3R3JA 2DU8A 2PZJA 4PG4A 4J0EA 3CE6A 5DCWA 1Q7GA 4PLTA 4WNCA 1QLJA 1DDOA 5EMHA 4IDBA 3PEFA 4W7HA 1ARZA 5AYVA 3DQPA 5TC4A 1IPFA 2YY7A 2BI7A 4UUNA 3ZV5A 1UXJA 3W1VA 5GZ6A 3GLQA 3L4BC 4XQGA 1NWCA 3QE3A 1BW9A 3UH1A 2O3SA 2HMSA 5DULA 3VKUA 2ZB7A 3U49A 1DLJA 2H9IA 3MJ4A 2O3QA 4EEXA 4Y6RA 4J90A 4PLWA 1A4UA 4M49A 3AOGA 1RYEA 3GNSA 3R1IA 4J49A 3WSWA 4BGIA 1Y8RA 4B8WA 3I52A 2PZMA 1HE2A 1NAIA 3VH1A 4BNZA 1KETA 3LF2A 4GX5A 3IP3A 3KHUA 4WLFA 2O7SA 5JAZA 1EE9A 2ZB3A 5B12A 5K0ZA 1CIVA 4CV0A 1MXHA 4GX0A 4CLDA 3E6AA 3O8QB 5JCJD 2YJZA 1KEPA 3MTGA 4Y6SA 2CF6A 3PDUA 3WJAA 4K9DA 4YYZA 5G0WA 2DT5A 4PLYA 1HXHA 4E2WA 1O89A 4MVJD 1UXHA 1WMBA 3B6ZA 1KERA 1KIFA 2J5QA 4N7RA 8ADHA 5K6AC 4CM6A 2VUUA 3HFGA 1Z7BA 4YAEA 4QT0A 1F8GA 1KBZA 5U1PA 3WIEA 1LNQA 2ILTA 4OKNA 3TOZA 5C7OO 3AUAA 5KJ6A 3GH3A 2JHGA 2DAPA 5FF9A 4IQ8A 2FHSA 5BSGA 4R1NA 4U6QA 1WVGA 2A4KA 4R4JA 3ZWYA 3QY9A 1HDGO 1LJ8A 2I9PA 3JQGA 5JDIC 1BDBA 3RJ9A 2D5CA 4CMEA 4BNWA 1AXGA 4H16A 2JAHA 1Q1NA 1AHIA 3JQBC 3WTBA 3N74A 2PNFA 2GLXA 3RSHA 1JKIA 5JYAA 2O3TA 3OA0A 1X0VA 3OJEA 1MC4A 1OC4A 3ZU3A 3ZW8A 4BO4A 1R0SA 1LLQA 3AM3A 1EUZA 1F14A 4A10A 1A71A 1CYDA 2QRJA 2VRBA 1YL7A 1T26A 2HAEA 2NTJA 5JLAA 1IUKA 2NVUA 1PS8A 3VPSA 3GQVA 4KTVE 2DC1A 2GZ2A 3OEYA 5TS3A 3C7AA 4HX5A 3F3SA 4B8ZA 4PLFA 3LT2A 4PG7A 3KRTA 4IDGA 1DAOA 2VHXA 3HN2A 4JLWA 4O0LA 5JYFA 5HS6A 4II2A 4UUPA 5I9MA 1B3RA 1D8AA 2HMWA 2F1KA 1GUZA 4J1TA 5FYDA 2AQKA 2VWPA 4BB5A 3QRWA 3PI7A 4GSLA 4IS3A 1E0DA 4JBHA 3X2FA 3PIDA 1ZK2A 3G1UA 3AOEA 4N5NA 2Y66A 1SB9A 4CQLA 1F12A 1M75A 3PTZA 3UF0A 3GA0A 1GEEA 3ADOA 3JQ7B 2ZQZA 3RC7A 2VN8A 2V6GA 1GZ3A 5BT9A 2VOEA 3VZQA 7MDHA 1BVRA 1O0SA 4XGKA 2CDCA 1ZEMA 4NHEA 3NT5A 4ILKA 2P5YA 4RF5A 3RUAA 5JFOA 4PG6A 4KP7A 4YQYA 3BMCB 1N7GA 3F1LA 3SC6A 1OBFO 4YT8A 4KUEA 1VL8A 1O9BA 1B2LA 1PQPA 3FR7A 1ONOA 1RYDA 4GMFA 5F5NA 4D46A 2ZYAA 3MZ0A 4XB1A 1ISJA 4NJMA 4BO0A 4BNLA 4Q39A 4NH4A 4J1SA 1TEHA 2F00A 4DC1A 1SC6A 3ZHXA 4N5MA 3KYCA 2EV9A 3OQBA 1CF2O 3FNGA 3JD2A 4CUKA 2YHIA 5IN4A 3KM0A 5I8WA 3FNEA 4XCVA 3GUCA 1E3WA 3Q2IA 1XYGA 2I99A 4GBJA 3WQQA 1LRLA 1Y8QA 3VPFA 1ORRA 3B1FA 4YT2A 1DIHA 3GZ4A 3GN1A 1DRWA 1EVYA 4L75A 4OJNA 4AJ2A 1M2WA 5KCZA 4WCFC 2RIRA 4DIBA 2J3IA 3I3OA 4HNGA 1HRDA 2HMVA 1P9LA 2IXBA 4HFJA 5CAEA 2WD7A 4I5DA 4JXKA 1LSUA 3ZHYA 3MTJA 1DOHA 3DBLA 3WWYA 3GFGA 2AA3A 1E6WA 2X22A 4YPOA 4I5GA 3ZWXA 2DPGA 4HP8A 4UVGA 3KEOA 2DPHA 4AJEA 3S1LA 5JY6A 4BO1A 4DMMA 5LDHA 1X13A 3JQFA 3PHJA 4F3YA 3PYMA 4FGWA 5A05A 1KY5A 1GUYA 2ZTUA 4EZBA 4ALMA 3QV1A 3KB6A 2O2YA 3C8MA 4Z6KA 3NTQA 3ENNA 1BGVA 6ADHA 1YB4A 3D4OA 1ONPA 1P33A 3K92A 2OFPA 3TZQA 4BMVA 4PFJA 4IJUA 5T6BA 1Z82A 2EHDA 4CJXA 2JCYA 4JBIA 3L9XA 5L9AA 2AMFA 5TRTA 1EFLA 4DREA 3Q0EA 2CVQA 2LDXA 2HCTA 3MWDB 1D1TA 3I9OA 3DFZA 3GVXA 1R4MA 5A9SA 4UAGA 4XA8A 3GK3A 2C82A 1E1NA 1YB1A 3ON5A 3G17A 1DC6A 4CL8A 4QUKA 2BFMA 2O2SA 5F3RA 5JDCC 5EJ2A 3BAZA 1LBEA 1SPXA 1A7KA 2FOIA 2QZZA 3UN1A 4E5NA 1P1FA 1QXSA 1M6HA 2FPGA 4TRRA 3KYDA 4YCAA 3RIHA 4DQVA 1B8UA 2P4HX 2Y0DA 3WNVA 2HJRA 3C7DB 3E48A 2ZJ1A 3OMLA 2RHRA 4RPJA 2EW2A 3H9GA 4U6SA 1JAYA 3GEDA 4PZCA 3T4XA 4N18A 1OC2A 2EKPA 2NU6A 1C3VA 3K96A 4IDFA 4MP6A 4RZIA 1NVTA 4CLOB 4DXHA 5I7SA 1DRUA 5IXYA 3Q1LA 4E3ZA 3R3SA 3KSZO 4JCOA 4ZGWA 4AJIA 1C0IA 1O94A 1BRMA 3QHAA 2EEZA 3QIVA 1H6CA 3ZWMA 2P2SA 5FI3A 4B4UA 1DBVO 4P22A 8LDHA 5LC1A 3LSYA 5DZSA 3I9JA 1PL8A 1N1GA 2OOSA 3MOIA 3QLJA 4KUGA 4DPKA 4II3A 3RUCA 3QSGA 3KVOA 2X0NA 1PWZA 7ADHA 3AY3A 3KXDA 4HADA 1HDRA 3GT0A 4P4LA 3ONFA 3SC4A 4PLVA 4N5LA 1E3SA 1YQXA 2HMUA 2QZ9A 4B3HA 4BO8A 4BOYA 2NQTA 4D0SA 1BXKA 4Y6PA 5TLSA 2Y05A 3RUFA 4B4WA 4IXWA 2E4AA 3RQSA 4E12A 4CQMD 4W4TA 1W0CA 4CV3A 1RM5A 3RASA 3FTPA 1SAYA 1JAXA 5COBA 5L7WA 3GN2A 1ZXLA 4ZD6A 4XYLA 4BB6A 2FWMX 3BMQA 1M66A 4RF3A 3VH3A 3X2EA 3EYWA 3DHYA 3RBXA 1V3VA 4ND2A 4DYVA 4NPCA 4WGGA 4WUVA 4LSMA 5I9NA 4PG5A 3JQAD 1E1LA 2CZCA 3P2OA 2VT3A 1DO8A 1M67A 3PWZA 1GPDG 3JYLA 1V9LA 3B1KA 3ZWVA 4CMAA 3TRIA 3PYXA 5DDIP 1QLHA 2A92A 4XR9A 5AQ1A 1VC2A 4N54A 3WFJA 3WNQA 2C0CA 1GD1O 2YZ7A 4CMEC 5BSHA 3LDHA 1E3JA 3DBVO 3ZNQA 1PGNA 2IDZA 1H94A 4K6FA 5DOVA 3AY6A 1I30A 3KO8A 5EL0A 4DWVA 3DMYA 4HBGA 5T8KA 1RM4A 4D44A 4GL4A 4QFDA 3CINA 6LDHA 4R69A 2Y1OA 1CDOA 3VVBA 4F6CA 2Y93A 3PRJA 1Y1PA 2CMDA 1LSJA 1DEHA 4O59O 2XOXA 2NU7A 4BO9A 4NBTA 4R01A 4CMIA 5BSEA 5IXSA 2ZJ0A 4NMHA 4F6LA 2PFGA 2WTBA 4YDRA 3H9EO 3BTSA 4P8RA 2RH4A 3DBHB 2QW8A 4ZQEA 2O7QA 2DFVA 3ZDFA 4KQWA 3QQPA 1WDKA 1VE9A 5TJHA 1I3LA 2CNBA 5MDHA 1ZK1A 4L76A 2OP1A 4IZHA 2Q50A 3I6IA 1ZW1A 2AHRA 5AOVA 5LCXA 1WXDA 1Z45A 1YDEA 4MVJP 1EQUA 2VHZA 1MX3A 3JQBA 2ZTMA 5FI5A 3SJ7A 4ALIA 5TJ9A 2ZCUA 2HK9A 1R0LA 3H6KA 2G82A 1DHTA 1MC5A 5JC8A 5KVCA 3PYLA 4B7UA 3ZWAA 5A9TA 1WWKA 3VOSA 1GEGA 3AOEC 3PQDA 2FR0A 1EFKA 1LU9A 5G4KA 4BNMA 3QVXA 3WQSB 5LDGA 4NFYA 3KLPX 4BGVA 3DHEA 3LT1A 4R16A 4NBUA 5DBFA 1R0KA 2I3GA 1IE3A 3K73O 2JHFA 1F0YA 3IIEA 3A06A 1SCUA 3V1UA 4MVJE 1QYXA 3N58A 3W8FA 4I08A 3HDHA 1PGPA 1Y81A 1NHWA 4IDAA 5HTOA 3GRPA 2Q49A 3RFXA 3NT2A 1YQDA 3TQHA 4NBVA 1V8BA 2Q46A 2CVZA 4FQ8A 1ZNQO 3CIFA 1U4SA 4PLPA 4CL3A 2PKQO 4W9NC 3QW2A 3ST7A 1P45A 3WFIA 2YFHA 2IRWA 4DQUA 4X54A 4XDYA 3VZPA 1E7QA 4K6CA 3CZMA 4YT5A 9LDTA 1CETA 3I23A 1JLLA 5A1TA 3C24A 3L4SO 2ZYDA 4AFNA 4I9UA 4UVIA 1ADFA 1ISGA 3BMOB 3MJVA 4MVJH 3L07A 5CDUA 1M76A 2BFOA 2AEFA 1X0XA 1HE5A 4ND1A 5CPFA 3UCXA 2AEJA 3DOJA 4FS3A 1XG5A 1DB3A 3BTUA 1GYQA 2H5LA 3B1JA 4OHUA 2YV2A 3D5QA 4LVUA 2D4AA 4CM7A 3C85A 1C0PA 4BNXA 2BHLA 5A04A 9LDBA 3HB4X 3JQFC 4HNHA 3DEYX 4Y67A 3VKVA 4IM7A 4CLRA 2P9CA 3RU9A 1PJSA 4J7CA 3VDQA 1XKQA 4DMLA 4OYRA 2DTEA 2Q2QA 4CM5A 2HK8A 3MWEB 1ZK0A 4OOFA 3K5PA 4D3SA 1JWBB 1V35A 1F17A 5MGBA 3TDKA 4YRDA 1TI7A 3ITDA 1R6DA 5IDYA 4ZQGA 2G1UA 5ITWA 1C1DB 3QWHA 3NJ4A 4QO7A 4BKUA 2ZKLA 3FF4A 3UOGA 2GRAA 4K1LA 4J7UA 1V3TA 3O9ZA 2Q2VA 3AU8A 1NBOA 1U3TA 4BNTA 3GR6A 2DKNA 2EGGA 5CDSA 3RVDA 5IDWA 5HWSA 3JQEA 2NUAA 4GWKA 3WDSA 4AG3A 3E9QA 2HMTA 1NVMB 1A27A 4BQRA 1YXMA 1GY8A 1I8TA 1SO8A 3TWOA 3KZVA 3FHLA 3GFBA 3ZH2A 1I0ZA 5CDTA 1JA9A 4WNIA 2BELA 3UAGA 4EBFA 1ZK4A 1VSVA 1E7SA 1GV0A 4WOJA 4XEHA 3WOHA 1QG6A 4GH5A 1DSSG 5IN5A 2X5OA 4M8SA 4R41A 1SB8A 5G2OA 5CEFA 1GZ4A 1ENZA 1GCOA 1W8DA 2YDXA 1FK8A 3O8QA 2YHUA 1MFPA 5F21A 3JYOA 3ZHZA 3TZHA 4YR9A 1U3VA 3RWBA 3LU1A 1IHYA 4KQXA 4MP8A 4M55A 5JBIA 4R5HA 1IL0A 4QEDA 3PXXA 4E5PA 3AI1A 1L1FA 1PZGA 1E3IA 5IZCA 3GMSA 1HDCA 3QA9A 1NWHA 1C1XA 5I7EA 5J23A 3GDFA 1ZMTA 3NJ8A 4J6FA 3AY7A 1VKNA 1YWGO 4GAEA 4AJ1A 5JDCA 2ZQYA 3P19A 2D1YA 3F5QA 2IZZA 1SOVA 3VDRA 2ZTLA 1NQTA 2OGUA 1YJ8A 2GASA 2ZATA 2Q45A 4FOOA 1CEQA 2RBEA 4NQZA 2NTVA 3PIIA 3IC5A 3JCZA 1UAGA 2CY0A 1YKFA 3E5RA 2B37A 4ZA2A 2CFCA 1LTHR 1M6WA 4J2HA 4EJ0A 4MDHA 4G65A 3JQ8B 4NFHA 4Q9NA 4CMHA 4LRSB 1UAYA 4TVBA 2VYNA 3D3WA 2HKIA 4YXFA 4JN6B 2I3AA 4E21A 2FPPA 3D0OA 3EZYA 4A73A 1XCBA 1L7DA 3E9NA 3Q11A 1P1KA 4DLBA 3PLNA 3O26A 3RKUA 5EINA 3D3EA 1GAEO 3EK2A 1E3LA 4ZVVA 2YQ4A 1J6UA 4FC6A 2C7VA 2J8ZA 1LDYA 3JD3A 4R3NA 3GHHA 3HADA 5JMWA 4BUCA 3G1TA 5G0VA 3HQ4O 2YV3A 1S7CA 2H63A 3ETGA 5CFZA 1CQIA 1EVZA 4YQZA 1BTOA 1VSUA 3UUWA 4OKIA 4FW8A 5JO9A 3WGHA 1PZFA 2O3JA 3GDOA 4M86A 3D4PA 1P0CA 1WMAA 3S55A 2IYPA 3KV3O 4L4SA 2G76A 1SEVA 1QYVA 3L6DA 3JYNA 3BHJA 3NX4A 1T2EA 1GFSA 4IUYA 4YAGA 5AXAA 4IQ0A 1QYCA 3ENKA 3ZW9A 1XWFA 3U3XA 2WEKA 5JXWA 1MG0A 3LK7A 4MO2A 3HFSA 4MINA 5THQA 4L8VA 1EK5A 2PKRA 1PU2A 3ONDA 2EIHA 2X86A 1GV1A 1NP3A 5CPBA 5CG2A 4OXKA 5T8KC 2Y67A 3AI2A 4IJKA 3WX0A 2D2IA 2AE2A 1N8KA 1QYDA 2WMDA 5KKAA 4UEJA 3ZWPA 2BI8A 2VZ0A 2GZ3A 5CEEA 3WG9A 2BFAA 3GF4A 4OQZA 2E37A 4ALKA 3HHPA 5HM8A 3FWNA 1LRKA 1ENOA 3BTOA 3WGZA 1YBMA 3IUPA 3MJCA 1K6XA 2WYUA 2I76A 2W2LD 2VRCD 2VYVD 4EDFA 4MVJI 1I01A 3P2YA 1HDXA 4FIZA 2FZEA 3PGXA 3LC2O 3JYPA 4UUOA 5B4TA 4J91A 4E31A 5CP8A 2EKLA 3ROPA 3VC7A 5ENVA 3UKOA 1DFIA 3SVTA 1GADO 1MFZA 4DBVO 1CWUA 4D42A 1H2HA 1DIRA 3JQAB 4FOSA 1JN0A 3JQ6A 3K30A 2H1SA 3O03A 4TRNA 3EZLA 1U7HA 2POQX 2AXQA 1KVSA 5HS4A 5L7TA 4ZN6A 1J5PA 1HEUA 5JS6A 2UAGA 1UH5A 4R1UA 4FPXA 2GN6A 4XGNA 1VJTA 2EWMA 2FR1A 2BH9A 3HB5X 4IGFA 4U5QA 4DLLA 3OFSA 2OMEA 3KYBA 2NU8A 3VPXA 4NDNE 4FR5A 4AVYA 4FJ1A 1LX6A 3RUHA 4MP3A 4HV4A 1TT7A 3WYBA 3DOCA 4TMFA 2BGMA 2O3UA 2XXJA 5IF3A 5JYDA 3RC1A 2JD2A 3H3FA 3ZWBA 4DA9A 3M1AA 2TMGA 4FFNA 1UUFA 1JKJA 1BW9B 1FJHA 2DFDA 2YFQA 4NK4A 3UGKA 1U8FO 1GQYA 1YL6A 3H2SA 4Z9XA 1MG5A 4Q3CA 4FFMA 5DOZA 4L73A 3JV7A 2NWQA 4R1SA 4OAQA 4PN3A 1BSVA 5T64A 3R6DA 3DZJA 1QORA 2W4QA 2CSUA 1NYTA 2Q3EA 4J1NA 1JTVA 4OXYA 4RO0A 1B26A 4CM1A 1WW8A 4QSMA 4YJFB 3FNHA 4E5YA 5I7FA 1O95A 1RPNA 2PA3A 3CSDA 4JBGA 3ZI0A 4BQPA 5L53A 1XU9A 1U2DA 1U5AA 1E3EA 3BYZA 3KEQA 1V3UA 3PFWO 1D1SA 1IOLA 2PZKA 3ANNA 3V2HA 2X9NA 3V1TC 4BNJA 3B70A 1OOEA 4ZJUA 4NI5A 2XPCA 3PZRA 4MKRA 2O48X 1T2CA 2X9VA 3OECA 3ZHBA 3H9QA 5ENDA 1DFGA 3OICA 1I2BA 4W9NA 1MXFA 4HUJA 5KTKA 1BXZA 1XGKA 4YEDA 3TJRA 1UZMA 4ALLA 3LC1O 1QV7A 4Q3AA 4DVJA 2OZPA 2D5AA 2Y68A 2PWZA 2GSDA 4CLOA 1V0JA 3TZKA 4Z9YA 4GPD1 5G0TA 2BRUA 1UDAA 1DJNA 4JGBA 2GYYA 3F4BA 3V8BA 1Y6JA 2RCYA 2GCGA 4JNKA 1SZJG 1LXCA 1HLPA 4B4VA 2D59A 4B3IA 1QV6A 1KVRA 3KOUA 1EDOA 2EG9A 2V6FA 3JQGB 1X7DA 4HFNA 3MCVA 1DC4A 1HDOA 5DCUA 5AXBA 4DIFA 4DBZA 1DHRA 1EMDA 4TZKA 3BHIA 3V5NA 2VUTA 1TXGA 3UCEA 1KVQA 3FI9A 4Z3KA 3JSAA 2JD1A 3ZV6A 1FDTA 3W6ZA 5DBIA 4UUMA 3H5RA 5C3MA 1SOWA 4DL9A 4DTIA 2J3JA 1U8XX 4BNYA 4INAA 1LLCA 3U4CA 3DWFA 2UV8A 2OO5A 1I10A 3HWRA 2VNAA 1LEHA 3ORFA 4EJ6A 4FFPA 4MKZA 1HE4A 1ADBA 2EKQA 2HK7A 2IODA 1YRLA 2P4QA 1U7TA 4DLAA 3LF1A 1DIGA 4FFLA 1XEAA 2R6JA 2PD4A 3S8MA 1KC1A 1PJBA 4Y98A 1GL3A 3O4RA 3EY4A 3ICCA 3GOHA 4R5MA 1PS0A 2FSVA 3DMTA 3PWSA 4D41A 1RKXA 3RC2A 2W98A 1VLLA 3AUUA 2GGSA 5HBRA 4QX6A 5IZCC 1MGOA 1N9GB 4KOAA 3OJOA 4OH1A 4E0BA 2QRKA 3H7AA 4OO3A 2WD8A 2YUTA 2W2KB 4OOEA 1XLTA 4ID9A 4CQLB 3I9KA 1YOVB 4BKRA 5DF1A 4AJOA 4RJTA 5U4QA 4LMPA 4CM9D 1BMDA 4PG8A 1VRWA 1XR3A 3DL2A 1ZK3A 4AJHA 1PJCA 2Q2WA 3AU9A 5DCYA 1HTBA 2DBRA 4IBOA 4XD2A 1JKFA 1IZ9A 4W7IA 4C7JA 3KSUA 3PJFA 4O1MA 2DM6A 4D3DA 4G2NA 3QVSA 4XYGA 3VPGA 3K9QO 3A28A 2ZCVA 1DRVA 3OEWA 2X9GA 4RPGA 3L77A 3GNTA 3KYCB 3PZBA 1P1RA 1B16A 2O50A 2R00A 2IZ0A 1GR0A 2ZB8A 4KTTE 4BGEA 2WWRA 4J43A 4XYMA 3ANLA 2Z95A 3NTOA 3QP9A 3HNPA 1HDZA 4CMJA 2WJPA 4NK5A 4UEKA 1AE1A 3FTNA 4PZDA 3W4IA 3IJRA 1EBUA 2FY8A 4IJVA 5JCJA 5L4SA 1Y8QB 2AQIA 4J7XA 3DBRB 3DHNA 5THKA 5KVSA 3DBHA 3DAFA 3RU7A 4JX8A 3D5TA 1LDBA 2EGHA 2O23A 4CM4B 4D0RA 2J3KA 1ZSNA 4G5HA 4J4HA 4HWKA 4XR4A 2X8LA 5JPIA 3RAJA 4XIYA 4NBRA 3HN7A 3ZU5A 3E8XA 3TSCA 1JVBA 2WD7B 5CHEA 5IZ4A 1K6IA 3QVOA 3ZZNA 1PGQA 3TFQA 3DBLB 3L9WA 3GUYA 2HSDA 4IJWA 4MJLA 2B69A 1MA0A 4XKJA 2Q99A 4OIMA 3E03A 2VZ8A 1PX0A 4XX0A 3MJTA 3IKVA 4GI2A 1F06A 2HJSA 4R54A 4Z0HO 4Q3BA 4RLSA 2DBQA 5L7YA 4D45A 1A72A 3UW3A 5H83A 5A02A 2B0JA 4Y9DA 3PQEA 3PP8A 2OORA 4W99A 5JCXA 3OSUA 2X5JO 3ZWNA 2X6TA 4D79A 5G4LA 3RFVA 3GPIA 2WYVA 3ZNPA 3DFUA 4YJGA 3U4HA 4EITA 1LDGA 5K9ZA 1I36A 1NQOA 5DP1A 3WMWA 3V2UA 3EVNA 3C1OA 1VJ1A 3OETA 4E5KA 1H2BA 2FZWA 1NR7A 3K6JA 1WDLA 4DRYA 5TT1A 1HZZA 4PLHA 2DVMA 4CV2A 4CM3A 1EK6A 1H9BA 4CMKA 2GUGA 1ENYA 2DBVO 5B4VA 1E5LA 3IQDB 4IIUA 1RM3A 4ZU3A 3WS7A 3EHEA 3N7UA 4FGSA 1E7WA 5A03A 3RCBA 2V7PA 4BMNA 2A9FA 4UEOA 1GZ6A 4RF4A 4R3WA 4FFOA 4B79A 3HDYA 4IMPA 1GQQA 3BZUA 5IDQA 4GMGA 1Q0HA 4IS2A 2OXIA 5KNLA 2PGJA 1DJQA 3HJAA 4OMUA 4TVOA 4RPHA 1AUPA 2PV7A 3CMCO 3E18A 1XSEA 4MPDA 4PVDA 3OH8A 3ONEA 3OJFA 3I5MA 3KSDO 2WSBA 1E7RA 1EVIA 1Z6ZA 2JFGA 5KJFA 1PSDA 4KMSA 1NFRA 3KBOA 4E2XA 3NT4A 4L0QA 4PLGA 1HYGA 3OIGA 1T24A 4YVFA 4AJNA 3GNQA 1IPEA 3QWIA 1J4AA 4ONEA 3WYCA 2V6BA 3WJ7A 1E7MA 4FJ2A 3WGTA 4R9RA 3I1JA 3QVWA 4D43A 1NQ5A 5H81A 4Z3DA 4RPLA 3M1LA 1GQ2A 2X0RA 3BMNB 2CDBA 1XQ6A 3VH2A 5HA5A 3I9LA 4NZ9A 1ISHA 3H5NA 5KJ1A 2FRDA 3GVHA 5M6DA 3RUDA 1SMKA 1YE3A 2DLDA 5GZ3A 4AICA 1NM5A 4XQ9A 5I7VA 2C20A 4C7KA 4ZICA 1BVUA 3WSVA 1D7OA 1GYRA 3GVPA 3PFFA 4XDZA 4F46A 5JAIA 2PGLA 2GN4A 2AG5A 2HLPA 3GEGA 3WBBA 4BIIA 3U0BA 1ZMOA 1TT5B 1N5DA 3JQDA 3GGGA 1OAAA 4GQAA 4TRJA 3OIDA 1ZSYA 4I9NA 1VPDA 1DIBA 5IAAA 3CZRA 2Z5LA 1YH3A 2PD3A 1I32A 2PGDA 2NM0A 3FWZA 3PHHA 1HZJA 1YVEI 1LI4A 3EW7A 3EVTA 3DB2A 4TKLA 4FB5A 3HDJA 1HDYA 4E4YA 2PK3A 1ZH8A 1A9YA 1NAHA 3ZU2A 2I66A 1Z74A 4GSKA 4NR0A 5IFLA 1ZFNA 1VI2A 2CVOA 1Y7TA 1PZEA 3PVZA 3NV9A 3AM5A 1T4DA 2NNLD 2X0JA 5FFFA 5JE8A 3DO5A 2QG4A 3W4KA 1T2AA 2WE7A 4BV8A 1VL6A 4O63O 3QVTA 3ASUA 4GLLA 5ICSA 5A3JA 3LC7O 1X7HA 4I1IA 4ESOA 4HKTA 3IUSA 4WE3A 2AW5A 2GZ1A 2PY6A 4GWGA 1P3DA 1UP7A 1UDCA 1KVUA 2OP0A 4IZIA
chains in the Genus database with same CATH superfamily
3U7QB 3PUWA 5FBZA 1URPA 3M6XA 5LOVB 5FPQA 1Z75A 4RV9A 3WDMA 2BBOA 1G18A 2PH5A 1JHYA 2BJVA 3K20A 5F64A 3U80A 1HQCA 4B6RA 2XUFA 1I51A 4RA6A 1JAHA 2ZWOA 4G81A 4RS4A 3KQYA 2JI7A 2PH3A 4BMDA 2PKYX 3ASYA 1O58A 4KREA 1YU6A 4ARZB 3Q7EA 4IRMA 5B2EA 4TMKA 2NU7B 4XLZA 1I4OA 1XAIA 1Z62A 3BPSA 1WXEA 2JCVA 2GNAA 4C7BA 3P9PA 4OHCA 4IDOA 3BWYA 3OKFA 2QG9A 1GITA 2Y71A 4LX0A 2IV3A 4ARBA 1QQTA 3HZZA 4H4DA 4QQRA 3VQTA 2JRCA 3ZE1B 2DXIA 3Q7RA 5ALNA 5A71A 3M6IA 4GM4A 1QX4A 2PWAA 3TTYA 4TYYA 5JSKA 4MWBA 3MGKA 5H82A 4KPYA 1F60A 3TW4A 1NU6A 2QNIA 1G7RA 1W29A 2MDTA 2PLWA 4PO8A 1MNQA 2Y1FA 2FSVC 3DMTC 3PITA 4PHTA 5TPWA 4NYJQ 4RDHA 3KC2A 5JXIA 4E08A 5IF9A 4U1RA 3QPWA 1T9CA 3AINA 5JEDA 2RGCA 5AHKA 2CCJA 1KFKB 2XVYA 3F2VA 4WJZA 5HNKA 1TD1A 2VPIA 2A0WA 3FOAA 4D96A 1NVXQ 2M32A 3KLBA 3STHA 2AX4A 4O2LA 4LW8A 2BP7A 4TZTA 3TBKA 4WASA 1ETUA 4GLOA 4R9SA 1MABB 3ROXA 1J8FA 2HRZA 5BQXA 1TNDA 4LN1A 2IYSA 2OBYA 4MYTA 3IP1A 2ILVA 1U5BB 2NSDA 2AG0A 3QXGA 4WECA 3RM3A 3WFZA 4D9FA 1N6LA 2VLIA 1MB2A 5AW5A 1WM1A 3L1KA 5LP1A 1R4NB 1R37A 1BZYA 3NKVA 3WRYC 4WZZA 5C34B 1GCUA 1XD2B 4FFVA 2F3QA 4JQCA 1W88B 4KIUA 3LPAA 2XXAB 3ZBQA 4CI9A 1BCSB 3CX6A 3K8YA 2HU2A 1AS2A 1RQ7A 2B4TO 4XJXA 1IXRC 2ZBEA 4F6RB 1WAMA 2D0DA 2FWRA 3DE4X 1N57A 2NUTA 2XEDA 4GL2A 3WYEA 2XYHA 2BEWB 1M7HA 1JFTA 3S0JA 2H08A 1HR0B 1I3MA 3SMQA 2HIHA 5FNVB 2XWSA 5B3AA 3OJLA 2FEAA 1YRYE 4W6ZA 2O4CA 2M6KA 3LXUX 1VHLA 2VJMA 3FNFA 3P94A 3MUFA 3DXFA 4O1IA 5AI0A 1ODIA 2IZ5A 2X1MA 3ZLBA 5A1JA 2DQ4A 4P1ZA 5I7UA 2ATEA 3WLJA 1XPOA 1I2ZA 1NX9A 2HA6A 2QPOA 3FCOA 4U8GA 2RGRA 1EB8A 1PL6A 2DSTA 4OPMA 5HDQA 3EEOA 3LQFA 2H5EA 3D8TA 3BXHA 1MIOB 3FDJA 5K0BA 1YO6A 1PJZA 1BWSA 2FWBA 2VAVA 2A0KA 4GXRA 2YCLA 3JQAA 2ZBUA 1YBVA 4LYJA 2DWPA 4FMDF 1FX1A 1Y3DE 3F7NA 3T1HB 1K5GA 4GX2A 4Z53A 2NU9B 5KPDA 2LE0A 4BTEA 2FZ5A 4WT7A 2F62A 1GLNA 4L5AA 5FUYA 2EG5A 4DV3B 3CW9A 3BRQA 1Y4DE 3I53A 1JJBA 3RSCA 3T4EA 4C04A 4IYRA 4RFSA 3ML1A 4HDOB 1ZR4A 4HR7A 5JG7A 1BCRA 5DB4A 1AX9A 1AB5A 5IKXA 2MMCA 2QL7A 4JOQA 3BREA 5LSAA 3TFOA 3WLLA 3ZV4A 3BE5A 1LDMA 3P9QA 1ZXXA 3R20A 1ECLA 2C2YA 2VAMA 4KXXA 1MU0A 1NJGA 1YNOA 1NBEA 2PCJA 4P4UA 4MS3B 5JO0A 1JLKA 5FLXA 1GTG1 4QOIA 1VPWA 1CB7A 2A86A 3EODA 4Q9LA 3LRXA 3V1MA 5FHQA 4EKEA 1AQLA 4RHUA 1WHSA 5J5VA 1DG3A 2D2VA 4U7HA 5IJ0A 1UBGA 1O8CA 4KFUA 4GI1A 4Q3NA 2IIBA 4RZSA 3C5VA 4GYJA 2A9OA 1NQXA 1SBIA 3FPAA 4WLNA 4DT1B 1JQLB 3WYAA 2CLSA 2HBQA 1YK1A 1J22A 2ZIFA 5BNFA 4IF4A 5C3UA 4NY1A 1P6UA 2NXEA 2JJYA 4CR6A 1ZRHA 1UFVA 5DN9A 2OCBA 4M38A 5BN5A 5JTTA 2IP1A 3QYAA 3JS5A 7REQA 3NCHA 3Q40A 1S2DA 4Z86A 4HFMA 4YJFA 2A0FA 1E59A 2PSHA 4FYIA 5TF0A 1PNRA 1SBNE 4EJFA 1SUEA 1ABBA 3EGDA 1RBQA 2XODA 5JJKA 5JECA 1CQZA 3OBBA 3Q3IA 5H0IA 1O94D 4HDSA 2RC6A 2VH1A 3H9UA 5D7NA 4BP8A 5IMSA 1RC8A 1FB5A 1Q0UA 1Q57A 2A35A 4QXAA 3FMGA 2H65A 5LQMA 2I2XB 1IN4A 1IXSB 2CXOA 3EH1A 4P4SA 4CQMB 4DUGA 5FBVB 5K09A 3LWDA 1WQ1R 2C58A 5D3KA 1KY4A 1Y5LA 3CTMA 3KKZA 3T7IA 3AI7A 5E3HA 4F3CA 1G42A 3FOBA 3A1DA 4BKPA 1YQEA 4ENWA 2DCMA 3M4JA 5C1DA 3BORA 4RZHA 5L51A 4C5AA 3TDNA 4YCLA 2YC4C 4D8WA 2QUKA 4OHMA 1QRAA 4XLLA 4ZCIA 5AUNB 2CHGA 2LXNA 1CHNA 2OCYC 4LRXA 4JA2A 3WL5A 3O1LA 1A5BB 3I92A 2CEKA 4LYDA 4QDOA 1OAKA 1PKXA 3O75A 3DZIA 5L3RA 4UVDA 2FSHA 4UFPA 4QU5A 4RENA 1B14A 2WB2A 1YF3A 3GZJA 5K4AA 1NQUA 4TMYA 4XSVA 3AJAA 1FDSA 2DWCA 3H2YA 3ZWCA 4HN9A 1KGDA 2IUEA 4E30A 4IXMA 2VKQA 5AJWA 3MTEA 1TEZA 1YFZA 1C29B 4HNAA 3WC4A 2IP4A 3TE6A 4YUAA 1II0A 1H5QA 2F48A 3NM4A 1E6MA 1MO6A 1OA0A 2PLRA 1W6UA 2ZT6A 2C8KA 3FWHA 2R7NA 3NH6A 3L0PA 5T5QA 3LAWA 4RQUA 4U9HS 4DCGA 2CSXA 1PNOA 3CUSA 5BN4A 1KHHA 4UM7A 2PKQP 2WG0A 1BJKA 3GDWA 4QOHA 5FDFA 3RUIA 3TL6A 2HEIA 3C8UA 3KWLA 3Q72A 1FYDA 2V65A 5KS2A 4AKEA 1AGXA 3HVHA 2PX0A 3G68A 1T25A 1JDNA 3DXYA 1ESMA 5B37A 2IXTA 4Q4HB 3M2TA 2FMUA 1QHEA 3PC3A 5IVDA 1EFPA 5C51B 1UBMS 2OMKA 4KWHA 2PUJA 3F2IA 2RG1A 1SKAA 4ERNA 2XF2A 1ZH2A 3J81k 3WTCA 1U4NA 3UPTA 1CZOA 4MPTA 4S35A 4EYEA 4XVUA 4WK6A 2P7IA 2YJNA 4AZ0B 3ZJ4A 4UQLA 3DZGA 1LLDA 4ZAZA 2OYSA 2QM3A 4TRMA 5T6MA 2PMEA 1JHRA 4C43A 2H06A 3D1LA 3HJGA 1XU4A 4TN5A 2WWTA 5AVSA 1E1RD 4MVJF 4C2BA 1OWMA 5JZBA 2HI0A 2E21A 2HQOA 4IDHA 4JUCA 4KXWA 3W9YA 4E33A 4MUYA 1EXWA 1U3UA 1C4KA 1NNSA 2AEMA 2ALJA 3W0LB 4ETNA 1YAJA 4FU0A 4JLDA 1FC0A 1CUZA 1QNLA 1X86B 1ZOPA 3SLRA 3ADCA 3DC7A 1U4OA 4DA8A 2O0KA 1JIVA 2WHPB 2YVKA 5CFQA 2G0TA 3FJ1A 3PTLA 5AVUA 3C6XA 4C76A 1AUVA 3EOZA 3U4IA 3W2FA 1TEVA 4I36A 3KTFA 4CXMA 4N6GA 2Y4OA 1FSPA 2OD9A 1COZA 3MEQA 2NZYA 1RMTA 5SZIA 1QTNA 4Y2PA 3TUXA 3H99A 1MTZA 3EASA 4F97A 3OZGA 2ZRQA 3B51X 3E61A 4YUZA 4D26A 3GGCA 1ISMA 3P32A 3UJNA 2E49A 1GPJA 1R6VA 2BN4A 3GJZA 4MMYB 1R0YA 2RJOA 1CJCA 3L8DA 3O8OA 1P0QA 1KJZA 1PV2A 2AXEA 3N3AC 1DWQA 2JLBA 3A9WA 4OQPA 4Q3LA 1DC3A 1YGYA 1T5HX 3D8SA 4K6HA 3DOOA 1ZXBA 1AKYA 3BF8A 2CUTA 3BB4A 4LRYA 4PS0A 1OI4A 3T61A 3WADA 5K0CA 4IUCS 1L7AA 2CJXA 2WSIA 3I83A 5LXTB 2NMVA 4M1WA 4Z0TA 4GOLD 1UR5A 1M1YA 2QTHA 4XX1A 4JR1A 4IUBS 4IWXA 2H1OA 3I62A 3O4GA 5LWHA 1SU7A 2Q3DA 1GA1A 4L15A 4Q19A 4ON9A 4RL6A 3HPRA 4O4HB 2WY2D 3WXBA 1YVUA 2ONYA 4DSTA 3K7EA 1EDZA 3GGOA 1NBIA 1SGWA 2E9SA 3E15A 3F5DA 2ZROA 5AW7A 1QRTA 4DEYA 3THWA 5HGXA 1P6QA 2XCLA 3W4JA 1YONA 1ZH4A 4NG5A 4N82A 3HLYA 4R8RA 4YHBA 1D9ZA 1JYSA 2I6TA 4IFTA 1BE6A 1F8FA 1RWPA 4LV6A 2JAPA 3OEHA 3PUZA 4FQ5A 4R2MA 5AKXA 3STXA 3BIOA 3UTCA 4OQNA 3WMRA 1Z2DA 1OZ0A 3OCZA 4IY1A 2HYDA 4RQTA 4CLXA 2X7XA 1WJGA 3V33A 4BVAA 3HFRA 1T35A 5CEJA 2RHWA 4RWEA 3MBIA 2ICAA 1KI1A 2FK7A 2H9YA 3NAQA 2XUJA 4I8XA 4TTPA 3RROA 2VRNA 2OFWA 5H3CA 2MINB 2QB5A 2IXAA 3HYRA 1D0SA 4HQLA 4J16C 3BULA 1ZHOA 1E1CB 5CXUA 1WABA 4LDZA 1VKRA 5JYEA 2VEOA 2AW3A 2ZTVA 4YB8A 4ZVSA 2R62A 5LQNA 6ABPA 1ISIA 2BGLA 1TYZA 2ZI9A 4C08A 3LLSA 2RKOA 3OUZA 4E11A 5AVJA 1H0KA 4D4JA 2JD0A 3FCAA 1HYEA 2QBYA 3KQVA 4EW1A 3KQNA 1IVYA 4Q3EA 3OIFA 3H3JA 3D4NA 4EKIA 4EG4A 4LG1A 2C9YA 1W2GA 3KWFA 4I9HA 1KQNA 1Z26A 4PZ9A 5HHTA 2Q8NA 1L3IA 3V2GA 4PQGA 5F7JA 1QVWA 4IX9A 3T7EA 1EM8B 2FLKA 3RC9A 1KFJB 3JR7A 5JH7F 4X7PA 2A1TR 1EK2A 1U7DA 2HMAA 2ODNA 2GR9A 1A82A 2BKUA 2H7YA 2GBFA 2QJTA 1X7GA 2IUSA 4JLVA 5DO9A 3VNBA 1FFXA 5JQGA 3RARA 1H6DA 3E58A 4XWWA 2PL1A 3IUNA 3UXEA 1AA9A 1R12A 1VPVA 2EERA 3C7CB 5DYWA 4FCTA 1N7HA 4WLEA 3E8SA 5D6NA 1W85A 4AK1A 1DAPA 621PA 2FFRA 5EWJB 3UJPA 4Z9FA 5JD4A 2WZCA 4WZ6A 4S1WA 4CCYB 2P2CA 3WOVA 4EJMA 2X23A 1XZNA 3N0XA 1TJYA 3OOEA 1KSGA 3KYJB 3PE3A 4CMBA 1RU3A 4EW2A 1ADCA 2GYUA 4CR7A 3U60B 1Q2XA 2H4FA 4G0MA 3L01A 4PLZA 4AJPA 4TTSA 1UBFA 2FUG6 2ZZNA 1T6YA 2BH2A 3ETEA 1P2GA 4D3FA 3ZEIA 2JBAA 2J9FA 5KIAA 1QGYA 2HH9A 1JMVA 5K8LA 5GZ1A 4W1PA 2W2QA 1H2AS 4YRIA 5ADHA 3O93A 3E70C 2Y6UA 3UMJA 421PA 1VSQA 2Q2OA 3QUBA 5FA8A 1ZVMA 3EVZA 1HNNA 1BHJA 5T57A 3ROMA 5KQLA 2YHIB 5HMLA 4ZEOA 4C6TB 3LUDA 2LDBA 2EP7A 2OCAA 5B58T 4NCKA 2QUIA 4EUHA 1IG3A 1LNZA 2BVNA 1ORWA 2C1EA 2D3TA 2HXGA 2R6R1 2DJ5A 2GBGA 2H48A 1XRPA 2PQ2A 3PDHA 3MD9A 5H9VA 4RNCA 3T5AA 1UP4A 4UDOA 3KKLA 1KOLA 2G9ZA 5B6IA 1A9ZA 2WM3A 3C6QA 1CF4A 1VFNA 4QECA 1FRVA 1WF6A 1Z2NX 2Q5HA 2QRHA 3WQHA 1QNFA 3D8HA 5U4XA 5IS2A 2PMCA 1OGYA 3ONWA 3QMPA 4JJAA 4DYHA 1M2VB 4EVRA 3F73A 1QU3A 4MVJA 4OB8A 1M5RA 1ATIA 3W8RA 4QOFA 1T8WA 2GBLA 2XQJA 2WVJA 3OA2A 4DOMA 2J67A 3TG8A 4LJ4A 1GQFA 1HT0A 1IEXA 4DLRA 1KI4A 4BV9A 2IDKA 3M5DA 1YHYA 4I3GA 2VYVA 3O0DA 4QUBA 4GKKB 1G2QA 4N3NA 1L5SA 3UK7A 3KNZA 4ZHQA 4HT3B 3DEZA 3KALA 2P62A 3S4YA 4EF5A 4P4GA 4BFXA 1UK6A 1V41E 1ZBQA 3BFVA 1VI5A 4PZPA 3LWZA 3AJDA 3V55A 4CUZA 4FSXA 5DH9A 3FHJA 2RHCA 1NR5A 1U02A 2RG7A 1XP8A 1J8QA 2WSSD 4BVBA 4RTNA 1Z35A 2R47A 4LV8B 3TXYA 3RYIA 4LISA 4BJ3A 2IHKA 3FCXA 5E2BA 5JAQA 2FZCA 4OI2A 1WSDA 1U9IC 3H5AA 5KTSA 2ADMA 2C2XA 2P2GA 2D2EA 2DPXA 2VAXA 3SFTA 3A1FA 4Z3OA 5JWHA 1FXUA 2NAPA 1H9AA 3AB3A 4K5QA 3IURA 4LBYA 1BJTA 2HA0A 3LMKA 4QHTA 4IW3B 3TKYA 5CG1A 5C8YB 5FWNA 2IQ5A 5JRDS 1QJ4A 3DW3X 4MR9A 4BZXA 3N6VA 3U4AA 1JG3A 3R3HA 5B4UA 1ZY2A 5B7PA 3IDOA 2GZHA 2C3PA 5KSOA 3B8HA 2IELA 2ZJ7A 1ZJ6A 1GUDA 4KSBA 4MW6A 3C3AA 4D7AA 3OF5A 2BEVA 1N0IA 1Y9AA 3OX4A 4ZRDA 5J5AA 3UWSA 5LQCA 4V0RA 3GPDG 1TAHA 4O4IB 5ENZA 5ALWA 3AJRA 2B8WA 3X44A 3JVVA 3GG9A 4J3FA 3EGOA 4FMPA 4LQDA 5GVSA 4PX3A 4QRDA 3RO7A 3BMOA 4DMGA 2NT3A 4TLCA 2IH5A 2AS0A 2M6LA 4E1VA 1I33A 2NLOA 5K0JA 2FPGB 1IZ0A 1SUIA 1FU7A 1K92A 1YDFA 1Z9BA 1PJLA 2ONCA 2QIOA 3F3KA 3N8GA 4MUGA 4OHBA 1KYQA 4EQ6A 2QRVA 1XWIA 3MQFA 5TMDA 2XNKA 4G1UC 1GVNB 1ZL2A 2B20A 3GCWA 4C0JA 1UZAA 3NVKI 3EAGA 3RRNA 4FYWA 1HBJA 1IHPA 1Y33E 1FMLA 2SCUA 3GAZA 2OCXA 2QTFA 2NU6B 4J8PA 4MUFA 1R3UA 2ZYGA 2CF5A 1VGVA 1XA0A 3MRVA 4OQYA 1JXAA 1KRXA 3HKEB 3RNOA 1UODA 4GPZA 3T4UA 3JY6A 2R65A 4IINA 4JK3A 4PYOA 1QG2A 1QZ3A 1B15A 4MZXA 4ZWNA 3TNLA 3UAXA 2ADFA 3BB1A 2HHCA 3F6RA 3A1SA 3D6FA 3S99A 3Q8MA 3QJ5A 4Q4JB 4BJHB 3HA5A 3EHDA 4DW8A 2FUCA 3CRQA 3E84A 2QX9A 3ET4A 3Q10A 2Q1WA 3UWDA 3UXYA 5C31A 4EENA 4LWQA 2QYTA 3IS3A 5EHNA 1MC8A 1DV2A 5JH7A 1JHUA 1J09A 1ZVVA 2OHXA 4UD6A 3SHOA 1ZD8A 3L1IA 1E2BA 1FMJA 4Y2SA 1AKUA 4WOKA 4BV3A 4W1RA 1ZEJA 4HEA6 1FFSA 1IY1A 1JDPA 1DADA 1Y89A 4G0NA 3IQEA 1JG6A 3VMMA 4MLZA 4AL4A 1CE8A 4OQ4A 3ENWA 3FIJA 4KK4A 1CC1S 4JJFA 2Z6AA 3LLVA 5CDHA 5TSDA 1WBJB 3OM8A 1FFDA 3WYFA 4AURA 1G0NA 3OWXA 1FF9A 1Y8CA 2PT5A 3GJ5A 4I1UA 5JLJA 4YGXB 4ARVA 3WVNA 1HPLA 3TX2A 1R66A 2VTDA 1JDUA 4UU7A 3UWMA 3EJWA 4C1BA 5J2UF 5J2TB 4LGVA 3CH5A 4H6VA 2GNPA 3HJBA 3NHWA 2KLHA 5HF8A 2A59A 3VA7A 1I3KA 2BE9A 2FX2A 1RE0A 3BMQB 3OZAA 4RIFA 4XX0A 3NALA 1PTJC 1Y5RA 2OLJA 1K66A 4W5RA 3IE0A 1F4VA 4ITUA 2HSGA 2EFDB 3E1SA 4G1BA 3TZEA 1FOEB 1OIVA 4YRRA 1YCGA 1OLXB 1LSSA 1X39A 3QVUA 3NDPA 4RPKA 1FS5A 1XQYA 3KETA 1EFCA 4YPFA 3OAAA 2R2GA 3EF1A 2LVBA 1Q1QA 3ODPA 1RZUA 4ZTBA 4D9IA 3G0HA 2A1UA 1Q1GA 3DEHA 1UZLA 3K32A 3OZ7A 3S1AA 4F4DA 5KOIA 4U7JA 2FWAA 3GGJA 5K0FA 4NZNA 5FPTA 4C4PA 2NAFA 2OA0A 2F9MA 4WBNA 1DC5A 3MS4A 1DCKA 2ZK7A 3LUKA 2CXTA 3O6VA 4HGNA 1S5PA 4ND5A 2FW6A 4TSKA 5DISB 4B7CA 1P4RA 1ZM9A 3NEAA 1PK7A 1M2EA 2FJPA 2GS9A 1K8ZB 1PQWA 2DJIA 2Z2KA 1XJQA 3CLRC 5IVIA 1K5HA 1R16A 3V1YA 2QVGA 1Z0UA 1J39A 2I1QA 3ZTTA 1MLDA 4GUDA 2YYYA 3D6HA 1VBNA 3KXPA 1N5IA 4UBMA 4OJYA 1Z5GA 2VHWA 4W5WA 4RD0A 2C4WA 2HUPA 4QJ5A 3VOAA 1C9KA 5FQNA 3GJSA 2ZIVB 1WZNA 3D4BA 1Z73A 10MHA 4MCHA 4US0R 1LSOA 3OLYA 4ZOAA 2P9TA 2OKCA 2IZ1A 4R7ZA 2DLNA 4ZQIA 3MGGA 2O0HA 4BVKA 3RYHB 1Y42X 4KL8S 5FNZA 4YAUA 5IYZF 4KQIA 3K1YA 4UKDA 1C3EA 4UOZA 4LAFA 1IJBA 1R27A 3D3QA 1A4XA 3WAJA 1Q3TA 1J5EB 1XU7A 3ELBA 1RHRA 3TF5A 3PHIA 4RXMA 1QWSA 1ABFA 1C30B 2CXXA 3E5MA 3O8DA 4XYEA 1G5HA 1RAEA 4BO2A 5TGTA 3M70A 3WLQA 5CYPA 2JGEA 1NX6A 1UBTS 2V7GA 3K2IA 4N3AA 3A0RB 1PIWA 4IDEA 1CZRA 1YZTA 1DJMA 2CZQA 1WTCA 3KE9A 4G85A 1GZUA 2PH7A 3DXXA 4X3OA 2F8MA 3RJZA 3UJ3X 3GPLA 4NMLA 1B76A 3KZ1E 3RYCB 2UUCB 3DDZX 2V1XA 3C3BA 3WO0A 5JAUA 4LJ6A 2ZB4A 4LYYA 5JNLA 1UKZA 4LRTB 3EBPA 3C3XA 2C0QA 4AXBA 5TV2A 4DN6A 3PGMA 3GCDA 4IQ4A 4R1PA 3VZSA 1GQRA 1EVJA 4WCFA 4P7GA 1R6AA 1W5BA 3D0KA 3K70D 4A9AA 4MQ5A 4N48A 4LC9A 3ZWQA 1L7MA 4GMHA 3ROEA 1U2QA 4EY5A 1PZHA 1I5RA 3OC0A 4B3FX 5A2GA 2JPDA 2WYOA 4N6NA 3V4ZA 4BQFA 1UM9A 3ABSB 2FR8C 3IH5A 4IFBA 3NR2A 1PLJA 3IJ5A 4BS9A 1QZZA 5ILOA 1FS4A 3QE9Y 2QP4A 4KN9S 1ZUD1 1OH6A 4BFVA 3H2KA 2EZUA 4X3CA 4EJSB 4UHCA 4NPHA 1TVEA 2I87A 3NHYA 4EUFA 4D3XA 3DZDA 2PKCA 4REQB 1KP3A 1D09A 3STWA 2AT1A 2DKOA 1LC0A 3R6LA 3KOZA 2CHFA 1SXJA 1RRMA 4IHAA 2YDYA 1WW2A 3D31A 1F2DA 1SXIA 1XEXA 1VCOA 2DPLA 2W00A 1D2HA 4MKXA 3OT1B 2BTEA 4O0MA 2LWIA 3QNWA 4DLVA 4CV1A 2P4EA 2C8VA 3IV9A 1AMNA 1A8QA 4QREA 1M0SA 1BKSB 1ORTA 3MB8A 1QRRA 3R0JA 5BSRA 3EFOA 2UDPA 3RC3A 5LQUA 2G4VA 1SUFA 1O77A 3KT8A 3ULKA 1GU7A 1P4HA 1I4EB 1PJTA 4FSHA 4IL5A 3U5TA 2RB4A 2I22A 2OE2A 3NTLA 4B6FA 1CDEA 4LJLA 3LRTA 3NUQA 1YZUA 1QRDA 5A5EA 1RPAA 1IXZA 2WB4A 1OWOA 1TCUA 2ISSD 2Q1YA 3H5WA 4XQ0A 4YRKA 3JZFA 2BMAA 2YZ2A 3JASB 1TA0A 4OL9A 4EA8A 3GY0A 3PPIA 3QKRA 3ZBPA 1Z88A 5JU6A 5KTMA 4XD7A 2WTNA 4B17A 2B4RO 2QG6A 4RD3A 5JJCA 4LDNA 5HKKA 5LIPA 2UUBB 1TYBE 1SBYA 3QKSA 3ORHA 3TTVA 2VSOA 3O7WA 1OXXK 3BQ9A 4OGGA 4QFBA 3WMXA 3D0RA 2ZIXA 3NBQA 5H16A 2R6FA 1X8KA 4YP7A 2H8KA 4E22A 1CRWG 1GPH1 3B78A 3GRKA 4PPNA 4GGPA 3FPFA 5J2UA 2G40A 4HBZA 2J0UB 3I28A 4RA6B 1E0KA 1H0HA 3A4VA 3R3JA 2G06A 3PWKA 2QD4A 3PHLA 4QUHA 4RLQA 3RWMB 3WLNA 1NVBA 3ER6A 1D1QA 2DU8A 4RAOA 4W5OA 3KXLA 3OQIA 3GLIA 5FOSA 4J0EA 3CE6A 1Q7GA 2HT6A 4AY3A 5EMHA 1U7OA 1VIDA 1N2XA 1V8FA 2PAFA 2SKDA 3B6JA 3AY0A 3IFSA 1DJOA 1R5NA 4IDBA 4C0XA 1IMOA 1IPFA 2PVCA 3KB1A 3M5PA 4OM7A 4OP3A 1NRIA 3ELDA 4OHOA 4YRPA 4HH0A 1UXJA 1Y37A 3ZV5A 3QFFA 3CNLA 3TEJA 2HNKA 2JIOA 2Q8PA 3L4BC 5JFGA 3K94A 1WW3A 3UH1A 3RQIA 2AKYA 3EG9B 4JOSA 5ERYA 4EZEA 1UMDA 3O2QB 4MQ4A 1ITZA 3TD6A 1C2YA 1UZUA 3TQIA 3ILYA 4BLVA 4ZYYA 1M6YA 2GZDA 1T6NA 2O3QA 2F64A 2D1FA 3GNSA 4KE9A 5AFSA 1Y8RA 4PTLA 1MHMB 4MCIA 4P3NA 4U7GA 1DQSA 4AYTA 3ZXUB 3F6SA 5DK4A 4B8WA 1DQZA 1I9CA 3FVRA 3CCBA 3I52A 3PNVA 1BVYF 2PZMA 3CA8A 2RHBA 3PXCX 4FLEA 1H22A 4G63A 5D3ZA 4KE6A 4D9NA 3LF2A 2DG2A 1QYIA 2O7NA 3KHUA 4KMOA 1VECA 1GRRA 2ODBA 3PEEA 2H1WA 4F4FA 1Q15A 2ZVDA 521PA 4D9MA 1UPAA 4QRIA 2AC7A 2IKQA 4JGGA 4GZ3A 3TB4A 5IWAB 1CIVA 4V38A 4WERA 4Q7JB 1MXHA 2GF9A 5DNCA 2PO7A 4CLDA 2FPXA 1GR1A 1NW4A 2HX1A 2J48A 2YJZA 3BH6A 3C74A 4CKEA 1RQLA 3FPGA 4Y6SA 2EP8A 3ZVMA 4AJ9A 4HNQA 2HQRA 2YJ6A 1G1MA 1KOFA 2CF6A 2H85A 3PDUA 2QRUA 2VSNA 4K9DA 4TSRA 3T5MA 1NXTA 1HXHA 3UATA 4E2WA 4MVJD 3C8ZA 3NH9A 2VSXA 4NCIA 1DKRA 1Y9DA 3N8KA 2LCFA 4P7FA 2P69A 2PZAA 2PZEA 4C1NA 1Z2PX 3T3HA 8ADHA 5K6AC 4FYPA 5CM9C 4Q01A 2VUUA 3IT0A 1TM5E 2W22A 1HG1A 2DR2A 4YRLA 1F8GA 1KBZA 1LWNA 5U1PA 4OMFG 2DFNA 2ILTA 2VJMB 2D1TA 1INLA 3IMGA 4O29A 4OKNA 1R88A 1C7ZA 1Z6PA 2K6GA 1XTSA 3GH3A 1YZLA 4QM7A 3OMWA 4BVEA 1E96A 1KK2A 3HFJA 5KWIA 1KJYA 4BWGA 1T15A 5EKSA 3VC1A 1PP4A 4P33A 2Q3MA 5BSGA 4A5SA 5K3OA 3PV0A 3TX6A 3ZDRA 5JDIC 2E2WA 3V4OA 1R9NA 2G1JA 1OLOA 3RJ9A 3BVPA 1C4OA 3MWYW 4F4IA 1GQOA 2VHTA 3FSGA 3FSEA 1AXGA 2RHTA 5IKPA 4YCBA 3JQBC 2WMNB 3N74A 2ZYWX 5FWXB 4GVPA 1O5OA 2CL5A 1PYOA 5SZHB 1MC4A 2OGTA 2J9YB 3IGFA 2GJ4A 4MW2A 2ZJ8A 1SCJA 5ESXA 4WBSA 4RM3A 3G9ZA 4DDMA 3EUAA 2VG8A 2JH8A 1NMQA 1M83A 4RFSB 4WK4B 4NYIR 3MG9A 1VPLA 3QF4A 4BASA 1GZ5A 1CFZA 2AOUA 4WSOA 2IS4A 5CX1B 2QRJA 1QVZA 3OU6A 3SAJA 4BPRA 1T26A 2HAEA 4OB7A 5FUQA 1DJPA 3KK0A 5IEJA 2NVUA 3TOCA 3TSAA 3VPSA 1HC7A 3IHTA 5AUOB 2DC1A 1Z4PX 4L85A 2CCKA 2CYAA 2UZ1A 1S8OA 1VHJA 3IP5A 3F3SA 5FB3A 2BIFA 3RK1A 1CQIB 1D5WA 4PLFA 1AIPA 1CJMA 1G8GA 4OYHA 1L5ZA 4PG7A 2JIZA 5IJ0B 1Z68A 4NPAA 5C5EA 3QKWA 4JT2A 4JLWA 1RRKA 4V1CA 5JYFA 2J30A 3KKOA 3NG1A 5K3AA 4II2A 3VBCA 3H0VB 2GYWA 4UUPA 4HWPA 5I9MA 1D8AA 1HG0A 3ND9A 1FTSA 5JNVA 1G8KA 2F1KA 5EJGA 1Z39A 3DDCA 2IX3A 2XVZA 5DTIA 2GD0A 1OFHA 1WULS 3OZTA 2H7CA 2OOKA 2P0YA 3PI7A 4GSLA 3S2SA 4JBHA 3PIDA 4D1YA 1GXSB 3H97A 3LQ2A 4F7DA 4HN2A 7REQB 3PTZA 1GEEA 4ZQCB 2XT0A 5KB3A 2ZQZA 4OBWA 2VN8A 1M7BA 5BT9A 3JWIA 5AI5A 2E5LB 4A2QA 1BN7A 2VP0A 3CRZA 4JODA 4NHEA 3KEGA 3NT5A 3EGDB 2P5YA 4IO0A 1V2HE 2QL5A 5DHSA 3FNRA 4HDSB 1N7GA 1CUBA 1KI7A 3TBFA 5IH7A 1OBFO 1M73E 4KUEA 2FE1A 2EFEB 3NXKA 1KR5A 4RH3A 1B2LA 1PQPA 2JS7A 1LPAB 3DE7X 4KACA 4LNAA 1XFDA 3LS2A 5F5NA 3SQNA 3NU1A 2KI5A 3WHPA 1Y3CE 3VC2A 1I94B 1JV2B 5AK6A 3KD3A 1C7FA 1TEHA 1FTYA 2EOAA 2F00A 3VZCA 3ZHXA 4DB4A 4IIJA 4AO7A 3OQBA 1QE3A 1VKZA 1EXDA 1Y1SA 3R3XA 5IAJA 2O8NA 1NY5A 2ZYVX 4ZT3A 1X6VA 3P0EA 6GPBA 3FHTA 1JTFA 5I8WA 1TCAA 3A3KA 1ISRA 1YS9A 2QTMA 2ERCA 5TVOB 2VDQB 1E3WA 3FNEA 4KPUB 3SR0A 3K0FB 1YRBA 2UXDB 1UKEA 3WHLA 3VDNB 1Q12A 4QAQA 3TLEA 4J2TA 2H1HA 1TPZA 3PL5A 5SYNA 3WQQA 3U17A 4YMLA 3TLBA 1SZDA 1YQ9A 3AB7A 1GGKA 4CTMA 2WTEA 3QNUA 1A9TA 1NKTA 4UXJA 3GJ6A 1RBZA 4PSCA 4TKUA 4CDNA 5KSWB 2ZS7A 1NW3A 3ABRB 2IU4A 4UU8A 3QXXA 4X5OA 2ODWA 4PYIA 4NOJA 2RIRA 2D8MA 2VTVA 4DIBA 2H3HA 3PWTA 4Y2QA 1OFTA 4ZXFA 5LR6A 1N33B 1HRDA 5CAEA 1P9LA 1RBYA 2FPSA 3QELB 3DYIA 2WJZB 5HOQA 4I5DA 4BP3A 4F85A 3AH8A 3TUZC 1U63A 2ZRPA 5CW1A 3N28A 2NXNA 3NW9A 2JLZA 1HRKA 3SYTA 3WWCA 4ZZ0A 2QL9A 3IMEA 1WMDA 2JHCA 4NV3A 3ZWXA 2AJDA 1AKNA 5TB5A 3TG2A 1NLZA 3EIFA 2DPHA 2HQSA 2AKAB 4AJEA 5LDHA 2XYQA 4JDUA 5BN3A 4M1EA 3PYMA 2AK2A 4KV9A 4A16A 3U6KA 3O8RA 1II8A 3HJUA 3FOZA 4OLFA 2WWXA 3JZDA 4JIMA 1RXCA 1MB0A 1L5OA 1M0WA 2TSYB 3NTQA 3AVUA 3HUTA 3B2EA 1BGVA 4AK9A 1YB4A 1I1NA 3K92A 3IUMA 4G0VA 4ZOEA 1C9MA 2C96A 2XOEA 4RVNA 3T0IA 2XH8A 1I5OA 3VC3A 3VPAA 1SKMA 3LCJA 4IJUA 2CNDA 3IBGA 3RS9A 2PUBA 1N8SA 3AF6A 1Z82A 1EP3B 3D3JA 2AFHE 2WWGA 5L6MB 4UTNA 4JBIA 1L4NA 3HGQA 2AMFA 3KQLA 4DV0B 2B25A 3F90A 3HEAA 1EFLA 2VJAA 2OCKA 3AKDA 3GIDA 4ZAWA 3TCNA 4DREA 3MAGA 2PUDA 3ODGA 3CGGA 2J9RA 2HCTA 4MRAA 3CSSA 1DI0A 4DJDC 1Z0ZA 3AUKA 2JFBA 3E9RA 1MD9A 4UAGA 3G0DA 1NJ6A 1CVRA 3I5AA 3ZCUA 3ON5A 1ZVJA 4MV4A 3W7VA 2G25A 4NWIA 2HA2A 2BFMA 2HDOA 1YZYA 2GOYA 4ZAVA 5F3RA 1SVMA 4EA6A 3GO4A 4EUSA 3K70B 2OHIA 4FMDB 2PSJA 5M04A 1SPXA 2IH2A 1QG0A 2QZZA 3EYAA 4G9GA 3N59A 1QXSA 3PF8A 1ECPA 1VIMA 3PC8C 1CS4C 3UK1A 2HJRA 3FJOA 3E48A 5CA0A 5I4KA 1TYDE 1W36D 5DM4A 2W4IA 2EW2A 1KPIA 1M2GA 3RVPA 1YTUA 1JR6A 4HVLA 1VXOA 1IDOA 2WA1A 4HEQA 4N18A 4IDFA 2YYSA 3K96A 4NQRA 5C8ZA 3AKZA 3BWVA 1F9AA 1M1YB 4MWGA 4DMKA 5ABPA 5IXYA 3BQNB 3IEVA 4AQYB 3NBKA 4RDCA 2IHYA 1UWVA 5EPUA 2GPWA 1B0UA 3NRJA 5F2EA 1B6SA 2LCIA 4AJIA 5KQSA 2PUAA 2B34A 4GPTA 2NP7A 3VMFA 1CDZA 4ABTA 1II9A 1Q1EA 2FQXA 5FI3A 4B4UA 2VI5A 2VPYA 3BFJA 3M33A 4QNMA 2FW9A 1YU9A 3FYHA 1PL8A 4ZXPA 4H4EA 3QMMA 2B1IA 4KYTA 2QD2A 5D00A 3DDWA 5JS8A 5DIFA 5IARA 1BE8A 3P9SA 4CRWB 3BK7A 4MJ7A 1QTIA 3C0KA 3W5SA 3HKCB 1KAMA 2B8JA 3ETNA 4KH1A 4X8MA 5BUZA 2IPOA 4KHZA 5EJ4A 2FW8A 3E9ZA 2V45A 4Y0AA 1RQPA 1HQYE 4RD1A 4ZOLA 3D6NB 3ABOB 3BDVA 3ENZA 3GT0A 3PFBA 3SC4A 1SD5A 4PLVA 1YQXA 1O2DA 4W5JA 2VK2A 2HMUA 4B3HA 3TZLA 5LIRA 1FW6A 2NPIA 4B4WA 4MWSA 1U80A 5ICGA 4UASA 1K9VF 2XW6A 3CLHA 4UXIA 2XSZD 1RM5A 3RASA 4CV3A 3FTPA 4DQKA 1NUUA 5JS2A 1KOGA 1Z0IA 2WJYA 2EWWA 4N8DA 4MRSA 2F59A 5COBA 4ED9A 4F1JA 2Q4OA 4X95A 1UANA 4UOEA 1V11A 4S24A 5HIMA 1W5EA 4TLAA 1JFRA 4ENVA 1M66A 4RF3A 3VH3A 5JXHA 2H1LA 3DHYA 4XCQA 4BEWA 1C5KA 1V3VA 3L06A 4ND2A 2O8DA 1NBMA 4NPCA 1SC9A 5I9NA 5DWDA 3BGSA 3D54D 5E4TA 5CITA 2W2OA 4NBNA 4A6EA 1QE0A 4C03A 4UPVA 2IZ6A 3H5TA 3IUEA 4XD7D 1PTKA 5LQDA 1GPDG 1W85B 2FPWA 1DX9A 3OIYA 3RJTA 1V9LA 3B1KA 4LXYA 4R98A 4JDPA 4DCSA 1F2UB 3TRIA 4BMXA 3PYXA 1OZHA 3EP5B 3B3QA 1LK0A 3P9YA 4FNOA 1KJ9A 5DDIP 1PX2A 3M9LA 1Q7RA 1RSZA 1OR8A 3UZUA 1NJ8A 3ZHRA 5M2QA 1YR8A 1ZH0A 3GLSA 3L7KA 1OYVA 3W04A 1XCJA 2Z2JA 4Q9HA 3SIWA 1QZXA 2F3UA 3CR8A 2J9FB 2XE4A 5JJ5A 3OQMA 1H94A 4LXTA 5DOVA 2GDJA 1TM7E 5IBPA 4H3SA 3KR2A 4DWVA 1KRHA 1BO6A 2O2GA 3A3PA 5T8KA 4GL4A 2Z4RA 4CEHB 4QICA 4F2PA 4C7OB 3JVEA 2ZZMA 2QAGA 1CDOA 4QPDA 1T3ZA 2BCGY 2P75A 2Y93A 2CMDA 1WPGA 3R9KA 5HW0A 1IJFA 1X1AA 4OMDA 1DEHA 1U9YA 5FOWA 3GLTA 4AW9A 2FX3A 2WWFA 2XOXA 3ZI7A 2HF7A 3VJRA 4BO9A 4NBTA 2DGDA 5ALJA 4CMIA 1QHHB 1WU8A 5IXSA 2C92A 4MS4A 5JI3E 1Q3HA 4LDRA 3I8SA 1G2OA 2PFGA 4YDRA 1OROA 2WTBA 4QC2A 3TQFA 2BFBA 1AHNA 2IXFA 1DEKA 2RH4A 4TS9A 1H05A 5CK5A 4ER7A 4F72A 2ZUWA 1H8EA 4ZQEA 2O7QA 1QF9A 3NHJA 2BZ1A 1RDFA 2ZW9A 1IQRA 4NVRA 3ZIAA 1VE9A 3P4YA 2XUIA 3E3AA 2CNBA 2CLMB 3UOWA 2WKWA 2ZR0A 1VTKA 3B6EA 5BSUA 1NI3A 2OQ2A 3A4NA 3BSFA 1ND6A 2F3RA 3LBAA 3PKZA 1TO1E 1WXDA 5LCXA 1XTTA 1N0VC 1Z45A 3UXMA 3VKFA 4LFAB 2J46A 4MS1B 2D62A 2ZTMA 5FI5A 5TJ9A 1S9HA 3PA6A 2HK9A 1R0LA 3H6KA 5FIUA 1PBTA 3EXHB 2YZKA 4WKBA 4YP1A